LOCUS Z11878 984 bp DNA linear ENV 23-OCT-2008 DEFINITION Plasmid RP4 DNA between par region and IS8(21). ACCESSION Z11878 S99061 VERSION Z11878.1 KEYWORDS insertion sequence. SOURCE uncultured bacterium ORGANISM uncultured bacterium Bacteria; environmental samples. REFERENCE 2 (bases 1 to 249) AUTHORS Gerlitz M., Hrabak O., Schwab H. TITLE Partitioning of broad-host-range plasmid RP4 is a complex system involving site-specific recombination JOURNAL J. Bacteriol. 172(11), 6194-6203(1990). PUBMED 2172207 REFERENCE 3 (bases 962 to 984) AUTHORS Reimmann C., Moore R., Little S., Savioz A., Willetts N.S., Haas D. TITLE Genetic structure, function and regulation of the transposable element IS21 JOURNAL Mol. Gen. Genet. 215(3), 416-424(1989). PUBMED 2540414 REFERENCE 4 (bases 1 to 984) AUTHORS Schwab H. JOURNAL Submitted (31-MAR-1992) to the INSDC. Schwab H., Technische Universitaet Graz, Institut fuer Biotechnologie, AG Genetik, Petersgasse 12, Graz, Austria, A-8043 REFERENCE 5 AUTHORS Balzer D., Ziegelin G., Pansegrau W., Kruft V., Lanka E. TITLE KorB protein of promiscuous plasmid RP4 recognizes inverted sequence repetitions in regions essential for conjugative plasmid transfer JOURNAL Nucleic Acids Res. 20(8), 1851-1858(1992). PUBMED 1579485 FEATURES Location/Qualifiers source 1..984 /organism="uncultured bacterium" /plasmid="RP4" /environmental_sample /mol_type="genomic DNA" /db_xref="taxon:77133" CDS 123..434 /transl_table=11 /gene="ORF6" /product="putative polypeptide" /function="unknown" /note="ttg start" /db_xref="InterPro:IPR007712" /db_xref="InterPro:IPR035093" /db_xref="UniProtKB/TrEMBL:Q52338" /citation=[5] /protein_id="CAA77937.1" /translation="MTAYILTAEAEADLRGIIRYTRREWGAAQVRRYIAKLEQGIARL AAGEGPFKDMSELFPALRMARCEHHYVFCLPRAGEPALVVAILHERMDLMTRLADRLK G" repeat_region 435..448 /rpt_type=INVERTED /note="KorB operator" regulatory 499..503 /regulatory_class="ribosome_binding_site" CDS 512..976 /partial /transl_table=11 /gene="ORF7" /product="putative polypeptide" /function="unknown" /note="ORF7 is interrupted by IS8 and continues downstream of the insertion element (towards aphA). The fusion junction between ORF7 and IS8 is at position 961" /db_xref="UniProtKB/TrEMBL:Q52339" /citation=[3] /citation=[5] /protein_id="CAA77938.1" /translation="MLSTLPQAHATFLNRIRDAVASDVRFRALLIGGSYVHGGLDEHS DLDFDIVVEDNCYADVLSTRKDFAEALPGFLNAFTGEHVGEPRLLICLYGPPLLHIDL KFSLASDLDQQIERRAVLFARDPAEIEKRIEAAAVAWPNRPSEWFEARCQRQ" mobile_element 962..984 /mobile_element_type="insertion sequence:IS8(21)" BASE COUNT 205 a 290 c 281 g 208 t ORIGIN 1 gatcaggcat ggcaggaact gaaaaccatg ctggggaacc gcatcaacga tgggcttgcc 61 ggcaaggtgt ccaccaagag cgtcggcgaa attcttgatg aagaactcag cggggatcgc 121 gcttgacggc ctacatcctc acggctgagg ccgaagccga tctacgcggc atcatccgct 181 acacgcgccg ggagtggggc gcggcgcagg tgcgccgcta tatcgctaag ctggaacagg 241 gcatagccag gcttgccgcc ggcgaaggcc cgtttaagga catgagcgaa ctctttcccg 301 cgctgcggat ggcccgctgc gaacaccact acgttttttg cctgccgcgt gcgggcgaac 361 ccgcgttggt cgtggcgatc ctgcatgagc gcatggacct catgacgcga cttgccgaca 421 ggctcaaggg ctgatttcag ccgctaaaaa tcgcgccact cacaacgtcc tgatggcgta 481 cttacccaaa gaacagctag gagaatcatt tatgctcagc acacttccac aagctcatgc 541 aactttcttg aaccgcatcc gcgatgcggt cgcttccgat gttcgcttcc gcgctcttct 601 gatcggcggc tcttacgttc acggaggact cgatgagcac tccgatttgg atttcgacat 661 cgttgttgag gacaactgct acgcagatgt cttgtctaca cgcaaggatt ttgccgaggc 721 actgcccggc ttcctcaacg cgttcaccgg cgaacatgta ggagaaccgc gccttctgat 781 ctgcctatat ggtccgccac tgctacacat cgatttgaag ttttctcttg cttccgatct 841 cgaccagcaa atcgagcggc gggcggttct gtttgctcgt gatccggcag agatcgagaa 901 gcgcattgag gcggcagcgg tggcatggcc aaaccgtccc tccgagtggt tcgaagcacg 961 ttgtcagcgc cagtgatata agac //