LOCUS       A18052                  1287 bp    DNA     circular PAT 05-APR-1994
DEFINITION  chimaeric gene (coding sequence of the barnase gene) seq ID No:3.
ACCESSION   A18052
VERSION     A18052.1
KEYWORDS    .
SOURCE      synthetic construct
  ORGANISM  synthetic construct
            other sequences; artificial sequences.
REFERENCE   1  (bases 1 to 1287)
  AUTHORS   
  JOURNAL   Patent number WO9209696-A1/3, 11-JUN-1992.
FEATURES             Location/Qualifiers
     source          1..1287
                     /organism="synthetic construct"
                     /mol_type="unassigned DNA"
                     /db_xref="taxon:32630"
     regulatory      1..545
                     /note="promoter from the TA29 gene from Nicotiana tabacum
                     "
                     /regulatory_class="promoter"
     CDS             546..881
                     /transl_table=11
                     /gene="barnase gene"
                     /protein_id="CAA01374.1"
                     /translation="MVPVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLA
                     DVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTD
                     HYQTFTKIR"
     polyA_site      882..1287
                     /note="reulatory sequence containing the polyadenylation
                     site derived from the nopaline synthase gene from
                     Agrobacterium T-DNA"
BASE COUNT          415 a          249 c          246 g          373 t
ORIGIN      
        1 atctagctaa gtataactgg ataatttgca ttaacagatt gaatatagtg ccaaacaaga
       61 agggacaatt gacttgtcac tttatgaaag atgattcaaa catgattttt tatgtactaa
      121 tatatacatc ctactcgaat taaagcgaca taggctcgaa gtatgcacat ttagcaatgt
      181 aaattaaatc agtttttgaa tcaagctaaa agcagacttg cataaggtgg gtggctggac
      241 tagaataaac atcttctcta gcacagcttc ataatgtaat ttccataact gaaatcaggg
      301 tgagacaaaa ttttggtact ttttcctcac actaagtcca tgtttgcaac aaattaatac
      361 atgaaacctt aatgttaccc tcagattagc ctgctactcc ccattttcct cgaaatgctc
      421 caacaaaagt tagttttgca agttgttgtg tatgtcttgt gctctatata tgcccttgtg
      481 gtgcaagtgt aacagtacaa catcatcact caaatcaaag tttttactta aagaaattag
      541 ctaccatggt accggttatc aacacgtttg acggggttgc ggattatctt cagacatatc
      601 ataagctacc tgataattac attacaaaat cagaagcaca agccctcggc tgggtggcat
      661 caaaagggaa ccttgcagac gtcgctccgg ggaaaagcat cggcggagac atcttctcaa
      721 acagggaagg caaactcccg ggcaaaagcg gacgaacatg gcgtgaagcg gatattaact
      781 atacatcagg cttcagaaat tcagaccgga ttctttactc aagcgactgg ctgatttaca
      841 aaacaacgga ccattatcag acctttacaa aaatcagata acgaaaaaaa cggcttcctg
      901 cggaggccgt ttttttcagc tttacataaa gtgtgtaata aatttttctt caaactctga
      961 tcggtcaatt tcactttccg gnnnnctcta gaggatccga agcagatcgt tcaaacattt
     1021 ggcaataaag tttcttaaga ttgaatcctg ttgccggtct tgcgatgatt atcatataat
     1081 ttctgttgaa ttacgttaag catgtaataa ttaacatgta atgcatgacg ttatttatga
     1141 gatgggtttt tatgattaga gtcccgcaat tatacattta atacgcgata gaaaacaaaa
     1201 tatagcgcgc aaactaggat aaattatcgc gcgcggtgtc atctatgtta ctagatcggg
     1261 aagatccccg ggtaccgagc tcgaatt
//