LOCUS MZ031103 421 bp DNA linear BCT 25-AUG-2021 DEFINITION Corynebacterium parakroppenstedtii strain MC-26 DNA-directed RNA polymerase subunit beta (rpoB) gene, partial cds. ACCESSION MZ031103 VERSION MZ031103.1 KEYWORDS . SOURCE Corynebacterium parakroppenstedtii ORGANISM Corynebacterium parakroppenstedtii Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae; Corynebacterium. REFERENCE 1 (bases 1 to 421) AUTHORS Luo,Q., Chen,Q. and Qu,P. TITLE Identification and characterization of Corynebacterium sp. JOURNAL Unpublished REFERENCE 2 (bases 1 to 421) AUTHORS Luo,Q., Chen,Q. and Qu,P. TITLE Direct Submission JOURNAL Submitted (23-APR-2021) Laboratory Medicine, The Second Clinical College, Guangzhou University of Chinese Medicine, 55 Inner Ring West Road, Guangzhou University Town, Guangzhou, Guangdong 510006, China COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..421 /organism="Corynebacterium parakroppenstedtii" /mol_type="genomic DNA" /strain="MC-26" /isolation_source="human breast specimen" /type_material="type strain of Corynebacterium parakroppenstedtii" /db_xref="taxon:2828363" /country="China" /lat_lon="23.06 N 113.15 E" /collection_date="2019" /collected_by="Qiang Luo" gene <1..>421 /gene="rpoB" CDS <1..>421 /gene="rpoB" /note="RpoB" /codon_start=3 /transl_table=11 /product="DNA-directed RNA polymerase subunit beta" /protein_id="QYL02869.1" /translation="VLEVHLGMLAKSGWKVDPESQDPAVKAMLETLPEDLYDVPADSR VATPVFDGTTNEELSGLMRSSRPNRDGDQMVNEFGKSTLIDGRTGEPFQQPISVGYMY MLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQR" BASE COUNT 85 a 141 c 127 g 68 t ORIGIN 1 aggtgctgga agttcacctc ggtatgctgg cgaaatccgg gtggaaggtt gacccggagt 61 cacaggaccc ggcggtcaag gccatgctgg aaacgctgcc cgaggacctc tacgacgtcc 121 ccgccgattc ccgcgttgcc accccggtgt tcgacggcac gaccaacgaa gagctgtccg 181 gactgatgcg ttcctcgcgg cctaaccgcg acggcgacca aatggtcaac gaattcggca 241 aatccaccct gatcgacggc cggacgggcg agcccttcca gcagccgatc tccgtgggct 301 acatgtacat gctgaagctg caccacctgg tcgacgagaa gatccacgcc cggtccaccg 361 gcccgtactc catgatcacc cagcagccgc tcggtggtaa ggcacagttc ggtggtcagc 421 g //