LOCUS GU388312 228 bp DNA linear MAM 25-JUL-2016 DEFINITION Procyon lotor MHC class II antigen (Prlo-DRB) gene, Prlo-DRB*01 allele, exon 2 and partial cds. ACCESSION GU388312 VERSION GU388312.1 KEYWORDS . SOURCE Procyon lotor (raccoon) ORGANISM Procyon lotor Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Musteloidea; Procyonidae; Procyon. REFERENCE 1 (bases 1 to 228) AUTHORS Castillo,S., Srithayakumar,V., Meunier,V. and Kyle,C.J. TITLE Characterization of major histocompatibility complex (MHC) DRB exon 2 and DRA exon 3 fragments in a primary terrestrial rabies vector (Procyon lotor) JOURNAL PLoS ONE 5 (8), E12066 (2010) PUBMED 20706587 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 228) AUTHORS Castillo,S., Srithayakumar,V., Meunier,V. and Kyle,C.J. TITLE Direct Submission JOURNAL Submitted (05-JAN-2010) Environmental and Life Sciences, Trent University, 1600 West Bank Drive, Peterborough, ON K9J 7B8, Canada FEATURES Location/Qualifiers source 1..228 /organism="Procyon lotor" /mol_type="genomic DNA" /db_xref="taxon:9654" gene <1..>228 /gene="Prlo-DRB" /allele="Prlo-DRB*01" mRNA <1..>228 /gene="Prlo-DRB" /allele="Prlo-DRB*01" /product="MHC class II antigen" CDS <1..>228 /gene="Prlo-DRB" /allele="Prlo-DRB*01" /codon_start=3 /product="MHC class II antigen" /protein_id="ADJ57705.1" /translation="NGTERVQLLVRNIYNGQEDVRYDSDVGEHRAVTELGRPDAQYWN SQKDLMERRRAEVDTVCRHNYGVVESFTVQR" exon <1..>228 /gene="Prlo-DRB" /allele="Prlo-DRB*01" /number=2 BASE COUNT 51 a 54 c 91 g 32 t ORIGIN 1 tcaatgggac ggagcgggtg cagctcctgg tcagaaacat ctataacggg caggaggacg 61 tgcgctacga cagcgacgtg ggggagcacc gggctgtgac ggagctgggg cggcccgacg 121 ctcagtactg gaacagccag aaggacctca tggagcggag gcgggccgag gtggacacgg 181 tgtgcagaca caactacggg gtggttgaga gtttcactgt gcagcgga //