LOCUS       AB012126                1324 bp    DNA     linear   PLN 14-DEC-2001
DEFINITION  Glycyrrhiza uralensis chloroplast DNA for
            ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit,
            partial cds.
ACCESSION   AB012126
VERSION     AB012126.1
KEYWORDS    .
SOURCE      chloroplast Glycyrrhiza uralensis
  ORGANISM  Glycyrrhiza uralensis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae;
            50 kb inversion clade; NPAAA clade; Hologalegina; IRL clade;
            Galegeae; Glycyrrhiza.
REFERENCE   1  (bases 1 to 1324)
  AUTHORS   Hayashi,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAR-1998) to the DDBJ/EMBL/GenBank databases.
            Contact:Hiroaki Hayashi
            Gifu Pharmaceutical University, Department of Pharmacognosy; 5-6-1
            Mitahora-higashi, Gifu, Gifu 502-8585, Japan
REFERENCE   2
  AUTHORS   Hayashi,H., Hosono,N., Kondo,M., Hiraoka,N., Ikeshiro,Y.,
            Shibano,M., Kusano,G., Yamamoto,H., Tanaka,T. and Inoue,K.
  TITLE     Phylogenetic relationship of six Glycyrrhiza species based on rbcL
            sequences and chemical constituents
  JOURNAL   Biol. Pharm. Bull. 23, 602-606 (2000)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..1324
                     /db_xref="taxon:74613"
                     /mol_type="genomic DNA"
                     /organelle="plastid:chloroplast"
                     /organism="Glycyrrhiza uralensis"
                     /tissue_type="leaf"
     CDS             <1..>1324
                     /codon_start=2
                     /gene="rbcL"
                     /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
                     large subunit"
                     /protein_id="BAA25365.1"
                     /transl_table=11
                     /translation="SVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEA
                     GAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDLFEEG
                     SVTNMFTSIVGNVFGFKALRALRLEDLRIPVSYIKTFQGPPHGIQVERDKLNKYGRPL
                     LGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYK
                     AQAETGEIKGHYLNATAGTCEEMIKRAVFARELGAPIVMHDYLTGGFTANTSLAHYCR
                     DNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGEREITL
                     GFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
                     FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNEVIRQACK"
BASE COUNT          358 a          245 c          323 g          398 t
ORIGIN      
        1 aagtgttggg ttcaaagctg gtgttaaaga ttataaattg acttattata ctcctgaata
       61 tgaaaccaag gatactgata tcttggcagc attccgagta actcctcaac caggagttcc
      121 gccggaagaa gcaggtgcag cggtagcagc cgaatcttcc actgggacat ggacaactgt
      181 gtggaccgat ggtcttacca gtcttgatcg ttataaagga cgatgctacg ggctagagcc
      241 cgttgctgga gaagaaaatc aatatattgc ttatgtagct tatcctttag acctttttga
      301 agaaggttct gttactaaca tgtttacctc cattgtaggt aatgtatttg gtttcaaggc
      361 cttgcgcgct ctacgtcttg aggatttgcg aattcctgtt tcttacatta aaactttcca
      421 aggtccgcct cacggaatcc aagttgaaag agataaattg aacaagtatg gccgccctct
      481 attgggatgt actattaaac ctaaattggg gttatctgct aagaattatg gtagagcagt
      541 ttatgaatgt cttcgcgggg gacttgattt taccaaagat gatgaaaatg tgaactccca
      601 accatttatg cgttggagag accgtttctt attttgtgcc gaagcaattt ataaagcaca
      661 ggccgaaact ggtgaaatca aagggcatta tttgaatgct accgcgggta cttgtgaaga
      721 aatgatcaaa agagcagtat ttgccagaga attgggcgct cctatcgtaa tgcatgacta
      781 cttaactgga ggtttcactg caaatactag cttggctcac tattgccgag ataatggtct
      841 acttcttcat atccaccgtg caatgcatgc ggttatcgat agacagaaaa atcatggtat
      901 gcactttcgt gtattagcta aagcgttacg tttgtctggt ggagatcata ttcacgctgg
      961 tactgtagta ggtaaacttg aaggggaaag ggaaattact ttaggttttg ttgatttact
     1021 acgtgatgat tttgttgaaa aagatagaag tcgcggtatt tatttcactc aggattgggt
     1081 ttctttacca ggtgttctgc ctgttgcttc agggggtatt cacgtttggc atatgcctgc
     1141 tctgaccgag atctttggag atgattctgt actccaattc ggtggcggaa ctttaggaca
     1201 cccttgggga aatgcaccag gtgccgtagc taatcgagta gctctcgaag catgtgtaca
     1261 agctcgaaat gagggacgtg atcttgctcg tgagggtaat gaagttatcc gtcaagcttg
     1321 caaa
//