LOCUS       AB029886                1473 bp    mRNA    linear   HUM 14-OCT-2000
DEFINITION  Homo sapiens mRNA for choline/ethanolamine kinase, complete cds.
ACCESSION   AB029886
VERSION     AB029886.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1473)
  AUTHORS   Yamazaki,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-1999) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoshi Yamazaki
            University of Tokushima, Faculty of Pharmaceutical Sciences;
            Syomachi, Tokushima, Tokushima 770-8505, Japan
REFERENCE   2
  AUTHORS   Yamazaki,N., Shinohara,Y., Kajimoto,K., Shindo,M. and Terada,H.
  TITLE     Novel Expression of Equivocal Messages Containing Both Regions of
            Choline/Ethanolamine Kinase and Muscle Type Carnitine
            Palmitoyltransferase I
  JOURNAL   J. Biol. Chem. 275, 31739-31746 (2000)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..1473
                     /db_xref="H-InvDB:HIT000058973"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
     CDS             69..1256
                     /codon_start=1
                     /product="choline/ethanolamine kinase"
                     /protein_id="BAA82512.1"
                     /transl_table=1
                     /translation="MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRD
                     AERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVL
                     LRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELRE
                     PVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSL
                     KDEMGNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFD
                     IGNHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKL
                     EEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVH
                     SSS"
     polyA_signal    1452..1457
BASE COUNT          318 a          423 c          437 g          295 t
ORIGIN      
        1 ggaaggaacc gagcccgtcc gaagggagcg gagcgcagcc tggcctgggg cccggtcgag
       61 cccgcgccat ggcggccgag gcgacagctg tggccggaag cggggctgtt ggcggctgcc
      121 tggccaaaga cggcttgcag cagtctaagt gcccggacac taccccaaaa cggcggcgcg
      181 cctcgtcgct gtcgcgtgac gccgagcgcc gagcctacca atggtgccgg gagtacttgg
      241 gcggggcctg gcgccgagtg cagcccgagg agctgagggt ttaccccgtg agcggaggcc
      301 tcagcaacct gctcttccgc tgctcgctcc cggaccacct gcccagcgtt ggcgaggagc
      361 cccgggaggt gcttctgcgg ctgtacggag ccatcttgca gggcgtggac tccctggtgc
      421 tagaaagcgt gatgttcgcc atacttgcgg agcggtcgct ggggccccag ctgtacggag
      481 tcttcccaga gggccggctg gaacagtaca tcccaagtcg gccattgaaa actcaagagc
      541 ttcgagagcc agtgttgtca gcagccattg ccacgaagat ggcgcaattt catggcatgg
      601 agatgccttt caccaaggag ccccactggc tgtttgggac catggagcgg tacctaaaac
      661 agatccagga cctgccccca actggcctcc ctgagatgaa cctgctggag atgtacagcc
      721 tgaaggatga gatgggcaac ctcaggaagt tactagagtc taccccatcg ccagtcgtct
      781 tctgccacaa tgacatccag gaagggaaca tcttgctgct ctcagagcca gaaaatgctg
      841 acagcctcat gctggtggac ttcgagtaca gcagttataa ctataggggc tttgacattg
      901 ggaaccattt ttgtgagtgg gtttatgatt atactcacga ggaatggcct ttctacaaag
      961 caaggcccac agactacccc actcaagaac agcagttgca ttttattcgt cattacctgg
     1021 cagaggcaaa gaaaggtgag accctctccc aagaggagca gagaaaactg gaagaagatt
     1081 tgctggtaga agtcagtcgg tatgctctgg catcccattt cttctggggt ctgtggtcca
     1141 tcctccaggc atccatgtcc accatagaat ttggttactt ggactatgcc cagtctcggt
     1201 tccagttcta cttccagcag aaggggcagc tgaccagtgt ccactcctca tcctgactcc
     1261 accctcccac tccttggatt tctcctggag cctccagggc aggaccttgg agggaggaac
     1321 aacgagcaga aggccctggc gactgggctg agcccccaag tgaaactgag gttcaggaga
     1381 ccggcctgtt cctgagtttg agtaggtccc catggctggc aggccagagc cccgtgctgt
     1441 gtatgtaaca caataaacaa gcttcttctt ccc
//