LOCUS       MZ031103                 421 bp    DNA     linear   BCT 25-AUG-2021
DEFINITION  Corynebacterium parakroppenstedtii strain MC-26 DNA-directed RNA
            polymerase subunit beta (rpoB) gene, partial cds.
ACCESSION   MZ031103
VERSION     MZ031103.1
KEYWORDS    .
SOURCE      Corynebacterium parakroppenstedtii
  ORGANISM  Corynebacterium parakroppenstedtii
            Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae;
            Corynebacterium.
REFERENCE   1  (bases 1 to 421)
  AUTHORS   Luo,Q., Chen,Q. and Qu,P.
  TITLE     Identification and characterization of Corynebacterium sp.
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 421)
  AUTHORS   Luo,Q., Chen,Q. and Qu,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-APR-2021) Laboratory Medicine, The Second Clinical
            College, Guangzhou University of Chinese Medicine, 55 Inner Ring
            West Road, Guangzhou University Town, Guangzhou, Guangdong 510006,
            China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..421
                     /organism="Corynebacterium parakroppenstedtii"
                     /mol_type="genomic DNA"
                     /strain="MC-26"
                     /isolation_source="human breast specimen"
                     /type_material="type strain of Corynebacterium
                     parakroppenstedtii"
                     /db_xref="taxon:2828363"
                     /country="China"
                     /lat_lon="23.06 N 113.15 E"
                     /collection_date="2019"
                     /collected_by="Qiang Luo"
     gene            <1..>421
                     /gene="rpoB"
     CDS             <1..>421
                     /gene="rpoB"
                     /note="RpoB"
                     /codon_start=3
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="QYL02869.1"
                     /translation="VLEVHLGMLAKSGWKVDPESQDPAVKAMLETLPEDLYDVPADSR
                     VATPVFDGTTNEELSGLMRSSRPNRDGDQMVNEFGKSTLIDGRTGEPFQQPISVGYMY
                     MLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQR"
BASE COUNT           85 a          141 c          127 g           68 t
ORIGIN      
        1 aggtgctgga agttcacctc ggtatgctgg cgaaatccgg gtggaaggtt gacccggagt
       61 cacaggaccc ggcggtcaag gccatgctgg aaacgctgcc cgaggacctc tacgacgtcc
      121 ccgccgattc ccgcgttgcc accccggtgt tcgacggcac gaccaacgaa gagctgtccg
      181 gactgatgcg ttcctcgcgg cctaaccgcg acggcgacca aatggtcaac gaattcggca
      241 aatccaccct gatcgacggc cggacgggcg agcccttcca gcagccgatc tccgtgggct
      301 acatgtacat gctgaagctg caccacctgg tcgacgagaa gatccacgcc cggtccaccg
      361 gcccgtactc catgatcacc cagcagccgc tcggtggtaa ggcacagttc ggtggtcagc
      421 g
//