LOCUS       AB020656                5414 bp    mRNA    linear   HUM 17-MAY-2001
DEFINITION  Homo sapiens KIAA0849 mRNA for KIAA0849 protein, partial cds.
ACCESSION   AB020656
VERSION     AB020656.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5414)
  AUTHORS   Ohara,O., Suyama,M., Kikuno,R., Nagase,T. and Ishikawa,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-1998) to the DDBJ/EMBL/GenBank databases.
            Contact:Osamu Ohara
            Kazusa DNA Research Institute, Laboratory of DNA Technology; Yana
            1532-3, Kisarazu, Chiba 292-0812, Japan
REFERENCE   2
  AUTHORS   Nagase,T., Ishikawa,K., Suyama,M., Kikuno,R., Hirosawa,M.,
            Miyajima,N., Tanaka,A., Kotani,H., Nomura,N. and Ohara,O.
  TITLE     Prediction of the coding sequences of unidentified human genes.
            XII.The complete sequences of 100 new cDNA clones from brain which
            code for large proteins in vitro
  JOURNAL   DNA Res. 5, 355-364 (1998)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..5414
                     /clone="fh04363"
                     /clone_lib="pBluescriptII SK plus"
                     /db_xref="H-InvDB:HIT000000566"
                     /db_xref="taxon:9606"
                     /dev_stage="adult"
                     /mol_type="mRNA"
                     /note="vector:pBluescriptII SK plus. This sequence is
                     replaced that of hk05904 cDNA as a representative cDNA
                     sequence for KIAA0849"
                     /organism="Homo sapiens"
                     /sex="male"
                     /tissue_type="brain"
     CDS             <426..3308
                     /codon_start=1
                     /gene="KIAA0849"
                     /product="KIAA0849 protein"
                     /protein_id="BAA74872.2"
                     /translation="YFEVNITMSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQK
                     LLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEK
                     FTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLL
                     AERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIEDDDTA
                     LESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDM
                     DNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQERRPPKLAFMSRGVGDKG
                     SSSHNKPKATGSTSDPGNRNRSELFYTLNGSSVDSQPQSKSKNTWYIDEVAEDPAKSL
                     TEISTDFDRSSPPLQPPPVNSLTTENRFHSLPFSLTKMPNTNGSIGHSPLSLSAQSVM
                     EELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKENPPFYGVIRWIGQPPGLNEVLAGL
                     ELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPVSNQIERCNSLA
                     FGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTV
                     LLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSE
                     EKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEW
                     SFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGL
                     AMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHG
                     CIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCP
                     EVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK"
BASE COUNT         1618 a          963 c         1196 g         1637 t
ORIGIN      
        1 ttgagaaacg aggtctaggg ttggcaggca atacaataca actcttgatg cctctcattc
       61 ctctgtcagg ctccacaagg acactttaag gactaatttg atttaaatca attcattaaa
      121 aaatatctat agcttttagc tagaagaacc ccaaggagtg attattttgc aatagggctg
      181 agttgggccg ggcatggtgg ctcacacctg taatcccagc actttggggg ccgcgcgtcg
      241 gagtttcccc ctttctaggg tgaggatggt tctacacagc cacccggagt tccttagttg
      301 aaaggtgcgc cctgctgtga cagcatggac accacgttgc tgaaaacatg ctttgggact
      361 gccactgaat ttatcttttg cggttttatg acaaagttat tagtagtttc ccttttttga
      421 attagtattt tgaagttaat atcacaatga gttcaggctt atggagccaa gaaaaagtca
      481 cttcacccta ctgggaagag cggatttttt acttgcttct tcaagaatgc agcgttacag
      541 acaaacaaac acaaaagctc cttaaagtac cgaagggaag tataggacag tatattcaag
      601 atcgttctgt ggggcattca aggattcctt ctgcaaaagg caagaaaaat cagattggat
      661 taaaaattct agagcaacct catgcagttc tctttgttga tgaaaaggat gttgtagaga
      721 taaatgaaaa gttcacagag ttacttttgg caattaccaa ttgtgaggag aggttcagcc
      781 tgtttaaaaa cagaaacaga ctaagtaaag gcctccaaat agacgtgggc tgtcctgtga
      841 aagtacagct gagatctggg gaagaaaaat ttcctggagt tgtacgcttc agaggacccc
      901 tgttagcaga gaggacagtc tccggaatat tctttggagt tgaattgctg gaagaaggtc
      961 gtggtcaagg tttcactgac ggggtgtacc aagggaaaca gctttttcag tgtgatgaag
     1021 attgtggcgt gtttgttgca ttggacaagc tagaactcat agaagatgat gacactgcat
     1081 tggaaagtga ttacgcaggt cctggggaca caatgcaggt cgaacttcct cctttggaaa
     1141 taaactccag agtttctttg aaggttggag aaacaataga atctggaaca gttatattct
     1201 gtgatgtttt gccaggaaaa gaaagcttag gatattttgt tggtgtggac atggataacc
     1261 ctattggcaa ctgggatgga agatttgatg gagtgcagct ttgtagtttt gcgtgtgttg
     1321 aaagtacaat tctattgcac atcaatgata tcatcccaga gagtgtgacg caggaaagga
     1381 ggcctcccaa acttgccttt atgtcaagag gtgttgggga caaaggttca tccagtcata
     1441 ataaaccaaa ggctacagga tctacctcag accctggaaa tagaaacaga tctgaattat
     1501 tttatacctt aaatgggtct tctgttgact cacaaccaca atccaaatca aaaaatacat
     1561 ggtacattga tgaagttgca gaagaccctg caaaatctct tacagagata tctacagact
     1621 ttgaccgttc ttcaccacca ctccagcctc ctcctgtgaa ctcactgacc accgagaaca
     1681 gattccactc tttaccattc agtctcacca agatgcccaa taccaatgga agtattggcc
     1741 acagtccact ttctctgtca gcccagtctg taatggaaga gctaaacact gcacccgtcc
     1801 aagagagtcc acccttggcc atgcctcctg ggaactcaca tggtctagaa gtgggctcat
     1861 tggctgaagt taaggagaac cctcctttct atggggtaat ccgttggatc ggtcagccac
     1921 caggactgaa tgaagtgctc gctggactgg aactggaaga tgagtgtgca ggctgtacgg
     1981 atggaacctt cagaggcact cggtatttca cctgtgccct gaagaaggcg ctgtttgtga
     2041 aactgaagag ctgcaggcct gactctaggt ttgcatcatt gcagccggtt tccaatcaga
     2101 ttgagcgctg taactcttta gcatttggag gctacttaag tgaagtagta gaagaaaata
     2161 ctccaccaaa aatggaaaaa gaaggcttgg agataatgat tgggaagaag aaaggcatcc
     2221 agggtcatta caattcttgt tacttagact caaccttatt ctgcttattt gcttttagtt
     2281 ctgttctgga cactgtgtta cttagaccca aagaaaagaa cgatgtagaa tattatagtg
     2341 aaacccaaga gctactgagg acagaaattg ttaatcctct gagaatatat ggatatgtgt
     2401 gtgccacaaa aattatgaaa ctgaggaaaa tacttgaaaa ggtggaggct gcatcaggat
     2461 ttacctctga agaaaaagat cctgaggaat tcttgaatat tctgtttcat catattttaa
     2521 gggtagaacc tttgctaaaa ataagatcag caggtcaaaa ggtacaagat tgttacttct
     2581 atcaaatttt tatggaaaaa aatgagaaag ttggcgttcc cacaattcag cagttgttag
     2641 aatggtcttt tatcaacagt aacctgaaat ttgcagaggc accatcatgt ctgattattc
     2701 agatgcctcg atttggaaaa gactttaaac tatttaaaaa aatttttcct tctctggaat
     2761 taaatataac agatttactt gaagacactc ccagacagtg ccggatatgt ggagggcttg
     2821 caatgtatga gtgtagagaa tgctacgacg atccggacat ctcagctgga aaaatcaagc
     2881 agttttgtaa aacctgcaac actcaagtcc accttcatcc gaagaggctg aatcataaat
     2941 ataacccagt gtcacttccc aaagacttac ccgactggga ctggagacac ggctgcatcc
     3001 cttgccagaa tatggagtta tttgctgttc tctgcataga aacaagccac tatgttgctt
     3061 ttgtgaagta tgggaaggac gattctgcct ggctcttctt tgacagcatg gccgatcggg
     3121 atggtggtca gaatggcttc aacattcctc aagtcacccc atgcccagaa gtaggagagt
     3181 acttgaagat gtctctggaa gacctgcatt ccttggactc caggagaatc caaggctgtg
     3241 cacgaagact gctttgtgat gcatatatgt gcatgtacca gagtccaaca atgagtttgt
     3301 acaaataact ggggtcatcg ggaaaggcaa agaaactgaa ggcagagtcc taacgttgca
     3361 tcttattcga gctggcagtt ctgttcacgt ccattgccgg caatggatgt ctttgtggtg
     3421 atgatccttc agaaaaggat gcctctgttt aaaaacaaat tgcttttgtg tccctgaagt
     3481 atttaataag aagcattttg cactctagaa agtatgtttg tgttggtttt ttaagaagtc
     3541 taaatgaagt tattaatacc tgaagcttta agttaagtgc attgatcata tgatattttt
     3601 ggaagcatac aattttaatt gtggaagttt aaagcctctt ttagtccatt gagaatgtaa
     3661 ataaatgtgt cttctttatg gaccaaggat atgaaatcat ttttcttttg tagctaacgg
     3721 ttgccttgag gaagaaataa tttggtttta ttaagagtct actctcaatc cagttattag
     3781 agatgtactg agtttgattt gttaatcctt tctatatact gctgatcttg catgtctaca
     3841 atctgctcag tttttctgtg tttctgcaat agtggtcaga aaaatactta aattccctta
     3901 atggtgttgt tttctatttg ttctggtttt gagataaatg agtgattctg tccccaaatg
     3961 tccatttttg aagtgatttt cctggaggat tagggtattt agcagttgaa gctcttcatt
     4021 catagtagtt actgtcagct aacaggtttt ttaaggcttt taactattaa tattttatgg
     4081 aatggggcaa agtaaattga tgaaagaatt ggagtgataa tagtccttta caaacataca
     4141 gtccataaga aaatgaattt ggcatataga attattacaa tttcctggga gagatggata
     4201 tttaaacctc tattatttta gacaagactg tctagaactt aagtttgatc tgtcagccag
     4261 tactcccatt aaattcagtg tagtttcact tgatagaatc agatatgtta tcgaaatgtt
     4321 agcagcagct tcatcctcct tctgattaaa gtaagtagaa atgggatgtt ttgtttaata
     4381 acagccatag tgtgtgttta gaccacagcg gatgttgtag accaggacca tagatgatac
     4441 atgtcagtgc tgtggaatgt gcattctctg agtgttgttt tgtggtatca ttgtctttcc
     4501 tgaatgactt tctaactgtg cagaaaggca gaaaagtcat catatgtata tgtcatatga
     4561 ctttataaaa tatttaatgt gacaaaaagt ggaaagaatc tttacaaacc ctgcaattac
     4621 ttttttaaag gcacttttac tctttggttt tatcattcca ttttgctaat atttactagc
     4681 tttataaatt acagtaaggt acaaaaactc atcttgtaat attttcattt ttgaagtgaa
     4741 aaagtacata tattttgcac aaggttttat actgctaagt gcttggttgg ggtggtgaga
     4801 tgatgattag atcaggggtg aggctgagag actctgggtt tagggctagc cctgcctcca
     4861 tctcccttgg gtaaaatgaa gggtgtgggg taaaagatgc ataaggcctt ttctagctct
     4921 gacagcctag aagtccaatc accctgtaat aaatatgtgt tgaatgaaga aatgggtgaa
     4981 tgagcttgtc aatgtgattt taaaaaattg actacctgga ggaatgatta ggaatctaaa
     5041 tgaagccagc cctcggtatc tgcaggtttc tcatccatgg attcaaccaa ctgcaaatgg
     5101 aaaatacgat tttttttaaa aaaaggatgg ttacatccgt attgaacatg tacagacttt
     5161 tttcttgtca ttattctctg aacaatacaa gaactcttta tgtagcattt acatttatta
     5221 ggtattataa gtaatctaga gattatttaa ttaaaatata caggaggatg tgtgtcagtt
     5281 atatgcaaat tctgtaccat tttgtatcag ggaattgagc atcttcagat gttggtatct
     5341 gcagggatcc tggaaccaaa cccctgcaga tactaagggc tgacgatcta ggtaagactg
     5401 gatttaacag ttgg
//