LOCUS       AB089203                 737 bp    mRNA    linear   PLN 02-NOV-2002
DEFINITION  Allium cepa lfs mRNA for lachrymatory factor synthase, complete
            cds.
ACCESSION   AB089203
VERSION     AB089203.1
KEYWORDS    .
SOURCE      Allium cepa (onion)
  ORGANISM  Allium cepa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Asparagales;
            Amaryllidaceae; Allioideae; Allieae; Allium.
REFERENCE   1  (bases 1 to 737)
  AUTHORS   Imai,S., Tsuge,N., Tomotake,M., Nagatome,Y., Sawada,H., Nagata,T.
            and Kumagai,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Shinsuke Imai
            House Foods Corporation, SOMATECH Center; 1-4, Takanodai,
            Yotsukaido, Chiba 284-0033, Japan
REFERENCE   2
  AUTHORS   Imai,S., Tsuge,N., Tomotake,M., Nagatome,Y., Sawada,H., Nagata,T.
            and Kumagai,H.
  TITLE     An onion enzyme that makes the eyes water : A flavoursome,
            user-friendly bulb would give no cause for tears when chopped up
  JOURNAL   Nature 419, 685 (2002)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..737
                     /db_xref="taxon:4679"
                     /mol_type="mRNA"
                     /organism="Allium cepa"
     CDS             53..562
                     /codon_start=1
                     /gene="lfs"
                     /product="lachrymatory factor synthase"
                     /protein_id="BAC21275.1"
                     /transl_table=1
                     /translation="MELNPGAPAVVADSANGARKWSGKVHALLPNTKPEQAWTLLKDF
                     INLHKVMPSLSVCELVEGEANVVGCVRYVKGIMHPIEEEFWAKEKLVALDNKNMSYSY
                     IFTECFTGYEDYTATMQIVEGPEHKGSRFDWSFQCKYIEGMTESAFTEILQHWATEIG
                     QKIEEVCSA"
     regulatory      627..632
                     /regulatory_class="polyA_signal_sequence"
BASE COUNT          229 a          119 c          177 g          212 t
ORIGIN      
        1 acaattcaga ctcacattac gttatatcaa gaagattgtc caatcagaaa aaatggagct
       61 aaatcctggt gcacctgctg tagtcgctga tagtgctaac ggagctcgaa aatggagcgg
      121 caaagtccat gctttgcttc caaatacaaa gccagagcaa gcatggacac tactaaaaga
      181 ctttattaac cttcacaagg tcatgccttc gttgtcagtc tgtgaactgg tagaaggtga
      241 ggccaatgtt gttggttgtg ttcgctacgt taaaggtata atgcacccaa tagaagagga
      301 attttgggcc aaggagaagc tggtggcgct ggataataag aacatgagct acagttatat
      361 ttttactgag tgttttacag ggtacgagga ttacacggct accatgcaaa tagtggaggg
      421 tcctgagcac aagggaagta gatttgactg gtcttttcag tgcaagtata tcgagggtat
      481 gactgaatct gcattcaccg agattctgca gcattgggct actgagatag gtcagaaaat
      541 cgaagaggtt tgcagtgctt gatcttgaat atcggttttc agtgctgtga tgcattatgt
      601 gtcttttaaa ccttgtcttg tgatataata aagtaacgta atatgtgcat gtaataagta
      661 agactgagtg ttgtgtgttc aataaaaaag aatttgcttt ttgcaagttc tagtgctttt
      721 caaaaaaaaa aaaaaaa
//