LOCUS       AB062754                1135 bp    mRNA    linear   PLN 08-JUN-2001
DEFINITION  Glycine max SferH-2 mRNA for ferritin, complete cds.
ACCESSION   AB062754
VERSION     AB062754.1
KEYWORDS    .
SOURCE      Glycine max (soybean)
  ORGANISM  Glycine max
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae;
            50 kb inversion clade; NPAAA clade; indigoferoid/millettioid
            clade; Phaseoleae; Glycine; Soja.
REFERENCE   1  (bases 1 to 1135)
  AUTHORS   Goto,F., Yoshihara,T. and Masuda,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2001) to the DDBJ/EMBL/GenBank databases.
            Contact:Fumiyuki Goto
            Central Research Institute of Electric Power Industry, Bio-Science
            Department; 1646 Abiko, Abiko, Chiba 270-1194, Japan
REFERENCE   2
  AUTHORS   Masuda,T., Goto,F. and Yoshihara,T.
  TITLE     A novel plant ferritin subunit from soybean that is related to a
            mechanism in iron release.
  JOURNAL   J. Biol. Chem. 276, 19575-19579 (2001)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..1135
                     /db_xref="taxon:3847"
                     /mol_type="mRNA"
                     /organism="Glycine max"
     CDS             86..859
                     /codon_start=1
                     /gene="SferH-2"
                     /product="ferritin"
                     /protein_id="BAB60683.1"
                     /transl_table=1
                     /translation="MALSCSKVLSFYLSPVVGGGDVPKKLTFSSFLGLSKGVGGSRSS
                     RVCAASNAPAPLAGVIFEPFQELKKDYLAVPIAHNVXLARQNYADDSESAINEQINVE
                     YNVSYVYHALFAYFDRDNIALKGLAKFFKESSEEEREHAEQLIKYQNIRGGRVVLHPI
                     TSPPSEFEHSEKGDALYAMELALSLEKLTNEKLLHVHSVAERNNDPQXADFIESEFLY
                     EQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV"
BASE COUNT          317 a          210 c          252 g          352 t
ORIGIN      
        1 cacacaatct caccctcaat atccgccatt gaattcttct tccatttctc ttttttctgc
       61 atacccattt cgtttttctt cccaaatggc cctttcttgc tccaaagttt taagctttta
      121 tctctcgccc gttgtgggtg gtggtgatgt tccgaaaaag ctcacttttt cttctttttt
      181 gggtctttct aagggtgttg gtggaagcag gagctcgagg gtgtgtgctg cttcaaatgc
      241 acccgcacca ctcgctgggg tcatatttga accatttcaa gagctcaaga aggattatct
      301 tgctgttccg attgcacaca atgtttnctt ggctcgtcag aactatgcag atgactctga
      361 atctgcaatc aacgagcaga tcaatgtgga atacaacgtt tcctatgtgt accacgcctt
      421 gtttgcgtac ttcgacagag acaacatagc tctcaaagga cttgcaaagt tcttcaagga
      481 atcaagtgaa gaagaaagag agcatgccga gcagcttata aagtatcaga acattcgtgg
      541 tggacgagtg gtgctgcacc caatcacaag tcctccctcg gaatttgagc attcggaaaa
      601 aggggatgcc ttgtatgcca tggaactagc tttgtctttg gagaagttga cgaatgagaa
      661 acttctgcac gttcacagtg tggcagaacg taacaatgat cctcaaytdg cagacttcat
      721 tgagagcgag ttcttgtatg agcaggttaa atcgattaaa aagattgcag agtatgtggc
      781 tcaactgaga ttagttggaa agggtcatgg tgtgtggcac tttgatcaaa agcttcttca
      841 cgatgaagat catgtataat ctttgaacgg cctctgcttt ctaaatatgg tcctatgtga
      901 agttatgtgt tgttctgctt gtaggaatag tgaataagtg tttctctcct aggtgataaa
      961 aatgtaggaa ctttgtgttg tattatagtt attgttggta gaatggtagt agtagtagta
     1021 ttattatgtg caatctcgta tgtttgtagc atgcaattat tttgttanaa gtaaaaaatg
     1081 acgtcggcta cttgggttca agtccaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa
//