LOCUS       AB080593                1656 bp    mRNA    linear   HUM 17-SEP-2005
DEFINITION  Homo sapiens WDR9 mRNA for WD repeat protein, WDR9-exon17-short,
            partial cds.
ACCESSION   AB080593
VERSION     AB080593.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1656)
  AUTHORS   Shimizu,N., Kudoh,J., Shibuya,K. and Obayashi,I.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-FEB-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Nobuyoshi Shimizu
            Keio University, School of Medicine, Molecular Biology; 35
            Shinanomachi, Shinjuku-ku, Tokyo 160-8582, Japan
REFERENCE   2
  AUTHORS   Obayashi,I., Shibuya,K., Minoshima,S., Kudoh,J. and Shimizu,N.
  TITLE     Isolation of WDR9 cDNA on human chromosome 21q22.3
  JOURNAL   Unpublished (2002)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..1656
                     /chromosome="21"
                     /db_xref="H-InvDB:HIT000242068"
                     /db_xref="taxon:9606"
                     /map="21q22.3"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /tissue_type="liver"
     CDS             <1..799
                     /codon_start=2
                     /gene="WDR9"
                     /note="WD repeat domain 9"
                     /note="WDR9-exon17-short"
                     /product="WD repeat protein"
                     /protein_id="BAD74078.1"
                     /translation="VSTGADGTVCFWQWDLESLKFSPRPLKFTEKPRPGVQMLCSSFS
                     VGGMFLATGSTDHVIRMYFLGFEAPEKIAELESHTDKVDSIQFCNNGDRFLSGSRDGT
                     ARIWRFEQLEWRSILLDMATRISGDLSSEEERFMKPKVTMIAWNQNDSIVVTAVNDHV
                     LKVWNSYTGQLLHNLMGHADEVFVLETHPFDSRIMLSAGHDGSIFIWDITKGTKMKHY
                     FNMIEGQGHGAVFDCKFSQDGQHFACTDSHGHLLIFGFGCSKPYEKM"
BASE COUNT          520 a          278 c          408 g          450 t
ORIGIN      
        1 ggtttccact ggtgctgatg ggacagtttg cttttggcaa tgggatttag aatccttaaa
       61 atttagccca cgtcccctga agttcactga aaagcctagg ccaggcgttc aaatgctttg
      121 ttcttctttt agtgttggtg gtatgttttt agccacaggt agtactgatc atgtaatcag
      181 aatgtatttt ttgggttttg aagcacccga aaaaatcgca gaacttgaaa gccacactga
      241 taaagtagat agtatccaat tttgtaacaa tggtgatcgg ttcctaagtg gtagcagaga
      301 tggaacagca cggatttgga gatttgagca gttagaatgg aggagcattt tattggatat
      361 ggctaccaga atctcagggg acttatcttc cgaagaggaa aggtttatga aacctaaagt
      421 aacaatgata gcttggaatc aaaatgatag cattgttgtc acagctgtga atgatcatgt
      481 cctcaaagtg tggaattctt acactggaca actgcttcat aacttaatgg gacatgctga
      541 tgaagtattt gttctggaga cacatccctt tgattccaga attatgttat ctgcaggaca
      601 tgatggcagc atatttatat gggatattac aaaaggtacc aagatgaaac attattttaa
      661 tatgattgaa ggacaaggac atggagctgt gtttgactgt aagttttcac aggatggaca
      721 gcattttgcc tgtacagatt ctcatgggca ccttctgata tttggttttg gatgcagcaa
      781 accatatgaa aagatgtaga tggaaatcct catccaacca agtatcagag attagtacca
      841 ggccgagaaa attctgcaga tgaacatttg attccacagc tgggctatgt ggcaacaagt
      901 gatggagagg tgattgaaca aattataagc ctgcaaacca atgataatga tgaacgcagc
      961 ccagaatcga gtattcttga tggaatgata agacagttgc agcagcagca agatcagaga
     1021 atgggagcag atcaggatac tattccaaga ggactttcaa atggtgaaga aacaccccgg
     1081 agaggtttta gaaggctgag cttagacatt cagtcccctc caaatattgg tctgcgtcgt
     1141 agtggacaag ttgaaggtgt tcgtcagatg catcaaaacg ctccacgcag tcagattgct
     1201 acagaacgtg acctgcaggc ttggaaacga agagtggttg taccagaggt accactaggc
     1261 atatttagga agctggaaga cttccgatta gagaaaggtg aagaggaaag aaatctttat
     1321 ataataggaa gaaaaagaaa gactcttcag ctctcacata agtcggattc agtggttttg
     1381 gtatcacagt ctagacaaag gacatgtagg cgtaaatatc caaattatgg tagaagaaat
     1441 cgtagctggc gtgagttatc ttctggaaat gagtcttcaa gctctgtaag acatgagact
     1501 tcctgtgatc agagtgaagg ttctggttct tcagaagagg atgaatggag aagtgacaga
     1561 aaaagtgaga gttacagcga aagttcaagt gactcttcat ctagatattc cgattggaca
     1621 gctgatgcgg gcatcaattt gcagcctcct ttaaga
//