LOCUS ALU86091 402 bp DNA linear INV 30-JAN-2001 DEFINITION Ascaris lumbricoides ABA-1 allergen (aba-1r1) gene, partial cds. ACCESSION U86091 VERSION U86091.1 KEYWORDS . SOURCE Ascaris lumbricoides (common roundworm) ORGANISM Ascaris lumbricoides Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Spirurina; Ascaridomorpha; Ascaridoidea; Ascarididae; Ascaris. REFERENCE 1 (bases 1 to 402) AUTHORS McSharry,C., Xia,Y., Holland,C.V. and Kennedy,M.W. TITLE Natural immunity to Ascaris lumbricoides associated with immunoglobulin E antibody to ABA-1 allergen and inflammation indicators in children JOURNAL Infect. Immun. 67 (2), 484-489 (1999) PUBMED 9916049 REFERENCE 2 (bases 1 to 402) AUTHORS Xia,Y., Spence,H.J., Moore,J., Heaney,N., McDermott,L., Cooper,A., Watson,D.G., Mei,B., Komuniecki,R. and Kennedy,M.W. TITLE The ABA-1 allergen of Ascaris lumbricoides: sequence polymorphism, stage and tissue-specific expression, lipid binding function, and protein biophysical properties JOURNAL Parasitology 120 (Pt 2), 211-224 (2000) PUBMED 10726282 REFERENCE 3 (bases 1 to 402) AUTHORS Xia,Y., Kennedy,M.W., Spence,H.J. and Moore,J. TITLE Direct Submission JOURNAL Submitted (21-JAN-1997) Pathology, School of Medicine, 511 S. Floyd Street, Louisville, KY 40202, USA FEATURES Location/Qualifiers source 1..402 /organism="Ascaris lumbricoides" /mol_type="genomic DNA" /db_xref="taxon:6252" gene 1..402 /gene="aba-1r1" CDS <1..>402 /gene="aba-1r1" /note="one peptide repeat unit of ABA-1; nematode polyprotein allergen" /codon_start=1 /product="ABA-1 allergen" /protein_id="AAD13644.1" /translation="HHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKDLQAKILYY YDELEGDAKKEATEHLKDGCREILKHVVGEEKEAELKKLKDSGASKEEVKAKVEEALH AVTDEEKKQYIADFGPACKKIFAAAHTSRRRR" BASE COUNT 153 a 71 c 102 g 76 t ORIGIN 1 catcatttca cccttgaaag tagtctagat acccatctga aatggctcag tcaagaacag 61 aaagatgaat tgttgaaaat gaagaaagat ggaaagacaa agaaagatct tcaagctaaa 121 attctttatt actatgacga actcgaagga gatgctaaaa aggaggcaac tgagcatttg 181 aaggacggat gccgcgaaat tcttaagcat gttgttgggg aagagaagga agcagagctg 241 aagaaactca aagactcggg agcaagcaaa gaggaagtca aagccaaagt cgaagaggca 301 cttcatgcag taaccgacga ggagaagaag caatatatcg ccgatttcgg accagcatgc 361 aagaaaatct ttgctgcagc acatacttcg cgacgaagga gg //