LOCUS       Z11878                   984 bp    DNA     linear   ENV 23-OCT-2008
DEFINITION  Plasmid RP4 DNA between par region and IS8(21).
ACCESSION   Z11878 S99061
VERSION     Z11878.1
KEYWORDS    insertion sequence.
SOURCE      uncultured bacterium
  ORGANISM  uncultured bacterium
            Bacteria; environmental samples.
REFERENCE   2  (bases 1 to 249)
  AUTHORS   Gerlitz M., Hrabak O., Schwab H.
  TITLE     Partitioning of broad-host-range plasmid RP4 is a complex system
            involving site-specific recombination
  JOURNAL   J. Bacteriol. 172(11), 6194-6203(1990).
   PUBMED   2172207
REFERENCE   3  (bases 962 to 984)
  AUTHORS   Reimmann C., Moore R., Little S., Savioz A., Willetts N.S., Haas D.
  TITLE     Genetic structure, function and regulation of the transposable
            element IS21
  JOURNAL   Mol. Gen. Genet. 215(3), 416-424(1989).
   PUBMED   2540414
REFERENCE   4  (bases 1 to 984)
  AUTHORS   Schwab H.
  JOURNAL   Submitted (31-MAR-1992) to the INSDC. Schwab H., Technische
            Universitaet Graz, Institut fuer Biotechnologie, AG Genetik,
            Petersgasse 12, Graz, Austria, A-8043
REFERENCE   5
  AUTHORS   Balzer D., Ziegelin G., Pansegrau W., Kruft V., Lanka E.
  TITLE     KorB protein of promiscuous plasmid RP4 recognizes inverted
            sequence repetitions in regions essential for conjugative plasmid
            transfer
  JOURNAL   Nucleic Acids Res. 20(8), 1851-1858(1992).
   PUBMED   1579485
FEATURES             Location/Qualifiers
     source          1..984
                     /organism="uncultured bacterium"
                     /plasmid="RP4"
                     /environmental_sample
                     /mol_type="genomic DNA"
                     /db_xref="taxon:77133"
     CDS             123..434
                     /transl_table=11
                     /gene="ORF6"
                     /product="putative polypeptide"
                     /function="unknown"
                     /note="ttg start"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="InterPro:IPR035093"
                     /db_xref="UniProtKB/TrEMBL:Q52338"
                     /citation=[5]
                     /protein_id="CAA77937.1"
                     /translation="MTAYILTAEAEADLRGIIRYTRREWGAAQVRRYIAKLEQGIARL
                     AAGEGPFKDMSELFPALRMARCEHHYVFCLPRAGEPALVVAILHERMDLMTRLADRLK
                     G"
     repeat_region   435..448
                     /rpt_type=INVERTED
                     /note="KorB operator"
     regulatory      499..503
                     /regulatory_class="ribosome_binding_site"
     CDS             512..976
                     /partial
                     /transl_table=11
                     /gene="ORF7"
                     /product="putative polypeptide"
                     /function="unknown"
                     /note="ORF7 is interrupted by IS8 and continues downstream
                     of the insertion element (towards aphA). The fusion
                     junction between ORF7 and IS8 is at position 961"
                     /db_xref="UniProtKB/TrEMBL:Q52339"
                     /citation=[3]
                     /citation=[5]
                     /protein_id="CAA77938.1"
                     /translation="MLSTLPQAHATFLNRIRDAVASDVRFRALLIGGSYVHGGLDEHS
                     DLDFDIVVEDNCYADVLSTRKDFAEALPGFLNAFTGEHVGEPRLLICLYGPPLLHIDL
                     KFSLASDLDQQIERRAVLFARDPAEIEKRIEAAAVAWPNRPSEWFEARCQRQ"
     mobile_element  962..984
                     /mobile_element_type="insertion sequence:IS8(21)"
BASE COUNT          205 a          290 c          281 g          208 t
ORIGIN      
        1 gatcaggcat ggcaggaact gaaaaccatg ctggggaacc gcatcaacga tgggcttgcc
       61 ggcaaggtgt ccaccaagag cgtcggcgaa attcttgatg aagaactcag cggggatcgc
      121 gcttgacggc ctacatcctc acggctgagg ccgaagccga tctacgcggc atcatccgct
      181 acacgcgccg ggagtggggc gcggcgcagg tgcgccgcta tatcgctaag ctggaacagg
      241 gcatagccag gcttgccgcc ggcgaaggcc cgtttaagga catgagcgaa ctctttcccg
      301 cgctgcggat ggcccgctgc gaacaccact acgttttttg cctgccgcgt gcgggcgaac
      361 ccgcgttggt cgtggcgatc ctgcatgagc gcatggacct catgacgcga cttgccgaca
      421 ggctcaaggg ctgatttcag ccgctaaaaa tcgcgccact cacaacgtcc tgatggcgta
      481 cttacccaaa gaacagctag gagaatcatt tatgctcagc acacttccac aagctcatgc
      541 aactttcttg aaccgcatcc gcgatgcggt cgcttccgat gttcgcttcc gcgctcttct
      601 gatcggcggc tcttacgttc acggaggact cgatgagcac tccgatttgg atttcgacat
      661 cgttgttgag gacaactgct acgcagatgt cttgtctaca cgcaaggatt ttgccgaggc
      721 actgcccggc ttcctcaacg cgttcaccgg cgaacatgta ggagaaccgc gccttctgat
      781 ctgcctatat ggtccgccac tgctacacat cgatttgaag ttttctcttg cttccgatct
      841 cgaccagcaa atcgagcggc gggcggttct gtttgctcgt gatccggcag agatcgagaa
      901 gcgcattgag gcggcagcgg tggcatggcc aaaccgtccc tccgagtggt tcgaagcacg
      961 ttgtcagcgc cagtgatata agac
//