LOCUS       GU388312                 228 bp    DNA     linear   MAM 25-JUL-2016
DEFINITION  Procyon lotor MHC class II antigen (Prlo-DRB) gene, Prlo-DRB*01
            allele, exon 2 and partial cds.
ACCESSION   GU388312
VERSION     GU388312.1
KEYWORDS    .
SOURCE      Procyon lotor (raccoon)
  ORGANISM  Procyon lotor
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia;
            Musteloidea; Procyonidae; Procyon.
REFERENCE   1  (bases 1 to 228)
  AUTHORS   Castillo,S., Srithayakumar,V., Meunier,V. and Kyle,C.J.
  TITLE     Characterization of major histocompatibility complex (MHC) DRB exon
            2 and DRA exon 3 fragments in a primary terrestrial rabies vector
            (Procyon lotor)
  JOURNAL   PLoS ONE 5 (8), E12066 (2010)
   PUBMED   20706587
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 228)
  AUTHORS   Castillo,S., Srithayakumar,V., Meunier,V. and Kyle,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JAN-2010) Environmental and Life Sciences, Trent
            University, 1600 West Bank Drive, Peterborough, ON K9J 7B8, Canada
FEATURES             Location/Qualifiers
     source          1..228
                     /organism="Procyon lotor"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9654"
     gene            <1..>228
                     /gene="Prlo-DRB"
                     /allele="Prlo-DRB*01"
     mRNA            <1..>228
                     /gene="Prlo-DRB"
                     /allele="Prlo-DRB*01"
                     /product="MHC class II antigen"
     CDS             <1..>228
                     /gene="Prlo-DRB"
                     /allele="Prlo-DRB*01"
                     /codon_start=3
                     /product="MHC class II antigen"
                     /protein_id="ADJ57705.1"
                     /translation="NGTERVQLLVRNIYNGQEDVRYDSDVGEHRAVTELGRPDAQYWN
                     SQKDLMERRRAEVDTVCRHNYGVVESFTVQR"
     exon            <1..>228
                     /gene="Prlo-DRB"
                     /allele="Prlo-DRB*01"
                     /number=2
BASE COUNT           51 a           54 c           91 g           32 t
ORIGIN      
        1 tcaatgggac ggagcgggtg cagctcctgg tcagaaacat ctataacggg caggaggacg
       61 tgcgctacga cagcgacgtg ggggagcacc gggctgtgac ggagctgggg cggcccgacg
      121 ctcagtactg gaacagccag aaggacctca tggagcggag gcgggccgag gtggacacgg
      181 tgtgcagaca caactacggg gtggttgaga gtttcactgt gcagcgga
//