LOCUS       AB020700                4195 bp    mRNA    linear   HUM 10-JAN-2004
DEFINITION  Homo sapiens KIAA0893 mRNA for KIAA0893 protein, partial cds.
ACCESSION   AB020700
VERSION     AB020700.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4195)
  AUTHORS   Ohara,O., Suyama,M., Kikuno,R., Nagase,T. and Ishikawa,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-1998) to the DDBJ/EMBL/GenBank databases.
            Contact:Osamu Ohara
            Kazusa DNA Research Institute, Laboratory of DNA Technology; Yana
            1532-3, Kisarazu, Chiba 292-0812, Japan
REFERENCE   2
  AUTHORS   Nagase,T., Ishikawa,K., Suyama,M., Kikuno,R., Hirosawa,M.,
            Miyajima,N., Tanaka,A., Kotani,H., Nomura,N. and Ohara,O.
  TITLE     Prediction of the coding sequences of unidentified human genes.
            XII.The complete sequences of 100 new cDNA clones from brain which
            code for large proteins in vitro
  JOURNAL   DNA Res. 5, 355-364 (1998)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..4195
                     /clone="hk08702"
                     /clone_lib="pBluescriptII SK plus"
                     /db_xref="H-InvDB:HIT000000610"
                     /db_xref="taxon:9606"
                     /dev_stage="adult"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /sex="male"
                     /tissue_type="brain"
     CDS             <59..2983
                     /codon_start=1
                     /gene="KIAA0893"
                     /note="Start codon is not identified"
                     /product="KIAA0893 protein"
                     /protein_id="BAA74916.2"
                     /translation="RAGGRREDRRQTQTAAVVLLPQPGAGRFGALAAGLPAAFSSAAP
                     PGLPWSPQAINMTAEETVNVKEVEIIKLILDFLNSKKLHISMLALEKESGVINGLFSD
                     DMLFLRQLILDGQWDEVLQFIQPLECMEKFDKKRFRYIILKQKFLEALCVNNAMSAED
                     EPQHLEFTMQEAVQCLHALEEYCPSKDDYSKLCLLLTLPRLTNHAEFKDWNPSTARVH
                     CFEEACVMVAEFIPADRKLSEAGFKASNNRLFQLVMKGLLYECCVEFCQSKATGEEIT
                     ESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAA
                     YADLLTPLISKLSPYPSSPMRRPQSADAYMTRSLNPALDGLTCGLTSHDKRISDLGNK
                     TSPMSHSFANFHYPGVQNLSRSLMLENTECHSIYEESPERDTPVDAQRPIGSEILGQS
                     SVSEKEPANGAQNPGPAKQEKNELRDSTEQFQEYYRQRLRYQQHLEQKEQQRQIYQQM
                     LLEGGVNQEDGPDQQQNLTEQFLNRSIQKLGELNIGMDGLGNEVSALNQQCNGSKGNG
                     SNGSSVTSFTTPPQDSSQRLTHDASNIHTSTPRNPGSTNHIPFLEESPCGSQISSEHS
                     VIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNS
                     KTLRVCAYPDVIDPSAHETPKQPVVRFKRNKHHKGSIYCVAWSPCGQLLATGSNDKYV
                     KVLPFNAETCNATGPDLEFSMHDGTIRDLAFMEGPESGGAILISAGAGDCNIYTTDCQ
                     RGQGLHALSGHTGHILALYTWSGWMIASGSQDKTVRFWDLRVPSCVRVVGTTFHGTGS
                     AVASVAVDPSGRLLATGQEDSSCMLYDIRGGRMVQSYHPHSSDVRSVRFSPGAHYLLT
                     GSYDMKIKVTDLQGDLTKQLPIMVVGEHKDKVIQCRWHTQDLSFLSSSADRTVTLWTY
                     NG"
BASE COUNT         1205 a          836 c          922 g         1232 t
ORIGIN      
        1 gtcgctgggc cgggaggggc ggacgtgaga aggacggatt gacgaactga tggattgacg
       61 cgcgggcggt aggagggagg accgacgcca aacccagacc gccgccgtcg tgctcctgcc
      121 gcagcccgga gccggccgct tcggggccct ggccgccggc ctcccagccg cgttctcctc
      181 cgccgctcct ccgggcttgc cctggagccc tcaggctatc aatatgacgg ctgaagaaac
      241 agtgaatgta aaagaggttg aaatcattaa gctaattttg gacttcctga attcaaagaa
      301 gcttcacatt agtatgctgg ccctggagaa ggaaagtgga gtcataaatg gcctgttttc
      361 agatgatatg cttttcctga ggcagctaat acttgatggt caatgggatg aagttcttca
      421 gttcattcag cctctagaat gtatggaaaa atttgacaaa aaaaggtttc gttatattat
      481 cctgaagcag aagtttttag aagctttatg tgttaacaac gcgatgtcag cagaagatga
      541 gccccagcat ctggaattta ccatgcaaga agctgtgcaa tgtttacatg ctctagaaga
      601 atactgtcct tctaaagatg actatagtaa gctctgtttg cttttgactt tgcctcgtct
      661 gaccaatcat gccgagttta aggactggaa tcccagcacc gcacgagttc actgttttga
      721 agaggcttgt gtcatggttg cagaattcat ccctgctgat aggaagctaa gtgaagctgg
      781 ttttaaggct agtaacaatc gtttatttca gcttgtaatg aaaggcctgc tttatgaatg
      841 ctgtgtagaa ttttgtcaga gtaaagcaac tggagaagaa attacagaaa gcgaagtgct
      901 tcttggcatc gacctcttat gtggtaatgg ttgtgatgat ttggatctga gtttactgtc
      961 atggcttcag aatcttccat cttctgtctt ctcttgtgct tttgaacaga aaatgcttaa
     1021 tattcatgtt gacaaacttc tgaaacctac aaaagctgca tatgctgatc ttttgactcc
     1081 tcttatcagc aaactctctc cctatccatc atccccaatg agaagacctc aatcagctga
     1141 tgcctatatg acccgctctc tgaatcctgc tttagatggc ctcacctgtg gactaaccag
     1201 tcatgataag agaatttcag accttggaaa caaaacttct ccaatgtcac actcctttgc
     1261 taacttccat tatccagggg tacaaaacct cagtagaagt ctcatgcttg agaatacaga
     1321 atgtcacagt atttacgaag aatcccctga gcgtgataca cctgttgatg cacagaggcc
     1381 tatcggcagt gaaatcttgg gccagagttc agtttcagaa aaagagcctg caaatggagc
     1441 acagaatcca ggaccagcta aacaagaaaa aaatgagctt cgagattcaa cagaacaatt
     1501 tcaagaatat tataggcaaa gattacgcta tcaacagcat ttagaacaga aggagcaaca
     1561 gcggcagata taccaacaga tgttgcttga aggaggcgtg aatcaggagg atggtcctga
     1621 tcagcagcag aatcttactg aacagttcct taataggtcc attcaaaagc ttggtgaatt
     1681 aaatattgga atggatggcc ttggtaatga ggtatcagca ctcaaccagc aatgtaatgg
     1741 gagcaaaggc aatggatcta atggttcttc tgtgactagt tttactacac caccccaaga
     1801 ctctagtcag agattaacac atgatgcttc aaatattcat acaagcactc ctcgtaatcc
     1861 tggatcaaca aatcacatac cttttctgga ggaatcacct tgtggaagcc aaatctcttc
     1921 agaacattcg gtcattaagc cacctcttgg agattctcca gggagtcttt caaggtcgaa
     1981 aggggaagag gatgacaaat caaaaaagca gtttgtttgt attaatatcc tagaagacac
     2041 acaagctgtt agagcagtgg cttttcatcc agctggaggt ttatatgctg ttggttcaaa
     2101 ttcaaaaact ctgagagtat gtgcctatcc agatgtaatt gatccaagtg cacatgagac
     2161 tcctaagcag ccggtggtac gttttaaaag gaataaacat cataaaggat ccatttactg
     2221 tgtggcctgg agtccttgtg ggcagttatt agcaacagga tcaaatgaca aatacgtcaa
     2281 agtgctgccc ttcaatgcag agacttgtaa cgcaacagga ccagatctgg aatttagtat
     2341 gcatgatgga acaattagag acttggcatt tatggaaggc ccagaaagcg gaggagctat
     2401 tttaataagt gctggagcag gggattgtaa catttataca accgattgtc aaagaggtca
     2461 gggcctccat gctttgagtg gacatactgg gcatatttta gcactttata cctggagtgg
     2521 ctggatgatt gcatctggtt cccaagataa gactgttaga ttttgggatc ttcgagtacc
     2581 aagttgtgtt cgtgttgttg gcacaacatt tcatggaact ggcagtgcag tggcatctgt
     2641 agctgtagat cccagtggtc gtctcttagc cacaggtcaa gaagattcta gctgcatgtt
     2701 gtatgacata agaggaggaa gaatggtaca aagttatcat cctcattcca gtgatgttcg
     2761 ctctgttcga ttctcccctg gagctcacta cttgctaaca ggctcttatg atatgaaaat
     2821 aaaggtgaca gacctacaag gggacctcac caagcagctt cctatcatgg tggtggggga
     2881 gcacaaggac aaagtgattc agtgcagatg gcacacccag gatctttcct tcctgtcatc
     2941 ctctgcagat agaactgtca ccctctggac ttacaatggg tagagcacac cgcatgtcag
     3001 tctatgcagc aaaagcacag agacttaaga ctactgagtt gtgaaaatta caaatctgaa
     3061 gaacatagtg tccaggaaag tggtttagca cgaagaggcc ccttattacc atgtatccca
     3121 ctgataggag gtgttgggtg gtgttattcc gcagtgcttt cagtcttcca tgtgagctcg
     3181 tgctgctgtg acctgctata tgtagtctcg ttgccaaagt ctgcagaaga gctcttcagt
     3241 tgttggtgtg cactccaagt caggatggac aatgtgttta cggtttagta ttcaatgcat
     3301 tccttggtct ttgcctaaat aacagtttta tatgcacatt gaaatggaat tatacttcaa
     3361 ctatattatt aaatgtaatg caaccaagtt cctcccagat taaacttccc aggtgttcag
     3421 aattactttt gctcttctca cgatcccata ttgtattatc acttgtcttc tagaggtcag
     3481 aattccataa tatatgtcac tcaaaagtta catggttgct ttcacttaag gatcattatg
     3541 gagtttaaag atgaatgaaa aactgcttct tagtttacta catggtatag gccctttttt
     3601 cttaaaccca gggatatgat tattttgtca tataattttg tttcaggcta aaaggtaaat
     3661 gtgtttgctt cagaaacttg ttaacttcag ttttttgaat gcaacaggat acctcccttc
     3721 caaactgaac tgtagaagca gagcagcagc agttatgtga tgcaacactt gatggtacag
     3781 taaatttact ggcatttttc tccttaaaaa ttaaaatcct tgacatagac catagcatgg
     3841 cttgaaatgc tatgtctgca tgataattta aaatggaaga tttaaacttt gcactccaaa
     3901 agcttatttg gatttttttc ttgcactgtt ttgtgtaatg cagaataatg attttatttc
     3961 tacagctttg tagattctaa catttatgta tctttatttt catattgtac agtaatttta
     4021 ctttaaatta tttaaatagg ctattttatt tatttcaaat gcagttgtat tagttctcat
     4081 tattgaactg tctgtgcact gtatgtagca agcatttttc atctgttgta tacaagtgga
     4141 aagggtatta gaagtgtaac tgtgctatta tttcaataaa gacctcttga cattt
//