LOCUS       AB023197                4848 bp    mRNA    linear   HUM 19-SEP-2015
DEFINITION  Homo sapiens KIAA0980 mRNA for KIAA0980 protein.
ACCESSION   AB023197
VERSION     AB023197.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4848)
  AUTHORS   Ohara,O., Nagase,T. and Kikuno,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-1999) to the DDBJ/EMBL/GenBank databases.
            Contact:Osamu Ohara
            Kazusa DNA Research Institute, Laboratory of DNA Technology; Yana
            1532-3, Kisarazu, Chiba 292-0812, Japan
REFERENCE   2
  AUTHORS   Nagase,T., Ishikawa,K., Suyama,M., Kikuno,R., Hirosawa,M.,
            Miyajima,N., Tanaka,A., Kotani,H., Nomura,N. and Ohara,O.
  TITLE     Prediction of the coding sequences of unidentified human genes.
            XIII. The complete sequences of 100 new cDNA clones from brain
            which code for large proteins in vitro.
  JOURNAL   DNA Res. 6, 63-70 (1999)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..4848
                     /clone="hj07083"
                     /clone_lib="pBluescriptII SK plus"
                     /db_xref="H-InvDB:HIT000000697"
                     /db_xref="taxon:9606"
                     /dev_stage="adult"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /sex="male"
                     /tissue_type="brain"
     CDS             75..4223
                     /codon_start=1
                     /gene="KIAA0980"
                     /product="KIAA0980 protein"
                     /protein_id="BAA76824.2"
                     /translation="MDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQ
                     LPVLLQTLLGNDHFARVNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKY
                     VNGSKWYGRRSRPELCDAATEARRVPEQQTQASLKSHLWRSASLESVESPKSDEEAES
                     TKEAQNELFEAQGQLQTWDSEDFGSPQKSCSPSFDTPESQIRGVWEELGVGSSGHLSE
                     QELAVVCQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEFQLGLFSHEPALLLESSTR
                     VKPSKAWSHYQVPEESGCHTTTTSSLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQE
                     GIQNGREILQSLDFSVDEKVNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQ
                     VEQLARERDKARQDLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLL
                     RSEVEAERELFWEQAHRQRAALEWDVGRLQAEEAGLREKLTLALKENSRLQKEIVEVV
                     EKLSDSERLALKLQKDLEFVLKDKLEPQSAELLAQEERFAAVLKEYELKCRDLQDRND
                     ELQAELEGLWARLPKNRHSPSWSPDGRRRQLPGLGPAGISFLGNSAPVSIETELMMEQ
                     VKEHYQDLRTQLETKVNYYEREIAALKRNFEKERKDMEQARRREVSVLEGQKADLEEL
                     HEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAE
                     LSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKLQPCASEKRAQM
                     CVSLALEEEELELARGKRVDGPSLEAEMQALPKDGLVAGSGQEGTRGLLPLRPGCGER
                     PLAWLAPGDGRESEEAAGAGPRRRQAQDTEATQSPAPAPAPASHGPSERWSRMQPCGV
                     DGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDASQTQPRMWEPPLRPAASCRGQA
                     ERLQAIQEERARSWSRGTQEQASEQQARAEGALEPGCHKHSVEVARRGSLPSHLQLAD
                     PQGSWQEQLAAPEEGETKIALEREKDDMETKLLHLEDVVRALEKHVDLRENDRLEFHR
                     LSEENTLLKNDLGRVRQELEAAESTHDAQRKEIEVLKKDKEKACSEMEVLNRQNQNYK
                     DQLSQLNVRVLQLGQEASTHQAQNEEHRVTIQMLTQSLEEVVRSGQQQSDQIQKLRVE
                     LECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLRLRQAQAQHLQEVRLVPQDRVAEL
                     HRLLSLQGEQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQF
                     EKNTKSDLLLKELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRIAPA
                     ALSV"
BASE COUNT         1164 a         1250 c         1588 g          846 t
ORIGIN      
        1 gcggtacggg ggtggtgccg cgctcctggc cccgcgcggg cggacggcgg aggcgcctcc
       61 cagcctgcta tgggatggat gaagaagaga accactatgt ctcgcagctc agggaagtct
      121 acagcagctg cgacaccacg gggactggct ttctggaccg ccaggagctg acccagctct
      181 gccttaagct tcacctggag cagcagctgc ccgtcctcct gcagacgctt ctcggaaacg
      241 accatttcgc cagggttaac tttgaggaat ttaaggaagg ttttgtggct gtgttgtctt
      301 caaatgctgg tgttcgcccc tcagatgaag acagtagttc tttggaatca gctgcctcca
      361 gtgccatccc tccaaagtat gtgaatggtt ctaagtggta tggccgtcgg agccggcctg
      421 agctatgtga cgctgccaca gaagccagac gcgtgccgga gcagcaaacc caggccagcc
      481 tgaaaagtca cctctggcgc tcagcgtctc tggagagcgt ggagagtccc aagtcagatg
      541 aagaggccga gagcactaaa gaagctcaga atgaattatt tgaagcacaa ggacagctgc
      601 agacctggga ttctgaggac tttgggagcc cccagaagtc ctgcagcccc tcctttgaca
      661 ccccagagag ccagatccgg ggcgtgtggg aagagctggg ggtgggcagc agcggacacc
      721 tgagcgagca ggagctggct gtggtctgcc agagcgtcgg gctccaggga ctcgagaaag
      781 aggaactcga agacctgttt aacaaactgg atcaagacgg agacggcaaa gtgagtcttg
      841 aggaattcca gcttggcctc ttcagtcatg agcccgcgct acttctagag tcttccactc
      901 gggttaaacc gagcaaggct tggtctcatt accaggtccc agaggagagc ggctgccaca
      961 ccaccacaac ctcatccctc gtgtccctgt gctccagcct gcgcctcttc tccagcattg
     1021 acgatggttc tggcttcgct tttcctgatc aggtcctggc catgtggacc caggagggga
     1081 ttcagaatgg cagggagatc ttgcagagcc tggacttcag cgtggacgag aaggtgaacc
     1141 ttctggagct gacctgggcc cttgacaacg agctcatgac agtggacagt gccgtccagc
     1201 aggcagccct ggcctgctac caccaggagc tgagctacca gcaagggcag gtggagcagc
     1261 tggcaaggga gcgtgacaag gcaaggcagg acctggagag ggccgagaag aggaacctgg
     1321 agtttgtgaa agagatggac gactgccact ccaccctgga gcagctcacg gagaagaaaa
     1381 tcaagcatct ggagcagggg taccgggaaa ggctgagcct cctgcggtct gaggtggagg
     1441 cggagcgaga gctgttctgg gagcaggccc acaggcagag ggccgcgctg gagtgggacg
     1501 tggggcgcct gcaggctgag gaggctggcc tccgcgagaa gctgaccctg gccctgaagg
     1561 aaaacagtcg cctacagaag gagattgtgg aagtggtgga aaagctttcg gattcggaga
     1621 ggctggccct gaagctgcag aaggacctgg agtttgtgct gaaggacaag ctggagccac
     1681 agagtgcaga gctcctggcc caggaggagc ggttcgcagc agtcctgaag gaatacgagc
     1741 tcaagtgccg ggacctgcag gaccgcaacg atgagctgca agctgagctg gaaggcctgt
     1801 gggcgcggct gcccaagaac cggcacagcc cctcatggag cccggatggg cgcagacggc
     1861 agctccctgg actcggccca gcaggcattt cattcctggg taattctgct ccagtgagta
     1921 tagaaacgga gctgatgatg gagcaggtaa aggagcatta ccaagacctc aggacccagc
     1981 tggagaccaa ggtaaattac tacgaaaggg aaattgcggc actgaaaagg aactttgaga
     2041 aggagaggaa ggacatggag caggctcgca ggcgcgaggt cagcgtgctg gagggtcaga
     2101 aggccgacct ggaggagctc cacgagaagt ctcaggaggt catctggggc ctgcaggagc
     2161 agctgcagga cacagcccgc ggccccgagc ctgagcagat gggcctggca ccctgctgca
     2221 cccaggcact gtgtggcctg gccctgcggc atcacagcca cctgcagcag atcaggagag
     2281 aggctgaggc ggagctgagt ggagagctgt cggggctggg agccctgccc gctcgcagag
     2341 acctgacctt ggagctggag gagccgccgc agggacccct gccacgcggg agccagaggt
     2401 cggagcagct ggagctggag agggcactga agctgcagcc ctgtgcgagc gagaagcgcg
     2461 cccagatgtg cgtatcgttg gccctcgagg aggaggagtt ggagcttgcc cgcgggaagc
     2521 gagtggacgg gccctccctg gaagcagaga tgcaggccct gccgaaagat gggctggtgg
     2581 caggaagtgg ccaggagggc acacgtggcc tcctaccact gcgtccgggc tgtggggagc
     2641 ggccactggc ctggctggcc ccaggtgatg gcagagagtc tgaggaggcg gcaggagccg
     2701 ggcctcgccg caggcaagcc caggacacag aagctacgca gagcccggcc cccgcccctg
     2761 ccccggcatc ccacggcccc tcagagaggt ggtcacgcat gcagccctgt ggagtggatg
     2821 gggatattgt cccaaaggag ccagagcctt tcggcgcgag cgcagcgggg ctggagcagc
     2881 ctggagcccg ggagctgcct ctgctgggaa cagagagaga cgcctcgcaa acccagccac
     2941 ggatgtggga gccacccctg aggccggccg cttcgtgcag gggacaggct gagaggctac
     3001 aggccattca ggaagagcga gcacgaagct ggagcagggg cacccaggag caggcctcgg
     3061 agcagcaggc ccgggccgag ggcgccctgg agcctgggtg tcacaagcac agtgtggagg
     3121 ttgccaggag agggtccttg ccatcccacc tccagctcgc agacccgcag ggttcctggc
     3181 aggagcagct tgctgcccca gaagaggggg agaccaaaat agcgctggag agagagaagg
     3241 atgacatgga aaccaaactt ctacatctgg aagacgtcgt ccgggctctg gagaaacatg
     3301 tagatttgag agagaacgac agactggagt tccatagact ttctgaagaa aacactttgt
     3361 tgaaaaacga tctgggaagg gttcggcaag agcttgaagc tgcagaaagt actcacgatg
     3421 cacagaggaa ggaaattgag gttttaaaga aagacaagga aaaggcctgc tctgagatgg
     3481 aggtgctcaa cagacagaat cagaactaca aggatcaatt atcccagctc aatgtcaggg
     3541 ttcttcaact gggacaggag gcttctaccc accaggccca aaacgaggag catcgtgtga
     3601 ccattcagat gttaacacag agcctggagg aggtggttcg cagtgggcag cagcagagtg
     3661 accaaatcca aaaacttaga gttgaacttg aatgcctgaa tcaggaacat cagagcctgc
     3721 agctgccatg gtcagagctg acccagaccc ttgaggaaag tcaagaccag gtgcagggag
     3781 ctcacctgag gctgaggcag gcccaggccc agcacttgca ggaggtccgg ctggtgcccc
     3841 aggaccgtgt ggccgagctg catcgcctgc tcagccttca gggagagcag gccaggaggc
     3901 gcctggatgc acagcgggaa gaacatgaga aacagctgaa agccacagaa gagcgggtgg
     3961 aagaggcgga gatgattctg aagaatatgg aaatgctcct ccaagagaaa gtggataagc
     4021 tgaaggagca gtttgaaaag aacacgaagt ccgacctgct gctgaaggag ctgtacgtgg
     4081 agaacgccca cctggtgaga gcacttcagg ccaccgagga gaagcagcga ggcgccgaga
     4141 aacaaagccg cctcttggaa gaaaaagttc gcgctctcaa caaactcgtc agtaggattg
     4201 cccccgcagc cctctctgtg taaagacaga ttattttcta ggattcattc gaaagcacat
     4261 cttttaaatt aagccactgt gctgccttag attccgtggg tcatgagcca tgagtcctgg
     4321 gacatctgag gattgggatt ctttgttcac cccgcagata gttaatgaat ggtctgccct
     4381 gggcaagatg gaggtggggg ctgggggaat atgcatgttg cagaagccgg cgtttttatt
     4441 agcggtcctg agtaatttcc cttggcaaaa ttcccagttt tgccactctc tggagccaga
     4501 tcctgggagc tgtcagcaag gagcaggtaa gtgagcagtt atggacagca ctttccatgt
     4561 ggtgcttccg accctggctg tcagagtgaa atgtaaagtc agggctctgt acagttttgc
     4621 catttcactg ttctgcttta agcttagctt attagaactc ttggtggagg gtgcgtacac
     4681 acattccaga aaaggcttca ctcgctggga acgtcaaccc agcgagaaag gaggggaagc
     4741 cccttctccg gggaccttat ctgtggactc aggaatgatg gtgtttattg caaatgcaca
     4801 atctttttcc cattgaaatg tcatcacact ggaaattgta ctatatgt
//