LOCUS       AB088000                2566 bp    DNA     linear   PLN 09-AUG-2003
DEFINITION  Panax japonicus chloroplast matK gene for maturase, located within
            the intron of trnK, complete cds, country:Japan.
ACCESSION   AB088000
VERSION     AB088000.1
KEYWORDS    .
SOURCE      chloroplast Panax japonicus
  ORGANISM  Panax japonicus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Apiales; Araliaceae; Panax.
REFERENCE   1  (bases 1 to 2566)
  AUTHORS   Komatsu,K., Zhu,S. and Fushimi,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Katsuko Komatsu
            Institute of Natural Medicine; 2630 Sugitani, Toyama, Toyama
            930-0194, Japan
REFERENCE   2
  AUTHORS   Zhu,S., Fushimi,H., Cai,S. and Komatsu,K.
  TITLE     Phylogenetic relationship in genus Panax: inferred from
            chloroplast trnK gene and nuclear 18S rRNA gene sequences
  JOURNAL   Planta Med. 69, 647-653 (2003)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..2566
                     /country="Japan: Toyama, Tokushima, Hiroshima, Miyazaki"
                     /db_xref="taxon:44685"
                     /mol_type="genomic DNA"
                     /organelle="plastid:chloroplast"
                     /organism="Panax japonicus"
                     /specimen_voucher="K. Komatsu, 96001;  S. Zhu, 20007,
                     20008, 20009, 20004"
     tRNA            2..38
                     /gene="trnK"
                     /note="5' exon of transfer RNA for Lysine"
                     /product="tRNA-Lys"
     intron          39..2556
                     /gene="trnK"
                     /note="intron of trnK gene"
     CDS             762..2273
                     /codon_start=1
                     /gene="matK"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="It is an open reading frame (ORF) located within
                     the intron of the transfer RNA gene for Lysine  (trnK)"
                     /note="complete matK gene sequence"
                     /product="maturase"
                     /protein_id="BAC81674.1"
                     /transl_table=11
                     /translation="MEEFQRYLELDRSQQHYFLYPLIFQEYIYALAHDHGLNINRSIL
                     LENAGYDNKFSLLIVKRLIARMYQQNHLILSTNDSNQNRFLRRNKNLYSQMISEGFAV
                     IVEIPFYLQLKSSLESKGIVKSHNLRSIHSIFPFLEDKISHLIYGLEILIPYPVHLEI
                     LVQTLRYWVKDASSLHLLRFFLHEYCNWNTPNKAGSSFSKRNQRLFFLLYNSHLCEYE
                     SIFIFLRNQSSHLRSTSSGTLLERIYFYGKIKYLVKVFVKAFQVNLLLLKDPFMHYVR
                     YQGKSILASKGTPFLMKKWTYYFVNLWQCHFYLWSQPGRICINQLYNHSLDILGYLSS
                     ARLNPSMVRGQMLENSFLIDNAINKFDAIVPIIPLIGSLAKAKFCNVLGHPISKAVWT
                     DLSDSDIIDQFGRICRNLSHYHSGSSQKKSLYRIKYILRLSCARTLARKHKSTVRAFL
                     KRLGSGLLEEFFTAEEQVLYLTFPRASSASQRLYRRRIWYLDIICINDLANHE"
     tRNA            2557..>2566
                     /gene="trnK"
                     /note="3' exon of transfer RNA for Lysine"
                     /product="tRNA-Lys"
BASE COUNT          822 a          418 c          457 g          869 t
ORIGIN      
        1 tgggttgcta actcaatggt agagtactcg gcttttaagt gcggctagga tcttttacac
       61 atttggatga agcgaaggat tcgtccatac catcggtaaa gtttggaaga ccacgactga
      121 tcctgaaagg gaatgaatgg aaaaaatagc atgtcgtatc aacgaagagt tctgagaata
      181 tttcattctt tccggatcgg tccaaaccct tgtttgattt tttgaaacgg agcaaaaaaa
      241 tgaattcaat ttcaagttgg gtcgaatgaa taaatggata gagatagagc cttgtggctt
      301 caattaattg attataggga aaaaagcaac gagcttctgt tcttaatttg aatgattacc
      361 cgatctaatt agacgttaaa aatatattag tgcctgatac gggaagagct tctcccatgg
      421 agtggattct ttatttttta atgaatccta actattatca ttttctatta tggaatggaa
      481 atgcttgtgt agaagaaaca gtatattgat aaaaaattcc aaaatcaaaa gagcgattgg
      541 gttgataaaa taaaggattt ctaaccatct tgttatccta taacgaacat aaaccaattc
      601 attaaaatgg aaaggagagg atagagaatc cgttgataag tttaccacta tccgaggtat
      661 ctattcgttt cttactataa taccttgttt tgactgtatc gcactatgta tcatttgata
      721 accctctaaa ccctctacct ttagttcaac tataatttca aatggaggaa ttccaaagat
      781 atttagagct agatagatct caacaacact acttcttata tccacttatc tttcaggagt
      841 atatttatgc acttgctcat gatcatggtt taaatataaa tagatccatt ttgttggaaa
      901 atgcgggtta tgacaataaa ttcagtttac taattgtgaa acgtttaatt gctcgaatgt
      961 atcaacagaa tcatttgatt ctttctacta atgattctaa ccaaaataga tttttgaggc
     1021 gcaacaagaa tttgtattct caaatgatat cagaggggtt tgcagtcatt gtggaaattc
     1081 cattttatct acaattaaaa tcttccctag aaagcaaagg gatagtcaaa tctcataatt
     1141 tacgatcaat tcattcaata tttccttttt tagaggacaa aatttcacat ttaatttatg
     1201 gtttagagat actaataccc tacccagtcc atctggaaat cttggttcaa actcttcgct
     1261 actgggtaaa agatgcttct tctttgcatt tattacgatt ctttctccac gagtattgta
     1321 attggaatac tccaaataaa gccggttctt ctttttcaaa aagaaatcaa agactattct
     1381 tcttactata taattctcat ctatgtgaat acgaatccat cttcatcttt ctccgtaacc
     1441 aatcttctca tttacgctca acatcttctg gaacccttct tgaacgaatc tatttctatg
     1501 gaaaaataaa atatcttgta aaagtctttg ttaaggcttt tcaagtcaat ctattgttgt
     1561 tgaaggatcc tttcatgcat tatgttaggt atcaaggaaa atcaattctc gcttcaaaag
     1621 ggacgccctt tttgatgaaa aaatggacat attactttgt taatttatgg caatgtcatt
     1681 tttacctgtg gtctcaaccg ggaaggatct gtataaacca attatacaat cattccctcg
     1741 acattctggg ctatctatca agtgcgcggc taaacccttc aatggtacgc ggtcaaatgc
     1801 tagaaaattc atttctaatt gataatgcta ttaataagtt cgatgctatt gttccaatta
     1861 ttcctctgat tggatcattg gctaaagcga aattttgtaa cgtattgggg catcctatta
     1921 gtaaggcggt ttggaccgat ttatcagatt ctgatattat tgaccaattt gggcgtatat
     1981 gcagaaatct ttctcattat catagtggat cctcacaaaa aaagagtttg tatcgaataa
     2041 agtatatact tcgactttct tgtgctagaa ctttggctcg taaacacaaa agtactgtac
     2101 gtgctttttt gaaaagattg ggctcgggat tattggaaga attctttacg gcggaagaac
     2161 aagttcttta cttgaccttt ccaagagcat cttccgcttc gcagaggtta tatagaaggc
     2221 ggatttggta tttggatatt atttgtatca atgatttggc caatcatgaa tgattcgtta
     2281 ggaatccgtg taaattaaat ggaaattatc actaaataat ctaagtaatg aagataaata
     2341 atgaagagat aacgaaaaaa atcctttttt tttattctga aatgttgatg taggatgtag
     2401 taagggttaa atcaaccgag tattcaacct tttaaagttc taagtaagga actgggtttt
     2461 agatgtatat atagggaaag ccgtgtgcaa tgaaaaatgc aagcacggtt tggggagggg
     2521 tttttaccta tttaacaagg aaattatcta ctccatccga ctagtt
//