LOCUS HM031388 265 bp DNA linear MAM 07-SEP-2012 DEFINITION Bos indicus MHC class II antigen DR beta chain (BoLA-DRB3) gene, BoLA-DRB3*5702 allele, exon 2 and partial cds. ACCESSION HM031388 VERSION HM031388.1 KEYWORDS . SOURCE Bos indicus (Bos taurus indicus) ORGANISM Bos indicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos. REFERENCE 1 (bases 1 to 265) AUTHORS Das,D.N., Sri Hari,V.G., Hatkar,D.N., Rengarajan,K., Saravanan,R., Suryanarayana,V.V. and Murthy,L.K. TITLE Genetic diversity and population genetic analysis of bovine MHC class II DRB3.2 locus in three Bos indicus cattle breeds of Southern India JOURNAL Int. J. Immunogenet. (2012) In press PUBMED 22607523 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 265) AUTHORS Das,D.N., Srihari,V.G., Saravanan,R., Krishnamurthy,L. and Hatkar,D.N. TITLE Direct Submission JOURNAL Submitted (24-MAR-2010) Genetics Lab, AB & AI Section, National Dairy Research Institute, Southern Campus, Adugodi, Bangalore, Karnataka 560 030, India FEATURES Location/Qualifiers source 1..265 /organism="Bos indicus" /mol_type="genomic DNA" /db_xref="taxon:9915" /chromosome="23" /map="23q21" /cell_type="WBC" /tissue_type="blood" /country="India: Karnataka" /note="breed: Malnad Gidda" gene <1..>265 /gene="BoLA-DRB3" /allele="BoLA-DRB3*5702" mRNA <1..>265 /gene="BoLA-DRB3" /allele="BoLA-DRB3*5702" /product="MHC class II antigen DR beta chain" CDS <1..>265 /gene="BoLA-DRB3" /allele="BoLA-DRB3*5702" /codon_start=3 /product="MHC class II antigen DR beta chain" /protein_id="ADG63454.1" /translation="HFLEYHKSECHFFNGTERLRYLDRYFYNGEEYVRFDSDWGEYRA VTELGRPDAKYWNSQKEILERRRAEVDTVCRHNYGVGESFTVQR" exon <1..>265 /gene="BoLA-DRB3" /allele="BoLA-DRB3*5702" /number=2 BASE COUNT 61 a 60 c 95 g 49 t ORIGIN 1 cacatttcct ggagtatcat aagagtgagt gtcatttctt caacgggacc gagcgtttgc 61 ggtacctgga cagatacttc tataatggag aagagtacgt gcgcttcgac agcgactggg 121 gcgagtaccg ggcggtgacc gagctggggc ggccggacgc caagtactgg aacagccaga 181 aggagatcct ggagcggagg cgggccgagg tggacacggt gtgcagacac aactacgggg 241 tcggtgagag tttcactgtg cagcg //