LOCUS       AB020718                5219 bp    mRNA    linear   HUM 10-JAN-2004
DEFINITION  Homo sapiens KIAA0911 mRNA for KIAA0911 protein, partial cds.
ACCESSION   AB020718
VERSION     AB020718.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5219)
  AUTHORS   Ohara,O., Suyama,M., Kikuno,R., Nagase,T. and Ishikawa,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-1998) to the DDBJ/EMBL/GenBank databases.
            Contact:Osamu Ohara
            Kazusa DNA Research Institute, Laboratory of DNA Technology; Yana
            1532-3, Kisarazu, Chiba 292-0812, Japan
REFERENCE   2
  AUTHORS   Nagase,T., Ishikawa,K., Suyama,M., Kikuno,R., Hirosawa,M.,
            Miyajima,N., Tanaka,A., Kotani,H., Nomura,N. and Ohara,O.
  TITLE     Prediction of the coding sequences of unidentified human genes.
            XII.The complete sequences of 100 new cDNA clones from brain which
            code for large proteins in vitro
  JOURNAL   DNA Res. 5, 355-364 (1998)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..5219
                     /clone="hj05129"
                     /clone_lib="pBluescriptII SK plus"
                     /db_xref="H-InvDB:HIT000000628"
                     /db_xref="taxon:9606"
                     /dev_stage="adult"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /sex="male"
                     /tissue_type="brain"
     CDS             <569..3739
                     /codon_start=1
                     /gene="KIAA0911"
                     /note="Start codon is not identified"
                     /note="hj05129 cDNA clone for KIAA0911 has a 1-bp
                     deletion at position 1783 of the sequence of KIAA0911"
                     /product="KIAA0911 protein"
                     /protein_id="BAA74934.2"
                     /translation="LLPLPSARRCSEAGRAPRPERAAQRHGGGGGGSSLDPRSSPRRG
                     AAGPRPLEPRELRELRSASRAPPCRSRPGLAMLRRPAPALAPAARLLLAGLLCGGGVW
                     AARVNKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEIC
                     GFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCELQKDYSFTIQAYDCGKGPDGTNVK
                     KSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILRVEAVDADCSPQFSQICS
                     YEIITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKISIKP
                     TCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASVQATVELETSHIGKGCDRD
                     TYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPD
                     GVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFRQ
                     DPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPLH
                     PSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKL
                     ADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISY
                     LNSRQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGVHHFAR
                     AASEFESSEGVFLFPELRIISTITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVT
                     VEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWH
                     ARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRSF
                     VDLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHRRTMRDQDTGK
                     ENEMDWDDSALTITVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEE
                     EEGEQGDPQNATRQQQLEWDDSTLSY"
BASE COUNT         1105 a         1568 c         1518 g         1028 t
ORIGIN      
        1 gtctcctgga ccccctttcg tgacccctct caacacctct actggggaga cgaggacccc
       61 gaggttctgg ggggcgacgc gacctgcccg aagtgacaag ggtcctgggc cgcactgctc
      121 cgccggggtc tgcgctcctc ggcggagcgg gtgggaagga tgagtcctcg gggtggagaa
      181 ggaggagcgg gtccccgggt accgctcacc cggccttagg agcccgggag cgcgcgtagg
      241 gacgcggagt tgaggctctc catctgcggc cagggaaagg gatacagtcc cccgggcccc
      301 tcccggccgc tcggaaccca ccccaggcgc gtccccgcgg gcgcgcgctc caggcggggc
      361 cgacgggctc ggaggcgcgc gcccgctgcc gggtccgccg cgcgcgctcc ctccgctcct
      421 ctcccccgcc cctcccgggc ccgcgcgctc ccagggtccg ccgcgcgcgc gcctcgcgtc
      481 gctccccatc cccgcccctc ccgccgccac cccgcccccg gccgggtacc ctcgccggac
      541 ccgagagaga gcgccgccgc catcttagtt gctgccgctg ccttcagcaa gacgctgctc
      601 tgaggcgggg agggcgccgc gtcctgagcg cgcggcccag cgtcacggcg gcggcggcgg
      661 cggctcctcc ttggaccccc ggagctcccc gcgccgcgga gcagctggcc ccaggcccct
      721 agagccccga gagctccgag agctccgctc ggcgtcccgc gcgcctccct gccgctcccg
      781 ccccgggctg gcgatgctgc gccgccccgc tcccgcgctg gccccggccg cccggctgct
      841 gctggccggg ctgctgtgcg gcggcggggt ctgggccgcg cgagttaaca agcacaagcc
      901 ctggctggag cccacctacc acggcatagt cacagagaac gacaacaccg tgctcctcga
      961 ccccccactg atcgcgctgg ataaagatgc gcctctgcga tttgcagaga gttttgaggt
     1021 gacagtcacc aaagaaggtg agatttgtgg atttaaaatt cacgggcaga atgtcccctt
     1081 tgatgcagtg gtagtggata aatccactgg tgagggagtc attcgctcca aagagaaact
     1141 ggactgtgag ctgcagaaag actattcatt caccatccag gcctatgatt gtgggaaggg
     1201 acctgatggc accaacgtga aaaagtctca taaagcaact gttcatattc aggtgaacga
     1261 cgtgaatgag tacgcgcccg tgttcaagga gaagtcctac aaagccacgg tcatcgaggg
     1321 gaagcagtac gacagcattt tgagggtgga ggccgtggat gccgactgct cccctcagtt
     1381 cagccagatt tgcagctacg aaatcatcac tccagacgtg ccctttactg ttgacaaaga
     1441 tggttatata aaaaacacag agaaattaaa ctacgggaaa gaacatcaat ataagctgac
     1501 cgtcactgcc tatgactgtg ggaagaaaag agccacagaa gatgttttgg tgaagatcag
     1561 cattaagccc acctgcaccc ctgggtggca aggatggaac aacaggattg agtatgagcc
     1621 gggcaccggc gcgttggccg tctttccaaa tatccacctg gagacatgtg acgagccagt
     1681 cgcctcagta caggccacag tggagctaga aaccagccac atagggaaag gctgcgaccg
     1741 agacacctac tcagagaagt ccctccaccg gctctgtggt gcggccgcgg gcactgccga
     1801 gctgctgcca tccccgagtg gatccctcaa ctggaccatg ggcctgccca ccgacaatgg
     1861 ccacgacagc gaccaggtgt ttgagttcaa cggcacccag gcagtgagga tcccggatgg
     1921 cgtcgtgtcg gtcagcccca aagagccgtt caccatctcg gtgtggatga gacatgggcc
     1981 attcggcagg aagaaggaga caattctttg cagttctgat aaaacagata tgaatcggca
     2041 ccactactcc ctctatgtcc acgggtgccg gctgatcttc ctcttccgtc aggatccttc
     2101 tgaggagaag aaatacagac ctgcagagtt ccactggaag ttgaatcagg tctgtgatga
     2161 ggaatggcac cactacgtcc tcaatgtaga attcccgagt gtgactctct atgtggatgg
     2221 cacgtcccac gagcccttct ctgtgactga ggattacccg ctccatccat ccaagataga
     2281 aactcagctc gtggtggggg cttgctggca agagttttca ggagttgaaa atgacaatga
     2341 aactgagcct gtgactgtgg cctctgcagg tggcgacctg cacatgaccc agtttttccg
     2401 aggcaatctg gctggcttaa ctctccgttc cgggaaactc gcggataaga aggtgatcga
     2461 ctgtctgtat acctgcaagg aggggctgga cctgcaggtc ctcgaagaca gtggcagagg
     2521 cgtgcagatc caagcacacc ccagccagtt ggtattgacc ttggagggag aagacctcgg
     2581 ggaattggat aaggccatgc agcacatctc gtacctgaac tcccggcagt tccccacgcc
     2641 cggaattcgc agactcaaaa tcaccagcac aatcaagtgt tttaacgagg ccacctgcat
     2701 ttcggtcccc ccggtagatg gctacgtgat ggttttacag cccgaggagc ccaagatcag
     2761 cctgagtggc gtccaccatt ttgcccgagc agcttctgaa tttgaaagct cagaaggggt
     2821 gttccttttc cctgagcttc gcatcatcag caccatcacg agagaagtgg agcctgaagg
     2881 ggacggggct gaggacccca cagttcaaga atcactggtg tccgaggaga tcgtgcacga
     2941 cctggatacc tgtgaggtca cggtggaggg agaggagctg aaccacgagc aggagagcct
     3001 ggaggtggac atggcccgcc tgcagcagaa gggcattgaa gtgagcagct ctgaactggg
     3061 catgaccttc acaggcgtgg acaccatggc cagctacgag gaggttttgc acctgctgcg
     3121 ctatcggaac tggcatgcca ggtccttgct tgaccggaag tttaagctca tctgctcaga
     3181 gctgaatggc cgctacatca gcaacgaatt taaggtggag gtgaatgtaa tccacacggc
     3241 caaccccatg gaacacgcca accacatggc tgcccagcca cagttcgtgc acccggaaca
     3301 ccgctccttt gttgacctgt caggccacaa cctggccaac ccccacccgt tcgcagtcgt
     3361 ccccagcact gcgacagttg tgatcgtggt gtgcgtcagc ttcctggtgt tcatgattat
     3421 cctgggggta tttcggatcc gggccgcaca tcggcggacc atgcgggatc aggacaccgg
     3481 gaaggagaac gagatggact gggacgactc tgccctgacc atcaccgtca accccatgga
     3541 gacctatgag gaccagcaca gcagtgagga ggaggaggaa gaggaagagg aagaggaaag
     3601 cgaggacggc gaagaagagg atgacatcac cagcgccgag tcggagagca gcgaggagga
     3661 ggagggggag cagggcgacc cccagaacgc aacccggcag cagcagctgg agtgggatga
     3721 ctccaccctc agctactgac ccgtgccccc ggccacctcg gtttctgctt tcgaagactc
     3781 tgctgccatc cgttctccca gtcccaaggg tccacgatgt acaaagtcat ttcggccagt
     3841 aggtgtgcag acccctcccc gccacgatcg tcgctgtgct tggtgtgtag gaccctaggc
     3901 tccccgccca ccctctgcct ggtcgcgctc ttcagtccca cgaggagctg acacgtcctc
     3961 tctggccgcc atccggctcg cacaggggcc tcccagcgcc tcaggccccg cgtttgtgtc
     4021 tggagtctcc ccccggggag aggacactgg cccctcgcac tccagaaaag ccatgccagc
     4081 tgggctcgtt gacaaagggt aaaacatgct cactcccacc cggtaatcat ttttttcttt
     4141 ttttaaaaaa agtttttatt ttttccaaac tagtgcatgt ataaataatg gcaggatggg
     4201 gggtactgtg tagatgatta actgactttt taatattttg taaataaatc ggattccttg
     4261 tgtcctttgt gctagtgtaa cccgggactg gaatgtaaag tgaagttcgg agctctgagc
     4321 acgggctctt cccgccgggt cctccctccc cagaccccag agggagaggc ccaccccgcc
     4381 cagccccgcc ccagcccctg ctcaggtctg agtatggctg ggagtcgggg gccacaggcc
     4441 tctagctgtg ctgctcaaga gactggatca gggtagctac aagtggccgg gccttgcctt
     4501 tgggattcta cctgttccta atttggtgtg gggtgcgggg tccctggccc cttttccaca
     4561 ctcctcctcc gacagcagct ccctgggcag tggcctggtc tcaccgtgtg cagccttgtg
     4621 gtttatgctt aaatgtacat tttcctgctg gtaaaaggag aaactgagag gtgtcctgca
     4681 gaccggctga ccactccttt tggagacggc aggaggcctg agcgatccgt actcagaacg
     4741 tccaggagag acgcatggcc cgaagtcaaa gtgctggaat tttccaaaac agcctgttct
     4801 ctcctctctc ctccccagag caccccctgc catcaggggg gttgaaatcc ctctccccca
     4861 ggagccctgc tgctttgctt ggtggtaggg caggagagca aacaaacagt catggtctaa
     4921 aacccacata gcactttgct cttagttaca tgtaaaattt tagatttcta aaacaggtgg
     4981 gcaatcattt tgaatactgt tctgtgaccc tgactgctag ttctgaggac actggtggct
     5041 gtgctatgtg tggccatcct ccatgtcccg tccctgtagc tgctctgttt agacagcgga
     5101 cagacgctca cgcccagggg atgtcctcac gctgtcgccg cgcggtttcc cttcgcagat
     5161 gtgtatactc atgataggtc agaaagtgta tccgctacaa taaagttctg gttctaact
//