LOCUS       AB088002                2564 bp    DNA     linear   PLN 09-AUG-2003
DEFINITION  Panax notoginseng chloroplast matK gene for maturase, located
            within the intron of trnK, complete cds.
ACCESSION   AB088002
VERSION     AB088002.1
KEYWORDS    .
SOURCE      chloroplast Panax notoginseng
  ORGANISM  Panax notoginseng
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Apiales; Araliaceae; Panax.
REFERENCE   1  (bases 1 to 2564)
  AUTHORS   Komatsu,K., Zhu,S. and Fushimi,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Katsuko Komatsu
            Institute of Natural Medicine; 2630 Sugitani, Toyama, Toyama
            930-0194, Japan
REFERENCE   2
  AUTHORS   Zhu,S., Fushimi,H., Cai,S. and Komatsu,K.
  TITLE     Phylogenetic relationship in genus Panax: inferred from
            chloroplast trnK gene and nuclear 18S rRNA gene sequences
  JOURNAL   Planta Med. 69, 647-653 (2003)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..2564
                     /country="China: Yunnan, Guangxi"
                     /db_xref="taxon:44586"
                     /mol_type="genomic DNA"
                     /organelle="plastid:chloroplast"
                     /organism="Panax notoginseng"
                     /specimen_voucher="H. Fushimi, 96002; K. Komatsu et al.,
                     Y287-1, Y299-1"
     tRNA            2..38
                     /gene="trnK"
                     /note="5' exon of transfer RNA for Lysine"
                     /product="tRNA-Lys"
     intron          39..2554
                     /gene="trnK"
                     /note="intron of trnK gene"
     CDS             761..2272
                     /codon_start=1
                     /gene="matK"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="It is an open reading frame (ORF) located within
                     the intron of the transfer RNA gene for Lysine  (trnK)"
                     /note="complete matK gene sequence"
                     /product="maturase"
                     /protein_id="BAC81676.1"
                     /transl_table=11
                     /translation="MEEFQRYLELDRSQQHYFLYPLIFQEYIYALAHDHGLNINRSIL
                     LENAGYDNKFSLLIVKRLIARMYQQNHFILSTNDSNQNRFLRRNKNLYSQMISEGFAV
                     IVEIPFYLQLKSSLESKGIVKSHNLRSIHSIFPFLEDKISHLIYGLEILIPYPVHLEI
                     LVQTLRYWVKDASSLHLLRFFLHEYCNWNTPNKAGSSFSKRNQRLFFLLYNSHLCEYE
                     SIFIFLRNQSSHLRSTSSGTLLERIYFYGKIKYLVKVFVKAFQVNLLLLKDPFMHYVR
                     YQGKSILASKGTPFLMKKWTYYFVNLWQCHFYLWSQPGRICINQLYNNSLDILGYLSS
                     ARLNPSMVRGQMLENSFLIDNAINKFDAIVPIIPLIGSLAKAKFCNVLGHPISKAVWT
                     DLSDSDIIDRFGRICRNLSHYHSGSSQKKSLYRIKYILRLSCARTLARKHKSTVRAFL
                     KRLGSGLLEEFFTAEEQVLYLTFPRASSASQRLYRRRIWYLDIICINDLANHE"
     tRNA            2555..>2564
                     /gene="trnK"
                     /note="3' exon of transfer RNA for Lysine"
                     /product="tRNA-Lys"
BASE COUNT          821 a          418 c          457 g          868 t
ORIGIN      
        1 tgggttgcta actcaatggt agagtactcg gcttttaagt gcggctagga tcttttacac
       61 atttggatga agcgaaggat tcgtccatac catcggtaaa gtttggaaga ccacgactga
      121 tcctgaaagg gaatgaatgg aaaaaatagc atgtcgtatc aacgaagagt tctgagaata
      181 tttcattctt tccggatcgg tccaaaccct tgtttgattt tttgaaacgg agcaaaaaaa
      241 tgaattcaat ttcaagttgg gtcgaatgaa taaatggata gagatagagc cttgtggctt
      301 caattaattg attataggga aaaagcaacg agcttctgtt cttaatttga atgattaccc
      361 gatctaatta gacgttaaaa atatattagt gcctgatacg ggaagagctt ctcccatgga
      421 gtggattctt tattttttaa tgaatcctaa ctattatcat tttctattat ggaatggaaa
      481 tgcttgtgta gaagaaacag tatattgata aaaaattcca aaatcaaaag agcgattggg
      541 ttgataaaat aaaggatttc taaccatctt gttatcctat aacgaacata aaccaattca
      601 ttaaaatgga aaggagagga tagagaatcc gttgataagt ttaccactat ccgaggtatc
      661 tattcgtttc ttactataat accttgtttt gactgtatcg cactatgtat catttgataa
      721 ccttctaaac cctctacctt tagttcaact ataatttcaa atggaggaat tccaaagata
      781 tttagagcta gatagatctc aacaacacta cttcttatat ccacttatct ttcaggagta
      841 tatttatgca cttgctcatg atcatggttt aaatataaat agatccattt tgttggaaaa
      901 tgcgggttat gacaataaat tcagtttact aattgtgaaa cgtttaattg ctcgaatgta
      961 tcaacagaat cattttattc tttctactaa tgattctaac caaaatagat ttttgaggcg
     1021 caacaagaat ttgtattctc aaatgatatc agaggggttt gcagtcattg tggaaattcc
     1081 attttatcta caattaaaat cttccctaga aagcaaaggg atagtcaaat ctcataattt
     1141 acgatcaatt cattcaatat ttcctttttt agaggacaaa atttcacatt taatttatgg
     1201 tttagagata ctaataccct acccagtcca tctggaaatc ttggttcaaa ctcttcgcta
     1261 ctgggtaaaa gatgcttctt ctttgcattt attacgattc tttctccacg agtattgtaa
     1321 ttggaatact ccaaataaag ccggttcttc tttttcaaaa agaaaccaaa gactattctt
     1381 cttactatat aattctcatc tatgtgaata cgaatccatc ttcatctttc tccgtaacca
     1441 atcttctcat ttacgctcaa catcttctgg aacccttctt gaacgaatct atttctatgg
     1501 aaaaataaaa tatcttgtaa aagtctttgt taaggctttt caagtcaatc tattgttgtt
     1561 gaaggatcct ttcatgcatt atgttaggta tcaaggaaaa tccattctcg cttcaaaagg
     1621 gacgcccttt ttgatgaaaa aatggacata ttactttgtt aatttatggc aatgtcattt
     1681 ttacctgtgg tctcaaccgg gaaggatctg tataaaccaa ttatacaata attccctcga
     1741 cattctgggc tatctatcaa gtgcgcggct aaacccttca atggtacgcg gtcaaatgct
     1801 agaaaattca tttctaattg ataatgctat taataagttc gatgctattg ttccaattat
     1861 tcctctgatt ggatcattgg ctaaagcgaa attttgtaac gtattggggc atcctattag
     1921 taaggcggtt tggaccgatt tatcagattc tgatattatt gaccgatttg ggcgtatatg
     1981 cagaaatctt tctcattatc atagtggatc ctcacaaaaa aagagtttgt atcgaataaa
     2041 gtatatactt cgactttctt gtgctagaac tttggctcgt aaacacaaaa gtactgtacg
     2101 tgcttttttg aaaagattgg gctcgggatt attggaagaa ttctttacgg cggaagaaca
     2161 agttctttac ttgacctttc caagagcatc ttccgcttcg cagaggttat atagaaggcg
     2221 gatttggtat ttggatatta tttgtatcaa tgatttggcc aatcatgaat gattcgttag
     2281 gaatccgtgt aaattaaatg gaaattatca ctaaataatc taagtaatga agataaataa
     2341 tgaagagata acgaaaaaaa tcctttttta tattctgaaa tgttgatgta ggatgtagta
     2401 agggttaaat caaccgagta ttcaaccttt taaagttcta agtaaggaac tgggttttag
     2461 atgtatatat agggaaagcc gtgtgcaatg aaaaatgcaa gcacggtttg gggaggggtt
     2521 tttacctatt taacaaggaa attatctact ccatccgact agtt
//