LOCUS       HM031388                 265 bp    DNA     linear   MAM 07-SEP-2012
DEFINITION  Bos indicus MHC class II antigen DR beta chain (BoLA-DRB3) gene,
            BoLA-DRB3*5702 allele, exon 2 and partial cds.
ACCESSION   HM031388
VERSION     HM031388.1
KEYWORDS    .
SOURCE      Bos indicus (Bos taurus indicus)
  ORGANISM  Bos indicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bos.
REFERENCE   1  (bases 1 to 265)
  AUTHORS   Das,D.N., Sri Hari,V.G., Hatkar,D.N., Rengarajan,K., Saravanan,R.,
            Suryanarayana,V.V. and Murthy,L.K.
  TITLE     Genetic diversity and population genetic analysis of bovine MHC
            class II DRB3.2 locus in three Bos indicus cattle breeds of
            Southern India
  JOURNAL   Int. J. Immunogenet. (2012) In press
   PUBMED   22607523
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 265)
  AUTHORS   Das,D.N., Srihari,V.G., Saravanan,R., Krishnamurthy,L. and
            Hatkar,D.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAR-2010) Genetics Lab, AB & AI Section, National
            Dairy Research Institute, Southern Campus, Adugodi, Bangalore,
            Karnataka 560 030, India
FEATURES             Location/Qualifiers
     source          1..265
                     /organism="Bos indicus"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9915"
                     /chromosome="23"
                     /map="23q21"
                     /cell_type="WBC"
                     /tissue_type="blood"
                     /country="India: Karnataka"
                     /note="breed: Malnad Gidda"
     gene            <1..>265
                     /gene="BoLA-DRB3"
                     /allele="BoLA-DRB3*5702"
     mRNA            <1..>265
                     /gene="BoLA-DRB3"
                     /allele="BoLA-DRB3*5702"
                     /product="MHC class II antigen DR beta chain"
     CDS             <1..>265
                     /gene="BoLA-DRB3"
                     /allele="BoLA-DRB3*5702"
                     /codon_start=3
                     /product="MHC class II antigen DR beta chain"
                     /protein_id="ADG63454.1"
                     /translation="HFLEYHKSECHFFNGTERLRYLDRYFYNGEEYVRFDSDWGEYRA
                     VTELGRPDAKYWNSQKEILERRRAEVDTVCRHNYGVGESFTVQR"
     exon            <1..>265
                     /gene="BoLA-DRB3"
                     /allele="BoLA-DRB3*5702"
                     /number=2
BASE COUNT           61 a           60 c           95 g           49 t
ORIGIN      
        1 cacatttcct ggagtatcat aagagtgagt gtcatttctt caacgggacc gagcgtttgc
       61 ggtacctgga cagatacttc tataatggag aagagtacgt gcgcttcgac agcgactggg
      121 gcgagtaccg ggcggtgacc gagctggggc ggccggacgc caagtactgg aacagccaga
      181 aggagatcct ggagcggagg cgggccgagg tggacacggt gtgcagacac aactacgggg
      241 tcggtgagag tttcactgtg cagcg
//