LOCUS       CP059399             8339910 bp    DNA     circular BCT 27-JUL-2020
DEFINITION  Nocardia huaxiensis strain WCH-YHL-001 chromosome, complete genome.
ACCESSION   CP059399
VERSION     CP059399.1
DBLINK      BioProject: PRJNA646810
            BioSample: SAMN15566273
KEYWORDS    .
SOURCE      Nocardia huaxiensis
  ORGANISM  Nocardia huaxiensis
            Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae;
            Nocardia.
REFERENCE   1  (bases 1 to 8339910)
  AUTHORS   Zhuang,K. and Ran,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2020) Dermatovenereology, West China Hospital,
            Sichuan University, Guoxue Xiang, Wuhou District, Chengdu, Sichuan
            610041, China
COMMENT     The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: FALCON v. AUGUST-2019
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 250.0x
            Sequencing Technology  :: PacBio Sequel
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 07/22/2020 23:23:33
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.12
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 7,641
            CDSs (total)                      :: 7,551
            Genes (coding)                    :: 7,450
            CDSs (with protein)               :: 7,450
            Genes (RNA)                       :: 90
            rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                             :: 75
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 101
            CDSs (without protein)            :: 101
            Pseudo Genes (ambiguous residues) :: 0 of 101
            Pseudo Genes (frameshifted)       :: 23 of 101
            Pseudo Genes (incomplete)         :: 76 of 101
            Pseudo Genes (internal stop)      :: 7 of 101
            Pseudo Genes (multiple problems)  :: 5 of 101
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..8339910
                     /organism="Nocardia huaxiensis"
                     /mol_type="genomic DNA"
                     /strain="WCH-YHL-001"
                     /isolation_source="skin sample from patient"
                     /host="Homo sapiens"
                     /type_material="type strain of Nocardia huaxiensis"
                     /db_xref="taxon:2755382"
                     /country="China: Chengdu"
                     /collection_date="2013"
                     /collected_by="Kaiwen Zhuang"
     gene            70..822
                     /locus_tag="H0264_00005"
     CDS             70..822
                     /locus_tag="H0264_00005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020546322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic polysaccharide monooxygenase"
                     /protein_id="QLY34976.1"
                     /translation="MPGDARAHGYVDSPASRQAQCAQGLVACGEIKYEPQSVEGPKGL
                     RSCSGGVGRFAELDDDSKGWRVQNVGRTVTFSWKFTAQHRTQNWEYYIGGTRVGMVEG
                     NNQPPSQSASHTIDLGGFTGRQKLLAIWNIGDTANAFYSCLDLNISGDGGPTTPPATT
                     TNPPTTNPPATTTHQHTTTPPTTEPPVTTTPPPVTTTTRPAPAGEWKVQAQYAIGDVV
                     TYQGSRYRCRQAHTVHDPNWTPPATPALWERL"
     gene            complement(830..1783)
                     /locus_tag="H0264_00010"
     CDS             complement(830..1783)
                     /locus_tag="H0264_00010"
                     /inference="COORDINATES: protein motif:HMM:NF013810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="QLY30850.1"
                     /translation="MLLRRIKTLLLAGLSGALAVTVAVPGTAAADGLPVVYGMGPFVN
                     AILTATAPYDPPGGNDWTCRPGPERPLPVVLVTGLSGNGENSWQTISPLLKNEGYCVF
                     ALTYGTYPGDSGWWAGVGGRTPIMDSSAELARYVDQVLAVTGAPKVKLLTWSAGAVVG
                     AAYIQFLGGDRTVDAQVSLAPMWKGTQVAQSTTNSANSLGIYNSVYAAMNPPCGACVD
                     VLTGSAFIDRLTASGVYSDEVRYYSVLTEVDGQVVPFTNGWVDAPNATNVVLQHGCPQ
                     NLTGHLMLSSDPRSVNLAVQGLDPDQPRSIPCAPNSGPAGI"
     gene            complement(2501..3727)
                     /locus_tag="H0264_00015"
                     /pseudo
     CDS             complement(2501..3727)
                     /locus_tag="H0264_00015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988873.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="YibE/F family protein"
     gene            complement(4189..5448)
                     /locus_tag="H0264_00020"
     CDS             complement(4189..5448)
                     /locus_tag="H0264_00020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011211961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate-dependent aminotransferase"
                     /protein_id="QLY34008.1"
                     /translation="MGRVSPSSHLPHRPPRTLEQSTKLQNVLYEIRGPVHAHAARLES
                     EGHRILKLNIGNPAPFGFEAPDVIMRDMIAALPYAQGYSESKGILPARRSIVTRYELV
                     PGFPQFDVDDVYLGNGVSELITITMQALLDNGDEVLIPAPDYPLWTAMTSLAGGTPVH
                     YLCDESNGWQPDIADMESKITDKTKAIVVINPNNPTGAVYSAEVLQQVVDLARKHQLL
                     LLADEIYDKILYDDAKHVSLATLAPDLLCLTFNGLSKAYRVAGYRSGWLVITGPKDHA
                     EGFIEGIDLLASTRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWEKLNT
                     IPGVSCVKPKGALYAFPRLDPEVHEIHDDSKLVLDLLLQEKILMVQGTGFNWPHHDHL
                     RIVTLPWARDLSVAIERFGNFLSSYRQ"
     gene            complement(5511..6887)
                     /locus_tag="H0264_00025"
     CDS             complement(5511..6887)
                     /locus_tag="H0264_00025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="QLY30851.1"
                     /translation="MSIREFAAHLGVHERLVSKWEAGGIRVHPRPINQAALDTSLARS
                     DDVVRARFAALIDQPLIDRPAVPGFDVHHNGAFQGKTFERQDRPVQASYSSDAELLAL
                     VDTGAMRGDALAAISERDLIMAAAHEASEHAGRAESTNVGATTLEQLDADVMRIANDY
                     VHVPPVPMMVEMLRVRRRVYRLLEGHQRPADTSHLYLLAGTLSGLLANASTDLGYFDA
                     AGEQGRAAWAYAELCGHNGLRAWTRGMQALIEYWSERPRRAVLLAQSGQQYAESATAR
                     VRLLNIEARIWSRLGSTQDTERCIRAADEARSGDVSDTLHDEVGGVFGFKEPKSQYYA
                     GATYIHLGQAEPALEATTRAIDLYANGPTEQRSYGAEALARVDSAAAHLINGSLDGAA
                     EALQPVLQLDEDKRIAQLEERLTGLRQRLTGPEFRDAAEGRHLDERIEEFCGATAAKS
                     LLPPDTAR"
     gene            7176..7625
                     /locus_tag="H0264_00030"
     CDS             7176..7625
                     /locus_tag="H0264_00030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34009.1"
                     /translation="MNADKLRTVEDWVSFYRHEFGLPVAERGGFVMLPVTGQIGVVHL
                     PVARAEKVRDAMQHQQTPAPALARQIRWSFLVDPDSRPGDQIMEELNRLDIGIPAIGS
                     AVMLPTGLGRWTREGCYWVVPPTRDLKLPPLSSLITTALAVGIESEG"
     gene            complement(7919..9271)
                     /locus_tag="H0264_00035"
     CDS             complement(7919..9271)
                     /locus_tag="H0264_00035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011211959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp70 family protein"
                     /protein_id="QLY30852.1"
                     /translation="MSSVLGVSVGAGAVRVARPHAGNSAEPRPAGFHTAPDAFDVQGI
                     PVEERRAEELVADAIGAVLAADPQIAATAIAYRDEQHARGIRAELARRQFTNYELVPD
                     VIAALEFLENAGELQGFGTVALYDLGASGLSVTVVDTGSRQICASERTSDISGDYLDS
                     LIREQQIASGRIAHPADPAGLAALDALCRTAKEQLSTSSAVALPSPEGLVLLSQENFE
                     ALIMLAVESSARMTRDVILRSEQPVQAVALIGGCAQIPLVARVLRRWLGVPVIVAAAP
                     DTVAARGAVMLARPAHQRPAPAPFPSTFHDDHPAQVRPDPEPAWLGNHSDPDKPNRRR
                     EISVAGVAVGALVVVAAIGTTLGWGPQVLEHDSQSKDVATTTAVPTTTSAAPAPTTEA
                     PTTTDPTNDALAVPQPRYQTTTTEAPPTQGPNTITVIPGLPPIVVPTIPPLFPAAPAP
                     "
     gene            9527..9916
                     /locus_tag="H0264_00040"
     CDS             9527..9916
                     /locus_tag="H0264_00040"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30853.1"
                     /translation="MSGIPVTVRIAALGIGIHAINHIIVLLTSPFSWNVGTVYHLLGA
                     PIYAALIPPILRGRNWARITITVLLVCQFGGRFVVWALWPSEGVRAALVFGWVLSLLV
                     FVMLWAPRGSRAHFRPRVESSGTPATE"
     gene            complement(9873..10445)
                     /locus_tag="H0264_00045"
     CDS             complement(9873..10445)
                     /locus_tag="H0264_00045"
                     /EC_number="3.5.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011211963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dCTP deaminase"
                     /protein_id="QLY30854.1"
                     /translation="MLLSDRDIRAEIAAGRLALEPFDEKLVQPSSIDVRLDSLFRVFN
                     NTRYTHIDPAQRQDELTSLVEPKEGEPFVLHPGEFVLGSTLEVCTLPDDLAGRLEGKS
                     SLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCVFRLTSPAEH
                     PYGSAAAGSKYQGQRGPTPSRAYLNFPLEV"
     gene            complement(10510..12249)
                     /gene="ctaD"
                     /locus_tag="H0264_00050"
     CDS             complement(10510..12249)
                     /gene="ctaD"
                     /locus_tag="H0264_00050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013416639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="QLY30855.1"
                     /translation="MTAVPAKDVPQLKAVRPYPRRMGPKGSFFWKAVTTTDPKVLGIM
                     YMFTAITFFLIGGLMALLMRVELARPGLQVLSPEQFNQLFTMHGTIMLLFYATPIVFG
                     FANAVLPLQIGAPDVAFPRLNALSYWLYLFGASMATAGFLTPGGAADFGWTAYTPLAD
                     GMHSPGVGGDLWIMGLAVSGLGTILSGVNFITTIVCLRAPGMTLFRMPIFTWNILVTS
                     VLVLLAFPILTAALLVLEIQRRMGGHVFDSANGGAIAWQHLFWFFGHPEVYIIALPFF
                     GIVTEIFPVFSRKPVFGYTTLVYATLSIGALSMAVWAHHMYATGAVLLPFFSIMTFLI
                     AVPTGVKFFNWIGTMWRGQLTFETPMLWSIGFLITFLFGGLSGVVLASPPLDFHVSDS
                     YFVVAHFHYVLFGTIVFATFAGIYFWFPKMTGRLLDERLGKLHFWTTFVGFHTTFLVQ
                     HWLGNEGFPRRYADYLPQDGFTALNTISTVGSFVLGFSMITFVWNVFKSYRYGEVVTV
                     DDPWGYGNSLEWATGCPPPRHNFYELPRIRSERPAFELHYPHMIDRMRTEAEVGWGGR
                     RKKAIEKESAPKQ"
     gene            12516..12589
                     /locus_tag="H0264_00055"
     tRNA            12516..12589
                     /locus_tag="H0264_00055"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:12548..12550,aa:Gly,seq:ccc)
     gene            complement(12654..13094)
                     /locus_tag="H0264_00060"
     CDS             complement(12654..13094)
                     /locus_tag="H0264_00060"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30856.1"
                     /translation="MRKTLIAAALAMLPLLAACGSSDQSTAPSTSAAAATSVAATTTA
                     GTTSAAPTTTVKTGTSTTTVSGAPLTAAEISKALQDKGSLDAKTANCIAEIYIDEGIS
                     QPGLRKILESDSTTGTLNVSDLGLTTSDIPKAVKATARVVSECN"
     gene            complement(13180..13503)
                     /locus_tag="H0264_00065"
     CDS             complement(13180..13503)
                     /locus_tag="H0264_00065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30857.1"
                     /translation="MRISLIAAALVALPLLTACGGGDDAPAVTAAEISKALQDGGLKD
                     TKLADCAAKIYVDEGISQDGLRLMIKNDGRTASATDPEALGMTKDDSEKAKSATNRIV
                     GECLK"
     gene            complement(13553..13852)
                     /locus_tag="H0264_00070"
     CDS             complement(13553..13852)
                     /locus_tag="H0264_00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003092405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30858.1"
                     /translation="MRKGEVWLYHPHGDAPRLRNIILISSDGINESPRPWLIAAEVLD
                     DDPQDILAVSIPGHGWIHAGNLGRIYRGWLARHVGTVDIETAERIDTALRAAMDL"
     gene            complement(13839..14063)
                     /locus_tag="H0264_00075"
     CDS             complement(13839..14063)
                     /locus_tag="H0264_00075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30859.1"
                     /translation="MATRKVTLSLDAAAWSYAEQAAARAGMSPSAWISRAARREAIRT
                     GCGPMPDQTASAATEEAELAAAEEELRAQG"
     gene            14150..14932
                     /locus_tag="H0264_00080"
     CDS             14150..14932
                     /locus_tag="H0264_00080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QLY30860.1"
                     /translation="MTKLNHHRTGSGEPLVLVHGVGSLWQVWEPVIPALAESFDVIAV
                     DLPGFGGSEPLTHTTVSTLADALVDFFAAEGVENPHLAGNSMGGGIVLDLAARGLARS
                     VTAYSPIGFWDTPGRIWCQQALARAKDLVRVLGPNLSAGILGTTAGRTAFTGLVFGKP
                     WDISREVAIATAEGLMSARGFDAALASFTDFRLPDRTAVETIPVTIAWGNRDILLTYA
                     TQARRARAVLPGARHVTLHGSGHTPYYDDPAGCARLLLDQLG"
     gene            14847..15716
                     /locus_tag="H0264_00085"
     CDS             14847..15716
                     /locus_tag="H0264_00085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crotonase/enoyl-CoA hydratase family protein"
                     /protein_id="QLY30861.1"
                     /translation="MSRCTAAATRRTTTTRPAAPGSCWTSWVNPRKYAVSSNNNVTLS
                     FDGDRAHVTLDRPDKHNGLTIDMLRELVKVAGIIGKRGDIRVVILSGNGPSFSSGLDI
                     ARAMRNPLDVALAFVPLPWKGTNVFQEACWAWRRLPQPVIAVVHGNCFGGGLQLALAA
                     DFRFVTPDAEFSVMEAKYGLIPDMTGAATLSRLVGVDKALLLTMTADTVDAAYAEKIG
                     LVTEVTADPREAAEKLADRIVARPAPAVAAAKKMFDRTWQASVRRTLAVERATQLPLI
                     VRQALNRGINSGK"
     gene            15873..16982
                     /locus_tag="H0264_00090"
     CDS             15873..16982
                     /locus_tag="H0264_00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009478237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4185 domain-containing protein"
                     /protein_id="QLY30862.1"
                     /translation="MNKSASLLLSAIAGASALLLTVTTQASANPNAINPIPVLNGTNG
                     LPQLPGRSKAVFQVTGMQSPNNTQTYNVLGTDLGIMWDNGHGEMLTAFGDTAGLGFPN
                     LLVGSTWAWRSNILVRSHTQDPSNGIYFDSVVRDVFGQARDLIPSPKIPFLEISRIPT
                     AAISVDGTQYMSLMSVKTWDDVGQWTTNFSGLAVSGDNGENWVELPATRRPDEGANGN
                     FQMNAFLKAGGFVYEYGTASGRNNAAYVARVPEQAIADLGAYEYWNGDKWVKGDVNAA
                     APVIGGGVSEMSVMWNDYLGQYIMLTTDPWNSVVMYTAPSPEGPWSAPSVLIDTRELP
                     TAYAPSIFPYQTGRDLYFLTTVHSQYNVILMKTTL"
     gene            17162..17896
                     /locus_tag="H0264_00095"
     CDS             17162..17896
                     /locus_tag="H0264_00095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="QLY30863.1"
                     /translation="MDAAAWDEHYSRTELVWGAPPSDTVVEQVFGLERKLPLGGFGIG
                     EPRPELPRALDLGCGEGRNALWLATHGWQVDAVDYSQTGIDKGRTVASRLSRSVRGRI
                     HWHWADVTALESAGITGPYELILLAHVHIPAAERRALLLRAAEMLSPEGTLVVLGNDT
                     LNITEGYGGEQDPAITFTPEDILADLGPAEELTIRVAGRVQRPTEDRDAIDALVVAYK
                     PAPDVPPAQPLALDPPIEPPALGPQL"
     gene            complement(17910..18455)
                     /locus_tag="H0264_00100"
     CDS             complement(17910..18455)
                     /locus_tag="H0264_00100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019891626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QLY34010.1"
                     /translation="MDHAIARATRELLGERGYAGLTVDAVAARAGIGKAAIYRRFATK
                     QEMIFSVVIHDMREVAPPDTGSLRTDLAALTATVAGQLASAPTDVVNGLLADIYADSA
                     LGERFSGTFLARQREVITELLERARDRGELAALPDPMTVHALVLGPIFVWLQVFQGDP
                     EQLPELTATVANSVAATLMPG"
     gene            18559..18993
                     /locus_tag="H0264_00105"
     CDS             18559..18993
                     /locus_tag="H0264_00105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011209279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30864.1"
                     /translation="MVKWAGRILVFLGAAHTALGLALTAPHHAGAWFGFELWTVSDSI
                     AEMDSSTGAFWMSVGSFGVPLALVGALVLWMDNRGIVPPPFIAWTVGLWIAVAAAIAE
                     PAPWLVAWVAVGLLLAADRQAKPAQRESQGIAAPAISSNPAR"
     gene            complement(18921..19529)
                     /locus_tag="H0264_00110"
     CDS             complement(18921..19529)
                     /locus_tag="H0264_00110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011211984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QLY30865.1"
                     /translation="MRIDTSAGPAEVEIDRPGKKKPKFLLVLTHGSGGGVDAKDLLAV
                     RDSAVELGGAVALVTQPYRVAGRRAPGKADVQDAAWLEIIAALRQEFTKTPLIQGGRS
                     NGARVACRTAREAGARGVLALSFPLHPPGKPEKSRREELLAPGDIEVLVINGSRDPFG
                     IPDAADAAEVHVVQGQAHSYRAGFDEIAGAAMPWLSRWAGLA"
     gene            19854..21680
                     /locus_tag="H0264_00115"
     CDS             19854..21680
                     /locus_tag="H0264_00115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007533792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="QLY30866.1"
                     /translation="MGHYKANVRDLEFNLFEVLGLGSLLDSGAYGDLDTETVKEMLSE
                     VRRLAEGPLADSFEDGDRNPPTFDPETHTVTLPASFKKSYKALEDAGWSKVPVREELG
                     GLGAPSVIGWALGEMILGANPPAQMYAAGAGFAQVFYNNGTDEQKKWAQIIAERNWGA
                     TMVLTEPDAGSDVGAGRTKAVQQEDGSWHIEGVKRFITSGDSDDLFENIMHLVLARPE
                     GAGPGTKGLSLFYVPKYHFDFETETLGERNGVFVTNVEHKMGIKVSATCEVTFGGHGV
                     PAKGWLVGEVHNGIAQMFDVIENARMMVGTKAIATLSTGYLNALEYAKIRVQGADLTQ
                     MTDKAAPRVTITHHPDVRRSLATQKAYAEGLRAIYLYTAAHQNDDVAQLVSGADHDLA
                     HRVNDLLLPIVKGVGSERAYQYLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTT
                     AIQAQDFFFRKIARDRGVALAHVAGQVQKFIEREGGNGRLKAERKLLATALEDVQAMA
                     ATLTGHLMGAQQDPKELYKVGLGSVRFLMAVGDLLIGWQLLQQAEVAIKALDNGSTEP
                     FYQGKIATAQFFARNILPELTSVRTVLSNLDNDIMELDEAAF"
     gene            21859..22055
                     /locus_tag="H0264_00120"
                     /pseudo
     CDS             21859..22055
                     /locus_tag="H0264_00120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005312868.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            22132..22581
                     /locus_tag="H0264_00125"
     CDS             22132..22581
                     /locus_tag="H0264_00125"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30867.1"
                     /translation="MGYFRGIAYGLQVAGTWIAVAGWGRIGMGLWTTRPTADPLRDLE
                     GGGSFAAAVQVYLPYLVLSACVAGLAVAGLTPGRGAVWASVWGSVLVAAFAGWVLSRG
                     YLLDYLPGLHEQLLWTLPLSGCAAGVAAASWGVDELPAGRRERATRT"
     gene            complement(22568..24373)
                     /locus_tag="H0264_00130"
     CDS             complement(22568..24373)
                     /locus_tag="H0264_00130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanW family protein"
                     /protein_id="QLY30868.1"
                     /translation="MVGGGFAPCESTISHLGGWFVTSGSPGRHARERQPDRNSAPAQQ
                     FLNSTAARRAGIAAGVLMAAGGLAFAADWSLSSGHVPRGVQVAGIDIGGLERAQAQTR
                     LETELNQRVAQPLTVQIGDVQATLVPRDAGLSVDWDGTWERIGSQPVNPLTRLASFFS
                     TRNVEPAAVIADSAMTAQLDALRAHDRQPVEGGIVFEDARPVGVYPVPGRVLDVPAAR
                     TVLSEHWADGSVLELPAVETQAQVTQAAVDRTLREVAQPAVRAAVTFTGKGGNGVLEP
                     AQIAAALTFAPDGQGGLAASYNNDALIAALKPQLHSTEIEPKDATFNVSGTRATVVPS
                     VVGDTIKWDKTLEGLPALLLSPSDRSKTVVYEQVKPKLVTEDAEKLGVTQVVGSFTTS
                     GFSGPSGVNIRTVAQKVDGAVVKPGDTFSLNDFTGPRGVEQGYVESGIINNGRPSTAV
                     GGGISQFATTLYNAAYFAGMEDAGHTEHSYYISRYPAAREATVFDGAIDLKFRNNTPY
                     GVFIETVTTGSDVTVRLWSTKTVEVESITGDRTKPTDPKEITLPKGKECIASEGAPGF
                     TTSDTRVIRDSKSGKEISRTTRTVKYDPIPVVKCE"
     gene            24630..25658
                     /gene="gnd"
                     /locus_tag="H0264_00135"
     CDS             24630..25658
                     /gene="gnd"
                     /locus_tag="H0264_00135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylating 6-phosphogluconate
                     dehydrogenase"
                     /protein_id="QLY34011.1"
                     /translation="MQLGMIGLGRMGANIVRRIVRDGHTAVGYERHQTNIDDLAAELG
                     DKFSGTTDLAKFVASLDAPRVVWVMIPAGATGAVIDQLADLLEPGDIIIDGGNSRYHE
                     DIARAKTLQPKGIHYLDIGTSGGVWGLERGYCLMIGGEAAQVAHIDPLLKSIAPGVDA
                     APRTPGRTGEPAQSEQGYLHCGPAGAGHFVKMVHNGIEYGAMAAYAEGMNILHKANVG
                     NQQDEEHSAEVTPLENPEFYRYDIDIPEVTEVWRRGSVVASWLLDLTAEALYADPNLD
                     SFGGRVSDSGEGRWTLDAAIDEGVPAPVLSAALFQRFSSRGESLYADKALSAMRKAFG
                     GHHELPQR"
     gene            25676..26842
                     /locus_tag="H0264_00140"
     CDS             25676..26842
                     /locus_tag="H0264_00140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010593518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="QLY30869.1"
                     /translation="MRIVPGIVLAVTAVVLTACSGSSSGPSQGSASSSTDPGSTTAPV
                     TTQPAQQDCKAGYLAQFTLRQKLAQLLTVGVTGADDAENVVRTEQIGGIFIGGWTDRA
                     LLANQQITEVTKASRTPLMVTIDEEGGRVSRLGALIGTVPSAREIVASGISPEQYYQD
                     SLVRARKMKALGITVDFAPDVDVSSQPDDSVIGDRSYSNDPDVVVEYADAQIRALQDA
                     GIGAVMKHFPGHGSGSGDSHTGAVRTPPLAQLQEKDLVPYRALVGSGAAVMVGHLDVP
                     GLTTPNVPASISPEVMDLLRKGTGYGAAPFDGVIFTDDLGGMAAITSRMSIEDAVEAA
                     LVAGADNALWITTDAVSSVLDRLVSAVEAGRLPGSQVDASVLRMAKFKGTAPQC"
     gene            27033..27632
                     /locus_tag="H0264_00145"
     CDS             27033..27632
                     /locus_tag="H0264_00145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009478226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QLY30870.1"
                     /translation="MAGGTKRLPRAVREQQMLDAAVEVFSLKGYHDTSMDAIAAEAKI
                     SKPMLYLYYGSKDELFRACIHRESIRFIEAVAVAGNPKLTPHEQLRAGLEAFLSYVDK
                     NRLSWQVLYRQAINQQPFASEIANSRERIIELTAKLLESSAKYAEPGTNFEVVSVAVI
                     GAGEAIADRVASGQVEMAEAVDLLDNLAWRGLSGKKKDA"
     gene            27738..28928
                     /locus_tag="H0264_00150"
     CDS             27738..28928
                     /locus_tag="H0264_00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="QLY30871.1"
                     /translation="MFGLLKPCAHSAAEYGIDATTWQTHMCGLCLGLRDGHGQLARAA
                     TNTDALVLGVLTEAQQPTEAERTTAAPCPLRGMRRVPVATAGSPGVQLAATASLLLGA
                     AKIRDHVDDGQTGRLSTRPMRRVSTRWRTQARAAAAPIGLDIEPLIAAIDSQAELETR
                     LSGELELDRLTAPTQVCAAELFAHTAILAGRPENAEALREAGWHFGRIAHLADAIEDL
                     DEDRAAGRFNPLAATGTSAEDAHSLLRESNSALRAALARVALERVATVRWMLLDPLNG
                     VVRRIWRVTGAVRACSAHACGNDHAAQSEDGVVAVVRGDTTKPPRHRKPGLLEGIGII
                     LSQYCTGYACCKDHTRPCSGHRRNAWVDRCNCRRRCKNCCDACDCCSGCGDDCCCDGC
                     CCDC"
     gene            complement(29343..30212)
                     /locus_tag="H0264_00155"
     CDS             complement(29343..30212)
                     /locus_tag="H0264_00155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="QLY34012.1"
                     /translation="MSQTINLTEVPKNSGLFVKAALGAVPVPGPLNARGSKIPDRKVR
                     LEGFKVDPDHLAAYCRATGLRFSDALPLTYPFVLSFPLAMQLVVARDFPFVAVGAVHA
                     ENVIERTREISVSEPLDFETHIENLREHPKGLLVDAITEVSVGRELVWRQVTTFLHQQ
                     RTSLSGGPKPEPKPDEVPPPPLRQLRVDQKMINRYANASGDHNPIHTSALGAKAFGFP
                     KPIAHGMWSAAAILGAVEGRIPEKATYTVKFGKPIFLPSTVNLYADQVAGGWDLSLKH
                     PKKGFPHFTATIR"
     gene            complement(30212..31570)
                     /locus_tag="H0264_00160"
     CDS             complement(30212..31570)
                     /locus_tag="H0264_00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="QLY30872.1"
                     /translation="MAASKSKGAPNLYGSFIHSAPGAFLASKLGLPQPETLRRYQAGE
                     PALPGPVLVGGKGRVADSVRNLLSDYTFVDSVTPGVKFGALVFDATGIKTIEELEQLF
                     QFFQPAMRSIAPSGRVLVIGTTPELSASVDEQIAQRALEGFSRSVGKELLRGATANLV
                     YLHPEAASAATGLESTLRFILSGKSAFVDGQVFRVGKDDSTAPASWDKPLEGKVAVVT
                     GAARGIGATIAEVFARDGATVIVADIPAAGEALSETANKVGATALALDVTAPDAAEKL
                     AEFATERFGGIDIVVHNAGITRDKLLANMDEGRWNSVINVNLAAPHRITEGLVAKGAL
                     KAGGRVIDVSSIAGIAGNRGQTNYGASKAGVIGMVNAEAPKLGEKGITINAVAPGFIE
                     TAMTAAIPLGTREAGRLLSSLLQGGQTVDVAETIAYFASPASNAVSGNVVRVCGQALI
                     GA"
     gene            31756..33078
                     /locus_tag="H0264_00165"
     CDS             31756..33078
                     /locus_tag="H0264_00165"
                     /EC_number="2.3.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA C-acetyltransferase"
                     /protein_id="QLY30873.1"
                     /translation="MTTKARSAKTAAKNTKQARPVAILGGNRIPFARSDGKYAHASNQ
                     DMFTAALNGLVSRFGLQGERLGMVVGGAVLKRVGEHGMIRESVLGSTLSPYTPAHDLQ
                     LACGTGLQAIQTVADGIALGRIEAGVGGGTDTTSDAPIGVSESMREWMLDANRAKNNK
                     DYVKLVGRLRPSMVGIEIPRNAEPRTGLSMGEHAAITAKEFGVSREAQDELAYLSHKN
                     MAAAYDRGFMDDLITPFLGLTRDDNLRPGSTIEKLSTLKPVFGVKAGGATMTAGNSTP
                     LTDGASAVLLSTDEWAAERNLKPLAYLVDSEVAAVDYIHGPDGLLMAPTYAVPRILAR
                     NGLTLQDFDYYEIHEAFASVVLATLQAWESDQYCKERLGLDGALGSIDRSKLNVNGSS
                     LAAGHPFAATGGRIIAQTAKQLAEKGGGRALVSICAAGGQGVVAIVER"
     gene            33227..33643
                     /locus_tag="H0264_00170"
     CDS             33227..33643
                     /locus_tag="H0264_00170"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30874.1"
                     /translation="MKYRLALTAIALGLPLHAGAGNAHAEGIPLEPVAVDSGSALLDT
                     DLATQLGTGSGQLARALLTGSSQLQRGSNADIAGSGSGDLASSGSALGNDVLTTGSAQ
                     ALIGPGSALSDLVLGVMSSGSGKGWLQGFGSHAPVG"
     gene            complement(33719..35203)
                     /locus_tag="H0264_00175"
     CDS             complement(33719..35203)
                     /locus_tag="H0264_00175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009327712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribosylglycohydrolase family protein"
                     /protein_id="QLY30875.1"
                     /translation="MSSCPRDSAGTPTRADGGRGRRSATSPCRCCRRWWTRPWPSCEG
                     AVGSIESAFFGHHEADPRALLFYEWCQRRESGYAVDDFTEEVYELSRVERPLEKACWR
                     LLERIESAAPLPDWPYVEWRDVNAPGAVDDSRPRVEAPALPPDELFDRIHGGWLGRCA
                     GCTLGKPLENGFVWTPARIRDYLEPAGGYPLRDYVPVRDPMPEGIELHWTWPESTRDR
                     IDGCPRDDDLDYTILGLHLLEQHGPDFTPDDVASLWLERLPFLQTYTAERVAYRNLID
                     GYTPPDTATFRNPYREWIGALIRADIHGYTNPGDPARAAALAARDASISHVGNGSWAA
                     QWAAALVAAAFTADSPHTALTTAQRFVPERSRLAAGLSEVLEDHRRGFPWEHSNAAIR
                     ARYGRYNWVHAIGNACCIAAGLLWGEGDFTRTIGLTVQAGWDTDSNGATAGSVAGILT
                     GASRIPARWTAPLHDRLRSAVTGYDGSSISDLAGRTRDLAVRFG"
     gene            35770..36255
                     /locus_tag="H0264_00180"
     CDS             35770..36255
                     /locus_tag="H0264_00180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="QLY30876.1"
                     /translation="MPCDLMLIAYDGSENARRAVEYAGRFLAADRAVVLTAWEPMVRQ
                     AARMSGLSGVMQPEWVTDEEIEDVAFVDAKTINSEGVRLAKLAGLNAEARTVECTTTI
                     WNAIVEVADELDVDIIVAGTRGATGIRALMHSSVADAVLKHCHRPVLMVPPGREPDSK
                     R"
     gene            36366..37457
                     /locus_tag="H0264_00185"
     CDS             36366..37457
                     /locus_tag="H0264_00185"
                     /EC_number="5.4.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="QLY30877.1"
                     /translation="MDGFLLATPDGVLRTTGTRAAYDTAQSAAAALRDGAADLIVGAL
                     PFEPGRPAALRAPAEALHTAGPWRPAAVPALPAVRVVSEMPSAAEHVARVTKLVEQLG
                     DPAQPLRKVVAARSLLAEAEEPLDPEVVAAHLVTRHPRANVFAVDLTPAGRPGDTLLG
                     ATPEVLVAKQGNTVTLRPLAGTLPRLADPEADQAQARELLSSTKNHDEHAFVIAWIRA
                     RLETVCGELTIPDAPELLGTPEVWHLATPISGKLNDPGISALDLAVLLHPTPAICGTP
                     TDLALETILEMEEDRGFYAGAVGWCDSRGDGEWVVAIRSAELSADGRSLRAFGGGGIV
                     AASDPHTELVETTAKLRTFLGSLNCAVPN"
     gene            37563..37733
                     /locus_tag="H0264_00190"
     CDS             37563..37733
                     /locus_tag="H0264_00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2613 domain-containing protein"
                     /protein_id="QLY30878.1"
                     /translation="MKFAVPGAASAVGGALVGLAAVLVITMAASQDKRPDIDRSGDAS
                     SSLLNNVEYGAR"
     gene            37798..42258
                     /locus_tag="H0264_00195"
     CDS             37798..42258
                     /locus_tag="H0264_00195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3367 domain-containing protein"
                     /protein_id="QLY34013.1"
                     /translation="MGRRWLLGTFLAAFLLTFLQAPGRTVADTKYDLAQNPLGFLERA
                     SHLWSSQAPMGQVQNQAYGYFFPHGAFFSLGHLLGLPAWVTQRIWWALLLLAGWWGII
                     KLCEVLGIGSRGSRIIAATTFALSPRVLTTLGSISSETLPMMLAPWVLLGPAALGVAL
                     RRKRNESHPASAHTIARETAETAESEPEVCAQAGSPRWGAATPAGSALALALMGSVNA
                     VATAAAFLPAALWWISFQPNRRWWQFTRAWIPLLVLATFWWVVPLLLLGKVSPPFLDY
                     IESSGVTTQWASLGEVLRGTDSWTPFVSPERIAGAVLVTQPAAVLATGMLAAAGMAGL
                     AMRSMPYRGRLALILGVGLVGICAGYAGQLGGPFAEQVRLFLDSGGAPLRNVHKLEPL
                     IRLPLVLGLAQLLSRVPLPASVPMPVWRKAFAHPERDRMVAVGALILTALALSTSLAW
                     TGKLAPRGDYDKVPDYWHQTADWLAHNASDTRALIVPGAPFASQVWGLTRDEPLQALA
                     STPWAVRDAVPLNPPGAIRAMDSVQRLIADGRPSTGLAATLAAQGIGILVLRNDLDPD
                     TSRSTRPMLAHRAIEGSPGLTKVTEFGDPVETPKAEGLVADNDLRPAYPAIEIYRVEA
                     EPPGTPVAGQGGNGDAARANGDPGSTTGGDGGSAESGNAAIEVRSGTGAPQSFPGAYT
                     VPLDSVPVVEGGPEVLERLRRNPATSNGPVLLAADAAAAGLPVRSLTVTDTPMDREAD
                     FGRVDNHNSALRAPTDARRTHNLVPDYPVPGAQLVEGEWSGATVTVSSAAADATQLGG
                     AAPGSSTAAVVDGDPATAWISNGTEHALGQWLRLDLDKPVSSGVLRLTTSAAAIGSPV
                     KWVEVETSKGTVAGRIAEPGTPVSISLPPGKTDWVKITATRTENGTAGGQFGIAELQL
                     VDYADGDNPAPIDIRHRTVLPPTPAGAEVLGWDLGQEFPGRGACFDAPDRVRCSKGLA
                     LAAEEPGLFERTLSVPQPVTVTPELTVRTRPGPALDALITDPNRPIARGQADVGDPRG
                     SALAATDGDPRTSWIAPETTVRNPTGPKPTLVIELPEPTLVTGLELTPSLGDLPAHPT
                     SVMVNLGAGPQVREMDADAGKPTRIELYPAVTDRIELSIQSWKPVLDRTALGFAQDQP
                     AGLAEINVLGPEYPAPADPDRLITIDCAHGPTIAAAGRTLHTTATGTAAELRSGAPLP
                     AQVCAMDDAADSTFDLPSGRIDVTVAPTELFSVDELRLQRPATPTIADDPNAGLAESD
                     SESSGLDAGNPGRTHVNPEDAPLSPSSVRAPEGAQLLVLPLSTNVGWKAETADGRTLD
                     PVVIDGWQQAWLVPEGASGPITVSFPADRWYRAAIFGGLLLLIPLVALAFRAGTRRVR
                     DPGPAPRAWQSRTVGAVAVTAAAGLIGGPTGLVLAVAGLLAVRFAPGNWSRILVWTAG
                     LGTAVCAAALSTGPWRSPEGYMGGSLWTQFPALVAIVAVGLAALPARDSD"
     gene            complement(42328..43491)
                     /locus_tag="H0264_00200"
     CDS             complement(42328..43491)
                     /locus_tag="H0264_00200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="QLY30879.1"
                     /translation="MSTTLHPSREPAATAGTDVPPAARLGRFVPSLEGMRAMAALGVV
                     LTHVAFQTGATAHPVLGRVWERFDMAVAVFFALSGFLLWRPHAAAARGLGAAPSAGRY
                     LLHRAARILPAYWVVVVAVLILLPSAAHTAGLRVWLANLGLAQVFVSYTLTDGLTQMW
                     SLSVEVAFYLVLPLIALAFAWLRGPRARWRVPAVLAFGLLFLTWNLLPIPTPEATHAD
                     NWLPGYLPWFAAGMLLAELADLAVPRLRRIVGNQWLMWPIAVTALLLSATDLAGLRGL
                     TRGEPWQYVMKIVFGMIIGFSLLAPLVLRPETRHRWLESRTAATLGRWSYGIFIWHLA
                     VLSIIFPVFGIVPFRGHFVIVYVLTVAFTLPLAAASFALVEEPVRQWTRRRFG"
     gene            43680..44852
                     /locus_tag="H0264_00205"
     CDS             43680..44852
                     /locus_tag="H0264_00205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005243723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3068 domain-containing protein"
                     /protein_id="QLY30880.1"
                     /translation="MALSAGTRRTVACLLVGLGAMLLVAAILIPTYTVSRLAKTPLDL
                     EITTVAANTPGSTSEVLDSKSLTSPTGSATVDKNVPLISQRYLTVEEPANAEELTVQA
                     GQTLRRTDKQGDTGLLTATIDRVTIDRKTGMPVDEVDGGPNGSIAVTVNKQGEAAMEP
                     VQHTGLQYRFPIGTEKKTYPYFDLNARKTFDINFVEETEINSMKVYHFQQSVPVTDMS
                     AVVNTPTNKLALPAAKWGLEGDETVTMTRFYTNTRDIWVEPQTGTVIKGGEQIHLYYA
                     RQGDKPEVTALKANIVFDENTIESQIAVAKENIDKLSLYGRIMPIILGVLGAIALIAG
                     LVLGFLGGKNDTPVRRVAPAGGNPYRAPGAGAGNADAPTEQIDIGKTQQIDMNKDK"
     gene            45119..45616
                     /locus_tag="H0264_00210"
                     /pseudo
     CDS             45119..45616
                     /locus_tag="H0264_00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988939.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
     gene            46761..47588
                     /locus_tag="H0264_00215"
                     /pseudo
     CDS             46761..47588
                     /locus_tag="H0264_00215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013417240.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(49308..50483)
                     /locus_tag="H0264_00220"
     CDS             complement(49308..50483)
                     /locus_tag="H0264_00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011597400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="QLY30881.1"
                     /translation="MREVLLLCWRDTGHPQGGGSERYLEQVGAQLAAQGVKVTLRTAR
                     YPGAAKRERIDGIDISRGGGRYTVYPRALAAIALGRLGLGPLRDVRPDAVIDTQNGIP
                     FFARAASQAPTVVLVHHGHREQWPVAGKLVGRIGWWIESRLSPRVHRNNQYLTVSLPS
                     AEELTALGVEGSRIAVVRNGAEPLPADLPAGDDSTRTAHPSIVVLSRLVPHKQIEDAM
                     AVAAGLRARIPGLHLDVIGDGWWSDNLRAHARDLGIADAVTFHGHVDEHRKHELLARA
                     WVHVMPSRKEGWGLAVIEAAQHGVPTVGYRSSRGLTDSIVDGVTGLLVDDPAQLTSAV
                     GDLLDDPEARTVLGEKARARAREFSWEQTGNGVYEVLSAVARGDRVSGLVAAALVEH"
     gene            50857..51726
                     /locus_tag="H0264_00225"
     CDS             50857..51726
                     /locus_tag="H0264_00225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010838396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="QLY30882.1"
                     /translation="MLRAEQTLSSGAVNRPRFARRATLRRSLRLLGSFKYAQTDPAVF
                     YGGVASDTADLVGDFYRDLTGRSLNGTIVLDVGGGPGYFADEFGKVGARYLPVEPDPS
                     EMHAAGLRVAGAVRGSGMALPFRDDAVDVCISSNVAEHVPRPWVMADEMLRVTKPGGL
                     MVFSYTVWLGPFGGHETGPWHYLGGEYAARRYRRKQGREPKNRFGKSLFAVKASDGLR
                     WARETPEDVEILSVFPRYHPRWAWWLVRVPGLRELLVSNLVVVATKKPGAAQADSTVR
                     GSAFEMAAAPESA"
     gene            complement(51688..51990)
                     /locus_tag="H0264_00230"
     CDS             complement(51688..51990)
                     /locus_tag="H0264_00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30883.1"
                     /translation="MAVQVVGRSLMTSDLTPHQAKSVGIGGWVVSFLPGRTLTTEQAT
                     AALQAAEAVAAVNALAGQVGLTAMETVGLATQESPWSEPVRSNGLRRFWRRGHLER"
     gene            complement(52184..52387)
                     /locus_tag="H0264_00235"
     CDS             complement(52184..52387)
                     /locus_tag="H0264_00235"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY27531.1"
                     /translation="MTDVDIDAFILPELTGLAPAPASTPMHRAASQLQKVLPPGWRVE
                     VVAVPPRPGRKDQPALRLVMSDL"
     gene            52696..54129
                     /locus_tag="H0264_00240"
     CDS             52696..54129
                     /locus_tag="H0264_00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="QLY30884.1"
                     /translation="MEYPSLFIGGKWTAPASADRVPVVSPATLETVGSVPAVTNADVD
                     AAVAAARRAFDSGPWPSTPPEERAEVLTRVSQLLDQKVGDLVTALSAEMGAPALAANT
                     LNYFPAKATLDFFAGLGKSFPWTETRTGMFGTSRVSREPVGVVAAVIAWNVPLFLAIN
                     KLAPALLAGCTVVLKPAPLTPLSANIVAELFAEAGLPEGVLSVLPADAEVSEYLISHP
                     DVDKVTFTGSTAVGRKIAAIAGKQLKRCSLELGGKSAAILLPDMDIADIPKLAFAGLM
                     NSGQACVAQTRILAPRTRYDEILGALTESIGALPVGLPSDPAAQLGPLISERQRERVE
                     GYIEKGKAEGARLITGGDRPDGLPGWYVNPTVFADVSNSMTIAREEIFGPVLSVLPYD
                     TEDEAVAIANDSDYGLAGSVWTTDIEHGIEIASRVRTGTYAINWYAFDPCAPFGGYKT
                     SGIGRENGPEGLDAYCEQKSVLMPMGS"
     gene            54194..54481
                     /locus_tag="H0264_00245"
     CDS             54194..54481
                     /locus_tag="H0264_00245"
                     /inference="COORDINATES: protein motif:HMM:NF025198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4190 domain-containing protein"
                     /protein_id="QLY30885.1"
                     /translation="MNAYHAAPQQKTNTLAIVTLVTGILGLCLIPWILGAISLGQIKK
                     SGEKGRGMAIWGMVIAVAWTIIGIIVGVASAMNAESAETVEGLRLLTQTVA"
     gene            complement(54547..56373)
                     /locus_tag="H0264_00250"
     CDS             complement(54547..56373)
                     /locus_tag="H0264_00250"
                     /EC_number="4.1.1.32"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase (GTP)"
                     /protein_id="QLY30886.1"
                     /translation="MTSATIPGLHDGTAPTEHKELLAWVQEVAELTQPDRVVWADGSE
                     EEAVRLSEQLVAAGTFKKLNEAKKPNSYLALSDPSDVARVESRTYICSRDEADAGPTN
                     NWVDPAEMRATMTELYRGCMKGRTLYVVPFCMGPLGAADPKLGVEITDSEYVVVSMRV
                     MTRMGKAALEKLGTDGAFVKALHSVGAPLAEGQADVPWPCNETKYITHFPEDREIWSY
                     GSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKNYYVAAAFPSACG
                     KTNLAMIQPTIPGWRAETLGDDIAWMRFGEDGRLYAVNPEFGFFGVAPGTNHSSNPNA
                     MATIDAGNTVYTNVALTDDGDVWWEGLEGQPDHLIDWKGNDWYERESETLAAHPNSRY
                     CTPMSQCPTLAPEWDDPQGVPISAILFGGRRKTTVPLVTESFDWQHGVFMGATMSSEQ
                     TAAAEGKVGTVRRDPMAMLPFLGYHVGDYMNHWVSLGKNADADKLPKIFYVNWFRRGE
                     DGRFLWPGFGENSRVLQWIVGRIEGTAEGEATPIGTVPHAANLDLEGLDVDPADVDEA
                     LVVNVEEWKREIPMIEEWFQFVGDRLPSGVRDEFEALKERLG"
     gene            complement(56596..58359)
                     /locus_tag="H0264_00255"
     CDS             complement(56596..58359)
                     /locus_tag="H0264_00255"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30887.1"
                     /translation="MSAQDDARTWPALNLPAVERRSIGSNHAPTGGSGATAPSDPVSG
                     PSFAGAGGISDAAEAVVARWNPHGLALLRAMSWDGEEAAAAVTLVGSGDVNQMLLRVE
                     LSRFEPHVDMVEPRTAADGPAAVDGPSSGDEALGADVSDRAAVGDAETLGRDGKHGGI
                     RRRPVPVALVVLDAGSPIGGDGLQAVHELWADGTRVVFALDGIHAHREWRAVLERDVA
                     LLTLERDIALSGGAALADVEVVPVSARMAAVARVGVDGALLDRSGLGLLHARLVAAVG
                     AGALVDQGVIVRDRVVDETRARIEGQLEKLRGSGDVVALREERATLLAVGDGGRGVAM
                     STLRNRLQLARVDLVHEVGARVRALNMEARAEAEGRPNRADIGHFGRLASAVEDLTRE
                     MDRVIRKRVEELSAQVEVSAGGSGWEIAEAACQAARVVQPCVGAGPERRRRGLEDRLM
                     VALGASAGFGLGRFVVAPLAVFEAFDWAIVPVGLVLGAAVAWWVVRARGQLAERAHVQ
                     QWVSDTLVNVKAQLEQRVATALVEAEERLAEEVVGATTERMVETDRRVGELEAQLRQA
                     AQRRPALTAACERDLAALEFA"
     gene            complement(58597..59256)
                     /locus_tag="H0264_00260"
     CDS             complement(58597..59256)
                     /locus_tag="H0264_00260"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30888.1"
                     /translation="MPASRPLRIQITGRSKVGKTTLRNALSLLAAEETQPVDQPGCSA
                     PVLDGDLIIYVLTGCPQPTDRQLTAALTAERTLVALNKAETIGTRWSDAAAAAARYAE
                     ILGVPVYPVVASLAARTRSGTFTTADLRTLQRHRTRNDPAFALAPELFTSPDLGPDVD
                     DRRTLLEHWDLHGVACALTALRMDPTLTPHALLQILHCASGIDALYEELHRRYEQGPR
                     G"
     gene            59515..60861
                     /locus_tag="H0264_00265"
     CDS             59515..60861
                     /locus_tag="H0264_00265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="QLY30889.1"
                     /translation="MTVTADVIGDAEPSGRQAAPDRPVPPSRDPFFRAPSGFAMHAPG
                     TILRSRTVELALFGLVSQQVTAWQLLYRSNDLHGRPEVAVTTVLLPKGAAPDRNRPLL
                     AFQSAMDAVTDRCAPSYALRKGAMAPGSITQLEWLLVANALRRGWAVSIADHEGPDGA
                     FGAAREPGYRALDGVRAALRFAPMGLRPETKVAVWGYSGGGMASSWAIEMAPGYAPEL
                     NIVGAVLGAPVGDPRHVFLNLNGGLFSGFPAIVIAALRGVYPALASVVDNDITPEGRR
                     MLDRMARLGPIAALPLLVGRGMDNYLHRPLTEILPELEDMFDDMRLGNSTPECPVLVV
                     QPVNDQVIHVKGIDGQVDRYREGGAAVWYVRDRLSEHFSLLPLSTPISLDWLADRIAG
                     KPLQAPTTKTVWSVALHPARWRSMVEMATTAMRVTLGMPLSREAEQPADTASGLAA"
     gene            60921..61670
                     /gene="trmB"
                     /locus_tag="H0264_00270"
     CDS             60921..61670
                     /gene="trmB"
                     /locus_tag="H0264_00270"
                     /EC_number="2.1.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(46)-N7)-methyltransferase TrmB"
                     /protein_id="QLY30890.1"
                     /translation="MDAVNDADAARPTGNRLYPRVTSFRARRGAISPTRQDAWDRLWP
                     EIGRDVADEPLDADTWFGRKAPVIVEIGCGTGTATAAMAQAEPQFNLIGIEVYRPGLA
                     QLVQRIERENIPNIRLLRSDAVDVLENMVAPGSLTGVRVFFPDPWPKARHHKRRLLQP
                     ETVKLIADRLMPGGVLHVATDHADYAEWIAEVGAGEPQLIGLNETTGGRSEDWKETAP
                     IGFERPITKFENKGLRAGSAIQEFIWGKIES"
     gene            61667..62413
                     /locus_tag="H0264_00275"
     CDS             61667..62413
                     /locus_tag="H0264_00275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NYN domain-containing protein"
                     /protein_id="QLY30891.1"
                     /translation="MSVSEMARDVAEVAEIVHGTSSTELTGTTSLSSSVPDVRRVLLV
                     WDAPNLDMGLGAILGGRPTAAYRPRFDALGRWLLARTAELSVGSPTRVEPEATVFTNI
                     APGTADVVRPWVEALRNVGYAVFAKPKIDEDSDVDSDMLAHIELRRRGAGLAGIMVAS
                     ADGQAFRAPLEEIASSGVPVQVLGFREHASWAVTSDILEFIDLEDIPGVFREPLPRVS
                     LDSLPDEGAWLQPFRPLSALLTSRPAQGVA"
     gene            62413..65709
                     /locus_tag="H0264_00280"
     CDS             62413..65709
                     /locus_tag="H0264_00280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MMPL family transporter"
                     /protein_id="QLY30892.1"
                     /translation="MFTRWGDLVYRLRYTVLGVTVAAFLGLGYFGLGVNDHLSSSGWF
                     DPTSESVHAAILKDQAYSRDHNSDVVLLYTAPDGKTVDDPAWNQKIIDSLNALPKQYP
                     QISKVNVAPWKTETGQQVAQTVSPDRKHAFATVALNANNDTEMLQAYAAVQNAFTVPG
                     VQVEVGGLQPIAYTLNNTIASDVKRMEMLALPAVAVLLFFIFGGVVAAALPLIIGGLT
                     IIAANGMIMALTKYTEVNSFVSAVVSMIGLGLAIDYGLFIVSRFREELAEGYDTKAAV
                     RRSVMTAGRTVTSSATMIIAASAGMLLFPQGFLKSVAYGTIAAVLLAMISSLTVLPAI
                     LSILGRRVDSLSLKWINKTKTADEIENGYWGKMTAWVMKHPLKVAIPIVIGLLLLIIP
                     VKNLQFGGISETYLPPDNPVRVAQEHFDEIFPLRKADPVQLVIVTDNSKDIGPILAQA
                     NKAPGLVKNAQFGIPSKPPNGSNVWVSEATVEDSAHPEDTVDYLRSMEVPDNAEVMVT
                     GQPVMMMDSIDSLLAKMPLMIALVLFITTVLMFLTFGSLVLPLKAALMSALGLGSTLG
                     ILTWIFIDGHGASLLNFTPQPIMSPVLVLIIAIIYGLSIDYEVFLLSRMVEARTQGAS
                     TTEAVRIGTAQTGRIITAAALILLVVTGAFAFSDLVMMQYIAYGMVAALFIDATVLRM
                     LLVPATMKLLGDDCWWAPAWMKKIQQKIGLGEPILDDERPGGEEVVDLVKTTPITDPV
                     TMQIPMLADGSMPRSRKPRRTARKVDVDSEAPTQALNEVAPATPAAAPGTPSGPAHPA
                     PPSEPANAGFTGSPTSANAGFATPSAPANTGFTAPSTPAKTGFAAKSDGPHGVSDFTA
                     FIGTATGAATGDPAAESGAPHSPAAGVAGADSGAPQRVPAPPAPAAGVPPRSDRAADG
                     AFTQPGFGTPAGQDVGVRPGTGVTEQSTSRGQDGAFAQQGGPAAPQGPVPAVSQPGSA
                     APQADPQSPSAPAQPVAGAERVLPPPSMKVPPHPATRAQLYQPHAEPTQPVAAAESDA
                     TQPVPTQHAQQEAPQGGGRNSIEQWMSDLRSARRRPGKDEEDDDEGKHRGGEGRTVSV
                     NELLRRQNRD"
     gene            complement(65840..67483)
                     /locus_tag="H0264_00285"
     CDS             complement(65840..67483)
                     /locus_tag="H0264_00285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015888975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2339 domain-containing protein"
                     /protein_id="QLY30893.1"
                     /translation="MPGIPQRRMAPPREVRPPWWQREGVISRVLAVAGVGVTLIGVVM
                     LLVLAAQAGFFGPVPRVVAGAVFSGALVAAAVRVHGRAGGYVGAVALAATGIAGGYLD
                     VVAVTSIYDWVHPVAGLAVAFGIAAAGVWLAVQWRSQALAVLVVLGAAVLSPVITTEM
                     ALLAFLLVLQIAAVPVQLGRDWPYLHIVRTVPAALAILISVAAVGFEGRRSGSIREEV
                     LAAAIVAAVAGLAGAILVVRRRAGDLTASVSFAAAGIPLVAATAMFERAGAVSLAVGY
                     AVVLFAVAVLPWVPKLGAAARIPGHLAIVSAVVGACSLLIGCFRATTFETLPIALFLV
                     ALGFLAVGAQQRSKVAAWIGAAFAGLGAGVFLDIAAPGMLAGQRSAEAHLGVSTALAA
                     VAALGVVAVALWCARRIGLLGSENTTSTAAVLAGILGLYAVTVLTVSVGVATGDKDGF
                     LAGHGIATIIWMVTATAALLFGLRRLARTPQQAKVALAGGLLVTAAALAKLFLFDLAT
                     LDGLVRAAAFLAVGVLLLVAGTRYARAFAEAADRETPAP"
     gene            complement(68332..69138)
                     /locus_tag="H0264_00290"
     CDS             complement(68332..69138)
                     /locus_tag="H0264_00290"
                     /inference="COORDINATES: protein motif:HMM:NF024109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QLY30894.1"
                     /translation="MVKGAPLGTTPEPQLRTGRGEPLLLLHGALLTWESWLPVLDDLA
                     ADHDVLAITYPGHHGGPEPKRPATIASLADHAEQALDEAGWATAHLAGNSLGGWLALE
                     LAARGRARTVTAIAPGGLWRNPAAADSLLRKFRTFGPLIGLDTDAPPTSPALIRSLLL
                     PLLAHRPAIVPNHVAKAMAAAPANCTIVEEIAEDPALPTGFTAMDALDVPVTILLPEH
                     DRVLPPHVYAPLVETPTREIRPLPGLGHIPMLEDPARITAEIRATISRAA"
     gene            complement(69208..69975)
                     /locus_tag="H0264_00295"
     CDS             complement(69208..69975)
                     /locus_tag="H0264_00295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1707 domain-containing protein"
                     /protein_id="QLY30895.1"
                     /translation="MGGPEAMSGAEPAAVVGDRDLRVSDSEREHVGRLLQRAVGLGML
                     SLGEFTERMDTALAAKTRGELNAVLVDLPGIRLVGQPAQPAQQPPRFVQNPRAQQFIA
                     GGAQQFMPGAAQQFGAGAAPQFGPGPQPAVPGNVIRARMSGVTRKGRWTVPPVLVIDS
                     SMAGVELDFTQAIMSTQVVEIRVRHQIGSLELIVPGEATVDTNGLQLVGAGINNKVRT
                     GPPIGPLHLIVHGQFRFGSVTVRHPFSAHWKRFLNGL"
     gene            complement(70035..70706)
                     /locus_tag="H0264_00300"
     CDS             complement(70035..70706)
                     /locus_tag="H0264_00300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007316340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="QLY34014.1"
                     /translation="MAEDAAERISIMVVDDHPIWRDGVARDLAEAGFDVVATADSVAA
                     AGRRAAAVQPAVVLMDMQLPDGNGADATAEVLRVSPRTHVLVLSASAERDDVLDAIKA
                     GAIGYLVKSASATELYDAVRATAAGQAVFTPGLAGLVLGEYRRIANTPPDRDEPHRPA
                     LTDRETEVLRMVAKGLSAKQIATRLSLSHRTVENHVQSTLRKLQLGNRVELTRYAIEQ
                     GLDGE"
     gene            complement(70737..71978)
                     /locus_tag="H0264_00305"
     CDS             complement(70737..71978)
                     /locus_tag="H0264_00305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019667835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="QLY30896.1"
                     /translation="MRQRLPTASPPVTPPRTEPDPGTIATAPLWRAAQALRLVTLLYA
                     VGQQIASVSHYTNQRLSWALIAVMAMWSGVSAILLSQWNIRQHPWLRVCVVIGDHLIT
                     IALIFATRFVADYDWYHGHQTLPTTLWCANAVISAAILWGPFGGIGSGLLISFAIITA
                     RSQWELDVWRDATLPVLLSVGLALGLATNTAKRAQEQLQRAVRLTAAAKERERLAREV
                     HDGVLQVLSYIKRRGTEIGGPTAELAQRAGEQEVALRVLISEQGARADMGGHSADEDL
                     RPLLTAQATPSVFVSTPGEPVLLGHWEAREVSAAVAAALANTALHAGPGAKAYVLLED
                     TGDELIVSVRDDGPGIPPGRLAQAEEQGRMGVSRSIIGRIDAIGGTAQLLFEALPADD
                     DAAEEGAGAEWEFRIPRGPRE"
     gene            complement(71926..73146)
                     /locus_tag="H0264_00310"
     CDS             complement(71926..73146)
                     /locus_tag="H0264_00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="QLY34015.1"
                     /translation="MHPLVREAAEWSWRLLLILFAVLAVAYLAHRLSSVMIPLSIALL
                     AAALLNPLVDLLQRFGVPRSLGVFVALVGSIGLMAGIMTFVVEQFVVGVPQLSDEFKT
                     SVHEIQDWLINGPPHMSNEQIRNAGDTIVKTIESNQDTLTSGALTTATVIGEFFTGTF
                     LTLFILIFFLYGGDQIWEFITRIIPTEQRERVRVAGKLGFGTLTGFVRATVLVALVDA
                     IGIGAGLAILSVPLALPLASLVFIGAFIPIIGSFIAGSVAVFIALMTKGFVTALIVLG
                     ITIAVMQLEGHVLQPLLMGRAVRIHPLAVVLAIAAGVVLAGIAGGLLAVPFVAVLNTA
                     IRSLLADTPEELYQELHTGDPSKPMYSAEPDSPEDDFDEVAYLRGAAPPGKAGSDGAA
                     TTSDSKPAGDPAAD"
     gene            73368..74885
                     /locus_tag="H0264_00315"
     CDS             73368..74885
                     /locus_tag="H0264_00315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005258596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing protein"
                     /protein_id="QLY34016.1"
                     /translation="MRTRWPLYLASMLAANAFGAVLVWAFIQYGLPVPEGELSATRQT
                     GLVIPAIVFATCGLLSVTASALMLRPVMRWQMRGGPPSRQEQMAALHAPLRQAIVHLA
                     LWFLGGGVLAWLIIIRAPELAAAVIVTECMAATIVFGFTYMLGERILRPVAAEALTVG
                     AFDHTLTPGVGTRMAMTWGMGTFAPVIAIVLLCVTQISSRVQFSAQSLAVSILLLCGV
                     VIMQALALSMLTASSISDPIRQLSQAIDRVQEGARDVQVEVFDGSEIGLLQVGFNRMM
                     DEAAKRRELQELFGQHVGEDVARRALEYGTELGGETRFVAVLFVDMVGSTATAAERPP
                     TEVVSLLNEFFRIVVDVIDRHHGLINKFMGDAALAIFGAPLDRPDAPTAALTAARELR
                     EALREVPGLDIGIGVSAGLAVAGNIGGANRFEYTVIGDPVNEAARLTELAKERPERVL
                     TSGSALFFADESEQLHWDTGDEVQLRGRRRKTRLAWPKESGDPMDADEVEASSLG"
     gene            74891..76051
                     /locus_tag="H0264_00320"
     CDS             74891..76051
                     /locus_tag="H0264_00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flippase-like domain-containing protein"
                     /protein_id="QLY30897.1"
                     /translation="MKAHRDLAGEPAPPAENSRRGRFWWAKWVLGVALLALLIGEGAY
                     LYPRLHDSWKNLTEIHWGWVVACIVMQAISMSGYGRIQKQLLHAGGVAVSQRKSVSVV
                     YGSTGMALTLPAGQVFSTAFTYRQTRRWGASPIVASWQLVMSGVVAAAGLALLGVFGA
                     MLAGDRIGPVKVVLSLGAVALLVWAGNYVSAHPGAIEGALRRILRLVNRIRHRPVDDG
                     MDKVAEVLDQLESVDLGKRDGAWVALWAIVHRLADVACLGAACYAVGADPRLTGLMLA
                     FAAGKAVGTIPFAPGGIVYVDATLWASLATFAGLPFSQAVAAAFVYRLVSFILVAIVG
                     WIVFLFLYRKPQADDAEYEKEFEELRTAPPLSDTRRPNPPAAQDNPGPSPAV"
     gene            76117..76500
                     /locus_tag="H0264_00325"
     CDS             76117..76500
                     /locus_tag="H0264_00325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005569203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3054 domain-containing protein"
                     /protein_id="QLY30898.1"
                     /translation="MKKLVPFAVDVVLVVVFCMLGRSSHDEDVLAGLGRTFWPFGLGL
                     LLGWVIAVAVASGREGASAAKRFDGRAAWPTGVIVWVSTLVGGMLLRAVSGQGVAFSF
                     IIVATAFLGLFLVGWRVAMSILRTR"
     gene            complement(76497..78086)
                     /locus_tag="H0264_00330"
     CDS             complement(76497..78086)
                     /locus_tag="H0264_00330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="QLY34017.1"
                     /translation="MGSCAFRERTNSAESVVERFTNLLDERDYEGAARLTSYPNGASA
                     TLKQVFEGLDPGKPDYELTQFINLDGSTGLFSMTGAWDFGEKKNWKYDLQGTVRKLSV
                     GWRISWDPALVMPQLDSTRTAKLVRTYAAPSPKVNDIVGAPLMTEQTINVIKVDPAKT
                     GDLVGTTNALADAIEPVAPLITGATLMQQLSSSQGKPIVAVQLRDGDFNILESRMAVI
                     PGVVMEKQNRLISADRRVWSPMLDALRKVWQDSNDQHSGWGVQLFGQNGAFITQLAGE
                     QGPPGPDIPATMDQRLQRAAEDAVVSVGTPASVVAIQPSSGALVAVAQNSQASAHGSV
                     AFTGLYPVGGMIELFKNLAAVTKNKAPQDVSVNDAAEAATQLGVGIDFTVPGLDETTG
                     RLPNGKNGAENVGNGKAADNLLASPWGMAIAAAAIARGQVPKPMIAIGSPATTEADLP
                     ALPGNATDKLRAMLQEGSASPEMVTLNRYRDVSAYGSGGWLIATMGDLAFAIHIDDAD
                     SGDATARMAARMLQSLASPDD"
     gene            78503..79111
                     /locus_tag="H0264_00335"
     CDS             78503..79111
                     /locus_tag="H0264_00335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30899.1"
                     /translation="MRHGHHGRGFGRPGGWQQADLPDAADAEDWFAGRLPADWFTGPA
                     TLEIDRDEIVVVGELPLPAPEPAPADEADGPQDAVPNEVPRATREGLIARFRESTRPA
                     RMQIAQEAQARYGRSVAWGVSVGGERIMFTHLAVPVMTRLRQPERKVLDTLIDAGVAR
                     SRSDALAWTVRLAGKHAEEWLEELRSAMRKVDDLRSEGPRGL"
     gene            79248..79679
                     /gene="aroQ"
                     /locus_tag="H0264_00340"
     CDS             79248..79679
                     /gene="aroQ"
                     /locus_tag="H0264_00340"
                     /EC_number="4.2.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005248177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II 3-dehydroquinate dehydratase"
                     /protein_id="QLY30900.1"
                     /translation="MTGPILVLNGPNLNMLGTRQPEVYGADTLDDVVELCRKTAARFG
                     REVEDFQSNHEGALIDRIHAARGVNSAIVINPGGLTHTSVALRDALVIPEVPIVEVHI
                     SNVHAREEFRHHSFVSPIATAVIAGMGIQGYAAAVEFLCTR"
     gene            79807..80736
                     /locus_tag="H0264_00345"
     CDS             79807..80736
                     /locus_tag="H0264_00345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QLY30901.1"
                     /translation="MTVDGGVVLDVDQLRMRYGTRDVLRDVSFQAHRGEVLVLLGPNG
                     AGKTTTIEILEGFRMRSAGRVEVLGTDPAHGSEEWRARVGVVLQSWRDHGKWRVRELL
                     GYLGMFYEPYSTENIRRPWDTDELIAAVGLTEHAGAKIMSLSGGQRRRLDVAIGIVGR
                     PELLFLDEPTAGFDPQARREFHDLVHRLADDERTTIMLTTHDLDEAEKLADRILILAG
                     GRIIADGSADQLSRRISGEAEVKWTRDGQRFVHTTTESTKFVYELFQQHGEEIDELEV
                     RRASLEDTYMTLVQRFESGQGEFDVRTLEEVTR"
     gene            80733..81584
                     /locus_tag="H0264_00350"
     CDS             80733..81584
                     /locus_tag="H0264_00350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY30902.1"
                     /translation="MNPTTVAVRAGLRRGLIELRQNFTNGMDLFGQLFWPVGVMVALY
                     LMRNGTFEASGLGLGALALPGVLGMLIAFNGLFGMAQYLAVDREDGTLLRAKATPNGM
                     RGYLIGKIVLTAGTVFAPLVLLLVFGMAVIGGVELNSVSHWLTFIWVLLLGLVASLPL
                     GAVIGSLFESPRSIGFMSFPIMGLVAISGIFYPITSMPGWLQGLGQVFPIYWLGLGMR
                     SAMMPDSAAAVEIAGSWRHLETAAVLGVWAVLGLALAPILLRRMARRESGSNVAARRE
                     KAMQRAF"
     gene            81541..81810
                     /locus_tag="H0264_00355"
     CDS             81541..81810
                     /locus_tag="H0264_00355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016332057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QLY30903.1"
                     /translation="MSRRAVRRRCSVPSEVIYNRIAMLRAERGISRRELAEALGVHYQ
                     TVGYLERGEYSPSLHLALRIAQYFEVPVEIIFSTAPFPRIGSETA"
     gene            complement(81956..82828)
                     /locus_tag="H0264_00360"
     CDS             complement(81956..82828)
                     /locus_tag="H0264_00360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="QLY30904.1"
                     /translation="MSQQQRSVSVIGLGPMGQSMVKAFLKAGVEVTVWNRSADKADAM
                     VELGAKKAATVAEALDANAVTVLSLTHYAAMYSVLEQAADHLNGKVIFNLSSDSPEKA
                     RAGATWVRKHGAEFVSGGVMSAGDNIEHPASYIFYSGPRAVFDAHAELLRPLSPQEYL
                     GADDGLAQVFYQGLLTIFHPWLLAFDQATAMISRSGHDIAQFVPFAVRSSEAFPYFMQ
                     EFSVANQNGGWATLASLKMMDAGAQHIIDASEEVGVDATFSHTSQALWRKAIAASEEA
                     GRAVSTYELIRGGN"
     gene            82968..83327
                     /locus_tag="H0264_00365"
     CDS             82968..83327
                     /locus_tag="H0264_00365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QLY30905.1"
                     /translation="MESDSGADHDVCGMSVAIDVVGGKWKLHLMWVLGEGPQRFSHIR
                     RLLAGVSEKVLAENLRQLEASGVVHREIYPEVPPRVEYSLTPLGEDLNRALAPLEQWG
                     ERNRDQILGRTPVAAAS"
     gene            complement(83324..84442)
                     /locus_tag="H0264_00370"
     CDS             complement(83324..84442)
                     /locus_tag="H0264_00370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="QLY30906.1"
                     /translation="MTDARPRLVILAPDKFKGSLTAAQVAGALATGITRAAPATEVRQ
                     LPIADGGDGTVDAFLAAGWERVPVNSVGPTLEPVATEYAVQSDTAVIELAAVVGLAKL
                     PGGQPDPLHASTYGLGMVIAHALDHGARHIVLGLGGSASTDGGAGLLQALGLRIFDSN
                     GKELDESAGGAEGLATAARIDRSGLHPAVADTSFTLASDVDNPLLGPSGAAAVYAPQK
                     GATPDQIPILEAALKNWADLVGAEWADEPGAGAAGGTGFGAMAVLGAVERSGIQVVLD
                     LVDFPARIAGADLVVTGEGSMDAQSLNGKAPMGVATAAHRAGIPVVAVVGRLQLSRDQ
                     LRDAGFAAAHALSDLEPDPARSMANAAALLERVGEQLV"
     gene            84539..84862
                     /locus_tag="H0264_00375"
     CDS             84539..84862
                     /locus_tag="H0264_00375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="QLY30907.1"
                     /translation="MPSETIEVRKNSALDRFELYVDGYLAGVASYQDTASERAFVHTE
                     IYPQHEGLGYGRKLVQGALDQTRSEGLGILPMCPMVHHFVESRPDYLALVPQWSRGRL
                     GLPQA"
     gene            complement(84909..85670)
                     /locus_tag="H0264_00380"
     CDS             complement(84909..85670)
                     /locus_tag="H0264_00380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012688908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="QLY30908.1"
                     /translation="MEPPEVILENSDAVYDYYRDHQQNLVKAKAAYWLLNRRFRARVG
                     YAPGAREKLREYISQGRALLISINHLSQQDPYTVAAAAWNSALRPAIGRTRVLAKDEL
                     FEEPEQRRKIDMMGGIPVFRGKDHGIRAVNAAGQRMIDICAERMARGDGVAVFPEGTC
                     NDVDHTQVQAVGTGIGHIAFRARKLGADPVLVSLGLSYGPRPDPKIEPSKEEARSASF
                     YFGVPVPELPLKPAEITRVVRDELQIALDGAVAAY"
     gene            85862..86476
                     /locus_tag="H0264_00385"
     CDS             85862..86476
                     /locus_tag="H0264_00385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqgE/AlgH family protein"
                     /protein_id="QLY30909.1"
                     /translation="MARAEEHGDRSRREFRREDQVVRPGTLLVSATDLTEPSFRRTVV
                     YIVEHNDAGSLGVVLNRPSDTAVADVLPQWADLAADPRTLYIGGPVKRDAALCLATMK
                     VGVAFTGVPGLRRVDGRVALVDLDSDPDTIEPLVEGLRIFAGYAGWTFGQLEGELDRG
                     DWIVLSALPTDPLATRADLWAAVLRRQPLPLSLLATHPIELERN"
     gene            86520..87026
                     /locus_tag="H0264_00390"
     CDS             86520..87026
                     /locus_tag="H0264_00390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012688216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="QLY30910.1"
                     /translation="MPDDQAALLRAIYEEHAAALWRYTFGLVGDPGRAEDIVQETLLR
                     AWQRPAILDQSTTSARAWLFTVARNLAVDEHRSARSRREFRTDHPPEQSQPDQSDRAL
                     DGWLVADALAQLSRDHRDVIVRAYYRGLSTHQIAAELDIPEGTVKSRMHYGMRALRLV
                     LQEMGVTK"
     gene            87023..87733
                     /locus_tag="H0264_00395"
     CDS             87023..87733
                     /locus_tag="H0264_00395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014988994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zf-HC2 domain-containing protein"
                     /protein_id="QLY30911.1"
                     /translation="MTESQELCDAYATWDGAYVLGALARDERREYEDHLVGCDRCKSA
                     VTELAGLPGLLALVDEETAVSVAAQEDPPSTVPPPPDRLLPKLAEAADRKRRRGRWLA
                     LGGAVAAVAAAVAVAIPVTADIVSHRPPAQEVVAEGSFQANVDTTIVATFKVLAVDGQ
                     TRVDMWCSYPPSNSIYAWQLSLWVVRQDGTQSKLAEWTAKPGEVYTPDGTTSAAPGDL
                     KTVEVRNASGNVLLSAGL"
     gene            complement(87832..88632)
                     /locus_tag="H0264_00400"
     CDS             complement(87832..88632)
                     /locus_tag="H0264_00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019890941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY30912.1"
                     /translation="MTTITGTPLAAPLKSHPLADVKTMLMRNLLHAKRYPSMVFALIV
                     MPVMLLLLFNYVFGGALGAPTGEKYINYLTPGMMLMIPAYMVAGVAVSISTDMTKGIV
                     NRFRSMHISQSALLTGEVLGSWIMGMLGVLGMTLVALLIGFRPHANPLEWLAAFGLIG
                     LVIFALSWLGVAFGLIAQTPESASNMPMPILFLPFLGSGLVPTDTMSNGVKQFAEYQP
                     FTPITETLRGLLMGTEIGHNGILALAWCLAIAVGGFFWSTSLFRRKTR"
     gene            complement(88629..89642)
                     /locus_tag="H0264_00405"
     CDS             complement(88629..89642)
                     /locus_tag="H0264_00405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="QLY30913.1"
                     /translation="MHSCILIYRKGDTVYSELRSSAISVTGLNKSYGEHIVLDRIDFE
                     VPEGSIFSLLGPNGAGKTTTVQILSTLLRPDGGEITVGGYDLATAPDGIRSTIGVTGQ
                     FSAVDELLTGRENLVLMGDLHHLPRRESVRLAADLLERLDLVDAADKVASSYSGGMTR
                     RLDLAMTLVGDPRIIFLDEPTVGLDPRSRRAVWDIVRGLVGEGVTIFLTTQYLEEADQ
                     LADRIAVLHGGRIVAEGTADQLKRLVPGGYIKLDFAEPGEFIAAARALGDCAQSSGEL
                     TLAIPSDGGVRSVREVIDRLDTVGIEPQGLSVHTPDLDDVFLALTGSNPAATASTEKE
                     IAR"
     gene            complement(89726..90250)
                     /locus_tag="H0264_00410"
     CDS             complement(89726..90250)
                     /locus_tag="H0264_00410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013809125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EXLDI protein"
                     /protein_id="QLY30914.1"
                     /translation="MPNKTIYVSDEDLKLFQRAQELVGGNLSGAIVTALRRFIELEEG
                     RVEGYDEVILKVGRDGVRQVRFSGQLLTEWHQVTNERIEDIRVYRTRKGAFAVHSHFS
                     NFSEMPTDVNILKNWKDMTSWRRFLGLGEQEWGDFNLDVVDTVEEVEALVPPQVYARV
                     VGMSGGPIVEDLDI"
     gene            90443..92107
                     /locus_tag="H0264_00415"
     CDS             90443..92107
                     /locus_tag="H0264_00415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate-binding protein"
                     /protein_id="QLY30915.1"
                     /translation="MHSGSRAADYLVQAISTLGVGHIFGVGGANIEDLYDAAFDHRQA
                     LTAVVAKHEFSAATMADGYARSTAGLGVVAATSGGGAMNLVAGLAESYTSRVPILALI
                     GQPPTALEGRGAFQDSSGRAGAIDAVRLFSPISQYCARVEHPSRLPAHLACAVAAAQR
                     GGPAVLLLPKDVQQAELSAPPFQPPVRGYRRDIENLWRVVDAVRSARATGKIVIIAGD
                     QIARDDARDELARLAAVLDAAVGVAPDAKDVYHHADPGFCGVAGSMGHPELVDALHNA
                     ALCLLVGTRMPVTARAGLEDSLAGVRIASLGAEPPYLAAVHAHTNNLATTLGELITPA
                     FEEEGEQAAALTPLAVPPSDGPGLRYREVVETINAELPEGADVFADAGNTGAAVVHHL
                     RLPRDGRFTVALGMGGMGYSFGAGIGSAFARGRRPDGSPRRTFVIAGDGAFFMHGMEI
                     HTAIEHNLPITFLVFNNNAHAMCITREQVYYGDRYSFNRFRPAHPGAGVAAMFPDMCA
                     HAPTTVAELAASLRHCVGRPGPSFIAVDCDPDEIPPFTPFLTAPRR"
     gene            92110..92769
                     /locus_tag="H0264_00420"
     CDS             92110..92769
                     /locus_tag="H0264_00420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRPBCC family protein"
                     /protein_id="QLY30916.1"
                     /translation="MTTSALPALSDIPEEVVPGVLRIENSDREATTPIILDMLRSVYP
                     HDQVFGEFCPVQGYIDAPPRELFEYLSDTRSLEEWTYSLRGFEQTEEPGLWVSYDRLG
                     PNTRIYTRTVANPESMTVDYHCAWDQGEHLWMIYLMRVVDAQVVFDKPGSVVLWNNCH
                     HPFYDKNPYQDTAPEGRKVWVGDFWEMFSAGHQLELDNLKAIAEYRVSHGLPVKPAWM
                     D"
     gene            92779..93819
                     /locus_tag="H0264_00425"
     CDS             92779..93819
                     /locus_tag="H0264_00425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="QLY30917.1"
                     /translation="MDFTDPNLRTVPVSLVDVSSYLPGKPVGTEYFTQFSRSERMAKN
                     VMFRAPKARHHVQRDETAVDMAERAVAGLIERHGAQEISNIDVLLTHTQLPDNPVLGC
                     GPEVARRLNMRPGWVFDVHNGGCAAFVHMMSLARMILRTTDARTALIVTAQNCAGPVF
                     TQTEIRGLAQAPVPGDGCGAGLLVKNNDAPILDIECRTYPEFAGDMDFSTGSDRKYWE
                     PGEGQGCVTFSESKVAKVFSRGNRLVPEVALTVCERIGVKSRDIDTFVTNQPNRLFLR
                     NWHDALELPAERHPDTFDDCGNLFAAGIPVTLDTENRAGRLRNGSIVLMSAFAHAGDF
                     AGAAAVRWGAAR"
     gene            93816..94964
                     /locus_tag="H0264_00430"
     CDS             93816..94964
                     /locus_tag="H0264_00430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006943753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class I/II-fold pyridoxal
                     phosphate-dependent enzyme"
                     /protein_id="QLY30918.1"
                     /translation="MTPQPGADVAAAEAHVAAQRDASVSGSPRFDAVRYDLTLSENPF
                     PPLPSVRAAIEGCLARANRYPEFLPRLLPQVIAEHLGVEADHIVVGAGATGVAMQIMQ
                     TLPARGSRFIFATPTFDGYPILANQVGLHTVQVPLDGSGRQNLWSILRAVDERTGLIA
                     VCRPHNPTGTVVPASELKGFLYSAPSHIPIILDEAYVEFLGAADTLDPVELVRRHPNV
                     IVLRTFSKAYGLAGLHIGYGFGSPELLARVRRLQLPFGMPEAAIAAVRASYAAEAELG
                     ERILRITTQREVLRTALRRTGIRVPRSSGNFLYLPGRDIAATLTHAGIAVKRYADGSA
                     RIAVGDPEADRAVLNALAAPVDPISGEDSHILSLTLRSGPSAVRSRHR"
     gene            complement(94918..95886)
                     /locus_tag="H0264_00435"
     CDS             complement(94918..95886)
                     /locus_tag="H0264_00435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="QLY30919.1"
                     /translation="MRFLSKFYIDGFILSILGAVVVASIFPARGEAATAVDWLTKIAI
                     ALLFLLYGTRLSPQEALAGLKHWRLHVTVLACTFVLFPLIGLAAHVLVPGILTDDLYT
                     GVLFLCLIPSTVQSSIAFTSIAKGNVAGAIVSATVSNLLGVFLTPALVILLMNTTGQA
                     QVDPSAILDIVLQLLVPFFVGQLLRPRVIGWLRRYAEPTKLVDRGSIVLVVYAAFSAG
                     MVEGIWHSLSPWRILAVAGVCAVMLAIVLGATVFIGRAAGFDRADRIVVVFCGSKKSL
                     ATGLPMATVLFAGSPVGLIVLPLMIFHQIQLITCAAIAQRWARTAA"
     gene            95990..96961
                     /locus_tag="H0264_00440"
     CDS             95990..96961
                     /locus_tag="H0264_00440"
                     /inference="COORDINATES: protein motif:HMM:TIGR04222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR04222 domain-containing membrane protein"
                     /protein_id="QLY30920.1"
                     /translation="MVTWILAAGADAPAATVWAAADNPAVAAATWGIPGRTFLGLYLI
                     VALLAAGYGFTQRARIIRDTAHTRPHAHPLTVTETAMLFDDRRPVLTGLAQLRGHGLI
                     TSSGTPTGSPHRGAEQSLDRFSQALLGYLRTSHKKHVLAMSGASRGPLKTLRKSLEDR
                     GYLLSREQRRALLLAALPLDAVFVLGLVRAVAGSSNDQPIGLLILAMIGVFILAVLVL
                     RPVRLTHQGRQARQETVRRNSHLRPGNSPAYTSYGMDSAAMATALFGALVLWQLDPEL
                     AGTTGMTTGGGSSGSSGSSCSGGSGGSSCSGGGGGGGGCGGGGGCGG"
     gene            96958..97923
                     /locus_tag="H0264_00445"
     CDS             96958..97923
                     /locus_tag="H0264_00445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF692 domain-containing protein"
                     /protein_id="QLY30921.1"
                     /translation="MSTPNPLSDGIPDSNTPSHGTGGPLPAGALGIGWRREICGIIAG
                     LDGISFCEVIAESLPRTTPRGQRAVLGRRRSDPRFEVTVPDELEALRSTGVAVVPHGI
                     SLSLGSAEEVDAARVAHMAACARALGSPLVSEHIAFVRAGGMEAGHLLPVPRTREALD
                     ALARNISRTQRELEVPLAVENIAALFEWPDAEFSEAEFLRELVERTGVYLLLDIANVY
                     ANARNRSQDPLTELLSLPAERIAYCHVAGGREAGGRYHDTHVHPVPDEVLGLVAEFTA
                     HNPVPLMLERDGNYPPASELVAELSAIARAAGRPAITLRPEAPVA"
     gene            97998..98300
                     /locus_tag="H0264_00450"
     CDS             97998..98300
                     /locus_tag="H0264_00450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014361043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34018.1"
                     /translation="MAQRQEELVRALVAGGEVPAGFDPAALGATAHALLHKRAEEVAH
                     RFPRLAHDAGPEYTAKYIAWARTRPKVSTAADAEAFAADHDLPPRPPRRRLRDLFR"
     gene            98406..98705
                     /locus_tag="H0264_00455"
     CDS             98406..98705
                     /locus_tag="H0264_00455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30922.1"
                     /translation="MTTLEHAVHTDHDHVHGPSCGHVAVPHGDHVDYVHDGHLHRSHD
                     GHFDECEPTGHVSCEHADHTHGEGCGHVAVPHGDHVDYIHDGHRHASHNGHYDDH"
     gene            98792..99214
                     /locus_tag="H0264_00460"
     CDS             98792..99214
                     /locus_tag="H0264_00460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="QLY30923.1"
                     /translation="MPFFRADPSRGFRPNAAPAVGTASRVLFRRTLAGREFVLRQTVI
                     EPGGDSGWHFHDGTLFVLVTGGDLDHPGLDCLPVTKRRGRVFREPSGREHAHLARNGG
                     TKPVKLTVLYIDPPGSPLSRSVPPPPCATVPDSGDAAH"
     gene            99229..99663
                     /locus_tag="H0264_00465"
     CDS             99229..99663
                     /locus_tag="H0264_00465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017616962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="QLY30924.1"
                     /translation="MIEVVTVATEQELSDAYAVRLQVFVEEQGVPEEEELDALDATAD
                     HFLARVDGLPAGAGRMVVRDGVGVLGRLAVLKEARGTGLGVALVRAIEDKVRERGLDA
                     VELHSQTHAQGFYERLGYQAYGEIGMDAGIPHIWMRKVLDGR"
     gene            complement(99683..100096)
                     /locus_tag="H0264_00470"
     CDS             complement(99683..100096)
                     /locus_tag="H0264_00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SdpI family protein"
                     /protein_id="QLY30925.1"
                     /translation="MVLVVALILFALSAVAVVTGVLGLTGTLPPNRFVGVHTEEAMRS
                     EDAYKLANKVAAPTSLVAGVLLAASAGVALMSGGVVSWIVPLLAVVVAVFTLGAGAAA
                     AGSAIDKAFPAKAQVGGCGSACGSCSLRSTCETAH"
     gene            100260..103127
                     /locus_tag="H0264_00475"
     CDS             100260..103127
                     /locus_tag="H0264_00475"
                     /EC_number="6.1.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine--tRNA ligase"
                     /protein_id="QLY30926.1"
                     /translation="MQDTRATDTSAASAAAGGDVPAHRYNADLAGRVEKKWQQNWQER
                     GTFFAPNPVGPLGGEIPADKLFIQDMFPYPSGAGLHVGHPLGYIATDVFARYHRMHGR
                     NVLHALGYDAFGLPAEQYAVQTNQHPRVTTESNIATMQRQLDRLGLGHDRRRSFATTD
                     PEYYKWTQWIFLRIYNAWFDEGQGKARPISELISEFESGKRAANGHEWSQMSTSERNA
                     VIDSYRLVYQTDSMVNWCPGLGTVLSNEEVTADGRSERGNFPVFRKRLWQWMMRITAY
                     ADRLVDDLDELDWPENVKSMQRNWIGRSRGAQVKFEAGSDVVEVFTTRPDTLFGATYV
                     VLAPEHELVDRLVAAAYPAGTDARWTGEGANPVEAVAAYRKSIAAKSDLERQESKEKT
                     GVFLGSYAINPVNGARLPIFIADYVLSGYGTGAIMAVPGHDQRDWEFATAFGLPILEV
                     IAGGDVSESAYSGDGALVNSGFLDGMDVETAKAEIIAKLEADGHGTGKIQYKLRDWLF
                     ARQRYWGEPFPIVYDEDGAPHALPESMLPVLLPEMEDFAPVTFDADDANSEPSPPLAK
                     ATDWVHVELDLGDGPKKYRRDTNVMPNWAGSSWYQLRYADPTNTEAFCAPENEKYWLG
                     PRTAEHGPKDPGGVDLYVGGVEHAVLHLLYARFWQKVLFDLGDVSGYEPYRRLFNQGY
                     IQAYAYTDERGAYIPAAEVVERDGKFFWTNQSGTEIEVFQEYGKIGKSLKNAISPDEM
                     CDLYGADTFRFYEMSMGPLDTSRPWSTKDVVGAHRFLQRVWRLVVDEESGAVKVTDAE
                     PTPETLRLLHKTIAGVDDDYANLRDNTAGAKLIELTNHLTKVYPAGAPRSVVEPVVLM
                     LAPMSPHIAEELWERLGHTTALAHGPFPVADPALLVADSVEYPIQVNGKVRSRVSVPA
                     DADQAAVQAAALADEKIAELLGGKDPRKIIVVPGRLVNIVA"
     gene            103311..103604
                     /locus_tag="H0264_00480"
     CDS             103311..103604
                     /locus_tag="H0264_00480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019465475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GIY-YIG nuclease family protein"
                     /protein_id="QLY34019.1"
                     /translation="MDCRQPCVYILASEPNGTLYVGTTSNLAARVWQHRNDVVAGFTE
                     RYGVHSLVWYETHEMMQSAIIREKRIKRWRRAWKIRLIESVNPEWNGLYPALL"
     gene            complement(103742..104215)
                     /locus_tag="H0264_00485"
     CDS             complement(103742..104215)
                     /locus_tag="H0264_00485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009107528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34020.1"
                     /translation="MALTAAITLAACGSDTKDEAGPVSSTAPVSAAPTGGATTSKAAT
                     AGAISVRSLGGRDALADASGRALYLFTKDTPNTSTCAGDCLAKWPAVPATATAGAGLD
                     AAKFGAITRPDGAMQAAYAGKPLYYFAGDKNPGDTAGQGVNGVWYLIDATGAAIR"
     gene            complement(104345..105163)
                     /locus_tag="H0264_00490"
     CDS             complement(104345..105163)
                     /locus_tag="H0264_00490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006900412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase family protein"
                     /protein_id="QLY34021.1"
                     /translation="MDRRGLLTLLAAGTAVALTGCNQAHSDPIGSGSSGGQPFELPDN
                     FPSGSGGGGKTLPAPPSGPKTRIPAGTITALPGAGTSMALTVDDGASPEVVGAYIKFA
                     RDTGARFTFFVTAYYDSWTTHRDALRPLVESGQIQLANHTWDHADLTALSGTGVADQL
                     NRAKTFLRNNFGVDGTPYFRPPFGRHNAAVDAIAADQGYTVPTMWYGSLSDSGVITEE
                     YLLQCAREYFNAQTIVIGHANAPAVTHCYDQLADIIRERNLSMVTLNDVLLPPT"
     gene            complement(105315..106019)
                     /locus_tag="H0264_00495"
     CDS             complement(105315..106019)
                     /locus_tag="H0264_00495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="QLY30927.1"
                     /translation="MPNSAESSSVQPTALVTGASRGLGAAIARELAPAHRLLLGARTP
                     EALEPILGELPGATGWPVELTDYAAVARAVEPIDRLDVLVHNAGIADLGTIADSSVAQ
                     WRNTLEANLIAVVELTRLLLPALRAANGHVVLINSGAGLRANAGWSAYAASKFGLRAF
                     ADALRLEEPDLRVTSVHPGRIDTDMQRAIIAGEQRDYQPREFLTPETVARAVRNAVET
                     PRDAHPTEVVLRPIPR"
     gene            106491..107831
                     /locus_tag="H0264_00500"
     CDS             106491..107831
                     /locus_tag="H0264_00500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen debranching protein"
                     /protein_id="QLY34022.1"
                     /translation="MTQPGFTPTQLAARAAYLLRGNDLGTMTSAAPKLYPHMWSWDAA
                     FVAVGLAPLSVERAALELDTLFSAQWRNGMIPHIVFANGVDGYFPGPSRWECRRLAAD
                     APDGPDTSGITQPPVHAIAVQRILDHSRRHGRSTRAVAEDFLNRRWPDLMRWHRWLAY
                     ARDPKQNGRITLYHGWESGMDNSPRWDRAYANVIPGPDLPPYQREDLHVVGDPTQRPS
                     DREYDRYMWLVEQMRRAGYDDYQLASTMSFAVEDVFVTAIFALACDVLANIGEDYKQP
                     LADVRELYQWADYFRAGVIATTDARTGAARDFDVREDKWIDTETLACFAPLLCGGLSR
                     DSERRLLRLFEGPRWCGHPDLRYALPPSTSPVSKDFRPREYWRGPVWPVMSWLFSWLF
                     ARRGWAERSFMLRAEGLRQASDGTFAEYYEPFTGEPLGSMQQSWTAASVLDWLG"
     gene            107914..108669
                     /locus_tag="H0264_00505"
     CDS             107914..108669
                     /locus_tag="H0264_00505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 25 protein"
                     /protein_id="QLY30928.1"
                     /translation="MYLSRNRSPKARRRYLIAPALAVAGTLLATGVAAAEEGPDVSSW
                     QHPGGSGINWFAVRGAGHRFAMVKATEGLNYINPHFVPDSLLMRAAGVARGTYHFARP
                     ALLPEAQAAFYSAIVLGQNGPLDLPPVLDLEDSGGLPAPALIDWTHRYLNTVQALTGR
                     VPIIYTGVNFWKTAMANSNEFTRYPLWIADYRGNDDPEVPGGWPAWTFWQYTDSGSIP
                     GIPGATDINVYSGAQGDLARFANMPSSGSAGSS"
     gene            complement(108822..110888)
                     /locus_tag="H0264_00510"
     CDS             complement(108822..110888)
                     /locus_tag="H0264_00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005256044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoX family phosphatase"
                     /protein_id="QLY30929.1"
                     /translation="MSIKPLALFVKHDGASARSSVTCQYKCGNACFHEVPNTSKNEYF
                     GDIVAGISRRRLFQGSAAVVLAAGAGSALAACGSDDTEKAAAVQNPGTGVGTGFDPVA
                     PNKEDAVVIPKGYEQSVVIRWGDPVLPDAPKFDFANQTAAAQAKQFGFNNDYSALLPI
                     AGKDNSFLLIANHEYTTEPAMFAGYKADAPTREQFEIALAAHGLSVVEVKGEQGSGKL
                     TPVLGQYNRRITGTTEFTVTGPAAGSDFLKTSADPTGAKVLGTFNNCSGGVTPWGTVL
                     SGEENFNQYFAGVIADETGQARGKRYGLGHPGAGQGEMPRKWETFDKRFDTAQEPNEA
                     NRFGYIIEVDPWDPAGTPVKHSAMGRFKHEAANIFVTADGTVVAYSGDDERFEYMYKF
                     VSSKKIQPGDTAAARKANMTILDEGTLYVAKLTGDHPDQIDGTGKVPSAQGFTGKGQW
                     IPILETGADGKGRSLVDGMTAAEVAVFTRLAGDKAGATKMDRPEDFEASPFTGKVYVA
                     LTNNKNRGDEGKAVVDEANPRKQNKNGQVLELVDDHKGTSFTWSLLLVCGDPKEADTY
                     FAGFDKTKVSPISCPDNLAFDPHGNLWISTDGNALKSNDGLFSVVLEGANRGETKQFL
                     TVPIGAETCGPIVTKDRVLVSVQHPGELDGASADKPGSHWPDGGTSQPRPSVVVVWKT
                     NGEIGV"
     gene            complement(111021..111746)
                     /locus_tag="H0264_00515"
     CDS             complement(111021..111746)
                     /locus_tag="H0264_00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005249317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="QLY30930.1"
                     /translation="MSASLTGKGLHLTLGRNHVLRGVDIHVDAGKTTTVIGPSGSGKS
                     TLLRVLNRLHEPEQGDILLDGTSVLAENPDALRQRIGMVFQHFNLFPHMTVADNVALG
                     PVKLHKLSKEQGRTLALEQLEAVGLSGKADARPANLSGGQQQRVAIARALAMKPQIMF
                     FDEATSALDPELVKGVLSLMAELARGGMSMIVVTHEMGFARSVSDRVVFMDHGQVVET
                     GTPEALFDSAETPRLRQFLSQVL"
     gene            complement(111743..113488)
                     /locus_tag="H0264_00520"
     CDS             complement(111743..113488)
                     /locus_tag="H0264_00520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005256062.1"
                     /note="The N-terminal region of this protein, as described
                     by TIGR01726, is a three transmembrane segment that
                     identifies a subfamily of ABC transporter permease
                     subunits, which specificities that include histidine,
                     arginine, glutamine, glutamate, L-cystine (sic), the
                     opines (in Agrobacterium) octopine and nopaline, etc;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="QLY34023.1"
                     /translation="MLTLGAGPAVAAPDSGDLCSPPGLSAATALPPNLATGTATAASD
                     KFTTATTEPLDRIDKSKLGLLTAGKLSVGTLSDAPPSICVNSKGAFTGFDNELLRAMA
                     DKLGLQIEFVGTEFSGLLAQVANGRFDVGSSNITTTDARRQLVGFTNGYDFGYFSLVV
                     PNGSGIKGFSDLNRGTRIGVVQGTVQDDYVVNELHLDPVKFPDYNTAYANLKTGQIDA
                     WVAPSAQAQGAIKPGDATSIVQNTFSLNNFVGYAVRKDNQPLTNALNSALDAVIADGT
                     YAKLYEQWVPREIPPGWKPGSKAAPVPQLPDFARIAAENAANAPADVAVAQPKSTLQQ
                     LKDTFFDWSLYKKAFPDLIKTGLPNTLILALVSGVLGTVLGMLLAVAGISRTRWLRWP
                     ARVYTDIFRGLPAVVIILLIGLGVGPVVKNITGNNPYWLGAVALALLAAAYIGEIFRS
                     GIQSVEPGQLEAARAIGFGYRQAMTLVVIPQGVRRVLPALMNQFIALIKDSSLIYFLG
                     LLATQRELFAVGRDLNAQTGNLSPLVAAGLMYLLLTVPLTHLVNYIDKRLRTGREEQP
                     IDPVEQAVITEGRGA"
     gene            complement(113643..114437)
                     /locus_tag="H0264_00525"
     CDS             complement(113643..114437)
                     /locus_tag="H0264_00525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005570362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class F420-dependent oxidoreductase"
                     /protein_id="QLY30931.1"
                     /translation="MSRPVRIGVQLQPQHAPEYGLIRDAVRRAEDLGVDIVFNWDHFY
                     PLYGDPEGAHFECWTMLGAIAEQTERVELGALVTGGGYRNPDLLADMARTVDHISGGR
                     LILGIGAGWFQKDYDQYGYEFGTPGTRLALLKDYMARITDRLAKLNPQPVRDIPILIG
                     GGGERKTLRLVAQYADIWHSFADLEVLRRKSGILAEHCAEVGTDPAGIEKSVSWPGSD
                     EAAAFVAAGATLFTVGVGGPEYDLSRVAEAIAWRDSFNPESVTGIA"
     gene            114583..116646
                     /locus_tag="H0264_00530"
     CDS             114583..116646
                     /locus_tag="H0264_00530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014986074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="QLY30932.1"
                     /translation="MSTTAKARPGTAGPTRHSADDGHGHGHGGLLGPRAEMVFAITSG
                     LTYAGGMLARYIFDSPPWLATTLFLATYFFGGFFTVRTAVHTVRRGRFEVDFLMLVAA
                     VGAAAVGKWAEGSVLLFLFSLGHALEEYAMSRAQRSISALAELAPRTAFIRRGPDTVE
                     EIDVDALTVGDVIVVRPNSRLSADGIVVAGVSAVDESAVTGESMPVEKQPAPDPGAAL
                     TSNTPLPEAQRVFAGTLNGSGVLEVMVTSRASDSTLARVIAMVRDAETQKSPTQRFID
                     RFQLFYVPAVILGVLAVIAFGAWVLTEPFTDSFYRGMVVLVAASPCALAIATPSAVLA
                     GVARAAQAGILAKGGGPLESLGRVKSIAFDKTGTLTWGQPRVTDIEPARPELREQLVA
                     TLYAVESFSDHPLASAITRDLAPLVPAEPELTATQVNSVTGRGVTALVNGVATEIGNT
                     TMYYELDPDGLPTAILTTVDRLHAAGRTTMIVRSGGVYLGVVGVMDTPRAEAAAVMDH
                     LRALGISDLIVISGDNQRVADAVADGLGLDAAHGGLLPEDKVDMIGRLRAEGGTAMVG
                     DGVNDAPAMVNSSVGIAMGASGSAVALETADVALMTDDIGRLPFAVALSRRTAAIIRQ
                     NLTVALIIVAGLVPATLIGLPIGPAVFIHEGSTLLVVCNALRLLRFRRGTEHAGIDHE
                     SRPGS"
     gene            116720..117817
                     /gene="ugpC"
                     /locus_tag="H0264_00535"
     CDS             116720..117817
                     /gene="ugpC"
                     /locus_tag="H0264_00535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate ABC transporter
                     ATP-binding protein UgpC"
                     /protein_id="QLY30933.1"
                     /translation="MATVTFDSATRLYPGATTPAVDALNLDIEDGEFLVLVGPSGCGK
                     STSLRMLAGLEEVSTGRILIGDKDVTHAEPKERDIAMVFQNYALYPHMSVAENMGFAL
                     KMAKVSKAEREQRVLEAAKLLDLEQYLGRKPKALSGGQRQRVAMGRAIVRQPQVFLMD
                     EPLSNLDAKLRVQTRTQIAQLQRRLGTTTVYVTHDQVEAMTMGDRVAVLKDGLLQQCA
                     SPRDLYRNPANLFVAGFMGSPAMNLFTLTVENGAVELGGYRLALPRTVADATDGTVVV
                     GIRPEHFEITGGANGLSKEPTGITMEVDVVEELGSDAYVYGRALGANSQESIVARADW
                     RNPPAKGSRLVLTADTEHIYFFAPADGRRLN"
     gene            complement(117849..118364)
                     /locus_tag="H0264_00540"
     CDS             complement(117849..118364)
                     /locus_tag="H0264_00540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QLY30934.1"
                     /translation="MMSVMSFVLEGPLSDLSSWKPEGCSIAKAMDIVGTRSAILVLRE
                     AYYGTTRFDGFAARVGVTDAAASSALRKLTAAGLLEKRPYQEEGKRTRNEYILTEMGL
                     DLIPVVVGLWQWGDKYLQDGVAPLERLEDSTGEPVRVELRSASGREVPPEHLRVRVND
                     AWRRKRKAAGS"
     gene            118451..119620
                     /locus_tag="H0264_00545"
     CDS             118451..119620
                     /locus_tag="H0264_00545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009478803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiolase family protein"
                     /protein_id="QLY30935.1"
                     /translation="MRDAVIVEAVRTPIGKGKPTGALHGIHPADLLAHSLREVVRRSG
                     IDPILIDDVIGGVVTAVGEQGSNLTRRAALAAGYPESVPATTVDRQCGSSQQAIHFAA
                     QGVIAGAYDIVVAAGVESMSRVPMGTNLIGAEDVSGLGFAERYPDGLVPQGISAELIA
                     ARWQLSRTQLDEFALSSHEKAARATKNGSFEAQIAPIAGVSLDEGIRVGSTLETLGGL
                     RPAYFSEEMAARFPEIGWNITAANASQINDGSSAVLIMTSERAAELGLRPLARVHSFA
                     VAGDDPLLMLTAVIPATRKVLQRAGLQLSDIDLFEVNEAFSSVVLAWAHDTGADLGKV
                     NVHGGAIALGHPLGASGARLATTLVHALQETGGRYALQTMCEAGGLANATIYERL"
     gene            complement(119626..119991)
                     /locus_tag="H0264_00550"
     CDS             complement(119626..119991)
                     /locus_tag="H0264_00550"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30936.1"
                     /translation="MAAVVTGHSGDMVEWWRPPGRSLDLVVATVIYVLACGAAWFAAL
                     LVPEYGALVADTGRDRYLPLAYAVGWFGIIATLMLVPLWTLHAIRLGQRAWPTALLAF
                     PMLAFSWLAGLLVAMVAVS"
     gene            complement(120035..120541)
                     /locus_tag="H0264_00555"
     CDS             complement(120035..120541)
                     /locus_tag="H0264_00555"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30937.1"
                     /translation="MEPFGAENRSSAGSFGGTSVLTEDDVETAKRPLSVPEGSEAGSG
                     VAVGAGPLRKRNVLIAVAVYAADVVAAFVLGYLVLGKLSGLIHNRCTAKRDFSVQCDV
                     IRPPTSGLLGLLIAGGGISLALVAALVLASVAAVTRRNAWLWTAVAFPVIVVAGLAGY
                     FLVNGAVS"
     gene            121890..122981
                     /locus_tag="H0264_00560"
     CDS             121890..122981
                     /locus_tag="H0264_00560"
                     /EC_number="4.2.1.113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019811777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate synthase"
                     /protein_id="QLY30938.1"
                     /translation="MALAPRVDRCFLRILSGWEIQCHSDSRAGTVSRVSDVSERVDTP
                     DFAGAVVYAIPLRTRFRGITVREGMLIPGPAGWGEFCPFPEYDDREAAGWLATAVEQA
                     TIGWPRPVRDRIPVNCIVPAVGPERAREIVAASSCRTAKVKVADHPDSLGADLERVAA
                     VRDALGPDGAVRIDANAVWDVDTAVDRIEQIDRAAGGLQYVEQPCRTIEELAAVRRRV
                     DVPIAADESIRRAADPMRVAVAGAADIAILKCTPLGGVRRALQVAEAAALPCVVSSAL
                     ETSVGLAAQIALAATLPDLDYACGLGTLSLFTADVVTDSLRPVDGWLPVPQTPPEPDP
                     ELLARYLHPDPERTEWWRQRLDRVRKLLD"
     gene            complement(122986..123492)
                     /locus_tag="H0264_00565"
     CDS             complement(122986..123492)
                     /locus_tag="H0264_00565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR04338 family metallohydrolase"
                     /protein_id="QLY30939.1"
                     /translation="MVRDSQRSRVYDAEGLVRGMFERADEFGARTVELHGSQLTLPIE
                     RRFASVDSIQDYVNRVLALNWVRARWERAATPITVRSRAGTKAAHYECEGAVLAVPLH
                     ARGTAWALRELVVLHEIAHHLDPNPGDSAAHGPEFCDRYLELLDGVVGPEAALLMRTT
                     MFDCGVRI"
     gene            complement(123482..124300)
                     /locus_tag="H0264_00570"
     CDS             complement(123482..124300)
                     /locus_tag="H0264_00570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2786 domain-containing protein"
                     /protein_id="QLY34024.1"
                     /translation="MLTRIGGLLRQAESTDNEHEAEAFLAAAQRLATRSSVDLAVARS
                     HIANREKRPTPVQRVIPIGEPGKKGLRTYVQLFVAIAHANDVRCDVARTSTTVYAYGF
                     DTDIDTCEALYASLLVQMVRASDQYIKSGSYKTATTPKLVTETRWGRKVQRKVQAPVA
                     AVTARLNFQMAFASRIGARLSEVKADVEAEAVRADPAEKASAGTALALRNKELELTDF
                     YKSTSEARGTWRGPQASAGYSAAARRAGDRAGRAARLGTAPELGAARAKLTDGS"
     gene            124467..125771
                     /locus_tag="H0264_00575"
     CDS             124467..125771
                     /locus_tag="H0264_00575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="QLY30940.1"
                     /translation="MALKKVSSLRSSLVPRAAFAAASVALLTATFATACSSDSGSNAI
                     SQNLTGRGPITYVEGKDTTETGAVKQLIERWNAAHPDEKVTFKEQSNDASQQYDDLKQ
                     HLKAKSADYDVFAMDVPWTAEFAASGWIQPLKDSFALDTGTLLSPPVESAKYNGTLYA
                     APRNTNGGLLYYRKDLVTEAPKTWTELLAQCPKAKEAGIGCYAGQFAPYEGLTVNTAE
                     VINAFGGSFVGPDGKTPTVDSAQSRAGLATLVDAYKNGDIPKEAISFKEPESQNAFVT
                     GKLMFMRGWPSSFGDAGSDASAVKDRFAVAPLPGKDGIGASTLGGYNAAISAYSKNKA
                     TALDFLRFLISEDAQHIIATGALPSVRASVYDDPALIAKMPYLPALKESIASAVPRPV
                     TPFYDAVSKAVTDNAYAALTGTKSVDDAIVGMQKGIETAGSR"
     gene            125862..126836
                     /locus_tag="H0264_00580"
     CDS             125862..126836
                     /locus_tag="H0264_00580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020110450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="QLY34025.1"
                     /translation="MKPQSARPKGRAALSDTAKGWLFVTPVLVALAVVIGYPVGRALY
                     MSFQKDAGLDPATGMFVEGGSAGFDNFKHWLLQQCTNSLGETVSCPTGNLGSQFWLAI
                     GVTLFFTVITVALEATIGLGMAVIMGKTFKGRALLRAAVLIPWAIPTAVTARLWEFMF
                     QYDGVVNRIFGTHILWTADEWPARFAVIAADVWKTTPFMALLILAGLQVIPEDVYEAA
                     RVDGASAWQRFWHITMPLLKPALLVAVLFRTMDALRMYDLPAIMTQSNPNTRTISMLV
                     VDQVRQGPNSASALSVLTFLLIFAVAFLLVKVLGANAVRTQEEQREAH"
     gene            126836..127669
                     /locus_tag="H0264_00585"
     CDS             126836..127669
                     /locus_tag="H0264_00585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="QLY30941.1"
                     /translation="MMRKLASGRVYLGALIVLIWGLGPFYWMVVTAFRDPDYQFENTP
                     WFTHVTFENFTNAFDTSRGNDFGKALINSVIIGTFTTLAALLIGVMAAYALARLTFKG
                     KYVVSGLILSASMFPVVVLVTPLFQLFTNLGWIGEYQAMIIPNISFVLPMTVYILASF
                     FTELPWELEEAARIDGASRFQAFRLIMLPLAAPAVFTTAILAFIASVNEYLLARLLSS
                     DKTEPVTVAVARFSGNNPLVQPYAAIMAAGTIVTIPLVIMVLLFQRRIISGLTAGGVK
                     S"
     gene            127825..130029
                     /locus_tag="H0264_00590"
     CDS             127825..130029
                     /locus_tag="H0264_00590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="QLY30942.1"
                     /translation="MLVSSSRKRQRGEPAPYATMAGWNELAAANSRRQPSHSRPRRRQ
                     KPPKTSKRQEGSRRPRASRGRRVLRVFTMLFVIFAVIPALLVGLAYWSAEIPDPNAVQ
                     TNQIATILTADGQNVIAKVVPPEGNRVPVPLTDVPEPVRLAMLSAEDRNFYTNPGYST
                     SAFVRAARDNLMGKEDAGGGSTITQQYVKNAFLTSERTMSRKMRELIISAKMARQWSK
                     DEILEAYFNTIYYGRGAYGISAAARAYFAKSVPELTLAEGAVLAAVVRTPSILDPETH
                     LDALQSRWHYVLDGMIEMGVLNRSERAATQFPTIVPVTEVADTAPRGPEGLIRAQVLR
                     ELRTSGISEHELNTGALQIFTTIDTRAQQAALDAVGDNLDGQPTELRTAVVSIDPRSG
                     AVRAYYGGPDGIGFDFAQAPLQTGSAFKTFAVLAALQQGISLSYKIDSGPITVNGEKI
                     QNVGGETCGTCPLSEAFKRSLNTSFYRLSQALFEGPKAIANAAHQAGIPESIPGVGKT
                     LTEEGGPPLPAIVLGAYSVRPIDMASAYATLAASGVYHEPYFVQKVVTGDGRVLLDRG
                     EPGRGEQRIQSTVADTVTSAMQPIAAYSNGHALAGNRPSAAKTGTTQLNDTDSNKDAW
                     MVGFTPSLSTAVWVGTEQSQPIRTARGSSIYGSMLPADIWKATMDGALEGTPVEQFPS
                     PAPIAGAPPADGNWDILNPGNGAQQDPVVVIPPAPEPKQVEIFPGLSIPVPG"
     gene            130197..130652
                     /locus_tag="H0264_00595"
     CDS             130197..130652
                     /locus_tag="H0264_00595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="effector binding domain-containing protein"
                     /protein_id="QLY34026.1"
                     /translation="MDFHVVERHETLVAGTVLRSPALAVEGPRRVKVEEAWKRNLSRT
                     LPGPPATAYVDHAPEIGSYLTHIVGYRCRSLDDLVAGDVLARIPAGKFALFTRSGDNL
                     GDTIASIWRTVWDLEASGTLQRAYTGDFERYPDSRTVEVYVALDTSAEG"
     gene            130661..131086
                     /locus_tag="H0264_00600"
     CDS             130661..131086
                     /locus_tag="H0264_00600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GyrI-like domain-containing protein"
                     /protein_id="QLY30943.1"
                     /translation="MDFEIITMDPFLVGGLTIPLAGREVTARDLDLVNFTWDRYLARE
                     KKVERVAAYIGQNDHAVAVLGYELKSLDDLDYGDVLTRIPAGRYAKFVVSDKPYDLLR
                     TAWAKVAKAENAGTITRSHTAEIERYTGPTSVEVYVSLD"
     gene            complement(131252..132349)
                     /locus_tag="H0264_00605"
     CDS             complement(131252..132349)
                     /locus_tag="H0264_00605"
                     /EC_number="5.5.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006550822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol-3-phosphate synthase"
                     /protein_id="QLY30944.1"
                     /translation="MSDINTEVRVAIVGVGNCASSLVQGVQYYKDADADSTVPGLMHV
                     KFGPYHVRDVKFVAAFDVDAKKVGFDLADAIFASENNTIKISDVPPSGISVQRGPTLD
                     GIGKYYAQTIELSDAEPVDVVQALKDAKVDVLVSYLPVGSEEADKFYAQCAIDAGVAF
                     VNALPVFIASDPVWAKKFTDAGVPIVGDDIKSQVGATITHRVMAKLFEDRGVTLDRTY
                     QLNVGGNMDFKNMLERDRLESKKVSKTQAVTSNLEGPLAGKVHDRNVHIGPSDYVEWL
                     DDRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGIIIDAVRAAKIAKDRGIGGPVI
                     PASAYLMKSPPKQIADDIARAQLEAFIIDAE"
     gene            complement(132342..132899)
                     /locus_tag="H0264_00610"
     CDS             complement(132342..132899)
                     /locus_tag="H0264_00610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QLY30945.1"
                     /translation="MLELAILGLLLESPMHGYELRKRLTGLLGPFRAFSYGSLYPTLR
                     RMQADGLIAEEAPLGLATRRARRVYNLTDTGRERFNELLADTGPQNYTDDGFGVHLAF
                     FSRTPAEARMRILEGRRRQVEERREGLREAIKRASGQLDRYTRQLHQLGLESSEREVR
                     WLNELIAAEQSTKAAPQKEGNIGHE"
     gene            133062..133475
                     /locus_tag="H0264_00615"
     CDS             133062..133475
                     /locus_tag="H0264_00615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF5318 domain-containing protein"
                     /protein_id="QLY30946.1"
                     /translation="MRIQRQVVDYALRRRSLLADVYAGRVAVAEVCDANPYLLRAAKF
                     HGRGSEVTCPICRKEQLTLVSWVFGDGLGPAAGSARTPEELLRMAEAREEFSVHVVEV
                     CRTCSWNHLVQSYVLGHAPAPTGRRRTGTRRSAAE"
     gene            133585..136407
                     /locus_tag="H0264_00620"
     CDS             133585..136407
                     /locus_tag="H0264_00620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="QLY30947.1"
                     /translation="MNSPYDDGPRGGRPRGGSQSGPGGYPPPRPAGPPPGARQPGGPG
                     PVPGGAPRRGPAQNGPGGLPPRGPQPGRTPLPQGGRAGDAPRRPAPQGGQPGGVGPGG
                     TRKLPHPAANTGGRQAVPEHIQRAATSDRAQRAAESGRRAGTATRPRPADDRTRPPSG
                     AQPASRRPQGDAPAGPPPRRPGGGSGGSGGSGRGPGGKKKTSPWKIIRRVCYITLALF
                     IIAPSTVFLIAYSTATVPKPGDLKTNQVAYIYAADGTTVLSKIIPPEGNRTDVTIDQI
                     PPQVRNAVIAAEDRSFYTNPGFSISGFIRALWRNVRGVEDAGGGSTITQQYVKNAMVG
                     NEHSLNRKLKELVISAKMARQWSKDDILTAYLNTIYFGRGAYGIDAASKAYFGKPVGE
                     LNVAEGAVLAAVIQQPSNLDPEKNPTGAKDRWNYVLGGMVDMGNLSAQDKASMQFPQV
                     IPAADAAGENTTDNGPEGLIKRQVLKELTAAGISERQLNTEGLSITTTIDPTAQQAAV
                     DAVAKYMDGERENLRTAVVSVDPKSGAVRAYYGGNDGSGFDFANAGLPAGSSFKVFGL
                     AENLELGKPLSTLYDSGPVSVNGIKITNVEGEQCGNCTIAEALKRSLNTSFYRMMLDM
                     PGNGPQKIADMAHKLGIPEEIPGVGKTLTEPDGSGPNNGVVLGQYQVRPLDMASAYAT
                     LAASGVYHAPHFVQKVVASDGSVLLDRGEVAGEQRVSAAVADNVTAAMKPIAAWSRNH
                     NLANGRESASKTGTHQLGDTGNNRDAWMVGYTPSLSTAVWIGTEQGDPILTPGGGLIY
                     GSGLPSDIWKATMDGALKGTPNETFPKPGAIGGQAGVPSWSAPYTAPSSTAPTIAPPV
                     ITQSQVEILPGITIPVPGLAPQNQQQRQTEDEDSGGNTGPMPGQPVAPSDGSPLTTTR
                     PAPTTANSGGGTGNGNGNGNGSPRSR"
     gene            136552..138168
                     /locus_tag="H0264_00625"
     CDS             136552..138168
                     /locus_tag="H0264_00625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013417633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2029 domain-containing protein"
                     /protein_id="QLY34027.1"
                     /translation="MYVSPAPLAADQRSLDDRDEPSRTDTLTAQLCTLVGGPVGDHAL
                     IGRVRFWTPMRVMMAFALLFLAFGWFGKAGCIQQTRDADGLMSLDWNNGRQYVAMCYS
                     DTVPLYGAEHLNEGAFPYKKQWTDFDSDGRPQVRYMEYPVLSGLYQYGAMGIAKVWKA
                     SPLPGGLEVVIYFNVVAIGLAMAWLVTVWASALLAGRRIWDGALIALSPLVAVHAFTN
                     FDALATAFAAGGLLAWARRRPVLAGVLLGLGGAAKLYPLLLLGPILILCLRAHWQEPP
                     PSDGGRGQSPRFRGSGGGAPGSTLRSAGYTIAATAVTWLAVNAPIAILYPNGWWEFFR
                     LNTERHADPDSIYNVITSFTGWGGFDGPLNPGETPSILNLVSLLLFLAACAGIGWIGL
                     TAARRPRLAQLAFLVVAAFLLTNKVWSPQYSLWLVPLAVLALPQRRILLAWMTIDALV
                     WVPRMYYYLGTDRKGLPEEWFTGTVALRDIAVIALCVLVIRQIYRPAEDVVRRDGQDD
                     PSGGVLNHAPDPEIPWLPPALRPRAVAAAT"
     gene            complement(138305..139789)
                     /locus_tag="H0264_00630"
     CDS             complement(138305..139789)
                     /locus_tag="H0264_00630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019746739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerD family protein"
                     /protein_id="QLY30948.1"
                     /translation="MSTALVKGQNGPLDVNDVVISVEIAAPADLSALLVTENGKVRSD
                     ADFVFFNQPSGPGVHLQPSPGQPAALVVSLPGVPADIAQIRAVITLDDPGNNFGRIPA
                     PTARIADGSGNVLFEYRVEGLSSESIVIALELYRRQGSWKVRAVGQGYAGGFAALVTD
                     HGVSVNESPQPAAQQPAPPQPAAPAGGYPPPPGGQGAYPPPNQPGGQGYPPAGGPGYP
                     PPAPGYGQPGPGDQYAPTGGYPPPPTGQYGPGGGYPPPNQPGGQGYPPPPGGQYPPQA
                     GYPPAGGPGYGQPAPAGDRDLPAGGQTVSLVKGQRVNLRKEGGGSLTYVKMGLGWDPV
                     KRGGMFGNRAVDIDLDASVALFADMSPVDVVYYGALSSKDGSVRHQGDNLTGEGAGDD
                     EVILVDLTRVPSHVTTLLFMVTSYKGHTFQQVANAFCRLVDGTSNAELARYTLDGGTP
                     TTAMAMAKLSRDGAGGVWKMEAIGEGFQAKHPGEALPQLGRFVS"
     gene            139905..140528
                     /locus_tag="H0264_00635"
     CDS             139905..140528
                     /locus_tag="H0264_00635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005258894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AIM24 family protein"
                     /protein_id="QLY30949.1"
                     /translation="MAQLFEKSKKVIEAQLAGTGVRAISGSMVAYEGNVQFKSAGFGG
                     GDGVLAGLKRRATGESLSLMECNGHGKVYFAVNGQNVTVVDLNNETLQVESQQLLAFA
                     GNLRSSVSFAGLRGATTGAGLFTTTVTGVGQVALLSAGGPLIHLEVSPQFPLVVDPDA
                     FVAARGNLNQSFVTDVSWRDAMGQGGGEAFSLRWDGQGVVLIQPAER"
     gene            140538..141242
                     /locus_tag="H0264_00640"
     CDS             140538..141242
                     /locus_tag="H0264_00640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AIM24 family protein"
                     /protein_id="QLY30950.1"
                     /translation="MFEQVNSKVVKVNVGQAGGVVARTGAMLFYTGDVSFAPHQVPGA
                     NQMGGMGGLARMAGRMMAGEHERTMLATGMGEVHYGFAGLETQVVHMQPGALLRVEAS
                     RLLANTAHLQSSIVSVASSGGGGGGRGGGLMGAIRGAATGVLTGAGMFTTQLSGQGSA
                     VLLGHGGFLELQVGGQYPVVVDPQAFVAAYGNVQTELKSALSWRDAVGKGSGEAMQLH
                     CVGQGVVYVQASEEKL"
     gene            141239..142003
                     /locus_tag="H0264_00645"
     CDS             141239..142003
                     /locus_tag="H0264_00645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AIM24 family protein"
                     /protein_id="QLY30951.1"
                     /translation="MTQILNPMNLGDSDNVPGNDYAYCIDLRKPWFMRKGAMIAYYGQ
                     MQFNALSHGLHGGLMHMVAQQFSAPLFSGDYVVAEGQGKLIIGDRGYNINSFDLDNGN
                     LTVRAANLLAFEPELALKQSIVPGFLTLIGTGRFLASSNGPVIFAEPPLRVDPESLVG
                     WADCPSPSHHFDQRWVSSFLAAGAARFGVNSGEERQFDFTGAGTVLIQSSEKVLDDAH
                     LVRTIEGQLQTGITPPGLQRLQGVIMQQLQGQQQNY"
     gene            142141..142875
                     /locus_tag="H0264_00650"
     CDS             142141..142875
                     /locus_tag="H0264_00650"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30952.1"
                     /translation="MSDGEVDPAEAHEQYLRAFRHPAVSRDQLEHLLDAVNGFLDTIT
                     PKDGEFVPNGGWAPESTAMAFQIGRAVEQVLAERKSAEREVQHRRDIRDRLVAALDAV
                     LDCLRTLPDLAEAEISLGTTAVNEGFQVFEDGSVRTTPMQEAHADLGALEMRRAELDE
                     QMTAAVTRRTELVDDTTDLVRERLGVADVGIPWVILEATQGGLDISEPFEFAAHHLPS
                     GELRELMVQLVTDIELARSLEDGAPE"
     gene            142990..143988
                     /gene="dhaK"
                     /locus_tag="H0264_00655"
     CDS             142990..143988
                     /gene="dhaK"
                     /locus_tag="H0264_00655"
                     /EC_number="2.7.1.121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020510649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase subunit DhaK"
                     /protein_id="QLY30953.1"
                     /translation="MKKLINDPGEVVDAALAGLAAAHPDLRVDAKQRIVVRADAPVAG
                     KVGLVSGGGSGHEPLHAGFVGHGMLDAACPGEIFTSPVPDQILAATTAVDAGAGVLHI
                     VKNYTGDVMNFEMAAELAADSGVEVLPVVVNDDVAVQDSLYTAGRRGVGATVIVEKMA
                     GAAAQQGRPLAEVARIAEKVNAESRSMGMALTSCTTPAAGRPTFDLGEHEMEIGIGIH
                     GEPGRMRVPLAAAHEVAAMLVEPILADLPFSQGDRVLCFLNGMGGTPLLELYLMFDEV
                     SRILRGHGVEIERALVGPYITALEMAGCSVTLTRLDEEMTTLWDAPVRTPALRWGM"
     gene            143988..144605
                     /gene="dhaL"
                     /locus_tag="H0264_00660"
     CDS             143988..144605
                     /gene="dhaL"
                     /locus_tag="H0264_00660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012948458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase subunit L"
                     /protein_id="QLY30954.1"
                     /translation="MTAIDAAAWIRAFAALVTERIAELTALDSAIGDADHGANMKRGL
                     DAAVAALQDSTASGPAAICKQTGTVLVSTVGGASGPLYGTFFLRCAPMLENGTDIATF
                     AKAFRTGVEAVAERGKAVPGDKTMIDALLPAADCLDKQVAVGSSPVTALEASVAAADK
                     GRRATQPLQARKGRASYLGERSIGHIDPGAASAVLLVRAARQALR"
     gene            144602..145309
                     /locus_tag="H0264_00665"
     CDS             144602..145309
                     /locus_tag="H0264_00665"
                     /inference="COORDINATES: protein
                     motif:HMM:TIGR01003.1,HMM:TIGR02364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr family phosphocarrier protein"
                     /protein_id="QLY30955.1"
                     /translation="MIGLVVVSHSRALATAAVDLATALLPNPQARIVIAAGLSETAYG
                     TDAVAVATAIKAADSGDGVLILMDLGSAVLSAETALDLLDSPHRVRLCGAPLVEGLVA
                     ALAAADGGADLDKAAHEADRALDGKRAQLGEPPTPPREEQSNDATTPMRATVTVTNEH
                     GLHARPAAELVSALRDLDADIQLRNATTGTGPVPGDSLTRVLTLGVLPGHQLEISADG
                     PDSATAMERIRAVVSSP"
     gene            complement(145432..146301)
                     /locus_tag="H0264_00670"
     CDS             complement(145432..146301)
                     /locus_tag="H0264_00670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="QLY30956.1"
                     /translation="MLDRRRLSRRRTLIATDLDRTMIYSRNAIGADTELPTVCVEHLE
                     GEPLSFMTIAAADRMRTLTEPAAVIPTTTRTIKQFNRIRLPGAPWRYAVTSNGGNILV
                     NGIPDMRWRIDLDAEVRSTSATLSEVSAELRSRIDDSFVSKFRIADHLFCYLVVKPKA
                     VPADFLAEWDAWCRPRGWSASQQGRKIYTMPLAVCKSRAVAEVRRRLTESAELAPGAR
                     LLAAGDGALDAEMLRTADSAIRPRHGELEQLNWTSPNLTVTRTSGIRAGEEIIDWFMR
                     STPESEQESTIAS"
     gene            complement(146301..148949)
                     /locus_tag="H0264_00675"
     CDS             complement(146301..148949)
                     /locus_tag="H0264_00675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019049993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase domain-containing
                     protein"
                     /protein_id="QLY30957.1"
                     /translation="MAESTRTSGVAGASSDGTTVTEPWATRELGLGLRHENSFVAEAD
                     WDIAALIEPGLRRNPRRAHLLVSTVLGKHLPTDPHRVIEAGNRLGDLVREVVSGPVVV
                     LGFAETATGLGHCVAARIEAECYLHSTRRDVPTAETLTGFEEGHSHATSHLLQPAPAG
                     IFLNDLPMILVDDEISTGATAIDAIRALNEFLPRSHYVLASLVDMRTEADKAAFAAAA
                     AELGARIDTVCLASGSTLLPEGLVDSVAALPDPELNPIAAARGHVARIELPWPSDVPE
                     GGRHGTLAADAPAFEAALAQTTETLWRELDALAWGSVDAQPGAPGAAFGQDGPTALRP
                     VVVLGHEELMYLPLRLAAALADSGVATRYQTTTRSPAYVLDEPGYPLRRGFRFIAPEF
                     DDEAPRFVYNAHWPEPSEVDPILLVVVDEPADNERLTGAGGLVDVLTASGADVVLAVL
                     PGADPRALHAQRNREEGDRPSSFRRAFGRNPLHQDGDDSVDPGQTHAGMTVGGTHAGM
                     TGGGELPEPLRGPDFGSYAPDEVAWLLKDLSYADLEADVAEREARIQAGVAHYAESLP
                     IEYQPDAAYRELFDKVLAESAERLALAVATVSEIVVAERGENVVLVSLARAGTPVGVL
                     MRRWLATRGLDVPHYAVSIVRDRGIDPVALDYLARHHNAADIVFVDGWTGKGAITREL
                     TEALDAYHAAGGARFNDELAVLADPGSCVRTYGTRDDFLIASACLNSTVSGLVSRTVL
                     NDTLIGPGDFHGAKFYRELAGDDVSGRLLDAVSAQFDTVRPLVAEHVAAVRDSDRSPT
                     WAGWRSVEAVRAEYGISSVNFVKPGVGETTRVLLRRVPWKVLVRDADAPEHAHIRMLA
                     AARGVPVEVVPDLAYACMGLIKDVKK"
     gene            complement(148949..150103)
                     /locus_tag="H0264_00680"
     CDS             complement(148949..150103)
                     /locus_tag="H0264_00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016692559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HpcH/HpaI aldolase/citrate lyase family protein"
                     /protein_id="QLY34028.1"
                     /translation="MRHHRQVPGPELRLLFHRAPEPLGDLTDRELVAMALGATLYVPA
                     TRPDLTATIVRRAETGVCSMVIDLEDAVADDDLEFGKRQAVATLDELGESTGLYPLLF
                     VRVRDADTIGEIIDWIGPGARVLTGFVFPKFDSVSGAKYLDALEAASERLGRTVFGMP
                     VLESPSLVHRQTRDLELHRIQDMLTQHRDRILAVRIGATDMCSTFGIRRDRDLTIYDV
                     RVVADVIADIVNYLGRTDGTGFTITGPVWEYFADHERMFRPLLRTSPFAEVDAVPFRE
                     YLVSRDLDGLLREIALDRANGIHGKTVIHPSHVSVVHAMSVVTHEEYSDALDVLGGEA
                     GGVAASEYRNKMNEMKPHRSWARQTLLRARVFGVTNKGVSFVDLLKALVA"
     gene            complement(150217..151419)
                     /locus_tag="H0264_00685"
     CDS             complement(150217..151419)
                     /locus_tag="H0264_00685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30958.1"
                     /translation="MAGRRRGWFRGSARNNEWVQQARQTLTAAFLDMDTRQSIAETAV
                     AASAQMFPEKGMAAQWEPVRARCYDAAGAYLALNERLDQAERDDTTVPQQEIDTIVRR
                     LGEAAGGVDRFYRGNQAHLEHAVAVYNTVPQLAAQVRAAAGETRQAAEASPYAGYPSI
                     RRATAAVDEGLITLEGAVAGGATGAVREAATRLEALTRELSRALEDAPGKQHSASTAL
                     SSAATRLAAAQHRLERTGPAMSTLLREFNAASSSDLTNNGQQAHRAVDAAAAELSRAR
                     AALQNNDPEQTLELTTSARAHLAAAEEQADAITDRLALLREVRDKPQDKAKAVRFKLR
                     DAQMLAVNNGLVAEWGSVLDAQAERLDRVTGHLEGRHPDYWAYVSELDAISNFVAGVV
                     ERMRNTDR"
     gene            151632..152207
                     /locus_tag="H0264_00690"
     CDS             151632..152207
                     /locus_tag="H0264_00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019057183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerD family protein"
                     /protein_id="QLY30959.1"
                     /translation="MGVSLSKGGNVSLTKQAPNLTAVAVGLGWDVRTTTGTDFDLDAS
                     AIATGADKKVVSDKHFVFFNNLSSPEGSIVHAGDNRTGEGEGDDEVINVDLANTPPTI
                     ESIFFPVSIYDAETRSQSFGQVRNAYIRVVDQANGAELARYDLSEDASTETAMVFGEL
                     YRNGAEWKFRAIGQGYASGLSGIARDYGVNV"
     gene            152311..153417
                     /locus_tag="H0264_00695"
     CDS             152311..153417
                     /locus_tag="H0264_00695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF475 domain-containing protein"
                     /protein_id="QLY30960.1"
                     /translation="MRIFGLSIAVTVVSLIVAAAYGAQGSMGALKALALCAILGILEV
                     SLSFDNAVINATVLQRMSEFWQKIFLTIGVLIAVFGMRLVFPLAIVWITAGLNPKEAL
                     DLALNPPTDGSPTYESLLTAAHPQIAAFGGAFLLLLFLNFILEEHEITWLSWLEKPLA
                     KLGKLDMLAVVLTLVAIVLAAEFAASEEERSTVLLAGILGAVTYIVVDGLGSMFHTEE
                     MVEEAEHAGPSELAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPIIIALGLG
                     LIGAMFVRSITVYLVRKGTLSEYVYLEHGAHWAIGALAVILLVSIGPHVPELVTGLIG
                     VGFIGAAFIASILRNKREGGEESIELEKETTPVG"
     gene            153550..154173
                     /locus_tag="H0264_00700"
     CDS             153550..154173
                     /locus_tag="H0264_00700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005141779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tellurium resistance"
                     /protein_id="QLY30961.1"
                     /translation="MTYQQPGGVNLGKVTLDKATPSVSLTKPGDRQGVMRVNLNWSQG
                     VKRGLFRRSNAVDLDLGCLWELNDGRKGVIQALGNSFGNLQAPPYIQLDGDDRSGSST
                     GGENMHINLDQPDFFRRILIFAYIYEGVPNWASADGVVTLFPTAGPQVEVRLDSPVND
                     ARSCAVALLENIGGGLQVRREVQYINGSQSAIDRAYNWGLNWTPGRK"
     gene            complement(154175..155137)
                     /locus_tag="H0264_00705"
     CDS             complement(154175..155137)
                     /locus_tag="H0264_00705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005245307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF389 domain-containing protein"
                     /protein_id="QLY30962.1"
                     /translation="MLHLRIMAPDKMTDDILGILDCDEAVSGLAVFRGVGVCPPGDMI
                     TAQVAREGANDIVQQLRAMRVHQEGSVELERVDTWLSRRAFDAEIRTPGSSSDAVVWA
                     EVAQRAYDDTELNWTYLSFMTLATIIASIAIITDAPILVVGAMVLGPEFGPIAALGVA
                     LVRRRFTLLQLALRTLVVGFVVAIALTLVLAIIARGLGWITLEDIDGPRPGTAFIYTP
                     DKWSFIVAVVAGAAGVLAITSAKALGLAGVFISVTTVPAAGNIALGVAFLDGSTVWGS
                     VAQLFLNIAGMALAGWATLAIQQAVWSRVSVWRARHMIAPRRML"
     gene            complement(155174..156616)
                     /locus_tag="H0264_00710"
     CDS             complement(155174..156616)
                     /locus_tag="H0264_00710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019665158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2029 domain-containing protein"
                     /protein_id="QLY30963.1"
                     /translation="MSNRPVSRESETGRRAGAAGWHATAAFWCVLVCALTLLLGYLNK
                     ARCAGGPFESSGRSLKFDVIKDSSVCYSDIQYLWLGRGIDEHVFPYVSGGITADGYLT
                     GGAVEYPVLSGLFMWAGALGADNDAMFLFDTALLLAPFALLTAWMLGRMAGRAAFLWA
                     AGPPLVLYAFHNWELPVVCTAVAAFYVMTALTRYSLRARGIAAAVLLGVGFCLKLYPG
                     IFVLPLMIYVLLGEQDEYPSEERRFDVSGAVSVALAAIGTVVAINLPFAVAGYDGWRA
                     SITFQQLRQADITTNSIWYWGLRPMFDASEHGEQAFQDLVSTISPLLILVSFGLAVWL
                     GCRRYLATGGFPWIGVSGAMLCGFLLFHKVHSPQYTLWLIPFLVLLRVRWPLIAVYLL
                     ADAAIGIGVFRYFYALGSGYPAEVEENIVLFGVWGRAALLVVFFFVFLWAEPRVRGFG
                     AARREFVELYPFNALAGIARDTTSAPVPGR"
     gene            156812..157102
                     /gene="rpsF"
                     /locus_tag="H0264_00715"
     CDS             156812..157102
                     /gene="rpsF"
                     /locus_tag="H0264_00715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="QLY30964.1"
                     /translation="MRHYEVMVILDPSLDERTVGPNLNNMLGVVGSEGGKVDNVDIWG
                     RRRLAYEINKQAEGIYAVVTLTAESATVSELDRQLGLNESVLRTKVLRLDKK"
     gene            157209..157754
                     /locus_tag="H0264_00720"
     CDS             157209..157754
                     /locus_tag="H0264_00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="QLY30965.1"
                     /translation="MAAGDTVITVIGNLTADPELRFTPAGAAVANFTVASTPRVFDRN
                     SNEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVSGRLKQRSYETREGEKRTVVEL
                     EVDEVGPSLKYATAKINKTTRGGGGGGFGGGGAQQGGGNFSGGGSGGGRGGQSAGDDP
                     WGSAPAAGSFGGGQMDDEPPF"
     gene            157815..158084
                     /locus_tag="H0264_00725"
     CDS             157815..158084
                     /locus_tag="H0264_00725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003941245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="QLY30966.1"
                     /translation="MPKAPAREKVLKKKACTFCKEDKAGKKNNTAGAKIDYKDTTLLR
                     KYVSDRGKIRARRVTGNCVQHQRDIAVAVKNSREVALLPYVSTAR"
     gene            158102..158557
                     /gene="rplI"
                     /locus_tag="H0264_00730"
     CDS             158102..158557
                     /gene="rplI"
                     /locus_tag="H0264_00730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="QLY30967.1"
                     /translation="MKLILTADVDNLGAPGDTVEVKDGYGRNFLLPRGLAIVATRGAQ
                     KQVEGIRRAQDARKVRDLDHANELKQAIQGLESVSLSVKTAGTGKLFGSVTTADVAAA
                     LKAAGGPVVDKRSIELPKAHIKTTGKHGVVVHLHPDVAAKFDLQVNAAE"
     gene            159056..160450
                     /gene="dnaB"
                     /locus_tag="H0264_00735"
     CDS             159056..160450
                     /gene="dnaB"
                     /locus_tag="H0264_00735"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019746049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="QLY30968.1"
                     /translation="MAVIDDRGHNDDGPAEYPDAPGEDFGRQPPHDMAAEQSVLGGML
                     LSKDAIADVIEVVRPGDFYRPAHQAVYDAILDLYGRGEPADPVTVSAALDRKGELKRI
                     GGPPYLVTLTQTVPTAANAGYYAEIVAEKAILRRLVEAGTRIVQFGYAGADGQDVAEV
                     VDRAQAEIYEVTERRSSEDFVPLEEILQPTMDELDSIASRGGISLGVPTGFTELDELT
                     NGLHAGQMIIVAARPGVGKSTLGMDFMRSCSIKHGLASVIFSLEMSRTEIVMRLLSAE
                     AKIKLGDMRSGRMSDDDWSRLARRMSEISEAPLFVDDSPNLTMMEIRAKARRLKQRHD
                     LRLVVVDYLQLMTSGKKVESRQQEVSEFSRSLKLLAKELEVPVIAISQLNRGPEQRTD
                     KRPMVSDLRESGSLEQDADMVILLHRPDSIERDDPRAGEADIIVGKHRNGPTATITVA
                     HQLHLSRFVDMARG"
     gene            160487..161785
                     /locus_tag="H0264_00740"
     CDS             160487..161785
                     /locus_tag="H0264_00740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012690420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="QLY30969.1"
                     /translation="MHSMRILRADTGREVAVSELAGSITQMEVWSLAARLRMVARPIT
                     LSFAGRTAFSRLRFASGLEIELPPHTQLLTVDGWVPVDSLEIESRVAVPRWIPEPTHA
                     AEMADAEVILLAHMIGDGSCVKGQPIRYASIDEENLTAVTDAATHFGVTAIRDEYAAA
                     RVTTLRLPAPYRLARGRRNPIAAWLDELGLFGLRSYEKFVPEPVFTLPTDQVALFLRH
                     LWATDGSIRWDERGRQAKIYYASTSLRLIRDVVQLLLRLEIHGRIKRARKPGYRDCWH
                     LTIDGSENQQTFLEDVSAHGARGVAGEAVLLELRKMTANPNVDTVPKEVWSRVRSLLA
                     HFAVGHREFQAAMGSRYCGSTMWKYSPSRARLAQAATILQAPDLTLLARSDIFWDRIV
                     EISSAGEQDIYDTRVEGTHNFVAHGVLVHDSTEPAAMVRW"
     gene            161819..162508
                     /locus_tag="H0264_00745"
     CDS             161819..162508
                     /locus_tag="H0264_00745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005261473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="QLY30970.1"
                     /translation="MTSGTITEAERAGAAIYGYRALRIYDFVVLRVSNSLVWRCPSRR
                     MLASYDAQVSGDHLDIGPGSGWFLREARFPVGETAVTLVDLNPAALEMSTQRLLGRGI
                     EPSCRIGSVVRPLPVERRYRSVAANLVMHCVPGGWAEKGVAFRHIADVMAADGVFFGS
                     TVLARGVRQHPVARWLIRFYNRAGAFQNASDDRAGLEAALRGAFAEVKVVVVGSVALW
                     EARAPRGAAEV"
     gene            162582..164492
                     /locus_tag="H0264_00750"
     CDS             162582..164492
                     /locus_tag="H0264_00750"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30971.1"
                     /translation="MSFAVRVDIAGAVRIVKTAARFGWVWDAGDVRGFARQLAWAAPQ
                     PVGTMRRGALFSRTGLGVWWDSVMFWGNGHGLGYVRVTVSDCLGPGEFGSAELLRGAL
                     EKLTARFTELWGEPESGGAGPESGPAWVFPSVVAGLALGPATVDLLLVSPAEQKYWRD
                     RKYGAARARTGLGAWGRFAEDLAGYVEALPPESILVLSARGGRYVQFSTDEEHLHGEL
                     SRSEFVDPTWRYGEETGAALRALGWSPPRESNWWRIQPRRAVTPAVSRFAVAAVDGLR
                     TLGVESPGDLFADAWVEGGDDLDIAPLGIPLNSTSRSKRAEYLLHYAAYPADSEPLRT
                     DIPGGIGIARAAQAFAWSWTREDAERFAGAAGWRPQRAPAPSARTTWMQTGLRVDTPT
                     AVFTFDGDRLESICVTLSDSIESHLYEDGLPADVQAQLTAAFARATDGFRTDLGPPVH
                     GVLWHAHGPVWASANLLLGLVADTDTVDLFLVNPAERARRLIIEQQQLALRAADHEWR
                     QYLDDLAGLAHGLAPGSQLIIDSREHGFARLDRAERELRVELVGVTGPQPQPQVAEVM
                     LRDGWRHPDEVRPRWRNALPLPALRRDFRWFMQIVLWPLRTEMTPETELHVRVDGWDQ
                     GLRTPPIGAPLS"
     gene            164530..165162
                     /locus_tag="H0264_00755"
     CDS             164530..165162
                     /locus_tag="H0264_00755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003097922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="QLY30972.1"
                     /translation="MSESADVRATRQAYDEMAELYSDFVHRHLESSPFDRAMLDVFAD
                     VTRGAGEVLEVGCGPGRIAGYLHAAGLRISGLDLSPEMIRIARIALPHLSFEVGNLER
                     LDRPDASLAGIVAWYSLIHTPPARIPAVLSEFARVLRPGAHLLLGFQAPAAGPSGQSY
                     DHKVATSYLWTPDAMSEALAGNGFRATATLSREARPDERTPQGYVLAVRL"
     gene            165256..166791
                     /locus_tag="H0264_00760"
     CDS             165256..166791
                     /locus_tag="H0264_00760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005514272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding protein"
                     /protein_id="QLY30973.1"
                     /translation="MTVWNEEVDVLVAGSGGGLSGAYTAAREGLSVAVVEATDKFGGT
                     TAYSGGGGVWFPCNPVLRRAGVDDTIEDALAYFRAVVGDRTPADLQEAYVRGGAKVIE
                     YLERDEAFSFQVFPWPDYFGRAPKARLDGKRHIIPTPLPAAELGELSTAVRGPLSTDR
                     HRAPQPDYLVGGRALIGRFLLALAKYPNASLSLNSPLVDLVVEDGGVVGAIVERAGER
                     VAIRARRGVLLAAGGFEGNDELRQRYGVPGCARDTMGPWGNIGQAHEAGIAAGAATDL
                     MDQAWWSPGLIHPDGRAAFALWFTGGIFVNQRGARFVNESAPYDRLGRDIIDAMSEGA
                     VSLPFWMIYDDAEGAVPPIKASNVPMVDAEQYVAEGLWHTAVTVEELAALIGVPADAL
                     SATVSRFNEMVAAGVDTDFGRGDEAYDRAFSNGASPLAPIVKAPFHAAAFGISDLGTK
                     GGLRTDTAARVLDADGAVIPGLYAAGNTMAAVSGTTYPGGGNPIGASVLFSHLAALDM
                     AGR"
     gene            166813..167139
                     /locus_tag="H0264_00765"
     CDS             166813..167139
                     /locus_tag="H0264_00765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005086273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30974.1"
                     /translation="MTPESGATAWVPDACTLPTVEQPLRTLEFATLLGETARRVHRRS
                     ATRLEVVIPAAAESAARDLARRESECCAFFAFSFEGDADDTVMGIEVPPAHSDILDAM
                     QARAAR"
     gene            167189..168772
                     /locus_tag="H0264_00770"
     CDS             167189..168772
                     /locus_tag="H0264_00770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014984151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="QLY30975.1"
                     /translation="MSDSERHPRPRRDRYDVVIVGGGHNGLVAAAYLARAGRSVLLLE
                     REPHTGGAAVSERVFPGVLARLSRFSYLVSLLPELIVRDLGLRFETRKRRISSYTPVG
                     EHGLLVDNASVAGTRDSFARVTGSERDFLAWQRFYAMTGELARRVFPTLTQPLPSRAE
                     LRRRVGDPAAWEAVFERPLGEVVEATFADDTVRGVVLTDALIGTFAQAHDPSLLQNRC
                     FLYHVIGGGTGDWDVPVGGMGAFTDALAAAARAAGAEIVTDCTVTGLETDGGTAEVRF
                     TLGDAVAGAVAARHVLVNAAPYVLAGLLGEEAAKPEGAQLKINMLLRRLPRLRDASVD
                     PRTAFAGTFHIAESATQLDKAYREAAAGRIPSAPPSEIYCHTLTDPSILAPELIEQGM
                     HTLTLFGLHTPARLFATEPESTKARLVDATLAQLDSVLSEPIRDCLALDADGNPCLEA
                     MSPVDLETEVHMPGGHIFHADLAFPFHTEDGDPATPAARWGVATAHANVFLCGAGAVR
                     GGGVSGVGGHNAAMAVLES"
     gene            complement(168884..169804)
                     /locus_tag="H0264_00775"
     CDS             complement(168884..169804)
                     /locus_tag="H0264_00775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018888525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="QLY30976.1"
                     /translation="MDIDTRLLRYFLAVAETEHLPLAAQRLHVAQPALATQIKQLEQQ
                     LGVELFIRSRAGMTLTAPGKVLAATVPSLLAAWDRILRDTKSDASRASRVLRLGCVHN
                     TADEHIAEIIRVFHRLHPDWQVDIHQGGWTDPTAGLDEGDVDVALLRLPFPGQDEYHL
                     RELFAEPRWIALPADHPLAERDDIAFRELWNEPYVASPAETGWWRDYWMGLDSRPADT
                     AIIGAIARNTDEWLRAIANGFGVSFTPSSTVRANAYPGVVFRPVHGIGPTRVALVWPD
                     ASESDAVVRYFIRCCTDIMGQQAGDGRRTS"
     gene            170013..171575
                     /locus_tag="H0264_00780"
     CDS             170013..171575
                     /locus_tag="H0264_00780"
                     /inference="COORDINATES: protein motif:HMM:NF018448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine/serine exporter family protein"
                     /protein_id="QLY30977.1"
                     /translation="MSRPGPRHLRSRPRPAGASVAAVGKRLTYTAKRAGGVFDDWLVR
                     RVVNRAGAHELHDPPPPEEPPVSADLLNLLRLLGVMLIGSGETTGRVQEILDDTARRY
                     GANEVQFFVLPTGVFVRVEDSRGSAVDLQAAFTDTLRLDQIAALYRVLDNLKHELPSP
                     VEVTEQLEDIIASKRPTAVWLMLLGNMVLTVGLGLMLNPTVHALAGYAVLGLVVQLLI
                     LLADRIPLLSLALPVTAGAVVTLLAFGFPHALGGGQPSELLIPAVASLLPGAMLTNGA
                     IELATGSMVAGSSRTIAGLNKLLLLAFGIYIGLQFLGPQPPDVADTSQLGWWAPLLGV
                     LLIGFGHSWRSSAPPKSLFWLLLVLYATYAAQRFGIQTGGALLGAFLGGLTAVPTAYL
                     VQRNRNAPPTQVAFLPAFWMLVPGGMGLTAVSELVTSKGGNGLQVLVNVLLSVLAIAL
                     GVLVGSGLTNTRKPGAASMVDWLLPPADQHPAGQHATGQRAEGQRTTGRSEPGSTSQS
                     NQCGTSESANSS"
     gene            complement(171491..172117)
                     /locus_tag="H0264_00785"
     CDS             complement(171491..172117)
                     /locus_tag="H0264_00785"
                     /inference="COORDINATES: protein motif:HMM:NF012863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="G-D-S-L family lipolytic protein"
                     /protein_id="QLY30978.1"
                     /translation="MVLDLRVCFLGESFVAGVGDEKCLGWAGRLAQRSIAAGQPLNYY
                     NLGIRRETSTELRDRWEAECTLRLPAGVDARVVISTGVNDTMVENDRPRVESDQSVAN
                     LAAILDGTRDKGWTTLVVSPPPNIHDDHNKRIAELDRRFADCCESAGVPYVRAHQALR
                     ENTTWMRDIRAGDGYHPSAVGYDEFADSLVPHWLLWLVDPGSDLPVVR"
     gene            172365..173114
                     /locus_tag="H0264_00790"
                     /pseudo
     CDS             172365..173114
                     /locus_tag="H0264_00790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353672.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR00374 family protein"
     gene            173220..175061
                     /locus_tag="H0264_00795"
     CDS             173220..175061
                     /locus_tag="H0264_00795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019665260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flippase-like domain-containing protein"
                     /protein_id="QLY34029.1"
                     /translation="MAAAARETVSAAAGSASRAAPPRATLVAPATAADPAPEADTLQQ
                     TPTRATSSGAPAGPPVGVENSAAAGDLTPITPPENELIVELYGANQRSRGALQAFRRW
                     LTIRSGEYPALFASMRRAVEHRALMGIAISDLGLGSNKPLTVAALNRGWMLYAHTVPQ
                     GEPLTAAAGTKGLEQVWRALHTMHQAQISHGELRAEEVRLVDGEARFGGFIQSEFGAY
                     DTRFESDNAQLLLSTAALYGTETAVRTAIDVLGEQSVLAASRRLTKTAIPAAVRNSVP
                     DAGELMKSTRAEVASQTGQDKIEAAQITRFSRNQIIQLALLIGLVYVAYPYISAVPTF
                     FSELRSANWAFAALGLAVSALTYVGAAMALWACASESVNFRNLLLMQVANTFAATTTP
                     AGVGGLALSVRFLQKSGLGAVRATAAVALQQTVQVITHLVLLLFFSVAAGVSTDLSHF
                     VPNATVLYLVAGVLVGLLGVTTFVPKVRKWLLNEVRPQLADVLGQLKDLGRSPGRLAM
                     IVGGCATTTLGMALALWASIEAFGGSTTFVTVTIVTMIGGTLASAAPTPGGVGAVEAA
                     LIGGLAAFGVAASIAVPAVLLYRVLTCWLPVFCGWPIMRWLTRKDMI"
     gene            complement(175058..175660)
                     /locus_tag="H0264_00800"
     CDS             complement(175058..175660)
                     /locus_tag="H0264_00800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="QLY30979.1"
                     /translation="MSLERTAVLALHWQVNVIKPEGFFGGLLAAPVAASGVVGRAFTF
                     HEQALAAGVPLVFTRFTIPEGEGELVRNTGFMHSVGEAQAAFRPESPGAQIIPELAEQ
                     ARAGVVFDNQKLSGLAGSALPEWLTGHGIDTLLITGVATNLTVEQTARHGTDLGFHVH
                     VISDCVATFAPPVHEASLANLELATGGSLAAEQVFERLTV"
     gene            complement(175789..177354)
                     /locus_tag="H0264_00805"
     CDS             complement(175789..177354)
                     /locus_tag="H0264_00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase"
                     /protein_id="QLY30980.1"
                     /translation="MSFQPLDEPIRSRRNHWVNQIATHAAMRPAQVAFRFKGVDTTWK
                     QLHERSEKFADALARRGVGFGDRVAILALNYTEYIEAVMGTNALGAIAVPVNFRLTPP
                     EVGYILGDSGAKAIVTDSLLQPLAVGVAAQVPTVETVVVINGQTGEGVIGYDDLLAEA
                     GEPHAPLDIPEDTPCLIMYTSGTTGSPKGAVLSHANMNAQGLTCIRAMEITPDSIGFC
                     TSPLFHIAGLGSLTPYFLLGGTTILHPLGAFNATEWLDAVEAEQATTAFCVPAQWQMI
                     CEDPSIKSRKLALRSLCWGAAPASDSVLRAMAECFPEAFNVAVFGQTEMSPITCVLEG
                     KDALSKLGSVGKPVPTIQARVVDDEMNDVAPGEIGEIVYRGPTLMSGYWNKPEATAEA
                     FAGGWFHSGDLVKQDADGFVWVVDRKKDMIISGGENIYCAEVENVLFSHPKIHEAAVI
                     GRAHEKWGEVPVAVVALLPGEELTLAELEPYLNDSLARYKHPKDLIIVTELPRNASGK
                     VLKVDLRKEFAAS"
     gene            177636..178610
                     /locus_tag="H0264_00810"
     CDS             177636..178610
                     /locus_tag="H0264_00810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003882240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitronate monooxygenase"
                     /protein_id="QLY30981.1"
                     /translation="MALRTRFTETFGVEHPIVQGGMMWVGRAELAAAVSEAGGLGIIT
                     ALTQPTPDDLRREIDRAREITDKPIGVNVTILPSINPPPYQDYVKAIIESGVKIVETA
                     GSNPEPFLPYYKEAGIKVLHKCTSVRHALKAQKIGVDGVSIDGFECAGHPGEDDVPGL
                     ILIPAAAKALDIPVIASGGIADARGLVAALALGADGVNMGTRFMITQESAVHENVKNA
                     VVERTERDTQLIFRTLHNTARVAANEISAKVVEIEKAGGTFEDVKDLVAGARGRRVFE
                     EGDLNAGIWTAGQVQGLIDDVPTCAELIDRMVSEAEELIKSRLAGMLA"
     gene            178777..178947
                     /locus_tag="H0264_00815"
     CDS             178777..178947
                     /locus_tag="H0264_00815"
                     /inference="COORDINATES: protein motif:HMM:NF021474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapB family
                     antitoxin"
                     /protein_id="QLY30982.1"
                     /translation="MAITRIYLDDAALRRTMAISGVHDEQDAVNLALRFFTAHATRSD
                     YEVPLTSLPSQR"
     gene            179099..182035
                     /locus_tag="H0264_00820"
     CDS             179099..182035
                     /locus_tag="H0264_00820"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012337.1,HMM:NF012901.1,HMM:NF020243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase domain-containing protein"
                     /protein_id="QLY30983.1"
                     /translation="MSIVGAACRETASTSFDSTWFGLTDRRLAALDSRQRTTLELAVE
                     ALDDSGLGHLARGTNAAVVFGAAGSGSANTARYVSHALDLHGPSLAVDSGHTSPLTAV
                     DTAVRLLADESIPFVLTGGADLALLPDISGIEWSGADHTCTVMVLQRTADLPRTGTRA
                     HAEITGYSTGLGGADPAATRIPLRATDTRDIEIGSDETPSDTNMTSPAPAQHNRVACS
                     ITMPRQADSLLGRDRHGTERSALGATAFRDRTRYDTGDDPPILIPLSGQDARSVQELA
                     TRWAARLGDYRTVREFATAVARLVPGPARAALLVRDRADAATQLRTLTMREVKLPMQA
                     APPPLREATPPTRQAAPPAPEATQPAQETTMPARGTTPPAREAIVPAQAGALTPWEPT
                     LPTGAAIRPGGGVATADGPGGVLFLFSGGGGHSRMGRSLAARYPVFAEAVTAAADAIA
                     EAGGPRVWTPRHGFGTLDGGAYFGQPAHFAFQVALAELLASWGVHPDAVSGHGAGEVA
                     AAVVSGALTLADGARVIVARGRLLAKIGEPCAAAVLEATPAEAVRLVEPMRAEVGIAA
                     IDGPRSITVAGDPRYIDALVRRAHRRAIFAQRADSDTATGSAATAPHIPRARDLASEL
                     TAELQDISPRVPDCTVYSTTVRGYAVAPHAAGADAGVPGGNRLSPDARNGTPGGASSS
                     VTDTVPGASGYSGQQRVPAPAFTTTDLSGATSRGLPGTTSFEPAAAVVAGSTAAQGAA
                     ATVDAAFAAAYWGRNAAGPVELGAALELAAGDGVSTVLEISPQPVLTRITRQHSRFHE
                     STYPVSSRGDEAATFLRAVARLFLEGRWIDWAALGPFTAAPPQRHWRRELPAPRFPKV
                     PIRADGTYVVAGGLGARGAVAVRWLIDAGAQDVVVLTRAPRPLPPPLDGMEDRIVLVR
                     CDASDRTDLAGVLQDIRECGSEISGVVYAGRGPESVTAANLVELTVGDPIEFVVFHTE
                     SGVSQP"
     gene            182063..182452
                     /locus_tag="H0264_00825"
     CDS             182063..182452
                     /locus_tag="H0264_00825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30984.1"
                     /translation="MADPKVAVKWKDQPDEHDYPAAADYLELLANADVVDTVVEELRK
                     APVTKKKAKDLLRASQLDLATPDNPYVRRDLEKILAGKALSPILVVRGDFRKGVPLTI
                     ADGYHRVCAIHFADENIQIPVKIAALP"
     gene            182449..183594
                     /locus_tag="H0264_00830"
     CDS             182449..183594
                     /locus_tag="H0264_00830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="QLY30985.1"
                     /translation="MSFDTLALIVALGLAGPLLAWRPSWHVPVILGELLAGILFGSTG
                     FGMMDPEDPTFTFLADIGFAVVMFVAGTHVPVRDASIRAALGMGVLRAALVGVLATVA
                     GVAIAAAFDIGHAALYAVLIASSSAALVLPIIDAQSLSGKPVLQLTAQVAVADTACVV
                     ALPLVIDPGHGARAAVGAVAVIAAAVGLFFVLRYLEESGLRRRLHKVSEERNFALELR
                     VSLALLFALVALATTTHVSIMLAGFAFGLAVAAVGEPRRVAKQLFAISDGFLAPLYFV
                     WLGARLNLREFGDHPRLILLGLALGAAAVLAHALMRGTGQPIPYGVLAAAQIGVPVAA
                     VTVGTQLHVLEPGEPAALMLGALVTIAATAWATMRAARRAAHSAGTS"
     gene            complement(183616..184026)
                     /locus_tag="H0264_00835"
     CDS             complement(183616..184026)
                     /locus_tag="H0264_00835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007530746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain-containing protein"
                     /protein_id="QLY30986.1"
                     /translation="MASASTNFPVSSQPAQARVDSWVWAVRLFKTRSAAAAACRAGHV
                     RVNGVPVKPAHNLKPGDEIRMRVNGLERIVIVELLITKRVGAPVAAQCMIDKSPPPPD
                     PQLVAAMPRRDRGSGRPTKRERRETDRLLGRDDA"
     gene            complement(184033..184623)
                     /locus_tag="H0264_00840"
     CDS             complement(184033..184623)
                     /locus_tag="H0264_00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C40 family peptidase"
                     /protein_id="QLY34030.1"
                     /translation="MGAMAATTTGAFPAVTATAATVDIPGIGKFDVPDQFAPQVDQFN
                     EAVKGVTQNGFQVGANPAPEGGQWQLPSLANPFDQKPSSPANIALNAAETKLGAQYSW
                     GASGPYSFDCSGLVQWAYKQAGVDLPRTSFEQSHVGAPVAYQDLQPGDIVITNGGGHV
                     GIYAGDNQLLNAVQSGTPVSYTPLRPDMVVTARRVV"
     gene            complement(185197..185448)
                     /locus_tag="H0264_00845"
     CDS             complement(185197..185448)
                     /locus_tag="H0264_00845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30987.1"
                     /translation="MSEEAVVPTVAEVVESWNVPEEAIVAGRIRSNILVAIERGYDDP
                     QLVADLAVGPLVMALGKLEVELADARRRIEELERTVAGR"
     gene            185605..186789
                     /locus_tag="H0264_00850"
     CDS             185605..186789
                     /locus_tag="H0264_00850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="QLY30988.1"
                     /translation="MDPVRNPYAPGAGQRPPELAGRDKQLDAFDIVLERIARGRPERS
                     VMLTGLRGVGKTVLLNQLRSAARSAGWGTGKLEARPDQELRRPLASALHMAVRSLAVA
                     HRNPEQVDDFLGILKAFALRATADKGMRERWNPGIDVPAVTGRADSGDIEIDLVELLM
                     EAAQVARGGGVGIAIFIDEMQDLGAADISAICGACHELSQDAAPLIVVGAGLPHLPAV
                     LSASKSYSERLFSYHRIDRLDRGSADQALIAPADRENVKYSEEALQALYVKADGYPYF
                     VQAYGKATWDMAAQSPITAEDVELAAPVAEEELAVGFFGSRYERATPAEREYMRAMAD
                     LSGDDGPVATSAVASELGRKPASLSPARDGLIKKGLIYSAERGTIGFTVPHFGRYLRS
                     VS"
     gene            complement(186786..187667)
                     /locus_tag="H0264_00855"
     CDS             complement(186786..187667)
                     /locus_tag="H0264_00855"
                     /inference="COORDINATES: protein motif:HMM:NF012298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="QLY30989.1"
                     /translation="MTLLPGDTFAGYAILDRLAAGGLSTVYKAAHPRTSEPVALAVLD
                     EKYSADPEYRKYFEQAADRIRELSHPNIVTVIDAGYDAGSLWLETRLVDGADVASVLA
                     GSGHGMRVERAARIVSEAATALHHLHEIGVLHGNLTPAHILVTGSGPTEQVRVTDIGL
                     LGGAVDGIETHWATENSGYTAPEVLAGAPLSARSDVYSLGAIFHALLSGRTPPPPAPR
                     PDVAPPPPPPGAPSGDPLSGYAPVIAKAQAEDPAQRYATPRDFSEAIRLSLPGQGAPT
                     GGKKPGGKGIRGWFKRS"
     gene            187803..189758
                     /locus_tag="H0264_00860"
     CDS             187803..189758
                     /locus_tag="H0264_00860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase family protein"
                     /protein_id="QLY30990.1"
                     /translation="MATTAKVDATEEQARALVEESRETTWAKPSFAKEMFLGRFRLDL
                     IHPFPRPGAEDAARTEAYLTKLRAFCETIDGQRIEAEGRIPDEYVKGLADLGCFGLKI
                     PPEYGGVGLSQVGYNRALMLVGSAHASLGVLLSAHQSIGVPEPLKLAGTAEQKREFLP
                     RCAKGAVSAFLLTEPDVGSDPARMASTATPTPDGEAYELNGVKLWTTNGVVAELLVVM
                     ARIPKSEGHRGGISAFIVEADSPGITVERRNSFMGLRGIENGVTRMHNVRVPKRNLVG
                     REGDGLKIALTTLNAGRLAIPAMCTAAAKWSLKIGREWSATRVQWGRPVGEHAAVGAK
                     LSFIASTTFALESVLDLSATMCDENRNDIRIEAALAKLWASEMACAIADELVQVRGGR
                     GYETAASLAARGERAVGAEQMVRDLRINRIFEGSSEIMRLLIAREMADAHMSAAGALV
                     DRNAELKDKAKAAVGASGFYAKWFPQLTVGAGTAPVTYGEFGPLARHMRYVERMSRKQ
                     ARALMYGMARWQAKLEYKQGFLGRIVDIGAELFAMAATCVRAQALRVEGGPNGIAAEE
                     LAEVFCRQSRLRVEQLFDGLWANTDEYDTQLTRGLLDGRYKFLEEGALDPSEGTGPWI
                     SDWQFGPSTEENLLRPFLPSTRSDVTT"
     gene            190090..191064
                     /locus_tag="H0264_00865"
     CDS             190090..191064
                     /locus_tag="H0264_00865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QLY30991.1"
                     /translation="MSTPLRRPNDHDEPHRTVLADDGVPIAVREFGSADAPLTVVFAH
                     GHCLRTESWELLRGHLVGYWGDDLHLVFYDHRGHGDSGAGDPATYTIDHLAQDLDAVL
                     RAVAPTGPVVLIGHSMGAMTILAYARLFPETIGCRIIGVGLLAGAASSVTRVGLGRFL
                     SAPAVTSLQLAVRRAPRAMAASKRLSHRIFEPLMREVEQGTRKVSPRLAAVATTLLND
                     TSLLTMAMFLDSLIRFDEMATLHRLGAIPALVLHGSGDIVIPFAHSVVLASQLDDAEL
                     VRLDGAGHSVIAERAEEVAAAVVTLVDRALARLHGRDPDCGPEYAIAG"
     gene            191221..191508
                     /locus_tag="H0264_00870"
     CDS             191221..191508
                     /locus_tag="H0264_00870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30992.1"
                     /translation="MTRSDIAELRYAVGQLRQCVSALRSHYGEANMVRRLENDLERLV
                     IDADEFEQTPPPEAPGKQQQTIYVPDSKSDEAAWMGAQDEGLGFHSKPRTK"
     gene            complement(191632..192813)
                     /locus_tag="H0264_00875"
     CDS             complement(191632..192813)
                     /locus_tag="H0264_00875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009192168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="QLY30993.1"
                     /translation="MRRAAIVMPMRTPVGLPGGALAAVAPHRLIATALSAAIGRSGLD
                     PARVDHVVSAVDGSAAVSAALPLAGLSPAVSEFAIGPGPGSGLRALVTAAMMVQTGAA
                     DVVAVVGAGTEIASEQPEFAGQEALARRYDITRADADALAASSHRRTARAYRQGIFGA
                     ETAPVVVNLDPGDPNSAVRQLVDHDETLRDDVSTRGFAVLEPLAPEGIGTAGNSSAPT
                     LAASACLVVAEERLADLGLEPMGYLLGWTTATGNPGVAVPATALAVDKVLSPGDFRVG
                     DMDLVEIDETTAVEVLALTRFWESEGTKFDADERLNVNGGAIALGDPGGAAGLRVITT
                     LLHELSRRAGGYGLATMPAGANQALAVLFETPHSVPIAATPRGARFHGARPRRFGRHR
                     A"
     gene            193172..194005
                     /locus_tag="H0264_00880"
     CDS             193172..194005
                     /locus_tag="H0264_00880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY30994.1"
                     /translation="MSAAPSKAPESGAAGVFSRSRAAIAAKTLRTDRWWVPPLITVLG
                     LSVFVIYATVRSFQNNWYWVEEYHYLTPFYSPCLSDACVPGSSHFGTPIPKLPSWIPL
                     GFLVLPFLLLFRLTCYYYRKAYYRSVWMSPPACAVAEPHAKYTGETRLPLIIQNAHRY
                     FFYAAALIAVINTYDAAISFHGADGGFGIGLGSLIITVNATLLWAYTLSCHSCRHIAG
                     GRLKHFSQHPVRYRFWTVVSKLNTRHMQLAWTTLGTLILTDLYIALVAADKISDLRII
                     G"
     gene            194055..196022
                     /locus_tag="H0264_00885"
     CDS             194055..196022
                     /locus_tag="H0264_00885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005196092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase/succinate dehydrogenase
                     flavoprotein subunit"
                     /protein_id="QLY30995.1"
                     /translation="MPEVERHKYDVVVIGAGGAGLRAVIEAREHGLSVAVVCKSLFGK
                     AHTVMAEGGCAAAMGNANEKDNWETHFKDTMRGGKFLNNWRMAELHAQEAPDRVWELE
                     TYGALFDRTKDGRISQRNFGGHTYPRLAHVGDRTGLEIIRTMQQKIVSLQQEDFAATG
                     DYEARIKVFAECTITELLKDGDKISGAFGYWRESGRFILFETPAVVLATGGIGKSYKV
                     TSNSWEYTGDGHALALRAGATLINMEFLQFHPTGMVWPPSVKGILVTEGVRGDGGVLK
                     NTDGERFMFNYIPAVFKGQYAESIEEADQWLKDNDSARRTPDLLPRDEVARAINEEVK
                     AGRGTPHGGVYLDIASRLPAAEIVKRLPSMHHQFKELADVDITKEPMEVGPTCHYVMG
                     GIEVDPDTGAATVPGLFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGAATYVEQL
                     PGRPKISDTDLAAAAKSAVAAFDPPSDGPAENPYTLHMDLQQTMNDLVGIIRKEHELK
                     QAIEKLAELRERYDHVQVEGHRQFNPGWHLALDLRNMLLISECVAQAAMQRTESRGGH
                     TRDDHPKMDSAWRNKLLVCRIDQDEIGFSVPSVTVTPEQQPPMRADLLRLFDLAELEK
                     YYGPAELEPLRGEGERTVVPPSGSADIEGES"
     gene            196025..196771
                     /locus_tag="H0264_00890"
     CDS             196025..196771
                     /locus_tag="H0264_00890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase/fumarate reductase
                     iron-sulfur subunit"
                     /protein_id="QLY30996.1"
                     /translation="MGYEAKFKVWRGDLDGGGLHDFTVEVNEGEVVLDIIHRLQATQA
                     PDLAVRWNCKAGKCGSCSAEVNGRPRLLCMTRMSTFTEDEVVTVTPLRTFPVIRDLVT
                     DVSFNYEKAREIPSFTPPMDLKPGDYRMQQADVERSQEFRKCIECFLCQNTCHVVRDH
                     EENKESFAGPRYLMRIAELEMHPLDVADRRELAQGEAGLGMCNITKCCTEVCPEHIKI
                     TDNALIPLKERVVDRKYDPLVWLGNKLFRR"
     gene            complement(196857..197054)
                     /locus_tag="H0264_00895"
     CDS             complement(196857..197054)
                     /locus_tag="H0264_00895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34031.1"
                     /translation="MDRGLRNYRPRYRKLGPDDWVERLIVGMLFAVSAMGVYVLTGAF
                     LPALAVGVLVGAVALGVVAIL"
     gene            complement(197187..197390)
                     /locus_tag="H0264_00900"
     CDS             complement(197187..197390)
                     /locus_tag="H0264_00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014351262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF397 domain-containing protein"
                     /protein_id="QLY30997.1"
                     /translation="MSMDLAGAAWFKSSRSGAGKECVEVAFLPAGHVGVRDSKNPTGP
                     ALVFDAREWDSFTTGIESGVFER"
     gene            complement(197387..198376)
                     /locus_tag="H0264_00905"
     CDS             complement(197387..198376)
                     /locus_tag="H0264_00905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="QLY30998.1"
                     /translation="MKCVPKCVSGREPVDRSVAHRCRRSSVPRPRTERAVSEVPGSTL
                     PRRQLGRYLRDWRIQAGLTIAEAAKLMEWGASTLQRLEKGNADRIRTIDIQELCRIYG
                     IPGEIADGLKGLAQQAAVKSWWHSYGDLIPENFDVYVGLEASAQQLSCYQNELVPGLL
                     QTPDYARALNRLGYPEDGPAELNRRVQLRLQRQALITRRTRPASVAMVLDESVLRRSV
                     GGARVMAAQVRHLAELSTRPNVALRILPFEAGVPLGLSTGPFVILEFGTDGKGQPVEP
                     PVVYVEGFTGDLYLERQGDVQRYRQAQESLERCALDVQDSRILLRQVAKGYSA"
     gene            199057..199923
                     /locus_tag="H0264_00910"
     CDS             199057..199923
                     /locus_tag="H0264_00910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="QLY30999.1"
                     /translation="MNRRVRRAAASYALLLPSLVGVGGFLLLPIAIVLWLSVHSWNLL
                     GPVEFTGSSNWRSVLSDGEFGHSLVVTLGLTALVVPIQTALGFAVAALLARRGRGGTV
                     LRVVYALPWMCAPVAVGVVWQWIFAPSDGALNAVLGRRVEWLSSPGLALPAVVAVLVW
                     MNVGYVALFFVAGIRAIPGEILDAGALDGATGWRRTRWLVLPLLRPTMFFVLVTGVLT
                     VFQTFDTVYALTRGGPEHRTDVVAMRMYSEAFEAAQPGRAAVMAVVVFAIMFVITVAQ
                     YRYFRDRTSYEY"
     gene            199913..200746
                     /locus_tag="H0264_00915"
     CDS             199913..200746
                     /locus_tag="H0264_00915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="QLY31000.1"
                     /translation="MNTEMRGGMGRSVVAYLILVAGALLTVAPLVLSAVTALKTPGQF
                     AGESALAPPHPVTGDNFATVLGQGLGRAVVVTALMTVFITCGQLLTSILAAYAFARTE
                     FPGREALFWVYLGTMMVPPAVTLIPLYLMFAKAGWLNTFWALVLPFVFGSPYAIFLLR
                     QYFRSIPGEIVDSARMDGANTLDILVHVVVPMSRPILATLTVITVVTQWNSFMWPLVA
                     ASGPKWQVLTVATATMQTRYNAQWTLVMAATTLAIVPLVVVFVVFQRQVLRSIAWTGL
                     K"
     gene            200749..202023
                     /locus_tag="H0264_00920"
     CDS             200749..202023
                     /locus_tag="H0264_00920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016889575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="QLY34032.1"
                     /translation="MKDSTRAVLGVLVALALLVGAALWLGRDTGDGGRTVVRLRIWDQ
                     SFVPAYRDSLDEFQRANPDVEVRITLVPWASYAQKLRLDVAGGIADDLFWTSLYEDYA
                     DSGHLMDIGAALGGDAARAWDPAAVTQFTRNGTLWAVPQFVDGGTALYYNRDLLERAG
                     VDPGTLAGLRWSSEEGIDTFRPLLRQLSGVAPWPYNAANDFQSILLPYLGSAGGRFQQ
                     DGRFAFASEQGRDAFGYLTRLIADGLSPSAADTNNSSDFAKNAFLQGRMPLFQSGTFN
                     LATVQQSAGFRWGVALIPAGPAGRVSANNAIGLSGNTATAHPEAVRRVLAWLGSAQGN
                     RYLAMDGNTIPAVVSEQQLYRDYWAQRGIDVSPFFDVLRGEQISAGGGAGFQAAIQAI
                     FPVFDEMFLGRIPVTDALDRAQAVGDKAIDQQ"
     gene            complement(202024..202947)
                     /locus_tag="H0264_00925"
     CDS             complement(202024..202947)
                     /locus_tag="H0264_00925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005517105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase 2 family
                     protein"
                     /protein_id="QLY34033.1"
                     /translation="MPTASARVRIVRSERPIDLAATVEPLRRGYGDPCHRETPDGGHW
                     HASRMPSGVVTYRLKQVDRCAVEAKAWGPGAEEFLEGLESMLCLDEDLGDFLPEHPKV
                     VEAHRLNPGLRMLRTGLVFEALVPAVLEQKVHTKTAHASWRKLVWKYGTPAPGPAPDG
                     LRVMPDAETWRHIPSWVWHRANVEPQRSRTIVLAARVAPKLEQAAGFSREEAERRVRT
                     VPGIGVWTAAEIAQRAFGDSDALSVGDFHLASIVGWTLLGRPIDDDAMVEYLEPLRPH
                     RYRAVRLLGLAGFAHKPKFGPRTPYTDHSRI"
     gene            complement(203029..205809)
                     /locus_tag="H0264_00930"
     CDS             complement(203029..205809)
                     /locus_tag="H0264_00930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="QLY31001.1"
                     /translation="MRGSWERALRAAVDGEVDTDARRRAEYASDASNYRVLPAAVVFP
                     RTAGDVAAALGIARGEGLAVTARGAGTSVAGNAIGPGLVLDFSRHLNGIPELDPERRI
                     ARVQPGVVLGALQREAARHGLRFGPDPSTQNRCTLGGMIGNNACGPRAVAWGRTSDTV
                     RELLILDGSGVERRLREDLAEIPGLAEFTRANLAVIRTELGRFERQASGYALEHLLPE
                     RGSSLAKAFVGTEGTCGLLLEATVDLVPVPAATVLVVLGYADMPTAADDIKAVTAAHP
                     IAVEGMDARLVDVVRSHRGAVPELPRGGGWLLVEIAGETAEQAREVAEFLASSATALD
                     SRVVTNKAEAQALWGIRADGAGLAGRTPDGHPAWPGWEDAAVPPDRLGAYLREFADLT
                     REHGVDGLLYGHFGDGCIHVRLDLPIVDAPQRFRAFLEDAARQVVRFGGSLSGEHGDG
                     RARSELLRFMYSEQALRAFAGFKSLFDPDDVLNPGVAVHPNPIDTDLRLAGLRPLPTA
                     DGFAFPADGDLATAVHRCVGVGKCRADTRASGGFMCPSYLATADEKDSTRGRVRVLQE
                     VVRGELDWRSDAVAESLDLCLSCKACGSDCPAGVDMATYKSETLHRRFRGRIRPLDHY
                     SLGRLPQWLSAATRAPRMSNRLAAFGPLRRIGLRAGGMDPRRPVPPLASRSFRRIWRD
                     HDSGAGFSQTRNPPVLLWLDTFTDAFDPEIASAAVQLIESTGCPVELPDRRVCCALTW
                     ITTGQLDGARKRLRATVDALAEHVGAGGLVVGMEPSCTAALREDLPRLLSDDPRAAEV
                     ARAVRTLAEFLATQPGWQPPDRTGTTVLVQPHCHQHAVLGFAADRRILERTGATITEL
                     SGCCGLAGNFGMQRGHYETSVAVAETSLLPALRAAPPDAVLLADGFSCRTQADQLAGR
                     TFRHLAQFLLDP"
     gene            complement(206021..206662)
                     /locus_tag="H0264_00935"
     CDS             complement(206021..206662)
                     /locus_tag="H0264_00935"
                     /inference="COORDINATES: protein motif:HMM:NF015928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase inhibitor family I36 protein"
                     /protein_id="QLY31002.1"
                     /translation="MSLRSRLAGLAGIGLLAFASTLAGSTPAQAATGYERCPTGWICL
                     FDRPDGEGTMKKFAIGSANLAEWGAEDFTRSLYNRTGAEVSLFTDRNYKGISYAIQPN
                     DQLDDTPDFDISSLTVHNDHAVGYNQCPDTWVCLFDGPNATGNMYKFKIGSLDLRQWN
                     ADNKAVSMRNRSGKEVNLYEDYNYASWAYTYAGHDAVYNGYQLPSGTSSIKVG"
     gene            206835..208715
                     /locus_tag="H0264_00940"
     CDS             206835..208715
                     /locus_tag="H0264_00940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QLY31003.1"
                     /translation="MSMESVAWNQLYRQMNAPTEQRPLRLATAKRILAFARRHHRRLA
                     WFLVLSIGSALLAVATPVLAGRVVDTIVGGGPARTVVVLAAIIAVVAVLDAGLGLVIR
                     WLSARIGEGLIFDLRTAVFDHVQRMPVAFFTRTRTGALVSRLNNDVIGAQRAFSSTLS
                     GVVTNVVTLALTLVVMLRLSWQITLLALVLLPVFVLPARRMGERLAGIQREASGLNAA
                     MSTQMTERFSAPGATLVKLFGRPQQESAEFATRAGRVRDIGVRTAMLQTVFVTALTLV
                     SALALALVYGLGGYMALRGQLDPGAVVALSLLLTRLYSPLTALASARVDVMSAMVSFE
                     RVFEILDLKPLIEDAPEAKPVPEGPVAVELDHVRFGYPSADKVSLASLEDVATLDTRG
                     GEEVLHGVSLRAEPGQLVALVGSSGAGKSTIAQLVSRLYDVDSGSVRLGGTDVRELTG
                     RSIQDTVGLVTQDGHLFHDTIRANLLLARPEATEDELWDALRRARLFELISALPDGLD
                     TVVGERGYRLSGGERQRLTIARLLLKQPRVVILDEATASLDSTSEAAVQEALAEALDG
                     RTALVIAHRLSTIRNADQIVVLEHGTVVERGTHTQLLAAGGRYAELYRTQFADDSTPA
                     AA"
     gene            208818..209375
                     /locus_tag="H0264_00945"
     CDS             208818..209375
                     /locus_tag="H0264_00945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011210261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QLY31004.1"
                     /translation="MSPKRVDKTARRQEILAAAVRVFARKGFAASRIDDVATEAGIAK
                     GSVYLYFDSRDALLAAAFEQYSGDSQAIVRRILESDAPPLDRFATLVREVLGALATTP
                     DHARILLDLWATDYMREVYQEHRVLITGLLREIRPDLGEAHATVIVGVIEGVLLQWLV
                     DPEVPVGELAQPILDICIDGLRERT"
     gene            209372..209890
                     /locus_tag="H0264_00950"
     CDS             209372..209890
                     /locus_tag="H0264_00950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014984029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31005.1"
                     /translation="MTTLTLNERLIAPGATTGESLACYLTAAAGAIGAVLLALDAELP
                     GLAVAVIALVAFDLCGGAVVNSTSAAKRHFHRPGRTRWHHLGFVAIHVQPFLLALVVP
                     GFGWAAAGFVYALALGGAVAVLAAPVRLRKPVAFAWVTLAMLAPIGLPAALVWVTPVL
                     LIKLLLAHLQPE"
     gene            209960..210910
                     /locus_tag="H0264_00955"
     CDS             209960..210910
                     /locus_tag="H0264_00955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014466643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="QLY31006.1"
                     /translation="MGTHSHGHSHGHQHGNGHSHGHGHGHTHDNIDWSTMLERLRQDD
                     SIEAATQAQIAERLVGLLTPENDQPTVLDIGAGAGGQSVAFALELARRGGGRLVIADA
                     VPELLEAAREAVLTALNGDDRVKVDTVRVDAASDEIFDVVPLTDLVWASRMVHHLPDQ
                     QAGTSRLARLVRPGGWLALAEGGLQTRCLPWDLGVGAPGLQDRLLAARDAGFAQMRAE
                     IDGSVRMPYGWNVALTKAGLSEVTSFSVVTDHPAPVSPEVRASVTAWLVWLLERTAER
                     LDADDRTAVGTLLDPSSDAYIGAREDVYLLGATTVYLGRH"
     gene            211039..211623
                     /locus_tag="H0264_00960"
     CDS             211039..211623
                     /locus_tag="H0264_00960"
                     /inference="COORDINATES: protein motif:HMM:NF019656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1707 domain-containing protein"
                     /protein_id="QLY31007.1"
                     /translation="MSQSNEKRSTAAVRIDDLERTLTARRLQHAVGEGRLDLMELDRR
                     LGAVYAARTNAELSAVTADLPDHNAETLDLRVGSGTKRVDGQWEVPDRLTAECGSGTI
                     HIDFNNAYCARRQITVKVEIGSGAVVLIVPRGWRVDLDRVQCGSGSVVNRVKLPHFPG
                     APILRVEGKVNSGAVKARYRYRSPWAWLKRSHTR"
     gene            211688..212776
                     /locus_tag="H0264_00965"
     CDS             211688..212776
                     /locus_tag="H0264_00965"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="QLY31008.1"
                     /translation="MRRWLLHVDLDQFQAAVEFRRHPELRGQPVIVGGNGDPAEPRKV
                     VSCASYPARAYGVRAGMPLRTAARVCPDGVFLPQDLTTYAEASEEIMELLRTFPGRVE
                     VLGFDEAFLAVDTDDPERLAQEIRSAIAELDLTCAVGIGDNKTRAKLATGFAKAVGKT
                     GDQANPGTGTFRLTSDNWAELMNHRPTTALWGVGARIAKRLSALGIETVGELAAADRD
                     MLAAEFGPNTGPYFWVLGHGGGDTDISAPREPVGRSRSETFPADLTEIADIDDAVTRL
                     ATQAAEETFAEGRAIGRVGVTVRTKTFFTRTKQKKLPRACTDVDEIVQTALTVLHAFE
                     LDRPIRLLGVRVEFVMLGPDIATEGSRG"
     gene            212773..213555
                     /locus_tag="H0264_00970"
     CDS             212773..213555
                     /locus_tag="H0264_00970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013471424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="QLY31009.1"
                     /translation="MSDYENILFEHNGPIARITLNRPKAANGIDQALADELARAAAYC
                     SEDPAIKVVVLTGAGRFFSAGGDVRAMADSPDTGEFIEKLAATLHHAVSSFARMDALL
                     IVGVNGTAAGAGLSLAVAGDLVVAAESASFTMAYTKVGLNPDGGASYYLPRLIGLRKT
                     QDLMLTNRVLTAADALDWGLLHQVVADDELTTTVETLAQQFAAGPKLSNAHVKKLLLV
                     SSQHTLEEQLNTEAQFITSCARSADGQEGIAAFVAKRAPKFA"
     gene            213685..214677
                     /locus_tag="H0264_00975"
     CDS             213685..214677
                     /locus_tag="H0264_00975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="QLY31010.1"
                     /translation="MEFQAMVAHETDSGITLVRETVGDDFLGPGNVTIRVQYSSANYK
                     DGLAITPRGGVVRAYPIIPGIDLTGEVVESEDPDFAPGDLVVAHGYDIGVAHHGGFTE
                     YAKVPGEWVVKLDGLTPREAAALGTAGFTAAMSVQALLDHGLTTSDGPVLVTGATGGV
                     GTVAVDILAGLGFEVIASTGKIGATELLETLGAKTVIGRLPAEGEKLRPLGKSQWAAA
                     VDSVGGESLAHILSTTNYGGAVAVSGLTGGPSVPTTVMPFILRGVSLLGIDSAHFPIA
                     KRRDLWARLAKDLKPQHLSLLENYAPITEAESVLRSILEGTHSGRTVLGVAGEF"
     gene            complement(214674..215375)
                     /locus_tag="H0264_00980"
     CDS             complement(214674..215375)
                     /locus_tag="H0264_00980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014986076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="QLY31011.1"
                     /translation="MIAVATWNVLHRVHADNYAGDTVERWPREADRIASVAAAIAQLP
                     ERVIALQEVSGDQVESLREALPDRTVHVLRYPRVPTPRRLPDPLRDRSENLVIVSDGS
                     SKVVAAENFANDRGNGLLAVEFEDLLVVATHVSGDERRESQFVRLAEVVADRRAVLLG
                     DFNVDRGTVAAALGGDFEVAEFPADSIPTRPRTSGTKSQFIDHVAGRGVTVRDLVVED
                     VAGVSDHNLVRAVVG"
     gene            complement(215634..218078)
                     /gene="lon"
                     /locus_tag="H0264_00985"
     CDS             complement(215634..218078)
                     /gene="lon"
                     /locus_tag="H0264_00985"
                     /EC_number="3.4.21.53"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endopeptidase La"
                     /protein_id="QLY31012.1"
                     /translation="MTTSQNLPVLFLTDPIVLPGMVVPVELDESAQAAIDAARAGKVN
                     QVLVAPRLDEGYATYGVVATIEQVGRMRGGAPAAVLKAEERAKIGHGVTGPGAALWVE
                     AEAVEVPAADGKTKELAAEYKKLVVAVLQRREAWQVIDAVNQLQDPSALADAAGWASY
                     LSNAEKRELLETVDTATRLSKLIEWTKQHIAETEISEKISEDVREGVEKTQREFLLRQ
                     QLNAIRKELGEDEPDGAEDYRARVENAELPDDIREAALREVGRLERSSDQSPESGWIR
                     TWLDTVLELPWTVKTEDSTDVSAARAVLDADHHGLDEVKDRMVEYLAVRARRAARNLE
                     VVGGRGSGAVLVLVGPPGVGKTSLGESVARALGRKFVRVALGGVRDEAEIRGHRRTYV
                     GALPGRIVRAMKEAGSMNPVVLLDEIDKVGSDFRGDPAAALLEVLDPAQNHTFRDHYL
                     DLDLDLSDVLFIATANVMETIPGPLLDRMELITVDGYTEADKVAIARDFLVPRQLERN
                     ALTAEEVSVTDAALREIAANYTREAGVRQMERLVAKALRKAATKLSEQADLADAESRV
                     IAGEFVPQPESLGYDEDLGYDEVARTGSLVIDLPDLKEYLGRPRFTPDSVERTAVPGV
                     ATGLAVTGAGGDVLYIEANAAEGDRSLTLTGQLGDVMKESAQIALTYVRSHLEEIGIE
                     PKVLDRNIHIHFPAGAVPKDGPSAGVTMVTALVSLALGRQVRSDVGMTGEVTLNGRVL
                     PIGGVKQKLLAAQRAGLKTVFIPARNEPDLDEVPTEVLAALDVRPVADVAEILAYAIE
                     PVAEPAYSGPALSATA"
     gene            218232..219239
                     /locus_tag="H0264_00990"
     CDS             218232..219239
                     /locus_tag="H0264_00990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007829717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="QLY31013.1"
                     /translation="MIMLAARLHLGKERRLELDEVPVPEPGADQVLIKVEAAGVCLSD
                     VHLIDGMLSPLFLKGDVVTLGHEVAGTVHALGPGVTAAKVGDRVLLQAGEVRGAAVYT
                     RGVDYDGGWAEYTLARVDTLVPIPDDLPFEQACFIPDAVSTPWAAITATAEVKPGEPV
                     GVWGVGGLGAHGVQLLRMVGAAPIIAVDPLPAARERALEFGADFAFDPADPDLRRKVF
                     AATGTGLAAAFDFAGVAAVREQAVVCLAPQGRLVLVGLTDKPITITGGTAFSFFQQQL
                     RGHYGSQPEHVTQLVKLQGLHRVDFSRSVSAVMPLADAAKAVHALDAKEGNPIRIVLK
                     P"
     gene            complement(219258..220319)
                     /locus_tag="H0264_00995"
     CDS             complement(219258..220319)
                     /locus_tag="H0264_00995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005513184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="QLY31014.1"
                     /translation="MTVDRRGFLAGAAAAAGVTTLAAAGPAWAAPVPAVADGVPKFPF
                     PTGTDLRILVTGDAGTGARPQWAVADAARALHARQPFSLALGLGDNVYESGPWADDDA
                     QFKAKFEDPNNGLDIPWIMVQGNHDNSSILPGDGGWLLRGDHEVAYHARSARWWMPSR
                     YYSVRIPHEQPIVEFFILDLNPIAAYLPPLFNEYWSAGGTFMTEQAAWLDRALAESPA
                     KWKIALTHHPYLSNGSHGNAGEYDGVPIDLVNGSEVKKFFEAHVLGRCQFLLSGHDHN
                     LQVLEPTTDCKGTRQIISGAAAKTSSGHPDRNPALFQTFTDLGFMVLDLNPSSADLGV
                     YTVDPSNPQPVNVFQRRLA"
     gene            220447..221802
                     /locus_tag="H0264_01000"
     CDS             220447..221802
                     /locus_tag="H0264_01000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31015.1"
                     /translation="MTTVASGMFLDWEQLTGQPKLVVDLISFPVFSAIAGLLTNWTGV
                     LMLFWPVYFRGIRIPGLEILYPYLPRRVQVLPIFSEDGRQFGFQGFIPARAEKMASIC
                     VDKALMRIGSPKDFIHELDLDGIADYIAAIGRKQVEPIVDGIMKRENPELWAVAPKAV
                     KNVLYQRVERELPNLARRSFEQLGDNVDQLIDIKSFVIRYLRENPEILKDLTTTIAAP
                     ELRFMIRVGLLGAPFGVLLALYMEVHHSIPIIGWIPGWLVILAAAAAIGVIVNMIAVK
                     VVFEPGDPQPRYKYLWKQALLAKRQPQAAADLATILAYQVLTLPNLARELLEGPNGDK
                     TRLMLEKLIADEIHRQLGPTHTMARAAFGKRQFDNLKVGAAGAAVNLVPSLVEDEVFA
                     AEQAKKIEEFAARKLQQLTPGEFMEMFYASVEQDAWLLYLHGALLGLVVGGVHLVLFG
                     W"
     gene            221906..222697
                     /locus_tag="H0264_01005"
     CDS             221906..222697
                     /locus_tag="H0264_01005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03084 family protein"
                     /protein_id="QLY31016.1"
                     /translation="MADLEALFADLTAEGDELDRLVADLEPAAWQTDTPAAGWTIAHQ
                     IGHLYWTDKVAAIAATEAGEFQKLVEAALPKALTFVDEAAEEAATIPAPELLAAWRTE
                     RTALVEALRGVPAGTKLPWFGPPMSVASMATARLMETWAHGQDVADALGVTRTPTPRL
                     RHVAHLGVRTRNFAYMTHGRSAPAEEFRIELTAPDGSLWTWGPEAAAQRITGPALDFC
                     LLVTQRRHIDDLTLAVHGADALEWLGLAQAFAGPPGSGRTAGQFL"
     gene            223047..223796
                     /locus_tag="H0264_01010"
     CDS             223047..223796
                     /locus_tag="H0264_01010"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31017.1"
                     /translation="MSHQSATSAARTFRRTSQVLRYSAVVTASMASIGLTVAAGSYIS
                     NEIAGTQKSGNIFAVPAAPGGPAYERELEGGELSVDIAAVAETTSVNTLFHTWGVERG
                     APATISPVRPAEPGTSTPIAGQLRLGDTFVGAQVFPVQRNSLTVTVDTNVFAAVGSWL
                     LSGPIGERLGLTADPSATTQVRTELDTRRGDVKLTITDPAIGDLGLQLARHPAPAATA
                     ANEEGSKDGQAVTGDATTAPVHPEDSATTAV"
     gene            223808..224992
                     /gene="lhgO"
                     /locus_tag="H0264_01015"
     CDS             223808..224992
                     /gene="lhgO"
                     /locus_tag="H0264_01015"
                     /EC_number="1.1.3.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-2-hydroxyglutarate oxidase"
                     /protein_id="QLY34034.1"
                     /translation="MYDYCVIGGGIVGVATAHRILDRHPGASLLLVEKAGELAVHQTG
                     HNSGVIHSGIYYEPGSLKARLCVRGAELTKEFAAAHDIPFQVCGKLLVATDSAEQARM
                     LALYERSVTNGVEVELLDAAELVRREPRVTGVGALFVPGTGIVDYTRVTAELARQVRA
                     GGGEIVLGAEITSISETADAVTVSGPSGSWRAARLVVCAGLQADRMARLAGLDIDLRI
                     VPFRGEYYQLPPHRKDLVRTLIYPIPDPELPFLGVHLSPTIDGDLTVGPNAVLGLARE
                     GYAKGSVNWRDAREILGYRGFHRVAANNVRTGLREMRNSVFKRGYLAECRRYCPELTA
                     ADLLPREAGIRAQAVLRDGTLVHDFLIERTPRSVHVLNAPSPAATSALPIAEHIAAQL
                     DS"
     gene            225132..225632
                     /locus_tag="H0264_01020"
     CDS             225132..225632
                     /locus_tag="H0264_01020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRPBCC family protein"
                     /protein_id="QLY31018.1"
                     /translation="MGHMKYASDVGAPVEVAFSYTDNHQFVPDWAFAVAGFEPLGDID
                     HGLGAVFDTTLRIGFWHPTVECEITDHRRNAVIEYTLRRRRKGKPAPASTPLAVITLR
                     FDPLGYGRSVLTSEAEYWAPRGLSRHLLSRMLTAAVESAVRRTESQLRREIEEFHGTD
                     LVGRIA"
     gene            225643..226296
                     /locus_tag="H0264_01025"
     CDS             225643..226296
                     /locus_tag="H0264_01025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012689187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HI"
                     /protein_id="QLY31019.1"
                     /translation="MIIVSTDGSCLRNPGGAIGWAWVNHAGSSSDSGGAPSGTNQIAE
                     LRALLEAVRAHPGPEPLLIESDSLYAIKCASEWINGWRVNGWRTSTGGPVKNVELIQQ
                     IDRAINTRSGPVRFRWVRGHVGNYFNEQADALAGQAARKVAASGATEPASDPAPYDPI
                     TEPLPVEPATEPIPVTPAVDRAAEKIVAATAPAPVAQPARRRATTAKAPAADALTLF"
     gene            complement(226375..227295)
                     /locus_tag="H0264_01030"
     CDS             complement(226375..227295)
                     /locus_tag="H0264_01030"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31020.1"
                     /translation="MSDDAAQDKKNDDEATTGTPAAADADQPGGTADADQTEKAAAAA
                     KPELTKKSGDDQTEKIDKVEPVAVDTAKVDAAKADKPAKAAKPAESGDGKTGAAAGSG
                     LPGGKITVPMLAAVVAGVLLVAAIATAAALGWQSHSRGNQLSERDSATEAACDFGRVV
                     SIYDDKSMDNFISQVKERSTGQFLDNFQSTADALKDVMVSVQGKSSLAEIHCAWQSGD
                     ENKATVIMLISQVRQNSLMQSPDRLTLPVVAELEKKDGKWLMANFDSPALKGLSTGGA
                     TGGGTTTAPQAGQPSTGAPAPTTGAPAPGN"
     gene            complement(227432..228604)
                     /locus_tag="H0264_01035"
     CDS             complement(227432..228604)
                     /locus_tag="H0264_01035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="QLY31021.1"
                     /translation="MSWLKNHKNLMSNLALAMLLVVGATYLAVSVMRVNPLRETYTVT
                     VNLDRSGGLQSGNDVTLRGYRVGKVTGIELVDNGAALAATVEIDSKYRIPVDTLVSVG
                     ALSGAGEQYIDFRPQTEQAPYLGDGSVIKFDKDKVKTPTPVWSVLDNSSALIAQIDPD
                     KFSVILSELDVALSGGQDQLRSLIDGISLATTGLDNLLPQTTNLLANLRTINSTTSLA
                     QPDLATLTRNSSVLFQQFNDANAELQRILEQAPEQMATLGAVLDRTADPMTSLASNFV
                     AITKAAQLRTPALRALFPSLVVGSSAIGVPAHDNEFFTVVDIWPRPFCDYVTKKVANE
                     VVTDNEFPKWAGYCANPPADQQIRGSGNAPRPDVPNNGALPPAGADPNERTLPPAR"
     gene            complement(228601..229698)
                     /locus_tag="H0264_01040"
     CDS             complement(228601..229698)
                     /locus_tag="H0264_01040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="QLY34035.1"
                     /translation="MKDLRKAKKARRAVLALAVTAALGASGCGLTVESLPLPKPGAGG
                     DTYTVHAVFENALNLPDQAKVKIGGSDVGVVTKIETRNYQAIVDLDIRKDIELPANST
                     AELRQATPLGDVFVAVSKPKAEPGQQMLKNGDTLQHTSAGATVEELLLSISLLFNGGG
                     IASLSKLTAEMESIVGGRGDQLGSVLTQLTSVMTALNNNSQRIDSVLGGFSSLANTLE
                     ANHSELGQVADTLPGMIGAIAENNQAIGELLTKISTTSAALGDYADTTSADLASLLDN
                     VKQLMGALAQTEQDLGPALDALHEVRPGVEASFKGNTLAVAATLSMLDIGLLTDPANS
                     KFPDLKDLGDFAGSLIQVLQIIQGRVQGGHR"
     gene            complement(229710..230798)
                     /locus_tag="H0264_01045"
     CDS             complement(229710..230798)
                     /locus_tag="H0264_01045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="QLY34036.1"
                     /translation="MKRITQAAMVGAVTFAVGSCSIVPLGVKDAVGQTQHFTADFLNI
                     AGMFEGNPITVLGLEVGKVDKIIPKGQYVEVHMTVDNDIKIPRNVVAALISPSIVTDR
                     HIELSPVYTGGDVLKDGAHLTTQQTKTPVELDTMIKTIDTFAAALSPKDGQEGIGPLS
                     GRVLYPMMNGNGEKMREVLNSLSGALKVGVDNKDAVSTIIIKLNELTTMLAENDSSVR
                     GFSDKLTQMSGLLAEQAPGLQATLDQLNAFLANTSGAFAQYQDQLNGTLTGLTNVTQQ
                     LRDNAAGVTEIVDVAPLLMQNLDRSVNRQGGFVRLHGLIGTALSGELISLFCSRIQMR
                     ADGCRTGKIEDFGPDFGLTAAMLGLTSK"
     gene            complement(230807..231802)
                     /locus_tag="H0264_01050"
     CDS             complement(230807..231802)
                     /locus_tag="H0264_01050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="QLY31022.1"
                     /translation="MIAKLKSRFDSNRNFWLGVLGVVIICALLLASTVFRAVGVGEKT
                     IKAEFAQTAGIKVGDKVDVSGVPVGTVADMELENDHVLISLSVKDSVKLGPDAHASIK
                     MATLLGARFIDLDPGDGSGLKGGRILKSNTSVPYNLADVVQEGTPKFEQLDTVKLAES
                     LNLINQQLGDTPELTVQALDSMGALAKTINDRQDAVDQLLKDLDTVTRVLGDNRNSIL
                     LVITQGEAIANRVMERQSLLKSLLDNISTLSLQLQQIGTENDGQFGPTLEQLNTMAEG
                     LQKNKDNLDKLLSIMPPSLRQFNNAFGNGNYGEVALPWLFPDNWLCFAHVAEGCQ"
     gene            complement(231799..232833)
                     /locus_tag="H0264_01055"
     CDS             complement(231799..232833)
                     /locus_tag="H0264_01055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="QLY31023.1"
                     /translation="MSIRKPLIGFSLFAIVSILVTAVIWNTLARTVDGSTNTYKAVFT
                     DVLGLREGDDVRMAGVRVGKVEKIELDGTNNAVVTFIVQNNQTMFSDTKALVRYQNLI
                     GQRYIALQLDKKSTGSHVPMKNNETIPVERTEPSFDISGLLNGFQPLFQVLQPEQVNS
                     LSNTFIQALQGDGVSLSAFVTQAAAVASDFQRRDGILADVITNLSAVMSGLAKRSGEL
                     ETLVTQTRALIGGLYEQGQSLQASTVQIADATSSLVSMITQIQPKLSLAQASTRDALT
                     LLLANGAKLDQAAVDLPAILAALGKFTQNGAYANAYVCSLDVSLYGVLFPRGLFNQIG
                     GNSHSAVCRP"
     gene            complement(232830..234269)
                     /locus_tag="H0264_01060"
     CDS             complement(232830..234269)
                     /locus_tag="H0264_01060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="QLY31024.1"
                     /translation="MIIDPSGRGPTMRQLLIAGVCGLTVFAIILAFLMARYQGYFVEK
                     VKVTANLTTTGDGLPSNADVKFRGVLVGVVKDVSVAAKGELQQVHIEMKPEYVSGIPA
                     TVTARVVPSNLFAVTSVELVYNGPDSAHLREGSQIEEDRSQGTIALQDTLTTVRDILG
                     KIDPIQFGRVLGTLSYALDGSGRMPGSTVERVDRWLREVRGAVPDVDGFLTDFSNSFN
                     ALNQSAPELMTVLSESVQTAATISNRRAELVSLIGGTSATVDKINSLFARNPNVGKEV
                     TTGTSALFGAISEDPNAIPIAIANLNNSVRKLGSTFHWGEQKQMVWNMGITFTPYKPY
                     TVADCPRYGELAGPSCGTAPAESDPGTLPESLRPRAVDSAAGLPPATLPEGISIPGLT
                     TGGATEQNPFAGTPLQGLFPSLAVPGASAPAAQQPAGETPAAGAISYQGDDAIVALLG
                     RRPNAAEYLLLSSIMKGGTLQVTESGAGR"
     gene            complement(234282..235145)
                     /locus_tag="H0264_01065"
     CDS             complement(234282..235145)
                     /locus_tag="H0264_01065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY31025.1"
                     /translation="MSATYVPPVLRPFQKLRGVATSPRDWLARIGHQVFFFLRSLAGM
                     PTAFKHYPNEVWRLLRDVTWGNGNLVVGGGTIGVVLILSAFGGMTVAIQGHTSLNLLG
                     LSPLTGAISAFATTRELGPMLATLAFAAQAGCRFTAQLGAMRISEEIDALESVAIRPL
                     PYLVSTRMIAAMIAIVPLYCIALPLAYISCSLTIALIGGTATGTFQHYFYQFLVPQDV
                     LYSLAKAIIFVAITTFIQCYYGFFASGGPEGVGVAAGRAIKLCIIAVVFADLFMTLAI
                     WGVDPGIRISG"
     gene            complement(235150..235968)
                     /locus_tag="H0264_01070"
     CDS             complement(235150..235968)
                     /locus_tag="H0264_01070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY31026.1"
                     /translation="MNTAVDWAKGYWQDHPKRSLETGGRMMAMGVSAVAELFIAIFRK
                     RFPFGEFIRQCAFMANVAAAPTLLVAIPIGVIVSIQVGSVAQQVGATSFIGAANGLGI
                     IQQGAPLVTSLMIAGAVGSAICADLGSRTIREEIDAMKVMGVDPMRRLVAPRLGAAML
                     VSVLLCGFVVFVGFLTGYIFNIFAQGGTPGSYVGTFSSFAVTMDLFVALLKSLIFGLF
                     AAIIACDAGLNAKGGPGGVANAVNTAVVLSAVMLFGTNLALTQIYNSLFPPQMV"
     gene            236462..237127
                     /locus_tag="H0264_01075"
     CDS             236462..237127
                     /locus_tag="H0264_01075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007297920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="QLY31027.1"
                     /translation="MIRKFAGVAGAFAVALSTALLGAGAASADPAPAVIGGGSGIIID
                     DMFECTVTTIGHDGAGRLVGLTAGHCGDPGAEVYAEASRGSGLIGKFVYSNHDLDYAV
                     IQFDPARVVPVNRVGNVTITGIGGPPNFPMIVCKEGRTTGNTCGISWGDVFGTNIETW
                     SQMCVVEGDSGAPVVVGSTLVGMVNAYLAIACFGPEVGTNMSTIMGDLNARGGIGSGY
                     YPI"
     gene            complement(237194..237790)
                     /locus_tag="H0264_01080"
     CDS             complement(237194..237790)
                     /locus_tag="H0264_01080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34037.1"
                     /translation="MFARTAAPLIAAAALLLAGCGGSTIDGTPVAASGGPSATTTAKS
                     PTTTKAPTGKGSPTTTKPGGGRTDFQAAIGDCVNLGGTDTDAEIDKATCGSANSNFKV
                     VAKARNSDSCPADTDHVYYETLNGIETGAICLEIDWIVGECMELNGIPKRISCTTPGT
                     IEGVKVEKILQGTTDINGCEDGGYVYEERRKVVCVFSL"
     gene            237909..239261
                     /locus_tag="H0264_01085"
     CDS             237909..239261
                     /locus_tag="H0264_01085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="QLY31028.1"
                     /translation="MNSTERLREPRPVLLHAAAAGVDLGRYLRWRREREGDPFRVAFP
                     RFGSAVFTGTPAGARELFRAPVELLEPPLPNPIEPLVGSASLILSRDGRHRRGRTLLA
                     PAFHRGRISAYGNIIRDAAVAEMAGGGTGSPWRRGSRVDARAAARAITLRVILAAVLG
                     VDDPIRRSEFTTATTEFLNAFGGHLMLVPALRRSMFGMSGWDRFVDARDRMDELIDAE
                     IERRRAEVEGGEDILGLLLGSRYEDGSAITDSDLRDQLRTLLVAGHETTATSLVWALY
                     RLHREPDTLRRLRAELDEAGDGLDPAELVKLPYLDAVCQESLRLHPPVPIVLRRLTGD
                     FTLRGAPLVAGDTMGLAVQLLHSDPAVWARPLRFEPERFLEQRYGPFEFAPYGGGHRR
                     CVGAALADYELRIVLATIVRSVGLRLSPRFAGGRVPHTVPHNIATGPHAAITFDVIEA
                     "
     gene            239476..240459
                     /locus_tag="H0264_01090"
     CDS             239476..240459
                     /locus_tag="H0264_01090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L,D-transpeptidase"
                     /protein_id="QLY31029.1"
                     /translation="MNAGLGPSGCICARILRVNEDREDQAVRHTRYRKTGLTVLAAVA
                     ATGAVVAAPAQAAPLWPGGPDVPGVPSAVMPQPAPGDLPTAPGASSPLPPANFDAPNI
                     NVGDGEVVGVAQPIIITFKEPISDHETAEKAIRITSTNKVSGHYYWFGDKQVRWRPES
                     FWPAGSKVTVKAGGTEVGFEIGDEFIATADDTTHQITVTRNGEVVRVMPTSMGKTGHE
                     TPNGTYIVSERNRKMIMDSSTYGVPVTAPEGYKLEVEYATRMSNSGIFVHAAPWSVAQ
                     QGKSNASHGCLNVSTEDAKWFQENVKRGDPVIVQNTKGGTLSTSDGYGDWN"
     gene            240744..241673
                     /locus_tag="H0264_01095"
     CDS             240744..241673
                     /locus_tag="H0264_01095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016883837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="QLY31030.1"
                     /translation="MRTRPERVLPQPPGRGWRGRPWQDYALFLVLVVPNLILLSVFVY
                     RPLVDNIRLSFFDWNISDTTATFIGFDNYTEWWSRDDSWQIVGNTVIFTLAAVVGSMV
                     LGLALALLLDRKLFGRNVVRSAVFAPFVISGAAIGVAFQFVFDPGFGLVQDLLHKLGV
                     DKTPDFYQDPNWALFMVTVTYLWKNLGYTFVIYLAALQGTRQDLMEAAEIDGASRWTT
                     FTRVLLPQLRPTTFFLSITVLLNSLQVFDIIYTMTRGGPLGTGTTTMVVQVYRESFVN
                     FRAGYGATVATIMFVVLLIVTLVQVRIMDRADD"
     gene            241673..242509
                     /locus_tag="H0264_01100"
     CDS             241673..242509
                     /locus_tag="H0264_01100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="QLY31031.1"
                     /translation="MRDNAFWAKVFGYAAMVCVLIMVGAPLFWIIITSFKTRPDIYVQ
                     PAVYWPKPWHPQNYSDATTKLPFWTFLQNSVIVTAVVSAVKFVLGVLSAYGLVFLRFP
                     GKNIVFLVIIAALMVPNQITVISNYALVSQLGWRNTLVGIIVPLCGVAFGTFLMRNHF
                     LSLPSEVIEAARMDGAGWWRLLTRVVLPMSGPTMVAFAVVTLVNEWNEYLWPFLMADG
                     QEVATLPVGLTLLQNTENPSVTNWGPVMAGTLLTMLPILVVFLALQRHMIKGLTSGAV
                     KG"
     gene            242529..243857
                     /locus_tag="H0264_01105"
     CDS             242529..243857
                     /locus_tag="H0264_01105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="QLY31032.1"
                     /translation="MSDQRFPNLSRRGFLGLAGAAAAGVALTACAGTGGGGKQEGDGK
                     TIKFWSNHPGTSKDLELELINRFQAKYPDLKVELVDAGKNYEEVSQKFNAALSGGELP
                     DVVVLSDVWWFNYALGGTIEPLDSHFASAGVQLDDYVDSLAADYLFNGKHYALPYARS
                     TQIFYYNKDVWSKAGLPDRGPNSWAEFDEWGPKIQSVVGADKWAHGWGDAKNYLAWTF
                     QGPTWTFGGRYSDQWTLKFNDPATISAGNYLRDSINTKKYASVRTQIAVDIGTGIVAS
                     GIASTGDLKGIMKNAEGKNSIGTAFLPHPNGPGATTGGAGLAIPSRISDQRKENALKF
                     IEFITNAANTAYFTQGTGYMPVRKSALNDPSELTFLAANPNSKTAIDQLSLTRSQDYA
                     RVFLPGADQIIGTGLEQIGLQNRDVTAAFGDVTTQLQAIYDKQISPKLPK"
     gene            243882..244961
                     /locus_tag="H0264_01110"
     CDS             243882..244961
                     /locus_tag="H0264_01110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016883834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QLY31033.1"
                     /translation="MATVQFDGVSLTYPGAPAPAVEDLSLEIADGEFLVLVGPSGCGK
                     STSLRMLAGLEAVTSGRIHIGDRDVTALAPRARDVAMVFQSYALYPNMTVADNMGFAL
                     RNAGMSKSDTMVRVREAAAMLELEDLLDRKPARLSGGQRQRVAMGRAIVRRPQVFCMD
                     EPLSNLDAKLRVSTRSQIAALQKRLGTTTVYVTHDQVEAMTMGHRVAVMRDGKLQQIA
                     APRELYDDPVNAFVAGFIGSPAMNLLTAPVIDGAAVLNELRIPVLRKDARDKVIIGIR
                     PESWDVTTDPTDALAVEVELLEELGAESFLYSHGITDQWSSRSGRIVARVDRRFQVAL
                     GDRLYLKPKPGEVFYFDAETELRLR"
     gene            complement(245041..246213)
                     /locus_tag="H0264_01115"
     CDS             complement(245041..246213)
                     /locus_tag="H0264_01115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014985970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="QLY34038.1"
                     /translation="MVHDPADRECLLQPRHERNRLPRSHSPAALLRHERRRRRQLRRH
                     RRGHRPRDRPRLRRPGLQIRRRRQHGRLVDRVRPHRIRQAHNGSHQPVQRLLPQGPLR
                     RPQGQRRVHHRREHRRPRRPLHRPGGVQDLPRRQGAPGHRRPHRPPARLLRLGPGVAH
                     QGPQGRSHPPPRRGPALPARIPLQRRHPQPRHLPRSLRGPAGRLPLPGPGGAREDLVT
                     PAVYLITGIQAAGKSTVAQALAERLPRTAHVRGDAFRRFVVNGREEMRPDPPEEALVQ
                     LRLRYQLAARTADAYADNGFTAVVQDVVLGDYLPWFAERIRTRPRYVVVLAPRPEVVA
                     AREAGRAKKAYGSYTVEDLDTGLHSTTPRIGLWLDTSDLTVDETVNAILDQARPMP"
     gene            complement(247596..247976)
                     /locus_tag="H0264_01120"
     CDS             complement(247596..247976)
                     /locus_tag="H0264_01120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF397 domain-containing protein"
                     /protein_id="QLY31034.1"
                     /translation="MITNAKYFPDSREWFTSTRTNNGNQCVEVRFDGATVHIRDSKYR
                     RDPANRPETEPVITVTATEWMAFLDHLTGRPAHPVELTAHTAADGHTTLRRGEITLVY
                     TPGEWEAFIAGVRDGEFDRIPVHS"
     gene            complement(248008..248859)
                     /locus_tag="H0264_01125"
     CDS             complement(248008..248859)
                     /locus_tag="H0264_01125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QLY31035.1"
                     /translation="MAPVSPTVARWELVLRLRELREQRGFDSATFAKRVGFTPANWSH
                     VEKGRRVLTVNTIGPVLELLEVDGEEREELQELLALSKERGWWAKSPALLGPELQRYY
                     GMEVGAESIRSYDSLVIPGLLQTEEYARALISADVMIRPVQVEQLVAVRMRRQERLRG
                     PERVELTAVVGEATLLQQIGGPKVLRGQLEHLVELLEDLDSVTVRVIPFAATHGAILG
                     GSSFHLLDFAGESLPTFAWVESSVFGGAVDDPGLVRDLAFALVRALDQSLSRTESLEL
                     IKHYSQG"
     gene            248950..249417
                     /locus_tag="H0264_01130"
     CDS             248950..249417
                     /locus_tag="H0264_01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31036.1"
                     /translation="MSALDPSSYTATQEALARCRRYRKEHGLYGVVDSALGRIMLEIG
                     AVGAVTMPADLGKKVCDRLKSGQRCGPVIAHPRSGRWTFLTGPTDDSYLDMSLFSDLF
                     SECAAVALPGSHIVLPSPTDEHNGYRAWICPPIGDFRPDLGEVVSATRECRVH"
     gene            complement(249448..249966)
                     /locus_tag="H0264_01135"
     CDS             complement(249448..249966)
                     /locus_tag="H0264_01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4190 domain-containing protein"
                     /protein_id="QLY31037.1"
                     /translation="MSQYPPPGQYGEQYPSPPPGGYPQQPGGYSPPPPGGGQQYWQES
                     PKGKGMAITAMVLGIIALPAILTVVGGILLGLVAAILGLIAIVKIRGGRAGGMGMAIT
                     GVVLGIIGIIGSVIWGLIIWTAAEETGFTDYIDCAQKAGSDQAKLDQCEREFNRRVED
                     KFSVTLTPQPTP"
     gene            complement(250060..250833)
                     /locus_tag="H0264_01140"
     CDS             complement(250060..250833)
                     /locus_tag="H0264_01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin family protein"
                     /protein_id="QLY31038.1"
                     /translation="MSTLTTPHIDVHRGGDRMKTRVAWLDSKHSFSFGEHYDPDNTHH
                     GLLLVNNEDIVLPGEGFETHPHRDMEIVTWVLSGSLVHQDSLGHNGVIYPGLAQRMSA
                     GTGILHSEKNDSWRISANPEHDEPVHFVQMWVVPDDSGLTPGYQQLEVDDELAAGGLV
                     TVASGLPRYRDRTAISINSSHAAMHVARMSDPATEIRLPEAPYLHLFVARGQVEMEGV
                     GPLYEGDAVRMARSGGQRITANVPAEILVWEMHARLGGQ"
     gene            251090..251560
                     /locus_tag="H0264_01145"
     CDS             251090..251560
                     /locus_tag="H0264_01145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX domain-containing protein"
                     /protein_id="QLY31039.1"
                     /translation="MRPEVLAGIERELRQQADSEGIVHFVVGVAVFQGGKLLVVRRVA
                     DDWHGGMYELPGGGVESGESFAECVERELFEETGLRVRRITDVLGGFDYATRTKSRVR
                     KYSFVVEVEPGEVSLAPGEHDQFQWIDADGLDSLPMAEDMRAAVFALVTTHPSR"
     gene            251467..252954
                     /locus_tag="H0264_01150"
     CDS             251467..252954
                     /locus_tag="H0264_01150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QLY31040.1"
                     /translation="MDRRRRPRQPAHGRGYAGRGLRAGDHPPVPVNTPASTGPAHSPP
                     ARRSPREFTRRIRTVLRESPGVLRLTTIRLAGQFGDGMFQGALSGAILFNPERETDPL
                     AIAGGFAALLLPYSIIGPYAGALLDRWDRRTVLLLANVLRAMLIAVTALALHGGVRAT
                     PLLLLALAVVGTSRFLGSGVSASLPHVLAQHRLVPMNSILATVASGFTIAGVGTAFAI
                     IKVVGAGDFGSAVAVAASTAGSVIAAIAAAGFAPHALGPDRPDKYPGPVAATEIPAVE
                     QRSAVRAIASGLRAGATAAWQSREVTTAMIGIGAHRVVFGADTLLMVLVLRRGEGGVG
                     THMAKFSAAISAAGAGMVIAAVVAPMLIPRWGRSKTVVAGLATAIVVQLLLVTPITFA
                     TGVAERWAEVALLAAAFLLGLAGQTIKLTGDAAMQIDIDDTHRGQVFALQDTVFNITF
                     VLAIAGTAMLIPADGRSPGVVIAAAGVYACGIAAIALNSRRTAGP"
     gene            253229..254893
                     /locus_tag="H0264_01155"
     CDS             253229..254893
                     /locus_tag="H0264_01155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4185 domain-containing protein"
                     /protein_id="QLY31041.1"
                     /translation="MGLRRPAASTRSDNPAALALSGVLTLGAVLLPAAPAHSAPHPWQ
                     PPPVNSCGETGFDPLAREREPGTTPPPPDTTVRIDVPVPEIIEVPVPGPQPDNTRIVA
                     EPLPADPCANPCPDIRDRPKPPDPADSALPEQNPDDSAAPDSGTSEPAPPPTGSGSGS
                     GSESGSGSGGGSAAIPWPHLEINKQTELIPIPVPGGEAPEPQPAPEPAFQAAEPAPVA
                     APPAVPGLESVRVVEQITGPGSTNRTDMRWSVDGTDLGLIWETKPGEVAVVFGDTFGK
                     GWEPIGGGTGDQDWRSNVLAYSTDRDLSDGLTLDTFVQDSRCHAAEILDSRKINNFEI
                     TTIPTSGFTLGDRQYLTYMSVARWSRIPGMWYTNLGGIAWSDDNGSTWTKSQWAQWHN
                     LFGLGRFQVSTMVPHGDHVYMFGTPNGRMGMIGLARVPQDQILNKTAYQYWVNGTWEP
                     ANGPGELFATPLVSGTASELAIRFDQDSGLWQMIYLDVTRNQMVLRTAAEPQGTWTEP
                     VPLLSTDDYPTAYGGFIHPWSTGKDIYFTMSTWNAYNVFLMRATLN"
     gene            complement(254915..255781)
                     /locus_tag="H0264_01160"
     CDS             complement(254915..255781)
                     /locus_tag="H0264_01160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-dependent carboxyltransferase family
                     protein"
                     /protein_id="QLY31042.1"
                     /translation="MIRVEQVGPLATIQDLGRPGWFTSGVGVSGAADRSSLRLANRLV
                     GNSEDAAAIEVLLGGLELLAESHLTLAVTGASAPATVDGRPVGAASVLELEEGQRLRL
                     GYAMSGLRAYVAVRGGIDIAPVLGSRSRDTLSGIGPPPLCSGDVLPIGPPPRAYSPID
                     VAPVAPPLDGLLTARVVLGPRDDWFTDAAMLFDGDWTVSQDTDRIGARLDRRNGPPLR
                     RSIQGELPTEGMALGSIQVPPSGQPVVFLADHPITGGYPVIGVVVDADVDAVAQARPG
                     QTVRFLRYRADS"
     gene            complement(255990..256721)
                     /locus_tag="H0264_01165"
     CDS             complement(255990..256721)
                     /locus_tag="H0264_01165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019925867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase subunit 1"
                     /protein_id="QLY31043.1"
                     /translation="MRESDRRDVTGEIRAAGDRALLVIPPARALLADLVAALRDRLTG
                     VVDVLPAAETIMITLSSPKEADSVRRQLNTLLARLAAEARVAVGSREYPGWRPAEADR
                     PGNAVATNGFHADPVLIPVRYDGEDLESAAALLGLSPAELIAQHTGTEWRCAFVGFAP
                     GFGYLESPDGRLTVPRRAQSRTAIPAGAVALAGGYTAVYPRRSPGGWQLIGTTDLPVW
                     DVDRDPPALITAGTRVRFSAVEAQA"
     gene            complement(256771..257526)
                     /locus_tag="H0264_01170"
     CDS             complement(256771..257526)
                     /locus_tag="H0264_01170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LamB/YcsF family protein"
                     /protein_id="QLY31044.1"
                     /translation="MGVDLNSDLGEGFGAYAMGDDAAMLDVVTSANIACGFHAGDPSI
                     MRRACALAVEKGVRIGAHVGYRDLAGFGRRALTVAPAELRDETLYQIGSLAAFARAAG
                     DRVRYVKPHGALYHAAAADRALADAVVSAMREFDPELALLGPAGTEMENAALAAGTPF
                     FGEGFADRAYTPEGLLAARGTPGAVLGADAAVAQALSIARSGKAQSTDGGTVAVRADS
                     ICVHGDSPAAVEMARRIRAVLDESDSPVRAFGG"
     gene            257606..258514
                     /locus_tag="H0264_01175"
     CDS             257606..258514
                     /locus_tag="H0264_01175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007268963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="QLY31045.1"
                     /translation="MNDTDKKVLLAGASGVLGGHITNSLRQHGYQVVALGRGAGADIR
                     ADLMDRDQLLRAVDGLRIDTVVHAATALRKAPMRHRDMYATDDLRIAGTANLVEAAKA
                     VGARRMIAESMVFGYGYEDFGDRVLTEADSFGQGGGKGVARHLEGMRVKEELMLKTPG
                     IEGISLRFGIFYGPGGTEAIVDMLRKRQLPGVNDHGRVLPWVNLADAGAAVALAVEGG
                     RPGAAYNIADDTPVGFGGHIRLVADTFHTPKPITLPSWLLTPMSYVHTITGVNMRVST
                     AKAKSELGWKPQYPACADGLRALAAA"
     gene            258610..259437
                     /locus_tag="H0264_01180"
     CDS             258610..259437
                     /locus_tag="H0264_01180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31046.1"
                     /translation="MATYFDPKSWMPLRAVDIGMDLGKRLFDQTWVDQWTTFTTAWLD
                     PVADFGVGTVTALMPDVLMTLLSEGILSQFGGQEVNATLLGHDLRATLHTLKVRRRGA
                     HFQTKTVLTQLHWNRHPIEELTVIAHGVRIIPGVPTKIRAAQLDFSGVISIAALLDWV
                     NTWQPDWELSLGPDGFVLAEHRRRRIRALATAEITDNVLTVNVHRAHWRRVRAPRSMT
                     RLDPIPLTDLPNQLRILRAERNGDYIEFAADVPGITGSFDLAQIRSAIVAGTTLIVF"
     gene            complement(259578..260993)
                     /locus_tag="H0264_01185"
     CDS             complement(259578..260993)
                     /locus_tag="H0264_01185"
                     /EC_number="2.7.7.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CCA tRNA nucleotidyltransferase"
                     /protein_id="QLY34039.1"
                     /translation="MLAAAAVTIGRLSDVLTPLGELFAANGHELYLVGGTVRDAVLGR
                     LGTDLDFTTDARPEVVQELMRGWADKLWDTGGLAFGTVSASKSGQQLEITTFRSDSYD
                     RVSRNPEVTFGDTLEGDLVRRDFTVNAMAVRIGALGELEFVDPLNGMDALLEGVLDTP
                     AAPEDSFHDDPLRMLRGARFVSQLGFTLAPRVRAAILAMAGEIDRITAERVHVELDKL
                     IGGEYPTDGIDVMVETGLAERVMPEIPAMQLEIDEHHQHKDVYQHSLTVLRQAIDQED
                     GDPDLVLRWAALLHDIGKPPTKKNEPGGGVSFHHHEVVGAKMVRKRMRALKYPKQFTE
                     DVAKLVYLHLRFHGYGKGQWTDSAVRRYVTDAGDLLPRLHKLVRADCTTRNKRRAALL
                     RSTYDDLEVRIARIAEQEDLARVRPDLDGNAIMELLGLQPGPDVGKAWKYLKELRLDR
                     GPMPREEAEAALIEWWNSQPK"
     gene            261250..261834
                     /locus_tag="H0264_01190"
     CDS             261250..261834
                     /locus_tag="H0264_01190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="QLY31047.1"
                     /translation="MSPADRANSRRRQPRRRGSAGSAAKPSGAASGAAKSGAPAKPRM
                     RTVRETSAGGLVVDGLDGPREKRCAALIGRTDRRGRLLWSLPKGHIEEGETAEQTAIR
                     EVAEETGINGTVVAELGSIDYWFVTDGRRVHKTVHHYLMRSLGGELSDADVEVTKVAW
                     VPLSELDSRLAYADERRLAEVANRLIDRMENGRQ"
     gene            261903..264374
                     /locus_tag="H0264_01195"
     CDS             261903..264374
                     /locus_tag="H0264_01195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014353745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34040.1"
                     /translation="MHRWLLSLVAVLSIVLTATPFAAAAPTGNGSPGSQFLKLSLDSV
                     TPNAVTTTSDPYFVVSGTITNIGDRVVDDVAVRIQRAAAVTEASGLRSILQLDQINYD
                     INGEFQDIAERLQPGQRKQFSLTVALHAGTELPSGVSSVEIDSPGVYPLLLNVNGQPA
                     YGTQARLDDARFLLPVLGVPAAKQPAAPPVPAAPDAAPVATTMLWPLADRPRLVAGRP
                     GSPDGEALLTDDELAASLTTGGRLDQLLSALETALDPTRTRDRNLTTSLCLAIDPDLL
                     ITVSDMIHGYKVLASPSDPDGSTRPGTGSDAAQSWLDRLRAIAPGMCVVALPFAQVDP
                     VALAAVGDTTLADRALNAPADLVDSLLSVKSVRGVSLPDAGTIDTEAGALLAQHGFTT
                     AVLADNAVTAATGATSNITGGRQTGSPAGTADSPEMVRLEGITGPGVAVGDTPAPPAG
                     PELRAATFDIWSATALAAVGSHPPTPPFTPEAVRYDVTNDSRAARLQDALGALSWSAL
                     NPQPGQPRSALFMPPQNWGANRDEATALLAQLDLLFRTNLATPRSFADLLAQPTDPQP
                     YELDYLSEAAEDGVPAHFAEPVRQQAHRITELMNALVEIPQQELSPRAFLTPLRDDLI
                     RTLTLSDRRGGNASADTVAQRRLDQTTRTLDKLFGSVTVLPPGGVYTLASEQSPLLLV
                     ARNDLPVAIRIRFTIDAPAETNITDIGEQVLPAKGTRSFQIPTEVSDSRNLVIPIALS
                     TPDGVPLGNAVSVQVRSNAYGRVLAIITACAGALLLLLAGRRLWHRFRGQSDPADEGF
                     DPGTRRRVNRYRRARKREMRRQETR"
     gene            264286..268977
                     /gene="murJ"
                     /locus_tag="H0264_01200"
     CDS             264286..268977
                     /gene="murJ"
                     /locus_tag="H0264_01200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein biosynthesis integral membrane protein
                     MurJ"
                     /protein_id="QLY31048.1"
                     /translation="MRGSIRGHDAGSTGTGARGNGRCDDRRRGDQGARQAHRADGGPP
                     LRDAGGAVSEYSGPRSGRPDGPGRPENAGRPEDAARAGHPGADRPQGPGRPGIPGRRI
                     EGPGSPRPDIPARRADAPGRPEGAESPNPRRAPSAPWERGVQRPARAGQGDVRGPQPG
                     SQGPGPRGGGVPPGRPVNPGNPQGVPGRPPSSQPSGPSSMPPQRPQPSESGPMMRRPG
                     PPKTGQPQGPSGRPAQASSGRPAAEPPSQERYHWGHPEGANRPAGQPGRPTPPGGQRY
                     PTPPFSGPRPAAAPARPVQALPRKLPSTAEHPVATAKPENANAKLVRDSGSIAIATLM
                     SRITGFGKQLMLLTVLGPAIASAFTVASTLPAMISELLLGAVLTAIVIPTLVRAEKED
                     GDGGAAFVRRLCTAAFTVLGIGTLLALILTPVLTSLIVSDDGEVSAPLTTALTYLLVP
                     AILLYGMSALLMAILNTHQIFKPGAWAPVLNNLVVLVVLFLYWLLPGEISLNPVEMGQ
                     PKLLLLGVGVTFGVIVQVVSLLPAIRRAGVDLRPLWGLDPRLKQFAGMGIAIILYVLI
                     SQVGWMVATRVLSNVDEAGPAIYQFTWLLLQLPYGVIGVTLLTAIMPRLSRNAAADDT
                     PAVVDDLGTATRLTMIALVPIVTFLTLAGPQIGSALLSYGRFGAEDAHRLGEAVSWSA
                     FTLIPYALVLIHLRVFYAREQAWTPTWIILGITGVKIVLSVATPFFFAADTVVVALGA
                     ANGLGFVAGALIGGWLLHRSLGDLRMTNVGRTITRVGGASLAGGAVMLIVDKVIGLHR
                     LTDSFGGVGSFVRVVILAVVMFGIAFALMRLAGIPEIVAITVAISRRLGITPPAPDLG
                     LEGVPGEEQHETTVLARPDMRAAPYYYRFDPYMDAQTMVLPAIRPDAVDITGTGEFPY
                     PVRHRSASAESGMPGPAGARARTTSDAGEPLPAHRSSTHQGEGGTRVSDDAAGGVPSA
                     DSSASAGGGLSTDVPPTPDEKSGKAGGTAESVPPSAPGDDGPDADELTGEETSGPETG
                     VYEAVSPLMPPMGMGSTTKRVQRGPKLMPGASVAGGRYRLLAGHGGARGLRFWQALDV
                     KLDREVALTFVDADQKDADNSGHDGPQAILSRTLRLGRINSPGLARVLDVVRGSSGGI
                     VVAEWTPGRSLKEMAETVPSPIGAARAIRALAAAAEMAHRAGGSLSIDHPDRVRISAT
                     GDAVLAFPGTLSDSDAQSDVRGLGAMLYALITDHWPIRAGGMTGSAATVGGLPLADFG
                     PDGTPIEPRQIRPEVPFEISAVAVRSLESNKGVRTAATVQHVLEQASVVDQKTDFIPV
                     LRLGQRPPSAPDESLADPELLAAEKERSQRMMWILVGLGVLAALVVGVIIWWLLSVFA
                     PGTSEAPLNEQRNIGLTTSAAAPATPGTPQSAPATTAAGGVPLPVTGATVFSPEGTPD
                     NVGQIGAVLDNNPSTVWRTDQYFQQFPALKKGLGVLSTLGSPSKVTKVIIDSPSAGTQ
                     VEIRTSPTASPTLDQTQLVGTATLADGITEIPVRADQPARYVLVWITGLGNNGGQFQS
                     VIADLRFEAAP"
     gene            269038..269745
                     /gene="sigM"
                     /locus_tag="H0264_01205"
     CDS             269038..269745
                     /gene="sigM"
                     /locus_tag="H0264_01205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005263510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor SigM"
                     /protein_id="QLY31049.1"
                     /translation="MHFLCHTLLPNPGSRYDLANSRRSRGCNLSANEHGGAAAQFAPP
                     RGAVGRTLSPVPEPSDRDLLAAHARGERHAFAELLQRHRDHLWQTALRASYGPEDAAD
                     SLQDALLSAHRSAGTFRGDSEVRSWLHRIVVNACLDRIRRNKLRQAVPLSDESVAEPI
                     YARDEFAQLETALIVDAALFTLPAEQRTALVAVEMEGYSVADAAALLGVPEGTVKSRC
                     ARGRRKLLEYMSRPHTA"
     gene            269870..270973
                     /locus_tag="H0264_01210"
     CDS             269870..270973
                     /locus_tag="H0264_01210"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31050.1"
                     /translation="MAAGTIPGPPFSVELLADLHAGNMPPSQAAQLWPEVRRDADAMR
                     YLDSLDGINGRLRDLGGSEHIAHAMPDDVFARLEGFLDALVSSERDDATDRVGPAPTR
                     ALNGIDPTEVTRPARHSGPGVPPRPVAPRPDAVETTHRVAPIDPTEVTRPVSPADVER
                     TDRVDPQAHARRMATVHQLRNRDAHPGPAQTAPMPALTPSIFDTGRLDPRDLADHEPE
                     IDDNEPIPLRPAERMSTRMRWISAAAAAVAVLAGGVVAVDALRGGGTSPQGEPDTPIL
                     LDASLPSSVLRGAMGKHEVSGPLAQGDALTSCLKAADLNRTQLGARSVTYNGQEAVLV
                     LLPAATPPGITAVVLGVNCAPGNPQVLATVDIQ"
     gene            271109..272086
                     /gene="trxB"
                     /locus_tag="H0264_01215"
     CDS             271109..272086
                     /gene="trxB"
                     /locus_tag="H0264_01215"
                     /EC_number="1.8.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013417693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-disulfide reductase"
                     /protein_id="QLY31051.1"
                     /translation="MSTPRDLIIVGSGPAGYTAAVYAARAELQPLLFEGTQFGGALMT
                     TTEVENFPGFREGIMGPDLMEEMREQAKRFGADIRTEDVEELDLSGTIKKVTVGGEVF
                     EAYAVILAMGSAARYLNVPGEQNFLGRGVSACATCDGFFFKGQDIVVVGGGDSAMEEA
                     TFLTKFANSVTVVHRREEFRASRIMLERAKKNEKIRFVLNSEVVEVHGDSAVTSLTLR
                     DTRTGETSELAATGLFVAIGHDPRSELVRGQVELDDEGYVKVEGQSTYTSVPGVFAAG
                     DLVDHTYRQAITAAGTGCRAAIDAERWLAEQGDITTNTLEHAGQPVEVN"
     gene            272098..272442
                     /gene="trxA"
                     /locus_tag="H0264_01220"
     CDS             272098..272442
                     /gene="trxA"
                     /locus_tag="H0264_01220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006550900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="QLY31052.1"
                     /translation="MSDAKTSATKTVTDATFADDVLIASGDKPVLVDFWAAWCGPCKM
                     VAPVLEEIAATNGEKITIAKIDADANPETSKTYGILSLPTMVLFQGGKETKRIVGAKG
                     KAALLRELQEVL"
     gene            272586..273779
                     /locus_tag="H0264_01225"
     CDS             272586..273779
                     /locus_tag="H0264_01225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003942558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein"
                     /protein_id="QLY31053.1"
                     /translation="MHRLRHGDTGPAVAEVRSTLASLGFLHTHPNTEPGSNGEYWKDS
                     DATFDHDLDSAVRAFQQHRGLLVDGVVGPATYRALKEASYRLGARTLIYQLSAPLYGD
                     DVATLQRRLQDLGFYVHRVDGYFGPHTHDALTSFQREIGLSADGICGPDTLRSLDLLG
                     ARVTGGNPHRIAEEEVVHRAGPQLTGKRIVIDPGLGGPDKGAAVPTEFGDVYESEILW
                     DLASRLEGRMAATGMETFLSRPWGANPSDAERAETSNTFDADLMISLRCAANPSESAS
                     GVASFHFGNSHGSTSMIGQVLAGFIQREIVARTSLQDCRTHARTWDLLRLTKMPTVQV
                     DIGYLTNDYDSSVLTNPRMRDVIAEAILISVKRLYLLGQDDQPTGTYTFAELLAEELA
                     AADRI"
     gene            complement(273878..274612)
                     /locus_tag="H0264_01230"
     CDS             complement(273878..274612)
                     /locus_tag="H0264_01230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="QLY31054.1"
                     /translation="MSTSVTALTLGGLDKLPAHARRCVFWEIDPAVAADSREFSDPVF
                     EKEAWLSTVMLEWGSCGQVAFVEGQPAGCALYAPPNVVPRAGLFPTSPVSPDAVLLTT
                     LRAEFAPTAGDVAHQLIQAVVADLMRRGVRAIEAFGLRWDPPATAMADRGFSSMMLLE
                     RIAPTPQRHQGGASAALECSPENCMIDADFLEEVGFKVVAAHHRFPRLRLELDHEHLW
                     KEDVERALDQLLAAASMTVPGRVLTL"
     gene            complement(274817..275824)
                     /locus_tag="H0264_01235"
     CDS             complement(274817..275824)
                     /locus_tag="H0264_01235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011212200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB/RepB/Spo0J family partition protein"
                     /protein_id="QLY31055.1"
                     /translation="MSQAKKGGLGRGLAALIPTGPAATPGLGSAAANVVIGLDPIGPQ
                     PASAYLHRVPDPEDAIEGVDAGAVYREIPPDQIEPNPKQPRSVFEEEALAELVHSIKE
                     FGLMQPIVVRQVETAPPRYQLIMGERRWRASQEAGLAAIPAIVRETADESLLRDALLE
                     NIHRVQLNPLEEAAAYQQLLEEFGVTHEELASRIGRSRPVVTNMIRLLKLPIPVQRRV
                     AAGVLSAGHARAVLALEAGAEAQEALAARIVAEGMSVRATEEAVTLANRNPDAAAPPA
                     PKRKPIQMPGLQDVAERLSESFDTRVTVSLGKRKGKITVEFGSIDDLERIVSLMEQSK
                     L"
     gene            complement(275905..276741)
                     /locus_tag="H0264_01240"
     CDS             complement(275905..276741)
                     /locus_tag="H0264_01240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003219244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family protein"
                     /protein_id="QLY34041.1"
                     /translation="MPRPREQRIITIANQKGGVGKTTTTVNLAAALALQGMRVLVIDL
                     DPQGNASTALGIEHHSGIPSSYELLIGECSVRDAIQQSPHNERLMCIPATIDLAGAEI
                     ELVSMVAREGRLKAAIQEANLAGYDIDYVMIDCPPSLGLLTVNALVAAKEVLIPIQCE
                     YYALEGVGQLLRNIGLVQSHLNPELHVSTVVLTMYDGRTKLADQVAEEVRGHFGEAVL
                     RSVIPRSVKVSEAPGYGMTVLDYDPGSRGAMSYLDAGREMAARAAARPAASNAASDAQ
                     SE"
     gene            complement(277321..277743)
                     /locus_tag="H0264_01245"
     CDS             complement(277321..277743)
                     /locus_tag="H0264_01245"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31056.1"
                     /translation="MSITRRAGFGTALLGALATAALVAAPQANALVTGITGPSGTVYV
                     GSTYTIVADVTITSFLFDVTFTDNGTEIGKVKPSGSTASISWTPTTAGSHDIKATQEL
                     ISSKTVTVTVTEKPTNPGGGTGSSGSNPLAGLLSGSSK"
     gene            complement(277849..278556)
                     /gene="rsmG"
                     /locus_tag="H0264_01250"
     CDS             complement(277849..278556)
                     /gene="rsmG"
                     /locus_tag="H0264_01250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019050120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (guanine(527)-N(7))-methyltransferase
                     RsmG"
                     /protein_id="QLY31057.1"
                     /translation="MFHVEPGAEVTEPVVEPAAAAVVFGDRVDMARRYYDVLASAGVE
                     RGLIGPREVPRLWDRHILNCAVVGELLPQGASVVDVGSGAGLPGIPLAIARPDLRITL
                     VEPLLRRTIFLAEFVEAVGLDNVVIVRGRAEQPGVRKEAGGADVVTSRAVAPLAKLAG
                     WSLPLVRDHGKMIALKGISAAEELERDRAELTKAGAGHAEVLECGVGILETPTVVISA
                     ERLPRKERRAEARAKRR"
     gene            complement(278639..279190)
                     /locus_tag="H0264_01255"
     CDS             complement(278639..279190)
                     /locus_tag="H0264_01255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019932011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein jag"
                     /protein_id="QLY31058.1"
                     /translation="MTVETDGGDPTVTAATAAPETEAAEPATDSEEALIEEGEIAGDY
                     LEQLLDVLDFDGDIDLDVEGDRAVVSIDGGKDLTKLVGRRGEVLDALQELTRLAVQQA
                     TGVRSRLMLDVAGWRAKRRSELSALGTEAAKRVLETGEREALSPMTPFERKIVHDAVA
                     AVDGVVSESEGVEPSRRVVVLPA"
     gene            complement(279229..280296)
                     /gene="yidC"
                     /locus_tag="H0264_01260"
     CDS             complement(279229..280296)
                     /gene="yidC"
                     /locus_tag="H0264_01260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertase YidC"
                     /protein_id="QLY31059.1"
                     /translation="MLDFIYYPVSWILWFWHRVFGFALGKDSGFAWALAVVFLVFTLR
                     LVLYKPFVKQVRTTKQMQELQPQIKELQKKYKNDRQQMTLEMQKLQKEHGFNPLMGCL
                     PVLLQVPVFLGLFHVLRSFNRTGHGFGQLGMSPELNAQTPNYVFNADDVQSFLTARLF
                     GAPLSAYITEPQAVLDSFAHYGGIPSKVAIAAVSIPLMVIAGLATHFNARASVARQSP
                     EALANPQAAMMNKLALWVFPLGVLVGGPFLPIAILIYWVSNNIWTYAQQHLVFGRMAQ
                     EEEEKKAAALERRAANAPKPGAKPTVDTRKKPAQDADAETGSDTPQAATNGSKPAAGA
                     KPAGAKKRSGNRGRANQKKRR"
     gene            complement(280301..280639)
                     /gene="yidD"
                     /locus_tag="H0264_01265"
     CDS             complement(280301..280639)
                     /gene="yidD"
                     /locus_tag="H0264_01265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014989222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertion efficiency factor
                     YidD"
                     /protein_id="QLY31060.1"
                     /translation="MSALRAAARIPAKALIFLIELYRTYISPTRMPVCRFTPTCSEYA
                     VTALRTRGLFVGLGLTAVRLVKCAPWHPGGWDPVPERKAARAERDRDGAQAYEGSSSA
                     VTGDTNDGSA"
     gene            complement(280636..281010)
                     /gene="rnpA"
                     /locus_tag="H0264_01270"
     CDS             complement(280636..281010)
                     /gene="rnpA"
                     /locus_tag="H0264_01270"
                     /EC_number="3.1.26.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010838985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="QLY31061.1"
                     /translation="MLPEPFRLHRRTDFSRTVRQGRRIGRRDLVVHVLLHDDRTDTQT
                     PAIRTGGPRFGLIVSKAVGPAVVRHRVARRLRHICASLAGELPDGADIVIRALPGAAD
                     APSAELERQMRSGIRKLGATDS"
     gene            complement(281098..281241)
                     /gene="rpmH"
                     /locus_tag="H0264_01275"
     CDS             complement(281098..281241)
                     /gene="rpmH"
                     /locus_tag="H0264_01275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005263481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="QLY31062.1"
                     /translation="MAKGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVSARRGKGRAK
                     LTA"
     gene            281733..283568
                     /gene="dnaA"
                     /locus_tag="H0264_01280"
     CDS             281733..283568
                     /gene="dnaA"
                     /locus_tag="H0264_01280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="QLY31063.1"
                     /translation="MDDEQNVLTAVWPEVIAELASGSADGEIQPVSKAHKAWLGIIEP
                     ITFLQGFALLSVPGTMAQEVVERDLREPILRSLARRGLQVEGLGVRIRAAQNNSGDRA
                     PAAPRHARMTSRPERPRESDHAPMGYQPAPAPPPVERAQAHYQAPQEYAQPRYLPPSD
                     YPAEYGEREAYPPVEFGQPPMAEELPVPVPEPAAAPRRRESHRQPAMPPGQESLFSPE
                     PDPEPAPMPAPARRPVDDDEHGDEEPVVNVRNNWPTYFNKPPERETPAPSSSASLNAK
                     YTFETFVIGASNRFAHAAAVAIAEAPARAYNPLFVWGASGLGKTHLLHAAGHYAQRLF
                     PGMRVKYVSTEEFTNDFINSLRDDRKVAFKRRYRETDILLVDDIQFIEGKEGIQEEFF
                     HTFNTLHNANKQIVVSSDRPPKQLATLEERLRTRFEWGLITDVQPPELETRIAILRKK
                     ARMDRLDVPHDVLELIASRVERNIRELEGALIRVTAFASLNGQPLDLSLAEVVLRDLM
                     PDTATLEITAATIMAVTAEYFNTTLEELTGPGKARPLAQARQIAMYLCRELTDLSLPK
                     IGQAFGRDHTTVMYAEKKVRKEMTERRRVYDQVQELTARIKQRSR"
     gene            284324..285493
                     /gene="dnaN"
                     /locus_tag="H0264_01285"
     CDS             284324..285493
                     /gene="dnaN"
                     /locus_tag="H0264_01285"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005249107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="QLY31064.1"
                     /translation="MELASMKFRVAREDFAESVAWVARSLPSRPPVPVLGGVLLVADE
                     DGLTVSGFDYEVSAQMRVAAEVAGPGQVLVSGRLLADITKALSNKPVDVSVDGTRVLI
                     QCGSAKFSLPTMPVEDYPQLPELPPQTGELGVDVFSAAVGQVAVAAGRDDTLPMLTGI
                     RVEIEGPKVVLAATDRFRLAVRELEWQPGRADVETAVLVPARTLSESAKTLGASDQPV
                     QLAFGTGTDGLLGIVNGGRRTTTRLLDAEFPKFRQLLPKEHTSIATLTVSALTDAIKR
                     VALVAERGAQVRMEFSDQGLLLSAGGDDAGRAEEWLEAEFRGEPLTIAFNPGYLVDGL
                     NALHSDRAIFGFTTPSRPAVLLPAPEEEPAQLDSGAFSALSGNYIYLLMPVRLPG"
     gene            285645..286874
                     /gene="recF"
                     /locus_tag="H0264_01290"
     CDS             285645..286874
                     /gene="recF"
                     /locus_tag="H0264_01290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication/repair protein RecF"
                     /protein_id="QLY31065.1"
                     /translation="MYVRALSLLDFRSWERAELELPPGRTTFLGSNGNGKTNLVEAIG
                     YLSTLGSHRVSADAPLIRIGAQRARIGATVVNTGRELRIDMELNQGAANKAQINRSPV
                     RRPREILGILHTVLFAPEDLSLVRGDPSERRRFLDELATARLPRLAGVRADYDKVLRQ
                     RSALLKTAGRNARSGARGAEMSTLDVWDGHLAAHGAVLLAQRLRLVHELYPHLAQAYG
                     SIAPESRPASIAYRSGYLPTEFQDPARSPQADDEAVLESILLRELGNARQKELERGVC
                     LVGPHRDDLELMLGSAPAKGFASHGESWSFALALRLGAFELLRTAGTDPVLILDDVFA
                     ELDRRRRTALAAVAATAEQVLITAAVPEDVPPELEANPLRVETTGEADRRTSHVSVGC
                     GRITAGNGAAEEGAVDG"
     gene            286867..287442
                     /locus_tag="H0264_01295"
     CDS             286867..287442
                     /locus_tag="H0264_01295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF721 family protein"
                     /protein_id="QLY31066.1"
                     /translation="MADQPEKQDPTPGASGPEGELRGVDLARRALEEARAAARARGQN
                     VGQGRASPRKGGVRALRRRRTGWSGAGPDDRDPQTLSSLAMALAKGRGWSGKVAEGTV
                     FGRWAQVVGEDIASHANPVTLENGVLSIQAESTAWATQLRLMQSQILAKINAAVGHGT
                     VTSLRINGPTAPSWRHGDRHIKGRGPRDTYG"
     gene            287865..289904
                     /gene="gyrB"
                     /locus_tag="H0264_01300"
     CDS             287865..289904
                     /gene="gyrB"
                     /locus_tag="H0264_01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010595447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase (ATP-hydrolyzing) subunit B"
                     /protein_id="QLY31067.1"
                     /translation="MDSNADGSTQPKSGNGYGADSITVLEGLEAVRKRPGMYIGSTGE
                     RGLHHLIWEVVDNSVDEAMAGYASRVDVKLLADGGVEVIDDGRGIPVAMHAQGVPTIE
                     VVMTQLHAGGKFDSDAYAVSGGLHGVGISVVNALSTRLEAEVDTDGFHWTQEYKDSRP
                     GKLVQGAATKRTGTTIRFWPDAEIFETTTFNFETVARRLQEMAFLNKGLTITLTDERV
                     SEGDVTDEVVSETAEAPKHAEEGVAAPAEPKVKTRTYHYPGGLEDYVKHINRTKTPIH
                     NSIVSFTGKGTGHELEVAMQWNSGYSESVHTFANTINTHEGGTHEEGFRAALTTVVNK
                     YAKDKKLLKEKDGNLTGDDIREGLAAIVSVKIADPQFEGQTKTKLGNTEVKSFVQRTC
                     NEHLTHWFEANPADAKTIVTKAVSSAQARVAARKARELVRRKSATDIGGLPGKLADCR
                     SKDPSKSEIYIVEGDSAGGSAKSGRDSMYQAILPLRGKIINVEKSRIDKVLKNNEVQS
                     IITAFGTGIHDEFDIAKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGHVY
                     LAQPPLYKLKWQRSEPEFAYSDRERDGLLERGLAAGKKINKDDGVQRYKGLGEMNPKE
                     LWETTMDPAVRVLRLVTLDDAAAADELFSVLMGEDVEARRSFITRNAKDVRFLDV"
     gene            289991..292507
                     /gene="gyrA"
                     /locus_tag="H0264_01305"
     CDS             289991..292507
                     /gene="gyrA"
                     /locus_tag="H0264_01305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="QLY31068.1"
                     /translation="MTETELPPSGGDRIEPVDIQQEMQNSYIDYAMSVIVGRALPEVR
                     DGLKPVHRRIMYAMYDNGYRPDRGYVKSARPVADTMGNYHPHGDTAIYDTLVRMAQPW
                     SLRYPLVDGQGNFGSRGNDGAAAMRYTECRLTPLAMELLREIDHETVDFIPNYDGKTQ
                     EPVVLPARVPVLLMNGSNGIAVGMATNIPPHNLTELAEAIYWALDNHEADEESTLAAC
                     MERVKGPDFPTAGLIVGTQGIHDAYTTGRGSIKMRGVVEIEEDNRGRTTIVITELPYQ
                     VNTDNFINSIAEQVKDAKIAGVSDIHDESSDRVGMRIVVTVKRDAVAKVVLNNLYKHT
                     QLQTSFGANMLSIVDGVPRTLRLDQMIRLYVNHQLDVIIRRTKYLLRKAEERAHILRG
                     LVKALDQLDAVIALIRRSADTETARTGLMQLLDIDEIQATAILDMQLRRLSALERQKI
                     LDELAKIEAEIADLKDILLKPERQRAIVRDELAEIVDKHGDDRRTKIIASDGDVQDED
                     LIAREDVVVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVRHFFITSTHDWL
                     LFFTNLGRVYRAKAYELPEANRTARGQHVANLLAFQPDEKIAQVIQIKSYEDSPYLVL
                     ATRNGLVKKSKLTDFDSNRSGGIVAVNLRDGDELVGAALCSAEDDLLLVSAHGQSIRF
                     SANDEVLRPMGRATSGVQGMRFNTDDELLSLNVVHEGDESNYLLVATAGGYSKRTAID
                     EYTAQGRGGKGVLTIQYDEKRGSLVGALIVNDDDELYAITSGGGVIRTAANQVRKAGR
                     QTKGVRLMNLGGDDTLLAIARNADEPDQVAEDDTSGSAKQ"
     gene            292597..293490
                     /locus_tag="H0264_01310"
     CDS             292597..293490
                     /locus_tag="H0264_01310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010595454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3566 domain-containing protein"
                     /protein_id="QLY34042.1"
                     /translation="MTERIAPSPIPPRPIPRPGASNESGVPISPETPDNSGEFVENAH
                     DSAAAAEPSDQQSAGSPFQEGWSQLPQREPQSNLYRPGQSPTTGRPAGGVGLNAGVSN
                     ARTTADLAAKAARKEAAMVKSVGIDGPTRSIARPELVKDLPDLSELRHPLPPPEPIAP
                     TGPVSPSAPAAVAQAAATGEPLRATVQLRHIDPWSTLKVSLVISVAMFFVWMLAVGLL
                     YLVLEGMGVWERLNSTFTEMVSDSSSSALVDAGTVFGYAGVIGLINVVLLTALSTVGV
                     FVYNQCCDLVGGIQVTLADPD"
     gene            293698..293771
                     /locus_tag="H0264_01315"
     tRNA            293698..293771
                     /locus_tag="H0264_01315"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:293732..293734,aa:Ile,seq:gat)
     gene            293939..294011
                     /locus_tag="H0264_01320"
     tRNA            293939..294011
                     /locus_tag="H0264_01320"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:293972..293974,aa:Ala,seq:tgc)
     gene            294105..295133
                     /locus_tag="H0264_01325"
     CDS             294105..295133
                     /locus_tag="H0264_01325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005101953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate/guanylate cyclase domain-containing
                     protein"
                     /protein_id="QLY34043.1"
                     /translation="MMASPEISKLVQSVVEPYLLNGERKYNRREVAAKSGAPTSLTRR
                     LWIALGFPAHPDDDAIEYSDADIAAAKSFGRLKVLAGADIHRQTTAARTLGRSMARLA
                     EWQVDLITEEILYRTEARMKADPAANQEDVARVVTEEVMNEIEALMTYAFRRHLDAAL
                     ARSLDEGSVAGDTMRVMAVGFADMVGYTRLTRHLEPDELSSLLEAFEAATSNAIIANG
                     GWVIKNVGDEVMFAANTAEEGARIALAVQEAATASHGVTQELRVGLAYGEVLQRFGDL
                     YGSVVNVAARLTGVARPGTVLVDDGAAAAIAGNPQFELTHLRGVRVRGINRLRGHVLR
                     RNVIRPLV"
     gene            295632..296627
                     /locus_tag="H0264_01330"
     CDS             295632..296627
                     /locus_tag="H0264_01330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="QLY31069.1"
                     /translation="MPDAIVAEGLVKRYGKLTALDGLDLSVPEGTVTALLGPNGAGKT
                     TTVRVLTTLLIPDSGSATVAGVDVLKDPQLLRSRIGASGQYAAVDEYLTGFENLEMVG
                     RLYHMGVQRSKERARELLERFRLTDAADRPVKGYSGGMRRRLDLAGALVANPPVLFLD
                     EPTTGLDPRARLDLWDVIEELVAGGTTLLLTTQYMEEADRLADSIAVIDHGNVIAEGT
                     ADELKALVGGDRIELVVEHADQLAIAQQALEGLAQGEIRLEPSLRRIVVPVNDGSQAL
                     VDAIGQLTKHEVRLHDVGLRRPSLDDVFLSLTGHEAEELVNGAKEAQETVGGGAR"
     gene            296624..297472
                     /locus_tag="H0264_01335"
     CDS             296624..297472
                     /locus_tag="H0264_01335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY31070.1"
                     /translation="MSATLAVAEKPSSAERLTMLINDSITITKRNVIKIKRVPDVLIF
                     STLSPIMFVLLFAFVFGNAIKVPGLEGGYREFLIAGIFAQTVVFGGTFTGLSLAEDMQ
                     KGIIDRFRSLPMAPAAVLIGRTAADVVINVVSLVVMSLTGLVVGWRIRGSFFDAVLAY
                     ILLLLFAYAVSWIMAVIGLIVRAPEVFNNAVFMVIFPLTFLANTFVPLNDLPGALKVF
                     AEWNPVSALTEATRVLFGNTSDAFPPPDTWSMRHPVATTFIWIAVILAIFVPLAVRQY
                     KRSVSR"
     gene            complement(297663..299501)
                     /gene="glmS"
                     /locus_tag="H0264_01340"
     CDS             complement(297663..299501)
                     /gene="glmS"
                     /locus_tag="H0264_01340"
                     /EC_number="2.6.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017982304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--fructose-6-phosphate transaminase
                     (isomerizing)"
                     /protein_id="QLY31071.1"
                     /translation="MCGIVGYIGHREAVPVLLEGLHRLEYRGYDSAGLAVPHRGKLRI
                     TKTQGRVQDLRTKVDGDAARLRGTVGIAHTRWATHGEPSDANAHPHTDGSGRIAVVHN
                     GIVENAEELRAALTAEGVTFLSETDTEAIAHLIAAALDDSETLEDAVRTALHRVEGTY
                     GLLVLDSRRPDELVVARNGSPIVLGVGDGEMFVASDVSALVHHTQRVVFLDDGELATV
                     RAREFRTSTLGLEARRTDKIPTTIDMAAEDYALGGYPDFMRKEMSEQPDAVRRALRGR
                     LDERFATAILGGLNMDARELRGISKVVFLGCGSAYYAGQLGAQLVEELARIPATAEPA
                     SEFRYRNPVVDPDALYVAISQSGETLDTLAAVQELQRKGGRVIGAVNVVGSAIARECG
                     AGVFLHAGPEVSVASTKALTNMTVSFAMLALLLGRVRDLSTAAGERVVSGLRALPEAI
                     ESVLAAEAAIADIAARYAKARSMFFIGRVRAWPVAREGAQKLKEISYIHAEAYQGSEL
                     KHGPLALIDSEMPSVVLVPNDELLAKNITTIEQIKARGGPVIAVTNTDLPEGLADAVI
                     RVPAVGPELDPIILTIPLQLLAYYTATALGRDIDKPRNLAKSVTVE"
     gene            complement(299517..299786)
                     /locus_tag="H0264_01345"
     CDS             complement(299517..299786)
                     /locus_tag="H0264_01345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018680675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31072.1"
                     /translation="MNDGTPADLVRHVASSTGLPPAVAARVVADVVGYFDETAEEFIR
                     RRHAELQRRQVRNAEIWQRLAEELAQRPVAAPAFTERQLRRIVYG"
     gene            299991..300518
                     /locus_tag="H0264_01350"
     CDS             299991..300518
                     /locus_tag="H0264_01350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012690696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="QLY31073.1"
                     /translation="MTSPNQTAVATVHTNLGDIKISLFGNHAPRTVRNFIGLADGSAD
                     YTTKNAKGADSGPFYDGSTFHRVMEGFMIQGGCPLGTGRGGPGYEFKDEFHPELRFDR
                     AYLLAMANSGPNSNGSQFFITLGPQPHLNRKHTIFGEVLDPDSRKVVETIGGTPTDRN
                     DRPKDEVVITGITIS"
     gene            300546..301451
                     /locus_tag="H0264_01355"
     CDS             300546..301451
                     /locus_tag="H0264_01355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005187412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family intramembrane serine protease"
                     /protein_id="QLY31074.1"
                     /translation="MNPHQQPAPTCFRHPDRVTGLGCTRCGRPACPECLTPAAVGQQC
                     VECVRQGRNETRQVRNVGGAVASNHPQPYVTYGLIALNLIVFAITAVQARTAMDMNSR
                     NSELFYDWVLVPVAVGEGEWWRVLGSGFLHYGLIHVAVNMFALYVLGPYAEIALGRGR
                     FVAVYFASLLGGSAAITALSEPLSASAGASGAIFGLFGAVAVIMLRTKQNMTQILVLL
                     VINLIITFSVPNISIWAHLGGLLAGTVATAGILYLPRWLHAGTPKAAALIGWGAVAAV
                     VVIALAVTVFGAPSLPTVVNTLFNV"
     gene            complement(301479..301913)
                     /locus_tag="H0264_01360"
     CDS             complement(301479..301913)
                     /locus_tag="H0264_01360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011596276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PH domain-containing protein"
                     /protein_id="QLY31075.1"
                     /translation="MTTDSVSRLSWSTPPAALVTCAIGGLVLAGAAVLSNEAPARLLI
                     GLAAAGLLAMAGLGLRQRPRLSIEPGDPAQLVVRGLTGPQRYSSRQITRARVVNYRRL
                     GRRMPMLEIDVDNGGEEKLLIFGRWDLGASPDDVLDTLRAHL"
     gene            complement(302064..302330)
                     /gene="crgA"
                     /locus_tag="H0264_01365"
     CDS             complement(302064..302330)
                     /gene="crgA"
                     /locus_tag="H0264_01365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007301412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein CrgA"
                     /protein_id="QLY31076.1"
                     /translation="MPKSKVRKKTDYSINPASRTPVKVKSAGPSPVWYVTIMLGFMLA
                     GLVWLLVYYLAGDQISWMNDLNAWNFLIGFGLMVVGLIMTMRWR"
     gene            302462..303100
                     /locus_tag="H0264_01370"
     CDS             302462..303100
                     /locus_tag="H0264_01370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate/anthranilate synthase
                     component II"
                     /protein_id="QLY31077.1"
                     /translation="MRVLVVDNYDSFVFNLVQYLGQLGVDATVWRNDDERLSDVDKVV
                     QEYDGVLISPGPGTPERAGASIDLVHACARHETPLLGVCLGHQAIGSAFGATVTRAPE
                     LLHGKTSEVFHIGAGVLAGLPDPFIATRYHSLTVLEETMPPELEVLGRTESGLVMAMR
                     HRTLPIHGVQFHPESVLTQGGHRMLANWLGVCGERPAEGLVAQLEAEVAALV"
     gene            303097..303792
                     /locus_tag="H0264_01375"
     CDS             303097..303792
                     /locus_tag="H0264_01375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018845169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase family protein"
                     /protein_id="QLY31078.1"
                     /translation="MSGPTRPHVLLSVAVSIDGYIDDAGPDRLLLSNAADFDRVDALR
                     AESDAVLIGAETLRRDNPRLLVNSEERRLHRIAAGKPDYPVRVIVTASGELDPRLKFW
                     RFGGERLVYTTDSGRDRIAGSLDGLAEVVSLGDAVDFEALLDDMGKRGMERLMVEGGG
                     SIHTAFLAAGLVDEIRMAVAPLVVGDPAAPRFLGPADFPGGPQHRMQLAEVSRIGDIA
                     LLRYLPKEDSDVG"
     gene            303782..304243
                     /locus_tag="H0264_01380"
     CDS             303782..304243
                     /locus_tag="H0264_01380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011209843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dCMP deaminase"
                     /protein_id="QLY31079.1"
                     /translation="MSDEARSDRGWMRHAIGLARLCPPSETAFSVGAVIVGEDGVEII
                     HGWSRETDDKVHAEESALNKLEPGDPRLPHATIYSTLEPCSTRASQDRTPCTDRILAS
                     GIRRVVIAWREPGTFVENCVGVERLRQHGIEVVELPDLAEEAMSMNRHLKL"
     gene            complement(304314..306227)
                     /gene="pknB"
                     /locus_tag="H0264_01385"
     CDS             complement(304314..306227)
                     /gene="pknB"
                     /locus_tag="H0264_01385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012690701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Stk1 family PASTA domain-containing Ser/Thr
                     kinase"
                     /protein_id="QLY31080.1"
                     /translation="MTTPKNLSSRYELGEIIGFGGMSEVHKARDLRLGRDVAIKVLRA
                     DLARDPTFYLRFKREAQNAAALNHPAIVAVYDTGEAEVDGGPLPYIVMEYVDGDTLRD
                     IVRGKGPLPPRRAMEVIADVCAALDFSHRNGIVHRDMKPANIMINRAGAVKVMDFGIA
                     RAIADSSNPMTQTAAVIGTAQYLSPEQARGEQVDARSDVYSVGCVLYEILTGEPPFTG
                     DSPVAVAYQHVREDPRLPSHVYAGVPRELDSVVLKAMSKNPANRYQTAAEMRADLIRV
                     LGGQKPTAPMVMTDEDRTSFLDDELPPPRSYRTVERRDDTTEQEIVEPAGGGGGRRTA
                     LIAASAAAAVAVVAALLWVLIGPGARLTQVTVPDLTGQSKASAQQALEDAGFHVAIQD
                     TPDSKVAIGNVIRTQPLGGSRIDKGSTVTMLVSKGPEQVAVPKLIGLTQAEAEKNLIN
                     AGLQLDPQVQQDWSSAAEKGKVIKSDPREGSRIDSGSTVEITIGKGPEQVAVPYVVGQ
                     SIDVAEQTLTKSAGLQIVKQEVQSAQPKGTVLATNPEAGTMVDKGSSVTVQVSAGDEI
                     TMPDLRGKTPAEAVTLLRQRGWNGQISQNTVSTLNSGDIGRIISQQPTAGSSIAKDGT
                     VTITTGVIAIGPP"
     gene            complement(306224..307789)
                     /locus_tag="H0264_01390"
     CDS             complement(306224..307789)
                     /locus_tag="H0264_01390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="QLY31081.1"
                     /translation="MLNNGALIADRYRLQRLIATGGMGQVWEALDTRLDRRVAVKVLK
                     AEFSTDPTFRHRFRAEARTTAQLNHPGIAGIYDYGETMDPSGGEIAYLVMEFVQGEPL
                     NAVLNRMSRLSVAQGLDMLEQTARALQVAHSAGVVHRDVKPGNILVTPTGQVKITDFG
                     IAKAVDASPVTKTGMVMGTAQYIAPEQATGEDATAASDVYSLGVVGYEALAGQRPFTG
                     EGALTVAMKHVRDTPPPLPADLPPNVRELIEITMAKDPQQRYATGGEFADAVAAVRSG
                     RRPTPPGGIPVTPNIPTGATRVLPPGPTMIIPGQRADQPTTRYATPPQQPAAMTGATA
                     LLSGPQPPTTRPGAGAAMADDEPTGRFTNSQKALAGLGVGALILGAAAAFVLLSGSPP
                     EPTPPTRTSAVVAPPVTAPPTTTAPLTTTKERPVPPPVTTYEPPVTTYEPPVTTTQPP
                     VTTTKPPVTTTVPKTTTVPPTTTKDEEPSTVPPTTTKKPQPGVDLPSFPVIPGAGGGV
                     RANTSDLSEQGQP"
     gene            complement(307823..309298)
                     /locus_tag="H0264_01395"
     CDS             complement(307823..309298)
                     /locus_tag="H0264_01395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005263445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 2"
                     /protein_id="QLY31082.1"
                     /translation="MNTPLRRVSLAVMVMIVALLANATYVQWWKADDLRTDTRNRRVL
                     LDEYARQRGQISAQGVVLASSVATEDRYKYLRIYPTDPRAYAHVTGYYTMQNGRDGLE
                     NAEDSILSGSDNDLFGRRLVDMISGRDPRGGNVITTLNPAMQKVAYDQLTSKGYTGSV
                     VAIEPSTGRILTMVSTPSYDPNELTVHDGAQVTEKKTELQQDDGQPLINRAVSMIYPP
                     GSTFKVVVTAAALANGLATPSDQLTAASRITLPDTNTTLENYNGSHCGPGDGATASLT
                     EAFKYSCNTAFVDLGIKVGAAKLKDEAAAFGIGDHSGIPLEWGTSTVGDIPDKAALGQ
                     SSIGQRDVSITPLDNAVIAATIANGGVRMQPHLVDQLQAPDLTTLKNINAMSVGQAVS
                     AQVASQITAMMIESEKNTQGGTQPRSYTIASKTGTAEHGDDPRNTPPHAWYIAFAPAQ
                     NPKIAIAVIVENGGDRALAATGGSVAAPVARAVLDAGLQGG"
     gene            complement(309295..310764)
                     /locus_tag="H0264_01400"
     CDS             complement(309295..310764)
                     /locus_tag="H0264_01400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003943414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FtsW/RodA/SpoVE family cell cycle protein"
                     /protein_id="QLY31083.1"
                     /translation="MSAPAPPSAGAFPSPPGGFAPAPPPSTRRNVELMLLALAAVITT
                     VSLILVEASQEQSITWDIAKLGASYLALFGVAHLAVRRFAAFADPLLLPIVALLNGLG
                     LVLIHRLDLAEAQDATFASKAIPSPDANQQVLWTGLGMVVFMGLLIVLRDYRTLARYA
                     YTLGLAGLVALAIPALLPSRFSEVNGAKIWIRLPGFSVQPGEFAKILLIIFFAGVLVA
                     KRDLFMAAGKHVFGMDLPRARDLGPILVVWVVCLGVLVLEKDLGTSLLIFATVLVMLY
                     IATERVGWLVIGGALLAVGFVIAYNAFGHVRVRVNTWLHPFDDYSNTGYQISQSLFGL
                     ATGGLAGTGLGSGRPTEVPFAKTDFIITTIGEELGLIGLAAVLMLFCIFVIRGLRTAL
                     AVRDSFGKLLAAGLAFTIAIQIFVVVGGVTKLIPLTGLTTPFVSYGGSSLLANYALLA
                     LLIKVSDAARAPAPARKRAPEPIADAPTELVRRPKGGAA"
     gene            complement(310764..312269)
                     /locus_tag="H0264_01405"
     CDS             complement(310764..312269)
                     /locus_tag="H0264_01405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine-protein phosphatase"
                     /protein_id="QLY31084.1"
                     /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGE
                     VASQLMIAALAHLDDDEPGPDLLGKLDRAVREGNASIADQVEEEPELDGMGTTLTAIL
                     FAGSKLGLAHIGDSRAYMLRGGELTQITRDDTFVQSLVDEGRITPEQAHTHPQRSLIM
                     RALTGNEIEPTLVVREARAGDRYLLCSDGLSDVVSDETIANTLREGSTDESADRLIEL
                     ALRSGGPDNVTVVVADVIDLDYGQSHPIVAGAASGEDEDTPPPNTAAGRAAAMRPPRA
                     TPRRAVAMPEPEPPKKGHKWRWIALSAALLVAVGAGLTIGYNMVRSNYYVGAEGGKVV
                     ILRGLPGSVLGFTIRDVDQIACATRNGEIQLADPGSAFPPGCRELTLPDLKSTVQDSV
                     QKGLPGVSRDEAVKQMQNLSGDKGLLPPCEKPAAPPVTTPPPGDPNQPGASTTAAAPT
                     TTGAPATSTPPNTGEQTLEPRTPGSEQPTTTPPVTTTTAPKASEQNCRVAD"
     gene            complement(312266..312733)
                     /locus_tag="H0264_01410"
     CDS             complement(312266..312733)
                     /locus_tag="H0264_01410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005064443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="QLY31085.1"
                     /translation="MQGLILQLTRAGFLLLLWLFVWAVLRTLRSDIYAASGLRVAPRA
                     AGGSAVLPSFRRGQKGAKYLVVTQGSLAGTRISLGSQPVLIGRADDSTLVLTDDYAST
                     RHARLSQRGEDWYVEDLGSTNGTYLDRSKVTTPVRVPLGTPVRVGKTVIELRS"
     gene            complement(312924..314318)
                     /locus_tag="H0264_01415"
     CDS             complement(312924..314318)
                     /locus_tag="H0264_01415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009476775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3662 domain-containing protein"
                     /protein_id="QLY31086.1"
                     /translation="MGIVSRFERRLQGAVGDVFARVFGGSVVPQEVEAALQREAGDSL
                     QDLGGGHLLASNSYVITINESDLNQLIQGDGQADHDLMVRAFAKHLQDYIREQGWQTY
                     GEVHVEFEASPTLHTGQFRTRGRVDPDAGGPGSVRRAGPAPGPERPPRPNPQPGAGPM
                     TQNSGYDPSREPAESDPRNRGYAPPPAGRGQQGYGQQGGYADPGYGQDQAYGQSEQGY
                     GDYQNGYDYQQQGGGYGQQPAGYDQAYGQQGGYSDQAYGQQPGYDQGYAGQQGGGYGQ
                     QGGYADQGYADQGYGQQGYDQGYGGQQGGGYDQGYGQQQGGGYGQQGYAQPGYDQGYG
                     QQQGGYDQYGEQGGGYAEPGYADQGGGYQPARGGSSYSATLQLDDGSGRTYQLREGSN
                     IIGRGQDAHFRLPDTGVSRRHIEVRWDGQTAMLSDLGSTNGTLVNGSPVQDWQLADGD
                     VIRAGHSEILIRIV"
     gene            314542..314627
                     /locus_tag="H0264_01420"
     tRNA            314542..314627
                     /locus_tag="H0264_01420"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:314575..314577,aa:Leu,seq:cag)
     gene            complement(315274..316338)
                     /locus_tag="H0264_01425"
     CDS             complement(315274..316338)
                     /locus_tag="H0264_01425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein M"
                     /protein_id="QLY31087.1"
                     /translation="MDLDAYTFVHKRSWDRLDQLSKPGRRLSGVEADELVRLYRLTSQ
                     QLARLQARDADPELIAGLSVVLTRARGKVLGAQVDTVSEISRFFTHRFPAAVYRAWPW
                     WVSVAALFLLASAALATWVAESESARKKLGLDTDTDALTRPGGEFETYYYEHPHDAFA
                     AQVWTNNARVAAVALFTGILILPAVFAMVMNALNLGVSAGLMADADRLGAFFGYILPH
                     GMIELTAIFVAGGAGLKLGWTLIDPGRESRPQALARQGRATAVIAIGLALTLLVAGLL
                     EGFVTPSGWPTPVRVGLGGLVELGFLIYVFVRGRQVVLEEQALEALPGGEHMPGYPTG
                     RDPEPVAGGATSKVSATAGI"
     gene            316487..317287
                     /locus_tag="H0264_01430"
     CDS             316487..317287
                     /locus_tag="H0264_01430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RDD family protein"
                     /protein_id="QLY31088.1"
                     /translation="MALFTTGEAVAVELPIARIPTRAAGFLVDLLVQIICGLVLAFFM
                     ALVLDTTNADDAWAEAAFVVLMVSTFIGYPVLMETFTGGRSVGKMALGLRVVRADGGP
                     IDFRHAATRGLSGLVDFYSSGLGLVAVVTSLCSPNARRVGDVLAGTVVVYDRSRLPFP
                     SFAVPPPWLMNWSRQLDLSGLPDDLALAVRRYLIRLRTLTPSVQDQMGRELLAAVCTR
                     LAVAAPTGYPPYHILGAILAERQRRALPALTPQQPAQGVAAVFPRAVA"
     gene            complement(317307..318602)
                     /locus_tag="H0264_01435"
     CDS             complement(317307..318602)
                     /locus_tag="H0264_01435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005167677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF58 domain-containing protein"
                     /protein_id="QLY31089.1"
                     /translation="MVFTGRLAALAVLDTLFVALLMPSWTGVALMTGTTLAAVILDIV
                     LLGSLAALELSREPLTTVRTGRSIDVELTALNTGTRTVRATLWDDWPPSAHARHRTHT
                     LNLPANTKTRLHTELTPAYRGDRLAGPVTVRAVGPLGLAGRQERRDVPARLRALPPFR
                     SEKLLASKVKQLQHLEGRNTTTIRGQGTEFDSFHEYVPGDDVRTIDWRATARAKDVLV
                     RTWRPERNRHVVMLLDTGRVSAGRAGDGTRLDATIEAALLLGGLAASGGDSVDLIAHD
                     RKVRTEVRGIGGKRLQVKLMHALAGVTPELVDTDYQGMLRATLQRARRRSLVVWFTHL
                     DAATLQEGLLPVLPVLTERHRVLVVSVTDPEVTAAAARRTGLENLYRAAAAENVIAEH
                     AVARETLRRKGVRVIATSPDLLPGALADEYLELKQTGAL"
     gene            complement(318606..319613)
                     /locus_tag="H0264_01440"
     CDS             complement(318606..319613)
                     /locus_tag="H0264_01440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MoxR family ATPase"
                     /protein_id="QLY31090.1"
                     /translation="MDRIGGLVTTVDTNHDAPTAEQAQQALLALRGEIGKAVVGNDQA
                     VLYLVLGLLCRGHVLLEGVPGVAKTLLVRALATALDLEHARIQFTPDLMPGDVTGSNI
                     YDPHSAAFTFRRGPVFTNLLLADEINRTPPKTQSALLESMEERQVSVDGVPQALPDPF
                     IVIATQNPIEQEGTYPLPEAQLDRFLFKVDIQLPGRDDEFRILQRHAAGFDPRDLNAA
                     GLRPVAGPAHLTAARQAIAQVAISPEVLAYTVDLCRATRTSPAVAHGASTRGATALMA
                     ASRAFAWLNGRGYVTPDDVKAVAVAVLRHRLHLRPEHEVEGVTAEGVMTSLLMSVPVP
                     V"
     gene            complement(319589..320647)
                     /locus_tag="H0264_01445"
     CDS             complement(319589..320647)
                     /locus_tag="H0264_01445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4129 domain-containing protein"
                     /protein_id="QLY31091.1"
                     /translation="MTQPPVPPTPDLGPAADHRAASEYAAQRQDFATALRERYRAVTR
                     GLEQHGVLEEQRGRTARETAQAAATALGGQEQGAAAAELPSAAHSFDEIVYGGRHATE
                     GEYRRLEQADRFSVAPAPKRAPAEIAEKRRRTRTPKKAREKRTRERMEWPPFLSDWRF
                     WAGAGAILGAFLLIYILTHIGTPPDVTPPDTTDLPDAPDAPERPDLDEPDYGEGSDSI
                     FRKGSWAAFGGLQLLIAWGVVLVWRGRRRGAVVGEARPVEAPANELLAGQAGLYRKSR
                     DHDHVAAKLRAAALRRLRPALNVTADTSPDMVTMAVATRTGAAPALVHAALYEPVTDQ
                     ATLETVAAQLEWIESEVL"
     gene            complement(320644..321432)
                     /locus_tag="H0264_01450"
     CDS             complement(320644..321432)
                     /locus_tag="H0264_01450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34044.1"
                     /translation="MQFRELLDLPFALIQTRIKTFATVFGVGVVVASAVAVGITVLGS
                     IATGDDKDGTRWAAVLGSLACAWGLRLLVRGVTVPMGLAAIHRRPLSWRAAFGRMSAQ
                     AGALLGYSGMFTLIGVGVLALGAPLMITLPFAVLWLAWLRARRFTTMPVIFDEYAGYK
                     QAAGRSKVLMQGTEWQIVGLWLYLRGLILVLLVPVLALPMFITTFSGTRRWTVTVLLI
                     TVALFMVAFTEMVESAAQVVTYVDRRCRREAMDIRVPPATGAQR"
     gene            321600..321902
                     /locus_tag="H0264_01455"
     CDS             321600..321902
                     /locus_tag="H0264_01455"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31092.1"
                     /translation="MTTPPVPQLPMIDVYDLLNGAVDMRMYTRRILVLKVRSLVGGYI
                     GNQANIERQLFPPIIAVADAVEWLESQGQGWRLVSITERPIEGISYWFAFLRRDQP"
     gene            complement(321893..322459)
                     /locus_tag="H0264_01460"
     CDS             complement(321893..322459)
                     /locus_tag="H0264_01460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010836222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QLY31093.1"
                     /translation="MTTRDPAGTRDRILDALETLLLDKGLSQVTLENVAATAGVSKGG
                     LLYHFKSKDALLAGLVRRLGNRADQQLETAVDQGKSVAEWYLQTPHPDNAADAMELAL
                     YRSMLAAMRSVDGPQDTDADEVARALDEVLETWKTALDNEIPDPVQSEIVRLVGDGVY
                     LRALLGAPPIDPTLYRQVVARLLGNDQG"
     gene            322537..324123
                     /locus_tag="H0264_01465"
     CDS             322537..324123
                     /locus_tag="H0264_01465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QLY31094.1"
                     /translation="MTSHSITTTAIGPKARPRDWAGLGVLALALLLVSVDATVLDLAV
                     PSISAHLAPTTPQLLWIIDVYSFVLAGLLVTMGTLGDRIGRRRLLIVGAAGFGIASAI
                     AAWSVSPEMLIAARVLQGVAGATLMPATLGLIRSMFQNARERTLAISVWGAMAGSGAA
                     VGPLLGGWLLEHFWWGSVFLVNLPVMALLIVLAPFVVPESRDPNPGRFDLFSAALSML
                     ALIPIVYAVKEFAAHGPSMTLVIAAAIGVLAGVVFVRRQRTLAAPLIDLDLFRLPPFR
                     AAVLANLLSVFALAGVLFFGSQYLQLVLGKAPLAAGLLLIPGTIGSMAGALLAAWLVR
                     QWRPVSVLSGALVTAALGALMFWMLGSAPSAPVLPFIVGFLLIGLGVGVALTVSSDMI
                     VSTAPAERAGNAAAISETALETGVALGVATLGSAVMATYRHGLDPATIPSAHLDAARE
                     SLGGAVETARALPEPAATTLLDAAHTAFVSGVHLAATGTTAILLITAFVVYRAATRRK
                     PNGEAPVTEPHTATPTAADS"
     gene            complement(324186..324482)
                     /locus_tag="H0264_01470"
     CDS             complement(324186..324482)
                     /locus_tag="H0264_01470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31095.1"
                     /translation="MFDPISLVVGAGLVVIGWAAGRYSRRTPRVQPPSTVCGCGHDLS
                     LHDRKAGECHAESPRKTGWGLTVWARCGCKNYTGATPLEELFAPPVLPPLNEGK"
     gene            complement(324588..326498)
                     /locus_tag="H0264_01475"
     CDS             complement(324588..326498)
                     /locus_tag="H0264_01475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4407 domain-containing protein"
                     /protein_id="QLY31096.1"
                     /translation="MPTRGIADLLPWLGGAHPHLVDQHERGGYSVTGAVVALFAAISG
                     GVTALATGAADWPLLAVVATAVIATLLVGAVSRALATAATPARDESQRARAEFAGRIA
                     VAVAAGVLTAELACTVLFGGTIDRKLDETAQRGIESAPSVVTAQAELDQAKNNRTALD
                     QAITKAQNDVDQALIVARCEFSAAPECSPLRMTGVPGRGPEERTANQMLEDARTRLSA
                     EQAKIGGLDQAVTDKDKALTDIRAAAYTEGDRGLGARWVAMNGYTTDHAGAFVLRFAT
                     ALLMIVLALLPLLLRRWRGETSFDREVATRTAAGRIEHAAATAIAIKQAEVRVETEAL
                     RADQELTAARLAAHADTAIDRERQRRRIIASIGNFEIGVTEPAQRAVAEFDSAAQHEL
                     PAGASAGGKDSSVSQEGIVTQSPHLPAQLMPGVATPVSAGGALVPAPAGVPAAAPQPA
                     PDKKGGGLELPIIGTVPFTDTAARWIRPLVPSFVANVIDTATHPLRTVRQAFEEAEEI
                     TFTLRRTRKVTVDSEDSAQQQAQPQQQVYAGQPQLGYQLPQGVPQHVYSQRVASHVVD
                     QPYAQPGYAPQYYPPLPQGQQPYPPLPPGPVVDHGYGLPSAPAQDELTGRQNPQLENR
                     APRELPPGKTSE"
     gene            327359..332008
                     /gene="gltB"
                     /locus_tag="H0264_01480"
     CDS             327359..332008
                     /gene="gltB"
                     /locus_tag="H0264_01480"
                     /EC_number="1.4.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase large subunit"
                     /protein_id="QLY31097.1"
                     /translation="MTQLPGHRSPGPRGLYDPANEHDACGVAFVVDMHGRRSRDIVDK
                     AITALLNLEHRGAAGAEPNSGDGAGILIQLPDKFFRAVVDFELPAEGSYATGIAFLPQ
                     ARREAARAGYGVEKIVREEGLEVLGWREVPIDSSSLGALSRDAMPTFRQIFIASPKDG
                     AEQLSGMDLERRAYVIRKRIEHELGKSGAGEGAVGKESVYFPSLSGETFVYKGMFTTP
                     QLRAFYLDLQDDRVESALGIVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVSGNENWM
                     RAREALLNSNVFGTDSEGNNRLEKIFPVCTPGASDTARFDEVLELLHLGGRSLPHAVL
                     MMIPEAWERNESMTPEQRAFYRYHSFLMEPWDGPASVCFTDGTVVGAVLDRNGLRPGR
                     IWVTEDGLCVLASEVGVLDIDPAKVVYKKRLQPGHMFLVDTSQGRIISDEEVKQSLAE
                     QFPYQQWLDNGPTKLSDLPDRPHVHMSHDRVLIRQQIFGYTTEELNLLVSPMAQTGGE
                     ALGSMGTDTPIAVLSSRPRLLFDYFSQLFAQVTNPPLDAIREEVVTSLRSMVGPEADL
                     LNPGPESCGQITLTQPILDNDELSKLVHINDDGSRPDLRSVVVHGLYPVKKGGKGLRK
                     AIEAVQKQVSAAIDGGARIIILSDRESNEKLAPIPSLLLTAAVHHHLVRERTRTKVGL
                     VVEAGDAREVHHMALLVGFGAAAINPYMAFESIEDMLERGALKMPGSTGDLAADYKKA
                     VYNYNKAAGKGVLKVMSKMGISTIASYRGAQLFQVIGLAQDLVDEYFTGLRSPLDGIG
                     LDDIAGEVAQRHKVAFLENRNERAHRELEVGGEYQWRREGEYHLFNPDTVFKLQHATR
                     SGQYSIFKEYTKLVDDQSEQLASLRGLFKFKSKGRNPIPIEEVEPASEIVKRFSTGAM
                     SYGSISAEAHETLAIAMNRLGGRSNSGEGGENIARFEVEENGDWRRSAIKQVASGRFG
                     VTAHYLTNCTDIQIKMAQGAKPGEGGQLPAHKVYPWVAEVRHSTPGVGLISPPPHHDI
                     YSIEDLAQLIHDLKNANPQARIHVKLVAEPGVGTVAAGVSKAHADVVLISGHDGGTGA
                     SPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVMIAALLGAEEY
                     GFATAPLVVSGCIMMRVCHLDTCPVGVATQNPVLRERFTGKPEFVENFMLFIAEEVRE
                     LLASLGLRTLDEAIGRVDLLDTTAAKEHWKAAKLDLSPILDDVETAFMFQDRRQTKTQ
                     DHGLDKALDNELIAQAADALERGKPVKIETKVTNVNRTVGTMLGHEVTKLYGGVGLPD
                     DTIDITFTGSAGNSFGAFVPAGITLRVIGDANDYVGKGLSGGRITVRPSGDAPEGFVA
                     EQNIIAGNVILFGATSGQVFLRGVVGERFAVRNSGATAVVEGVGDHGCEYMTGGRVVI
                     LGETGRNFGAGMSGGIAYIYNPNGTFESNLNPELVDLEKLSDEDTAWLQSTIAQHRDE
                     TGSAVAERLLGDWANESAKFVKVMPRDYKKVLLAITEAEKNGRDVAEAIMEAARA"
     gene            332053..333522
                     /locus_tag="H0264_01485"
     CDS             332053..333522
                     /locus_tag="H0264_01485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit beta"
                     /protein_id="QLY31098.1"
                     /translation="MGDAQGFLKHTSRELPKRRPVPLRLMDWKEVYEENFSKDTLKTQ
                     ASRCMDCGIPFCHNGCPLGNLIPEWNDLVYKGAWKEGFDRLHATNNFPEFTGRLCPAP
                     CEASCVLGINQDPVTIKQVEVEIIENGFDEGWVTPVYPTRLTGKRIAVVGSGPAGLAA
                     AQQLTRAGHTVTVFERDDRIGGLLRYGIPEFKMEKRFIDRRLAQMEAEGTIFKTGVNV
                     GVDITAEQLREQFDAIVLAGGATIARDLPVPGRDLDGIHQAMEFLPLANRVQLGDQIT
                     DENGLPRINARGKKVVIIGGGDTGADCLGTSHRQGAESVHQFEIMPRPPEERAGSTPW
                     PTYPLMYRVSSAHEEGGERVFSVNTERFVGENGKVTGLQAHEVKMVNGRFEKVEGTDF
                     TLEADLVLLAMGFVGPQKNGLLEGLGVGYDQRGNVKRDNDWQTTVPGVFVAGDMGRGQ
                     SLIVWAIAEGRAAASAVDKFLEGETALPSPITPTMVAQR"
     gene            333928..334833
                     /locus_tag="H0264_01490"
     CDS             333928..334833
                     /locus_tag="H0264_01490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012690723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cutinase family protein"
                     /protein_id="QLY31099.1"
                     /translation="MRLKSVVAAAGAAASVLMSGIVLGGGAVTTAHADPSCPALYTVA
                     IPGTWETGHEKDPKPGMLAAVTDGLPGRVDYVTYAATAFPWEGDVYGASKKEAVDHAR
                     QFVSAMGAACPGTKIAITGYSQGADAAGELAAEIGTGLGVVPPDRISAVALISDPRRS
                     PSDVQVGPIAPGAGAGGARTGGFGFVSDRVRTICAIGDLYCSTEDSDFVTRFAGFLAQ
                     ASDPNPVNLWRYQLEVGTIINDLMAQGGIPTLQAQLSEGANEQRARQFEQFFRTGTHT
                     SYGSYGVGGGQTALTWMHNYIANSI"
     gene            complement(334883..335488)
                     /locus_tag="H0264_01495"
     CDS             complement(334883..335488)
                     /locus_tag="H0264_01495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase family protein"
                     /protein_id="QLY31100.1"
                     /translation="MQLILVRHAQPQRVAGSSGPADPRLTEIGVQQAGRVPAALAPHR
                     IARVVSSPQLRARETAKPTADKLGREIEIFDGLAEYDRDLPVYIPIEDAKRDFQAVYD
                     RIKAGYLPEQIDGDAFKARVLNDITAITTAADPADTVVVFAHGGVINVLLQDVLGLER
                     PLTFPIDYCSITRILYSRTGRRTAATINENGHVWDLLPRNL"
     gene            complement(335538..335750)
                     /locus_tag="H0264_01500"
     CDS             complement(335538..335750)
                     /locus_tag="H0264_01500"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31101.1"
                     /translation="MYLDMLTQASLLDHTVWADADTWNTAMDLAAKKKSKSKGGGFWI
                     FAAVCCIGIIVLILGIVYMMRKKKSQ"
     gene            complement(335895..339263)
                     /gene="lysX"
                     /locus_tag="H0264_01505"
     CDS             complement(335895..339263)
                     /gene="lysX"
                     /locus_tag="H0264_01505"
                     /EC_number="2.3.2.3"
                     /EC_number="6.1.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007537650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional lysylphosphatidylglycerol
                     synthetase/lysine--tRNA ligase LysX"
                     /protein_id="QLY31102.1"
                     /translation="MGSIHTGAVTSTRDRHHHDTETRPDVRSSEVPHRGHGRFGEVPH
                     VAGLALGTFAALCALWSISPGLRYLTAGLRHFIDTYYFDAPDTSLVWALVVGLLAGAT
                     AARKRIAWWLLVGYMAAYALSNILDFVTERDLNALTALIVHLLVIGVLIAAWPEFYTH
                     VQRGAVWRALGWLASGIALGCLVGWGLVELFPGTLVGGWQRPLWAISRVTGAVLVSNE
                     DFDGHPKHFVNLLLGLFGAVALLAAVAVLFRSQRASNALTGLDESALRGLLERSDVED
                     SLGYFATRRDKAVVFAASGKAAVTYRVELGVCLASGDPIGLKEAWPHAIEAWLRLCDQ
                     YGWAPAVMGASEEGATAYKRAGLSALRLGDEAILETRTFSLAGAEMKQVRQAVNRLSK
                     QGITVRVRRHKEVPPEEMREVMRRADAWRDTETERGFSMALDRLGDPLDGDCLLVEAV
                     DANDRVLGMLSLVPWGRTGVSLDLMRRDRQSPNGVMELMISKLALNSEQYGITRISLN
                     FAVFRAVFEEGSRIGAGPVLRMWRSILMFFSRWYQLEALYRSNVKYQPEWVPRFSMFE
                     DRRHLARVALASALAEGFLPRIGKDPETSHHTGVRASVPDTMTGLHADGSPPDFTPEE
                     LEDNGPRRPEQVRVRMDKLRKLEESGVEAYPVAYPPTHTVAAARRTPQGTTVRVCGRL
                     LRIRDYGGVTFALLRDWSGDIQLMIDRGRVGADRSAEFDEYFDLGDLIEVSGQIGRSR
                     RGELSLLAADWRMIGKCLHPLPDKWKGLSDPEARVRQRYVDMAINTDIREMMTKRSAV
                     VRSLRDTLHGWGFQEVETPVLQQVHGGANATPFTTHINAYDLDLYLRIAPELYLKRLC
                     VGGMEKVFELGRVFRNEGVDFSHNPEFTVLEAYEAHSDYERMMHTCRQLIQEAAVAAN
                     GKMVVLRPNSDGGLDEVDISGEWPVKTVHGAISQAIGETITPDTEVERLRILCDKEGI
                     PFQLGWDAGQIVLEMYEHLVESKTEEPTFYIDFPTSVSPLTRAHRHIQGVTERWDLVA
                     WGVELGTAYSELTDPVEQRKRLTEQSMLAAGGDPEAMELDEDFLQALEHAMPPTGGLG
                     VGVDRVVMLITGRSIRETLPFPLVKPRTGQGDSR"
     gene            339371..339592
                     /locus_tag="H0264_01510"
     CDS             339371..339592
                     /locus_tag="H0264_01510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain-containing protein"
                     /protein_id="QLY31103.1"
                     /translation="MSDPVDVPIDDEIIRLGQFLKLANLIDSGSEAKTVIAAGLVRVN
                     DEVELRRGRQLQAGDVVALAGHKARVAAH"
     gene            complement(339615..340103)
                     /gene="rraA"
                     /locus_tag="H0264_01515"
     CDS             complement(339615..340103)
                     /gene="rraA"
                     /locus_tag="H0264_01515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003936564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease E activity regulator RraA"
                     /protein_id="QLY31104.1"
                     /translation="MTESANVVATADLADEIGPEIRSCDTQFIQFGGVEAFAGRIVTI
                     KCFQDNLLVKQTLSEPGEGRVLVVDGGASVHTALVGDIIAGRGVDNGWAGVIVNGAVR
                     DSAILRTLKIGVKALGTNPRKSTQTGSGDKDVPVEFGGVTFVPGDMLYSDHDGVVVRA
                     ES"
     gene            340235..342532
                     /locus_tag="H0264_01520"
     CDS             340235..342532
                     /locus_tag="H0264_01520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005515751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="QLY31105.1"
                     /translation="MVHAEGTSVDPLTDSDTGGETRSLLAAVAARFTSAWEAAGSPPD
                     ISEFLPAAPELRRLCLIELIKVDLEYRWIRYDYPKRLAEYRTEYDELRSGPLPPDLAY
                     EEFHALRRSGRGPDHSGYPTEAGSTAAAWMTRDYRSTLIARPQARQALDGIEVGDRVD
                     DFDLLVELGAGAFARVFLARQRSMQRLVAVKISQNHGTESETLAQLDHEHIVRVFDQR
                     LLAERELKLLYMQYVPGGTLSKVLRLVRERPPDQRDGGLLLEAVDSSMRDKGGLVPGE
                     SAARLVVHERTWPETVAWLGSRLARALDYAAANGVLHRDIKPANILLTADGLPKLADF
                     NISFSSHVAGTSPLAYFGGSLAYMSPEQLAACHPQLPDTAEDLDGRSDIYALGVVLWE
                     LLTGKRPFDDETRAGDSESSLERMLELRQQEVDPRHLGELPPDCPPTLRRVLLKCLAP
                     HREDRWPTGAALAQQLDLCLDHRARDLVDPPAGSWRARVGPWSLILLITLASAVGDFA
                     GTLYSNLHNGPLWDLWFTEAEQHTLRVIGTAMAIFSTPAAVGLTNYLCRRGFFVWRGL
                     RRGRKYDPVTLARGRLDTLWDGDRVAIVAFGWWVVSAVVASIAMVAFTDLAPGRLVNL
                     AATLLVSGAIAVAYPFFVVTFFVVRCFYPRLLSHGETASDHHALRALARRCTMYLVVA
                     AALPLIGVVISLIFLTPHEVSLVIEPIKWLCLVAVLGFVLDYWLFRQLEADLRAFERA
                     FSAPLTLGTATRIGPGTPVRLSPSA"
     gene            complement(342554..342934)
                     /locus_tag="H0264_01525"
     CDS             complement(342554..342934)
                     /locus_tag="H0264_01525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF5313 family protein"
                     /protein_id="QLY31106.1"
                     /translation="MSERTTPSLPQRIGYVCGRTLPPSMREWVLNDVTGPGATRRYLL
                     RMLIPMIPVLSLFLLIPGPLWMGLAMMALLYLPLIYFTVALTYVFRRNRLIKHGLDPA
                     LADADRRAREAAERDAYEQRHGRA"
     gene            complement(343006..343467)
                     /locus_tag="H0264_01530"
     CDS             complement(343006..343467)
                     /locus_tag="H0264_01530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRPBCC family protein"
                     /protein_id="QLY31107.1"
                     /translation="MTAVKIVAECAAPAESAFAYVNDYRHLPRFINEISAFEPITEQT
                     EGVDATFDGTIGLGPVTLHSTIKIVRHEPGYAIAVKSIKGFEIESTFLFHAKGENAST
                     IDAIVDYRVPGGIAGKLLGKTIEPFVKLAVKSSTHNLVTQVAEFHAARSNA"
     gene            complement(343564..344466)
                     /locus_tag="H0264_01535"
     CDS             complement(343564..344466)
                     /locus_tag="H0264_01535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopD family protein"
                     /protein_id="QLY34045.1"
                     /translation="MKWLLLVVPIGLCGAGIAWALAGNDPVQPEAPTRVLADCAGATV
                     LGLAALPRLSERLSPSWRLLAVVAGLWAAMEFAMLVFEASEVVGTSARELGGSQFGDY
                     LSEVSGGQIGIAILIGSGAVAGYSAFGFRRPDRATADLVLVFTAVTLALRPITGHMSQ
                     QAFGSLLGAVHALAASAWFGVLLALALTVRTRGEWAVLLPRYSRWALVLAATVTLTGI
                     VNGLVRVGGVVELATTGYGRILLAKTVLLAGLLALGWWWRTRWVPVAADHRMDAESSL
                     RRAIFEVLVMAVVFGLAATLAVTA"
     gene            complement(344526..345062)
                     /locus_tag="H0264_01540"
     CDS             complement(344526..345062)
                     /locus_tag="H0264_01540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance protein CopC"
                     /protein_id="QLY31108.1"
                     /translation="MTRKLFAGVLTGLLVTGFALLGAGTAGAHSAAIGSSPADGAQID
                     ASPARVSVTFNEDLQPNFPSMTVTGPDGNLWSKGQPLIEGATASIEVGELGPAGEYKI
                     AYRVTSADGHPVSGTRSFTLTKAGNGTPGAKANANAASGGSDDGGVPLWVFIAGAVVL
                     FGGGLAFALLGGKNKQRK"
     gene            complement(345074..345727)
                     /locus_tag="H0264_01545"
     CDS             complement(345074..345727)
                     /locus_tag="H0264_01545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007298273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YcnI family protein"
                     /protein_id="QLY31109.1"
                     /translation="MHISLSRALGTAAVAASLTLLGAGVASAHVTVDAPGAAQGKYTV
                     LTFKVPNESDTASTTKLTVAVPNLKSVRTEPLPGWTAKIDRNEKGEATAVTWTADPGN
                     AGIGQGQFQRFVLSLGPLPKQDTVSFNATQTYSDGKVVAWDQQENADGTEPEHPAPSL
                     KLASANGSGDEHKVDGGETAAAHDTDDTARWLGGVGLALGALGTALGLGSLIRSRRA"
     gene            complement(345771..346250)
                     /locus_tag="H0264_01550"
     CDS             complement(345771..346250)
                     /locus_tag="H0264_01550"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31110.1"
                     /translation="MLAGTAMAALAVAAHGQAGGGYPDSTGSTLLLLAAAAIGVGVSA
                     SRSPAALLALMAAGQPVGHVALSGLAHQGHSGTADFAMDGAMAGAHAAAAVAFAFLIL
                     VAERLYGVVSQAIRVVSTRPVGLPVRVGGTRWVRAAGRAKSLLGAWAAGPRAPPVTV"
     gene            complement(346518..347156)
                     /locus_tag="H0264_01555"
     CDS             complement(346518..347156)
                     /locus_tag="H0264_01555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31111.1"
                     /translation="MGLFTKRKKRVSRRAEAKALKHKAAMEAKLGARNERKRNRAENK
                     TQQKVAKAEVAKLQAEEKAALKLAAKAERDPFSAAQVRKYLSVARILVPVLAPLAYRG
                     ATFVRGQLDARRAQQLGIGVNQLGEFSGPGARLQARIANIEATLQEIEGKSGDTDTKK
                     FVAATRDRLDSLTAAVRTSDQMPAQRRRAVHASISNELSGIEADVLARLGVN"
     gene            347367..349004
                     /locus_tag="H0264_01560"
     CDS             347367..349004
                     /locus_tag="H0264_01560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005560935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TM0106 family RecB-like putative nuclease"
                     /protein_id="QLY34046.1"
                     /translation="MGDHGERAAFLDARALIGCRHRLLLDATHPGVLTGVAEDAGVQQ
                     RREAAAAHRAQVRDTLISASPDSWVVIESGVPASQRAEATMRAMENGAERIWGGLLPQ
                     ESDTGRRGGCEILWRDADRGGYIPVIVVNHKITDPRQPDPADYHPTTSDMYEWIPKPD
                     KHVRTRPQPRDQQRLAHLYRMLQRHGYASPALVGGAIGYHFDRILVHDLGPILDDYDR
                     RYADRIAVVRGELPTVPSKVPECRQCPWWSRAPEEGKPSCERWLSEHRDVSLVAPGSR
                     AEVLRRHGVETIDDLAAWSGDDPDDWQYEPFTETIVTARAWATGAPLVRRVEQVRVQR
                     ADVEVDVDLESFQEHGAYLWGTLLDGVYRPFVTWDPLPTEDEGRSFAEFWTWLMRIRA
                     DAKAEGKTFAAYCYSRTAEDKWLYESARRFAGMPGIPTEREVQRFVDSPDWVDMFQAV
                     SEQFICPNGKGLKKIAPVAGFAWRDPEAGGEASMSWYRLAVGYDGGEPDMSQRTRILE
                     YNEDDVLATKTLRDWMSERADAEVPSIADFSRRSIAS"
     gene            349001..350950
                     /gene="htpG"
                     /locus_tag="H0264_01565"
     CDS             349001..350950
                     /gene="htpG"
                     /locus_tag="H0264_01565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone HtpG"
                     /protein_id="QLY31112.1"
                     /translation="MTEHVEHLEFQAETHQLLELMIHSVYSNKDTFLRELISNASDAL
                     DKLKMEVYRDKDLEADTSDLHIELEVDHDARVLTVRDNGIGMSRAEVVDLIGTLAKSG
                     TAQLRKQLLEVKSDAAAEELIGQFGIGFYSTFMVADKVTLTTRKAGETGGTRWESAAG
                     SSTYSIEDLDEAPQGTTVSLHLKPADEDDHLFDYTMEWKLREIVKKYSDFIAWPIRMT
                     VERTVMDGEGEDKTEKTILETQTLNSQKALWTRPKSEVTEEEYKEFYRHVSHAWDDPL
                     ETIAMKAEGTFEYQALLFLPSHAPFDLFTREHKRGVQLYVRRVFIMDNCEELMPEYLR
                     FVKGVVDAQDLSLNVSREILQQDRQIRAIRKRLVKKVLSTVKDLRGAEDQEKYQTFWK
                     EFGRVLKEGLLSDTDNRETILQVSSFASTHSESELTSLAEYVERMPDGQSAIYYMTGE
                     SRQQIENSPHMEAFQAKGLEVLVLTDPVDEMWVGSVPEFDGKPFQSIAKGEVDLETED
                     EKKESEALREQQEKDFAELLTWMQETLAASVKEVRLTARLTTSPACIVGDVFDFTPML
                     ERMYRASGQVLPETKRILELNPTHPLVTGLRDEFAKQRDAEDKGALAETAELLYGTAV
                     LAEGGELKDPAHFARILADRLTRTL"
     gene            351296..351496
                     /locus_tag="H0264_01570"
     CDS             351296..351496
                     /locus_tag="H0264_01570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013491183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold shock domain-containing protein"
                     /protein_id="QLY31113.1"
                     /translation="MVQGTVKWFNAEKGYGFIAREDGPDVFVHYSEIEGNGYRQLEEG
                     QAVSFEITEGKKGPQAAAVRPN"
     gene            complement(351787..352554)
                     /locus_tag="H0264_01575"
     CDS             complement(351787..352554)
                     /locus_tag="H0264_01575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011596523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family NAD(P)-dependent oxidoreductase"
                     /protein_id="QLY31114.1"
                     /translation="MEISGSAAIITGGASGLGAATAKRFADAGATVFGLDLAQSIERA
                     GDSVPDGVTLIPTDVTSGDEVAAAVAKVVESGVPLRIVVNCAGVGWAGRILSKNGPHD
                     LELFRTVITVNLLGSFNVMRLAAEAIAKTDPVDEYGQRGVIINTASVAAFEGQIGQIA
                     YSASKGGVAGMTIPAARDLAQFGIRVNTIAPGIIDTPMLAGVTEEYRKGLEAGVPFPS
                     RLGRPDEYAQLAQYITEHDYLNGETFRMDGALRMAPR"
     gene            352718..353647
                     /locus_tag="H0264_01580"
     CDS             352718..353647
                     /locus_tag="H0264_01580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family NAD(P)-dependent oxidoreductase"
                     /protein_id="QLY31115.1"
                     /translation="MNASSARRLRRGLFRPALRVAGKRILITGAARGIGAQLARQLHA
                     HGARVALLGIEAELLAEVAAECGDAPWRYCDIGDPEQVERVVDSLTHELGGLDAVVAN
                     AGIAKQLSLIGGDPRVLEETLAVNVLGVYYTLRAAGPHIAHPNGYALIVTSLAAAVHL
                     PLAGAYSASKAAVEALGQTLRIELRHTGAKVGLAYFAELDTDMTSRGFDTEAARSILG
                     HGKGGGTSTISGIAPLGPAIDGMERALARRSRRTVSPYWVGLVLWCRPIAQRVIDYSL
                     RHGVEPGLEIARTERAGFTTDQPARERRMRKLA"
     gene            353668..354318
                     /locus_tag="H0264_01585"
     CDS             353668..354318
                     /locus_tag="H0264_01585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QLY31116.1"
                     /translation="MTESAVTARQLPRGRHGLPRETVVAAQRDRILLAMAEAMAEKGY
                     VGTPVAAVIKRAGVSRETFYEQFRSKEDCFEAAFERAVELMLAGILTVTGAEFDGETQ
                     VERIERVLGAYLDALASEPAYARVFLVEVYAVGPEAITRRTQLQETFVAMVADILGAD
                     TEEQRFACQTLVAAVGAMVTARIAANDTEGLRGLREPLLGLVRRSGELFGSAPLSS"
     gene            complement(354259..354972)
                     /locus_tag="H0264_01590"
     CDS             complement(354259..354972)
                     /locus_tag="H0264_01590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TMEM165/GDT1 family protein"
                     /protein_id="QLY31117.1"
                     /translation="MITTILLSFGALFLAELGDKSQLMTLTFALRYRWWVVLSAITVA
                     SIAVNLIAVGVGHFLGAALPTEVISLFAAAVLIGVGLWTLREVLTGSDDDAEAPAPQA
                     HSRSAFFVVLSAFLLAELGDRTMFAAMALATNNGWIAVWIGSVAGMVAAGGLAILIGV
                     TVGKHVPERLIAICSGLLFLYFGAATLLGTLASGLSTVAAIALAAIAPACAGLVLLGL
                     SARKGRAAEQFAAAADQAQ"
     gene            complement(355267..355794)
                     /locus_tag="H0264_01595"
     CDS             complement(355267..355794)
                     /locus_tag="H0264_01595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010595966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="QLY31118.1"
                     /translation="MGAHEQIGVTPFHSSGSLRGFLISGRWPDSTKEWAQLLVIAVRV
                     ASLPGLLPTTTVFGAREELPEDPQPGMVGLVMAEGTVLGEEALQPGRFAQHVPPALIM
                     LHPPRETRPSLPECSGAASGCLLLPGLPHLGLEHRAAWVETDVDGTVTSMVSRVGVDP
                     ISDPDTAVLAMLLAA"
     gene            complement(356017..356640)
                     /locus_tag="H0264_01600"
     CDS             complement(356017..356640)
                     /locus_tag="H0264_01600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008262954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="QLY31119.1"
                     /translation="MAVYTLPELDYDYDALEPFISGQINELHHSKHHAAYVAGANAAL
                     EKLEEAREKGDHAAIFLNEKNLAFHLGGHVNHSIWWKSLSKDGGDKPVGDLAAAIDDQ
                     FGSFDKFNAQFSAAANGLQGSGWAWLGYDTLAGKLLTFQLTDQQGNVPLGIIPLLGLD
                     MWEHAFYLQYKNVKADYVKAFWNVVNWAEVQDRFTRAVNQGKGLIFG"
     gene            complement(356876..357487)
                     /locus_tag="H0264_01605"
     CDS             complement(356876..357487)
                     /locus_tag="H0264_01605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31120.1"
                     /translation="MTVSRGTLDGLDIAGLNTALSEATCLGIDVDAAAARIRLELDVL
                     TLPVDGPPPPNCKIFLTLTGVTRVAASLRRQRWDDLEPVVLPLTADSLREAVLSFGGG
                     ALHGWEFFDLNDKSWEKWRKLLSFDATLSDGPAAHMLEFSQEEGIDPRELDVRVWFDS
                     VEVTDCDGNPMAVEDFIGGGVRWWQAHDKGDPRTMLPNIVPPL"
     gene            357808..358176
                     /locus_tag="H0264_01610"
     CDS             357808..358176
                     /locus_tag="H0264_01610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="QLY34047.1"
                     /translation="MPHVPSVPIDAVPAEFDTAEPWAGAEPVPAMLIDVRDADEWQQG
                     HAPGAMHIPLVDVPARLDELDYDAEIYVICRQGGRSVTAVQYLETVGIEALCVTGGMV
                     AWQQAGRPLIGDGDQQAKIY"
     gene            358187..359341
                     /locus_tag="H0264_01615"
     CDS             358187..359341
                     /locus_tag="H0264_01615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4328 domain-containing protein"
                     /protein_id="QLY31121.1"
                     /translation="MEPRNGGHVADSRSPVVQPCARCGARWAVQGKPLHWCPRCHGVL
                     LSPAPVDAPPARRNYRWVARPPGRRGHPAPAARRRQPTETPRYLRIPRWGLQDRPPQR
                     TIAPPTRFQRLVERIPELLMTTAGLFVLAALAEFGRYGVLLRNRTRLIPPWLLYLSDG
                     AVYVFGITALLFALVTAVAMVGWLARTRRAAFAAAQREDPRSLRALILGCVVPGVNLV
                     WPGVFLTDAVRARAAGTMLPGGDPRLLRTVRIWWAAWVLNGILVVVAQLYRFADTLQA
                     QADGVLVAAWTDLAAAAVAVLTLWMVRTFDGRDLRGREVGRTRWLVATAPAEPVIEPV
                     HPGAESARARAESEPDESAARESGSAGRAPADAVGNDEAVASNPEEVLAK"
     gene            359338..360105
                     /locus_tag="H0264_01620"
     CDS             359338..360105
                     /locus_tag="H0264_01620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="QLY31122.1"
                     /translation="MSRASRAPFVVAHRGASAARPEHTLAAYELALQEGADGVECDIR
                     LTKDGHLVCVHDRTVDRTSNGTGAVSEMTLDELKSLDFSMNGTEPAEVLTLSELIELV
                     LDWKSRPTKLFIETKHPVRYGALVETTLLNELQRYGIATPASADHSRAVVMSFAATAV
                     WRIRRAAPLLPTVLLGESSLYLSGGAATTVGATAVGPSVRTLREHPDLVDKAAAAGRA
                     TYVWTVDDHEDVKLCAELGVDWVATNHPGRTKNSLDA"
     gene            360192..361109
                     /locus_tag="H0264_01625"
     CDS             360192..361109
                     /locus_tag="H0264_01625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31123.1"
                     /translation="MGKSKRNTPKQGSNRAEKLAARRAAHEQAAQTVTRPFEGLAAEC
                     DLVALREFVPSATATLKLSPNVAAERPVTLATVLPGAVAALVRAGDEPVGFVGTQVQF
                     QSADPSADLAAAILWTQGAEPGDSLQTANVEGAPRLSEVLDPGAALDLTVHQDFNWWV
                     PAGVTPDPQVAATIEQANQAIMPSARLELGADAVGAAWWVDAGEKAHLRWVRPEDEDA
                     LMLALARLHAAGNLNLGEGSRFAGSFRTHGLLVPVFDLDPEKHATEWEAPAREFGARL
                     AEALKVDAPLTSDERRSRDGLRSRQVTLR"
     gene            complement(361438..361986)
                     /locus_tag="H0264_01630"
     CDS             complement(361438..361986)
                     /locus_tag="H0264_01630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="QLY31124.1"
                     /translation="MATRTQTKKSKFHALLQDQIRNEFNAEHQYIAIAMWFDHADLPV
                     LAKYFYKQAVEERNHAMMIAQYLLDQDFNVEVAPTDAGKSQFANAKEPIALALAQEEA
                     VTDQIVQLAKTAREEGDYQGEQFMQWFLKEQVEEVATMRTLLAVAERASANLFDLENY
                     VSREMSSPKDASGSPHAAGGSL"
     gene            complement(362079..363659)
                     /locus_tag="H0264_01635"
     CDS             complement(362079..363659)
                     /locus_tag="H0264_01635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LCP family protein"
                     /protein_id="QLY31125.1"
                     /translation="MNGDDPQHYARMRREPPPGRAGEPPARPQRPAANQPQPPRAQPA
                     RPMRPNPAAPPAGQGGRPQRPDQGARGPQPGRDRPGFDPTRKLDREEPRRPQAYSQVP
                     TVKNPRNQPPPRREQAPPQRNSNNPPRDRAGQRGPADARRDQAAAQGNPAATRKYSER
                     DREGAPLLHAPTQQPVPYREDTPPPPPPPSRPPRRGGGGGDRPRGSRRKFRLRWGRLI
                     LIVLVLLLALPIAAAVYVDTHLVRIDALTSYSGRPGDTPGTNWLLVGSDSRSGLSEEQ
                     EQELSTGGEVGSERTDTIILVHVPESGTPTLVSLPRDSYVSIPGNGRDKLNASFAIGG
                     PQLLVQTVEGATGLRIDHYAQIGFGGFADIVDAVGGIDMCLDEAINDPLAGIDLQAGC
                     QKLNGAEALGFVRTRATPRADLDRMLNQRKFLSALLKKASSPGTLINPFRSWPLIQGL
                     TKALKVDDGCHVWNLASLGRALGGDPIATTVPIGGFEDVDGSGNVVLWDKAKASRFFE
                     ALANDEQVPSDLVTTVGN"
     gene            complement(363721..364518)
                     /locus_tag="H0264_01640"
     CDS             complement(363721..364518)
                     /locus_tag="H0264_01640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="QLY31126.1"
                     /translation="MVSAAESRAGWPAPASSDGEKRAIRIEIAVVLVVTFGLSGANAA
                     LSLLESALSPGGVGGQTVALNPSRAAQSAIDLMFQLLGVARLLGWAALGLYLLWRSGI
                     GPKAIGLARRLRWRADVLPGSALAAVIGIPGLGLYLAAHTLGASVTIVPGSLEHWWRL
                     PVLVLSAWANSAAEEVLVVAWLITRLRQLGWSENRSLLASALLRGSYHLYQGLGAGVG
                     NLVMGVIFGRYWQRTNRLWPLLLAHALIDTVAYLGYAFLRGHVSWLP"
     gene            complement(364537..365307)
                     /locus_tag="H0264_01645"
     CDS             complement(364537..365307)
                     /locus_tag="H0264_01645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013473067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2470 domain-containing protein"
                     /protein_id="QLY31127.1"
                     /translation="MPNLAPVAAPTTAERVHSSCSLAEQAMLALPGLDPIPTSVHRLR
                     QCGDAVIAVPMTSTAAMLVSGAGSTGSPGVLELTDHAPVTVREPVRALVWLRGWVHTV
                     PTHAQRALAAAVAEDHPNPALLDIGHTTTLLRLVIDSAVVADSTGADSVGREQIRQAH
                     ADPFCEMEAAWLQHLQADHGDIIDRLARNLPGHLRRGALVHPLALDRYGITLRVEGAD
                     RDHDVRLSFSAPADDVEALSRAVRILAGCPFRNGLRHS"
     gene            365732..366151
                     /locus_tag="H0264_01650"
     CDS             365732..366151
                     /locus_tag="H0264_01650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31128.1"
                     /translation="MPHDSSPSADPVPLTLSLPPRPARGLTDDLVRPISGALEAEVLD
                     LAVPDIEVAKFLVRIAHGDSGFVARTDSGERAVAIVAATTAALMGDDIPAALANPDVA
                     FLRGLKPEAVEALRGVLLAVETSEPGAVNDALRVLRG"
     gene            366244..367161
                     /gene="pheA"
                     /locus_tag="H0264_01655"
     CDS             366244..367161
                     /gene="pheA"
                     /locus_tag="H0264_01655"
                     /EC_number="4.2.1.51"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="QLY31129.1"
                     /translation="MPRIAYFGPSGTFTEMALAKLESTGIFGGPVERVPAASQGATIE
                     LVRAGEVEGAVVPIESSVEGSIAPTLDALAVGPRLQIIAETELDVAFTIVGRPGVTLD
                     EVRRIAAYPVAAAQVRIWLAHRMPQAELYTSGSNAAAAEDVAAGHADAAVSTALAGER
                     LGLATLASGVADHEQAVTRFVLVGPPQPAPPRTGADRTSLVMELANEPGSLMRAFAEF
                     ATRGIDLTRIESRPTRTGMGTYRFYLDCVGHIDDAAVAEALKALHRTVPMIRYLGSWP
                     ASSANGAPPPSDEPAAAWLIDLRKGVADL"
     gene            367158..367820
                     /locus_tag="H0264_01660"
     CDS             367158..367820
                     /locus_tag="H0264_01660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase family protein"
                     /protein_id="QLY31130.1"
                     /translation="MTGKLILVRHGETEGNVGKILDTRLPGLPLTERGAGQAKTFGAG
                     LSVPPRKLFSSAALRARQTGGYIEAATGVPLEVLDDLQEVQLGDLEGRNSKEAHDAFQ
                     QIYRAWHFGDLSVRVPGGESGQDVLDRYIPALERLRDDYLSDRDAGDIILVSHGAAMR
                     LVSRELTGVPRLFAANNHLDNTETIELLPFEDGLWECTRWGRYPAPFADAIEPTGDDP
                     MG"
     gene            complement(367890..368720)
                     /locus_tag="H0264_01665"
     CDS             complement(367890..368720)
                     /locus_tag="H0264_01665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ESX secretion-associated protein EspG"
                     /protein_id="QLY31131.1"
                     /translation="MTVLGGGRGPSLLKSVTLSLDEMQYLQEALEIDELPVVLDAMGR
                     YDNVTDHGVAMAAAAATLTERNLLDGEQVHPELADRLRVLYRPHWVLALRWYVDGHVN
                     RFCIAKGDDVEVVALRGPDSYVLDEAGHDLAGTVIAALGPADPLELEGMRAPTEDLVP
                     IFDDAGDATTTANRLAAVCNPAADAKTLASALVQVDSHAEIVGVLYGDGSRDVADGHI
                     AVYNTRHGRFLATSSRADDGTKWTSFATGTPARLRTALQDLITALPLREEFPTPQQPE
                     "
     gene            complement(368717..369886)
                     /locus_tag="H0264_01670"
     CDS             complement(368717..369886)
                     /locus_tag="H0264_01670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PPE domain-containing protein"
                     /protein_id="QLY31132.1"
                     /translation="MTLGITGVFWLPRMAEINSISLNAGAHAIPISAASTSWTTLTGA
                     WVDATATVARVMAEVGVGLEGLNGLNVLARLTGFTVWAEQQVVMATALAAKTAANATA
                     YTVASIAMPSLPEIAAVETARVAAHSTGGALNGTAELAEAAKLAMDIRAALVMETYEA
                     ATTAIVATPGTFLMPPPIASGAGSANAASSTFSDSSDPVTSAIATVTSLASNPTVLSG
                     ISQVAQVAGSVVTTGASTVTSAAGNAISSLTSAAGTGGGYSPGISNAGVTTAGVGAAA
                     LATTAVAYAGGSTVSIGNGGGTLQLPQGWGAGAGAGGAAVATVAEPMTVAQSASGSGA
                     APVRSGTSPVLGGGNHGDDEEETHDGNDFGRSTDHFAHGGLIAPAVIGGDPADRR"
     gene            complement(369902..370225)
                     /locus_tag="H0264_01675"
     CDS             complement(369902..370225)
                     /locus_tag="H0264_01675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PE family protein"
                     /protein_id="QLY31133.1"
                     /translation="MVGLVSVQPELILAAALELDLLAERLAAVATAAGPTTHVLPSGT
                     EEVSLLAATHFNQAAATHDSAVAQGILELHHAAATLRTQLAQYMAQDTVRAAGIAATT
                     ATIQA"
     gene            complement(370319..370672)
                     /locus_tag="H0264_01680"
     CDS             complement(370319..370672)
                     /locus_tag="H0264_01680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009477115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallopeptidase family protein"
                     /protein_id="QLY31134.1"
                     /translation="MPVTMTDDRFEELVGDALDLIPPELSDAIDNVVVLIEARNDEEP
                     ELLGLYHGIALTERDFSHYGGALPDTITIYRDAILDMCHTEEEVVEEVAITVIHEIAH
                     YFGIDDDRLHQLGWG"
     gene            complement(370695..371786)
                     /locus_tag="H0264_01685"
     CDS             complement(370695..371786)
                     /locus_tag="H0264_01685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006944536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation family protein"
                     /protein_id="QLY31135.1"
                     /translation="MPSAPRQKPERSGPFGKLRDKIEHGDPVSAQMVRWGLLAFAVGT
                     TIAAVIMLVTGGFDTGKVTAHNPGAPQPTGAVAGEAFGTAKQGDCLNWSKANASDLTK
                     VDCSGKHLFEVTEDIDLSKYPGREFASGSRFPDSLRFSELRDEHCVSAAQSYLGGKFD
                     PRGKFVVGLINPGEAGWKAGERTLRCGLQVTGSGGTATQQVSGSVREVNQSKVFDTGM
                     CIGISRNLPTDPVDCAQPHAFEIVSTADLGTHFTGGPPSKDEQDKWMEEQCAQASTDY
                     LGSGDALRNKTLTLFWDYLDTRSWLAGSRSLNCMIGKGAQEGFAPISGSARGEILIDG
                     QAPVPPPNNGRSTPQPLPGAVPPVIPTPR"
     gene            complement(371893..373479)
                     /locus_tag="H0264_01690"
     CDS             complement(371893..373479)
                     /locus_tag="H0264_01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006330415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase N-terminal
                     domain-containing protein"
                     /protein_id="QLY31136.1"
                     /translation="MPQFTPDTVDYIVVGAGSAGAVVAARLSDRHGTSVAVLEAGGED
                     KDKFVHIPAGFSKLFQGPFDWNYRTEPQPELANRQVYWPRGKMLGGSSSMNAMMWVRG
                     FAADYDEWATHAGPGWSWQRVQPYFERMEMSDAVTTTIGQGGPLHIAAQRSPRPVTRD
                     YLQAASQAGYPVERANLDQPQGFTETLVTQKRGARWSTADAYLRPALQRHRDLTVLTG
                     AHVTRVLFEGKRAVGVEYRQDGEVRRLHARGEVILSGGAINTPQLLLLSGIGDADHLR
                     DLGVEVRHHLPEVGRNLRDHLAAPIVYRTTAGSLYGADKSIRELAAYLIRRRGQLTSN
                     VGEAYGFVRSRDELPLPDLELIFGPAPYIAEGLGDPDGHALTFAAILLKPYSVGRISL
                     TSADPFTAPRINPRYCAEPEDRTALLAGLRMCVNIAAQPALKEHIGELMQPAVPTGTP
                     LEEVLRRCLDDHSHTLYHPVGTCRMSADDTGVVDPELRVRGVDGLRVADTSVMPIITR
                     GHTHAPAVLIGEKAADLLTS"
     gene            373635..374894
                     /gene="serS"
                     /locus_tag="H0264_01695"
     CDS             373635..374894
                     /gene="serS"
                     /locus_tag="H0264_01695"
                     /EC_number="6.1.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine--tRNA ligase"
                     /protein_id="QLY31137.1"
                     /translation="MIDLRFLRENPDVVRASQRARGEDPALVDVLLEADAARRAAVLN
                     ADNLRAEQKALGKKVGKASPDERPALLAQGQELSAKVKEAEAAENAADADLDAAQRAI
                     SNVVQEGAPAGGEDDYIVLETVGTPREFDFKPRDHLELGESLGIIDMERGAKVSGSRF
                     YFLTGYGALLQMGMLQLAAQRAVKNGFTMMIPPVLVRPEIMAGTGFLGQHAAEVYHLE
                     EDDLYLVGTSEVPLAGYHSNEILDLNEGPKRYAGWSSCFRREAGSYGKDTRGIIRVHQ
                     FDKVEMFVYAKPEDADAEHQRLLAWEREMLAAVEVPYRVIDVAAGDLGSSAARKFDCE
                     AWVPTQQTYRELTSTSNCTTFQGRRLNVRYRDENNKPQTAATLNGTLATTRWIVAILE
                     NHQQADGSVRVPAALVPFVGTEVLEPR"
     gene            375063..376859
                     /locus_tag="H0264_01700"
     CDS             375063..376859
                     /locus_tag="H0264_01700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="QLY34048.1"
                     /translation="MVMARTTGAFYVMGGVLGLILTAVAPGDEGNRPLVGTAAFVALL
                     LGLSLLIWGPRMPHGVHHVYVGIATVLVTVAVHWFPNTVGAISLAAFYVFVACDAAIF
                     FAWRWLGIHLAFAIACCLWVVPSRGLPWWSGLIPAGITFGIGIVVGILTRMASDADID
                     VLTGLLNRRGFDRALNNAIGHATRTGQGLALVLVDLDRFQKINDHLGHRAGDAVLQRV
                     ADTWAKLLAPDQRLARYGGDAFALLLPNTTEQAAILLTEQLRAAVTTGCSAGVTSWQP
                     GESGSLLVSRADVGLYRAKQAGRNRTVLESSRQLPLAVELREAIDRGTLDVQYQPIVS
                     LSDGDTRAVGVEALLRWSSHAQPDVTTEGLIRVAEEYDLISDLDELVLRRACADAARL
                     QETFAQLDLTLNVNVSGLELAETDYADRVSGILADTGWPSDQLVLEVTESELAAESET
                     AIANLHKLRERGVRIAIDDFGTGYSSLSRLATIPSDILKVDQSFVAAIRSDSPAPPLL
                     GVIAALSKSLDLQVIAEGVETEYQAAVLTELGFALAQGYHYSDSHPVSELINDLNEHH
                     GLVGAGLDREPSTNGWIPMDNPLDGGLGGAQD"
     gene            376966..378294
                     /locus_tag="H0264_01705"
     CDS             376966..378294
                     /locus_tag="H0264_01705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016884413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QLY34049.1"
                     /translation="MFALTADLIPLYALYALLFADHGLSIAQISSLLAIWSTTSFVLE
                     VPSGAWADTVSRRGLLVLSGVLLFAGFTAWTVFPSYAGFALGFVLWGTSGALRSGTFE
                     ALIYDELAAHRATGSYVRIMGRARAAAEIAALLGILAAAPLFAWGGYALVGWASVVVA
                     LVHTLTALTLPSAPKAVSAADVDDLDDADLEELPPRHSGALLAGIHSDGSSADCVDPG
                     QKHAGMTGWRYVHMLRSGLREALRVRLIRRGLILAALLNGITAYDEYFALLAGDAGVS
                     PWVAAILVGVTVAGAAAGALLADRTDGMRPRTMALALAVGGFLFIGGALLSGLAAQHP
                     HAVYVLTAVGFTAIGIAYGIDYNAETIAGARLQDAIEGPARATVTSVSGLLTEVIAFA
                     VFGFVALASLWISIPVMVALLGVPFLLTAALFPAWLPARKEEAPTPLTAG"
     gene            complement(378272..378976)
                     /locus_tag="H0264_01710"
     CDS             complement(378272..378976)
                     /locus_tag="H0264_01710"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31138.1"
                     /translation="MSEGVIGGIHDDATYAVLDAAWDSWGRRDIDVIAHLINPAFLGG
                     PRWPALRQAHTIARRENALLVASSGLADPTAWDDAAPTNGYELEVYGITPDLPLDSDA
                     MSIAHSWFGQTVMTVSNLVAQYGFEVPDMVDRHGVITIELAEADLPAEAADTYLEDGA
                     AVVMLGLTAAELPASVQGPLSPIRLLNVKLLTAAEGRFCVDNSMGDDNARRELARRFT
                     EQGHPLWSSLTRPSVV"
     gene            complement(379235..379609)
                     /locus_tag="H0264_01715"
                     /pseudo
     CDS             complement(379235..379609)
                     /locus_tag="H0264_01715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012181807.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF805 domain-containing protein"
     gene            complement(379707..380276)
                     /locus_tag="H0264_01720"
     CDS             complement(379707..380276)
                     /locus_tag="H0264_01720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012181807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF805 domain-containing protein"
                     /protein_id="QLY31139.1"
                     /translation="MGFNEAVKSVLSQYANFEGRARRSEYWYWTLANMLAVFSVFLLN
                     ILLSLIHESLAIIGGLLLLILILGGFIPSLAVAVRRLHDTGKSGWFLLLGVIPFGGIV
                     LLVFECMEGNPGPNQYGPDPKGGFQGGPGYPMQPNQYQPYPPQQQYAPQQQYAQQQAF
                     APQQQQPYPPQQQYPPQQPYPGQQYPPQY"
     gene            380374..381333
                     /locus_tag="H0264_01725"
     CDS             380374..381333
                     /locus_tag="H0264_01725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="QLY31140.1"
                     /translation="MVLRRVGLVLGGCIGAAVAVQARINGALGERLGDGIAAAVISFG
                     TGLLMLAIAFAVSGRLRAGVGGVRTALSAGKLRWWQLLGGLCGAFFVACQGLTVAAIG
                     VTVFTVAVVAGQLVSSLVVDRLGVGPSGRTPVTGLRAAGAGLALVAVLLAVTGRSGGS
                     GGLSVPESFRGGPQVLLIVLPLLAGLGVAWQQAVNGRVGAVGGPASATLANFTTGTIG
                     LLLVEAVLLAGNGWPARFPDQPWLYLGGVIGVAFIALAVVVVRWIGVLLLGLTSVAGQ
                     LLMALLLDAVAPSGSGVTATAVAGCVLTFVAVGLAARTGAGEA"
     gene            381416..382435
                     /locus_tag="H0264_01730"
     CDS             381416..382435
                     /locus_tag="H0264_01730"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012787.1,HMM:NF018942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin domain-containing protein"
                     /protein_id="QLY31141.1"
                     /translation="MLIDYMVWAARLALSAVFGLSAWAKFIDLPGTRKAVGEFGIALR
                     WVPWVAWVLPTGEAVVAVAVLPPWTAVGGAALAITLLGVFTASMVRLLRAGKRPACSC
                     FGSVSATPIGWDTVARNGGLGLLALLVLVGTAARPHVPGVLPVDHAVGMAVGAVLVAV
                     LMWLGGLVFELRRRLDQQVLSTLGAEGLPAGAVAPEFELARTDGGRTDLAELLAGGRQ
                     LLLVFVHPACEMCAALARELPRWHARTAGVLTIAVVGNGEVAEYTEWKSRQQLGGIPV
                     LVQQGNEASLRYRVRGTPSAVLIGADGRVAAPVARGAMAIRDLIVQSKRTVPRSNPER
                     NGSVL"
     gene            382544..382879
                     /locus_tag="H0264_01735"
     CDS             382544..382879
                     /locus_tag="H0264_01735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011552243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calmodulin"
                     /protein_id="QLY31142.1"
                     /translation="MADFAFTDYSGKEFVIRLENEQRIAEARRILSGEETMSTHVMGR
                     IRKTRAEYNPGWNFHLDPETITFFTVAIEVCDSSITYVEDHLDEVCGAFLPGCFWCPW
                     SSRLTREIS"
     gene            complement(382932..384473)
                     /locus_tag="H0264_01740"
     CDS             complement(382932..384473)
                     /locus_tag="H0264_01740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005568843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske 2Fe-2S domain-containing protein"
                     /protein_id="QLY31143.1"
                     /translation="MQITSVGHAGFHIRTKAGTILCDPWVNPAYFGSWFPFPDNTQLD
                     WDELGNCDFLYVSHLHRDHWDAQLLADKVNKDTTVLLPDYPVPDLKRELEKLGFHKFV
                     ETEDSVKHTITGPGGDLDVMIIALRAPADGPIGDSGLVVSDGETVCFNMNDARPVDMD
                     VLHDAFGHVDIHLLQYSGAIWYPMVYDIPAKTKSNFGKQKRQRGMDRARSYIEQVGAT
                     WVVPSAGPPVFLDDELRYLNDDRGDEGNIFPDQIVFLEQMKIHGNEGGLLMIPGSTAD
                     LRGKELISVTHLTDPDTVYRDKAAYIEDMAQRMAPVLAAEKATWAVEDGTPLLPQLKE
                     LFEPIMAQSDLICDGIGYPVSLVMGDETVVLDFPKRVVREPVEGEGKHRYGFRIDKQL
                     VRTVLRDNEPDWVNTIFLSTRFTTWRIGGYNEFLYTFFKCLTDERIAYADGWFSEAHD
                     DSASTELDGWEVQRRCPHLKADLSKFGVVEGNTLTCNLHGWQWDLESGRCKTSKGHEL
                     RSRKL"
     gene            complement(384519..385334)
                     /locus_tag="H0264_01745"
     CDS             complement(384519..385334)
                     /locus_tag="H0264_01745"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31144.1"
                     /translation="MEYGRTALRGNVRRGLLGRGPARNLALTVIAAAVVAGCDSVVGI
                     PGDGPRTVAAPTVSRMPEPAPGTAAVGRWAADLREHGIDGMADRCWTMAPHHVRTMYA
                     EPAPIFEAIVAPGAREGGMVVWRTAAVTVAARDRDIATGYACPYVFGSGEEIAFDAAE
                     ARHTVRRYLSRAVGSPLNAADTETAYPLLCPADSGWDPKTTGKPGIPPMASGARTPVG
                     IKGFVDEDIKSEWPRNGYITVSVPVTTRTGVRTKQTFTLKSGVDGYCIGDVSG"
     gene            385409..386152
                     /locus_tag="H0264_01750"
     CDS             385409..386152
                     /locus_tag="H0264_01750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="QLY31145.1"
                     /translation="MEPVYFPIIGLARTVFALQGLKFTVTGDENIPAQGGAVIAINHT
                     GYMDFTYAGLPARTSKRYIRFMAKKEVFDNSISGPIMRALKHIPVDRAAGADSYHEAV
                     NRLKAGELVGVYPEATISRSFELKEFKSGAARMAIEANVPIIPIVIWGAQRVWTKGHP
                     KRLGRTNTPISIEVGAPIAPFEPASELTEKLHSTMEAMLLNVQRDYVHEPGAYWVPAR
                     LGGSAPTLEEANELDRAEAAEKAARRSGQ"
     gene            386313..386867
                     /locus_tag="H0264_01755"
     CDS             386313..386867
                     /locus_tag="H0264_01755"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31146.1"
                     /translation="MNTRTLGLAVSSAAVGIGLVVVGCARTIDGTPVVNETDRLAHFS
                     SVASSSSAASSSAAAASTSRAATMKTDACAAFTAGVLDVTQKWEVITGILDSGGDWRA
                     LQGPSRDWATALSTAAGNIQAVLRTDASITAPWRAPLTEYVDAANGFAAIISSMLLGG
                     ASDAFTPAATRYDDATSAAAIACQ"
     gene            complement(386919..387563)
                     /locus_tag="H0264_01760"
     CDS             complement(386919..387563)
                     /locus_tag="H0264_01760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015889196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34050.1"
                     /translation="MGHPLAYPVVVTIGALVSCLIWAPFADPDQVAMLGTVALVIVGY
                     SVFRIGMAVGWVPNGLPGREVGVRRVRQQYRLVSRSWLEFTLGGRTRWLPVYFDPGLV
                     SLTQGTAELSSRAVRVGDLRVYPAGRARDIEPQGRLIDNPGRVDPEAGVLAARANRVG
                     RRLLLDAQSAVAAPVAGLLWVYVDGGGTAAFVGATVVAAATAVWLAAIRGSDPS"
     gene            complement(387572..389245)
                     /locus_tag="H0264_01765"
     CDS             complement(387572..389245)
                     /locus_tag="H0264_01765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter family substrate-binding
                     protein"
                     /protein_id="QLY31147.1"
                     /translation="MRIRSTVTRLAIPMVALGLVLTGCSSNTGPTGTSDIGTTNDINA
                     HPVEDLKQGGNLRLDLSALPESFNYLHVDGNTGDTSDVVLPLLPTAYNSDAAGNLTIN
                     HDYFTDIQLAETNPQKVIYTINPKAVWSDGTPITWEDMRAQWKALSGENPEYLISAQL
                     GFNKVASVERGVDDRQAIVTFREPHGEWQGQYGLLYPKAMMESPQTFNDWARSNLPVS
                     AGPFIITAVDRTQNRITLGRNPKWWGDTPVLDTITFSVLDSSARIGAIQNNEIDATDM
                     GSLSDIVAARNTPGIQVRRTSKLYWSHLTFNGAPGSLLSDVNVRRAVAKAIDRQAIVN
                     NLQNGIVTEPKVLNNHVYMAGQKGYQDNSASVAYNPEAAAKELEALGWIIPPGGDVRE
                     KDGRKLILKDVMYQQDSWIDAAKIVQDNLQKIGVKVEIQTVPGQGLFTDVIDPGNYDL
                     AQYSYGGSVQPLEGLRQFYYYDPANWVGNKARIGSPELNKVIDAALAELDPAKAIELA
                     NQADTMIFEEVHSLPWAQSAGNTACRESLANWGAFGMASVDYTKVGFLK"
     gene            complement(389266..390981)
                     /locus_tag="H0264_01770"
     CDS             complement(389266..390981)
                     /locus_tag="H0264_01770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter family substrate-binding
                     protein"
                     /protein_id="QLY31148.1"
                     /translation="MRIRAHCTPIRHRRGRSARRGTALLFAAGLAVAALTSCSTGQDP
                     VGETTLGSSSDINPQARDNLRDGGNLRLAITSFPANWNTVSNDGNEGEIAEVVRPMMP
                     RSYRIDAAGETSLDHNYFTDIQLTSTEPQQVVYTINPKAVWSDGTPITWEDIASQANA
                     LSGKDKRFLIAINNGFDRVEKVERGADDRQAVITFARHYADWRGQFAGNSMLYPKSVT
                     ATPESFNDSLVNGISLTAGPFQVRSTDRTQGRIVLERNPKWWGDTPKLDTITFSVLDR
                     TAWAAALQNNELDAARLSGLDEVTTIRNSPGLAIRQAPDNRWRHITFNGAPGSILADQ
                     GVRVAVSKAIDRQQIADSLYYGLIDDPKTLNNHLFLMGQKGYQDNSLGFDPEAAGREL
                     DALGWVRQSDGIRAKDGRRLVIRDVMYNNPLWVQVATIVQQNLAKIGVGLEIDTRGGQ
                     GFFTDVIQPGDFDAAQFIYQGDPFPLGSISQIYAYHPDDLQGNYGRIGSDELNALIER
                     TVSELDPDKTIELSNQVDRKVFEEGHSLPLVQEMGLYGVRPEVANFGAPGLASYDYTT
                     IGFLK"
     gene            complement(390993..392855)
                     /locus_tag="H0264_01775"
     CDS             complement(390993..392855)
                     /locus_tag="H0264_01775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QLY34051.1"
                     /translation="MSKDPLKTTTAPLLEVSDLRVSFPSEEGRVEAVRGVDFTVNDGE
                     VLAIVGESGSGKSVSSLAIIGLLPEQARVRGSIRLRGRELLGLGDKHMSTLRGSRVSM
                     VFQDPLSALTPVYRIGDQIAEALLAHKKMSKAEAEAKAVELLDLVGIPDPAVRAKAFP
                     HEFSGGMRQRVVIAMAIANDPELIICDEPTTALDVTVQKQILGLLRKARDITGAGVIM
                     ITHDMGIAATLADRVAVMYAGKVVETASAQELFTTPRMPYTVGLLGSIPRMDSPPRSP
                     LIPIVGAPPAMHDLPPGCSFAPRCPIAVDDCRAAEPPLEDTAPGHRAACIRTSEVGTG
                     DLFTAYREEITRPDEVADTDASQVVLRVQELRKTFPLTKGVILRRRTGEVKAVDGISF
                     EARAGRTLALVGESGSGKTTTLTQILDLVPPESGSIEILGYDVATLTKQQRREIRRKM
                     QIVFQDPSASLDPRLPISDALAEPLRIDGRSRDEINRRIPELLELVGLRREHADRYPA
                     DFSGGQKQRINIARALALNPELLVLDEPVSSLDVSIQAGVLNLLRNLQTERGLSYLFV
                     SHDLSVVRNLAHDIAVMYRGKIVESGPAEQIFANPEHEYTRALIDAIPQPVATR"
     gene            complement(392861..393796)
                     /locus_tag="H0264_01780"
     CDS             complement(392861..393796)
                     /locus_tag="H0264_01780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY31149.1"
                     /translation="MTDVEIIVQGAPQQPTGRRKLVLRRFLRNKTSVIALLILVALFV
                     AAFVLPHFLPYTYTDQDKTAILQPPSGKHWFGTTNNGEDVLAQTLRGMQKSLIIGFGA
                     AIISAVLATLAGALAGLLGGWVDRTVMWVVDLLLVVPSFIMIALFAPRTKGNDSTLLL
                     MVLIGLFAWMISARIVRGLTMSMREREFVRAARYMGASTWSVIVTHIVPNIASILIID
                     TTLAIGSAVMAETGLSFLGFGVQWPDVSLGSLIGRYSAQAFTFPWTFMFASGVLVLIV
                     LCANLVGDGLRDAFDPSAKRARSRKSLREKKAGKS"
     gene            complement(393793..394770)
                     /locus_tag="H0264_01785"
     CDS             complement(393793..394770)
                     /locus_tag="H0264_01785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018599038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY31150.1"
                     /translation="MAGFLLRRAANYVVLLVLASFLVFTISSLTFRPLDYLEERSPRP
                     PQSVIDAKRAELHLDEPIPQRYLSWAGGVVQGDFGKTKAGQPVSEELPRRVGVSLRLL
                     LIGSLVGTVLGVLIGAANAIRQYKFSDYFSTVVSLVLLSTPVFVLATLLKYGALQVNQ
                     LTGEQIFLYTGETSATAVNGLWNQLVDRIQHLAIPTLGLALGAMAGYSRYQRNAMLDV
                     LGSDFIRTARAKGLTRTRALYKHGLRTALIPMATLFAYSLGGLITGATFTEKIFGWHG
                     VGEWLVNGLNDQDLNIVLASTLFAGVVVLVSGLLSDVAYALLDPRVRVS"
     gene            394966..395808
                     /locus_tag="H0264_01790"
     CDS             394966..395808
                     /locus_tag="H0264_01790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="QLY31151.1"
                     /translation="MDWVTLFHLPKPKMVATDVDGTLIDRHEQVSARTKAAVDALIAD
                     GVPFVLATGRPPRWIDPVVDGLGYAPLCVCGNGAVIYDSAADSILAAYTLDVDTLEWA
                     AEMAESLLPGCGLATERVGRSAHDAATPQFVSSPEYEHAWLNPDDTRVSRAEVISAPA
                     IKMLIRLPGTSSGDMRTILEPRLAGRADVTYSTDDGLIELSAPGVTKATGLAMVAQRL
                     GVQHATMIAFGDMPNDVPMLRLAGHGVAMGNAHHEAKAAADEVAATNDDHGVAQILER
                     WWQV"
     gene            complement(395866..398190)
                     /locus_tag="H0264_01795"
     CDS             complement(395866..398190)
                     /locus_tag="H0264_01795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="QLY31152.1"
                     /translation="MPYQRRKPAYVLPVVTALAITAPLGVLALSDSPDIRNTDESNLA
                     AIPAKMTEVVLASSPDIVLPLRELTGLNLPDLRLSDLRMIPLPKSVRVPQGLPLPPGV
                     QLPAEIPLPNLQGTTTAPASFDSAGPFTAAPGFIARRQPGDENLPAPADPGVSPADPG
                     ATPADPNVPATDPAAGTPTLPELTGDPSTPALSPGAVPRDMIDKVGAQVKELTRDTPF
                     SMVALTADSLAGRSAMIRAQRPDGSWGPWYPAEQADGRAQVKGKTGTEPVYVGNTKSV
                     QVLVTKQQAAAPTDGVPAEPGPLTPDSTDPAQINLEKLAAVLIDPGRGAIDENLSQVA
                     SSLPGGGPKVITRAQWGADESLRCEEPTYDDGVSAITVHHTAGRNDYSKAESAGIVRA
                     IYAYHAKTLGWCDIGYNALVDKYGQIFEGRYGGLDRPVEGAHAGGFNINTAGVAFMGN
                     HEEEAPTDVAVQSMGQFIGWRARTAGIDPEGSTTMYSEGSEYTRYAMGQAVKLPNVFA
                     HRDVGNTTCPGDAAYSLMDRIREIAEGVAGPSPATSSPRTRPDVQVNHQNPGATTPDT
                     DTTGTADAELATLAELTTRLLGLLDKSAVARYYSEQGGPNGPLGQVKSEPQPTADGGQ
                     TAGFVNGYVYASPTGQVYAVVGKILERFLQLGAGTGVLGLPQSNEYRIQDGIRSDFQN
                     GSLIYNTVTGIVTTVLKNFGTGAGTGAGTAPNARVNPGAATTPGAGVTPGGPGTSPGA
                     GAPGAATVPGAVTIPEVMGEVPAAAPIPEAAPTN"
     gene            398363..399535
                     /locus_tag="H0264_01800"
     CDS             398363..399535
                     /locus_tag="H0264_01800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpoIID/LytB domain-containing protein"
                     /protein_id="QLY31153.1"
                     /translation="MPNGYLRRRRRRRRLIALSLAAATLATATAGLLWAWPKGSIRPL
                     AGPGHGRGLSQTGAFNQAVDGSTAEQILAHYYPGADLGEIAPVPVRVRIAQQDDSTLD
                     VISESGLFVAGRRVIPGQAAHLTPTASGADVTITTGCDGEILWEGTTDDPWVYPMVDG
                     TDRPAEEHLELCGGYSYRGVLGVTLENGEPRTVNEVNIEDYLLGVVPAEMVPNWADQG
                     GTEALKAQAIAARSYALAESRYPYAETCDTTDCQMYPGTEKEDDRTSAAVRATAGRVL
                     LRDSHILRSEYSAAPDGGSPMNIENLEVGPAVSEFPSAPIPSVEIPPDVSLSDLIPEL
                     LPSDQIADPATPDGTVKPVVPSGTAAPSTAITPTPPVNPVPLHTTPRLTTAFPKPQ"
     gene            complement(399610..400143)
                     /locus_tag="H0264_01805"
     CDS             complement(399610..400143)
                     /locus_tag="H0264_01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004937655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="QLY31154.1"
                     /translation="MLRIFPSRGVAVPDAVDLITTAWNTARPDVDVSPMAVCARITRL
                     SNVLDREFRDFFGAHGLEFWEFDVLATLLRSGSETGLTAGDLNKAAMRTSGAITNRID
                     KLAGKGFVERVPDATDRRSVRVQLTDTGRELVNKLLPLHVANEQRILAGLSGGDRDDL
                     AGLLRKLAESLGDTALS"
     gene            400215..401150
                     /locus_tag="H0264_01810"
     CDS             400215..401150
                     /locus_tag="H0264_01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="QLY31155.1"
                     /translation="MTTARTGAASYAGTLALAGLAPLVWGSTYAVTTEFLPPDRPLFT
                     ALMRALPAGLLLLAITRSLPRGRWIGRAAVLGMLNIGAFFPLLFLAAYRLPGGVAAVL
                     GAAAPLIALGFAALALNEKLTLRKVLAGIIGLFGVALVVLRATAALDTIGVIAGLAGA
                     ASMAAGTVMTKRWGRPEGVGPLAMTGWQLTAGGLFLLPLALLVEGAPPALDLKAVGGY
                     LYLGLIGTAVAYALWFRGIARTNATSIAFLGLLSPVSAAVIGWVALGQSLAPLQLAGM
                     LIALGATLLGQLATAPRAAKPENASEQREAARTAA"
     gene            401188..401832
                     /locus_tag="H0264_01815"
     CDS             401188..401832
                     /locus_tag="H0264_01815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018841191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-binding protein"
                     /protein_id="QLY31156.1"
                     /translation="MKITVFGAAGEVGGRVLAEALSRGHEVRAVSRSADRLRGLPREV
                     EVFAGDAANPADVAAASAGSDLVISATRPVPGAEHELAVVAAALLKGLAGTGIRLLVV
                     GGAGSLTVPGTGLTLAEQPDFPAELGPIAAGCGAQLAVFLAEGDGGEVDWAYLSPAAL
                     LEPGERTGRYRLGAHDLIADDEGNSSISMEDLAVVLLDEAERPKHHRTRFTAGY"
     gene            complement(401967..402668)
                     /locus_tag="H0264_01820"
     CDS             complement(401967..402668)
                     /locus_tag="H0264_01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006550994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34052.1"
                     /translation="MRWAATIGAVLSTTLLTGGVADAAPVVTLGGGSGVFVEQLGSNE
                     IADCTLTAIGYDRDNRLVALTAGHCGEVGARIAAEYTRSGGIGVISNKDENMDWAVIT
                     LDPDRVLPTRQVAQSVINSVGTGPRVGDIACKNGRTTGYTCGLVWETKSTFFRSQVCA
                     NYGDSGGPVLVGDRLVGMIVAGQDLELGPVTIDLQPCKGQGDLLHTPEIATNIGSVLA
                     SIDRTGGPGAGFRAF"
     gene            402814..403569
                     /locus_tag="H0264_01825"
     CDS             402814..403569
                     /locus_tag="H0264_01825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="QLY31157.1"
                     /translation="MATEWSIQDLAKSAGTTSRTLRHYGELGLLPPSRIGSNGYRYYD
                     QESLVRLQRILLLRELGLSLPVIGEVLAGEKDTAAALHTHLELLHQQQDRLARQIASV
                     RTTLRKTEAGEPLMADEVFDGFDHTQYKDEVIERWGKDAYDRSNNWWNSMSDADKKAF
                     MQTHLDIAADYGRAHAAGLPLDSDEVQAIVQRHYDWIALAWGGRRPEKVAFVNLGEMY
                     VADPRFAINYDKHGEGTAEYVRDAMKVYAEAQL"
     gene            403654..404322
                     /locus_tag="H0264_01830"
     CDS             403654..404322
                     /locus_tag="H0264_01830"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31158.1"
                     /translation="MSYPYGQPGQPGYQSQPGYPQQPQPGYPGAQPAYPDAQLYPGSQ
                     PPGYPQPAYPQQGYSPYGYQQPAPSGGTAIAAGAIAAFGGVIATLGGLALAIGGAAVG
                     AADETGDIGDGLGTLFAILGGVLAIVGILWLVGAVLMFMARPAGRVILIVMSGIGVTL
                     NIVGFAISAANDASSGSGVLGLLFGGLILGLSLAPSTGRWIEYKKQLRNQPVGGGYAP
                     YPYQ"
     gene            complement(404383..405597)
                     /locus_tag="H0264_01835"
     CDS             complement(404383..405597)
                     /locus_tag="H0264_01835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019925077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31159.1"
                     /translation="MRFRRLAPLTGTLALTAVLSTAALLPAAAPARAEGETLAATTVT
                     DASDVCGKGSATFDDIVATAATAIRTVVPGGQLSEYDRQVDDFRRSIATVRVHRDMLP
                     VGAPNDRTEFLDDPIVSNLVNSLDAIRTGRINQTVPVSSLSVNDVIEVFILATRIVKI
                     PAQLGASLVPTAGFILKPIVGAIFNGVKSLARAVQNQLELGCNTTGVYGKLQLETPDE
                     QVSVPQPLVDLANQLVLADGSCTPLAELKTSDLVERARTFLTTTQGLGIDPGVVEGNA
                     AALQAFLRDNRVADLVTLRRTEQLGPLVNAMDWGPMTFLANLGFDIYEGKALNTVALA
                     DVSVENAFDLVTLALDTTSLLLTLGNTIAGWTGVASAVLTPLSIAQTLAFAPTTYGAP
                     ILKGVMQSMCAA"
     gene            405869..407065
                     /gene="glf"
                     /locus_tag="H0264_01840"
     CDS             405869..407065
                     /gene="glf"
                     /locus_tag="H0264_01840"
                     /EC_number="5.4.99.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-galactopyranose mutase"
                     /protein_id="QLY31160.1"
                     /translation="MTVASPFDLIVVGSGFFGLTIAERTANLLGKRVLVVDRRYHLGG
                     NAYSEAEPETGIEVHKYGAHLFHTSNKRVWDYVNQFTEFTGYQHRVFAMHKGQAYQFP
                     MGLGLISQFFGRYFTPDEAKALIAEQSAEIDTKDAANLEEKAVSLIGRPLYEAFVRDY
                     TAKQWQTDPKELPSGIIARLPVRYNFDNRYFNDTYEGLPKNGYTAWLSKMAEHENIEV
                     RLNTDWFEVREEIRAQNPDAPVVYTGPLDRYFDYSEGELGWRTIDFETEVLNTGDFQG
                     TSVMNYNDADVPYTRIIESRHFHPERDYYPKDKTVIQREFSRFAQTGDEPYYPINTPE
                     DRARVLAYRERAKAETASAKVLFGGRLGTYQYLDMHMAIGAALSMFDNVLRPHLESGA
                     ELVDNA"
     gene            407065..409002
                     /locus_tag="H0264_01845"
     CDS             407065..409002
                     /locus_tag="H0264_01845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactofuranosyltransferase GlfT2"
                     /protein_id="QLY31161.1"
                     /translation="MTAQLELEEMTTDSRAKSLLQRVILPRPGEPLDVRKLYLEESDT
                     NARRAHAITRTALAIGAESEVSFCTYFNAVPASYWRRWSVLKSVVLRLELSGHGRVDV
                     YRSKADGSRIHVQGNEFTTPGDGAAAAAFVEFEVDLGPFEDGGWIWFDITTDSQVTMR
                     SGGWYAPVEAPGEGSIAVGMPTFNRPTDAVKTIAALGSDPLVLEKIKAVIIPDQGTRK
                     VVDEPGFAEAAKPLGDRLAFHNQPNLGGSGGYSRVMYEALKTTDAEYIVYMDDDIEIE
                     PDCILRALAFSRFAKSPILTGGQMLNLQERSHLHVMGEVVDRSIFMWTAAPNVEYDHD
                     FAKNPLRDRDNSKLLHRRIDVDFNGWWTCVIPRSVAEEIGQPLPLFLKWDDAEYGLRA
                     REHGYPTVTLPGAAVWHMAWSDKDDAIDWQAYFHLRNRLVVASLHLPNDGRPMVVNTI
                     KATLKHLLCLEYSTVAIQNEAIRDYLAGPDKLFELLPTALGKVHAMRKEYPDAVVLPS
                     STELPMASRAEVGAVGEPANPLAKVARLGKGVLHNFRKANPAHHETPQLNVPTLDARW
                     FLLSQVDGVTVTTADGRGVVYRKRDPRKAMELFKEAMRLRKELAERFPEVREQYRAAH
                     AHLTSKAAWENVFGIDSGEPK"
     gene            409053..409628
                     /locus_tag="H0264_01850"
     CDS             409053..409628
                     /locus_tag="H0264_01850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003943893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
                     /protein_id="QLY34053.1"
                     /translation="MTEVSDEAEGCCGGGCCGADAEVPPLEVQALNIVQGTIGQYPAV
                     IKAARGMSHFGEHALGWMAIGAAGAVLDKKRRRQWAGVAVGAFGSHAASVVIKRIVRR
                     PRPNDPSVQVNVSTPSKLSFPSSHATSTTAAAVLLGRLTGLPLPAVLVPPMLLSRMVL
                     GVHYPSDVLAGSALGAASAAAVLAAEKRLAK"
     gene            409658..410602
                     /locus_tag="H0264_01855"
     CDS             409658..410602
                     /locus_tag="H0264_01855"
                     /EC_number="2.4.2.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decaprenyl-phosphate phosphoribosyltransferase"
                     /protein_id="QLY34054.1"
                     /translation="MSEEPTGTDLAEAVIKGPPKTLGGGLIKAMRPRQWVKNVLVLAA
                     PMVAGKTAAGDIIITDGSVILNVAIAFAVFCLAASGIYLINDALDVEADRAHPTKRFR
                     PIAAGVVPVNLAYGLAVVLLTGSIVGSLLANWHLAVVMAVYIAIQLAYCFGLKHQAVL
                     DIAIVSSGFLLRAVAGGAAADIKLSKWFLLIMAFGSLFMAAGKRYAELKIALDTGAKI
                     RKSLEYYTPTYLRFVWTLAATTVVVCYGLWAFEPDHANNVWFAISMIPFTIAILRYAV
                     DVDGGEAGEPEEIALGDRILQFLAIAWIGAVGVAVYLT"
     gene            410634..412589
                     /locus_tag="H0264_01860"
     CDS             410634..412589
                     /locus_tag="H0264_01860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019746405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31162.1"
                     /translation="MTAELPIGRARRRADSSARRFSRLSRTTFVGGIALTAALFAVGG
                     WERRWIADDGLIVLRTVRNLLAGNGPVFNAGERVEANTSTAWTYLVWFFSWLTQARLE
                     YVVLGIALTLSVAAIVFAMLGTARLWGGTAAQLLLPAGALVYIAVPPARDYATSGLES
                     SLVIFWLAVLWWGMIRWSQAEKVRLTSFFALTFCAGLAPLIRPEMTLVGALALLMIFC
                     APLPETRLRPWVFRAVIVAVAGVVPVLYQIWRMGYYGLPYPNTAVAKDAGGAKWGQGI
                     VYLWNLVGPYWLWLPLLVLAVAGLLVMRSRRDGEQTGRHSIVHPSAKQTPRERIHSFS
                     TWLRTPSAVVALMLGSGFLLTVYEIRVGGDFMHGRMLLPQLFCLLLPVMVLPLKLPGA
                     LTGGEMGSRRTDYVFLIVLAACLGTAGWALFAANTTAIKTGTKISSSGIVDERVYYVL
                     NTGHDHPIRAEDYLDYPRMRAMVRDIANNPNGGLLINSPSFMNWYIAPPPEPIPDGGA
                     GHTVFFLNLGMTSMNVPLDVRVIDQMGLAYPLAAHTDRLTDGRIGHDKNLYPDWVIVD
                     AGMVDKKPWMPWFLDERWVTQARVALSCPETQDLLASTRSPLTFDRFRHNIQQSLGFA
                     KYRIDRVPKYEIQRCNLVDPTDPNAPK"
     gene            412776..413834
                     /locus_tag="H0264_01865"
     CDS             412776..413834
                     /locus_tag="H0264_01865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="QLY31163.1"
                     /translation="MRVETVGGAQPERALGRRTLLKGAAIGAAAALLPAGVTALAGRA
                     SAAFNPEGFDFWVDSSMGPIKNRIFRAADGNTHRVVYALDGQRARDDLNGWEIDTNVA
                     AELMKANINVVMPVGGQSSWYADWDSPSTFLGLPAGSVAGSSGSGGSQVLSGGPGKSY
                     TYKWETYLTTNLRDAIRDRLGFSVTRNGIFGLSMSGGSALMLAAFYPGQFCYAGSFSG
                     ALNLSLPFMKEAVRASMIDAGGYNIDALASSKSTKWQHLDPYMFAPKLKANNTRLWIS
                     SGSALPSSTDGMSVTTIQGMGIEAVSLVGTRSFQARFASLGGTNVTYDFPGVGIHNWK
                     NWEAQLYKMLPDLSANIG"
     gene            414015..415082
                     /locus_tag="H0264_01870"
     CDS             414015..415082
                     /locus_tag="H0264_01870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="QLY31164.1"
                     /translation="MRGERRQRSRGGWLKKSVLGLALATLAPLGISVAAAPAAHAAFD
                     PSGFDFWVDSAEMGPIKTRIFRAADGNTSRVVYALDGMRATQILNGWENDTNVVGALT
                     AANINVVMPVGGESSFYADWAEPSTILGITGSGGSSGSASGSSSGSGGLNMFSGGPGK
                     SYRYTWETFLTQDLRNALRDRLGFSSTRNGVFGLSMGGSAALTLAAYHPDQFSFAGSY
                     SGYLNISAPGMREAIRLAMIDAGGYNVDSMAPPWGSQWLRMDPFVFAPRLIANNTRLW
                     ISAASAIPSAGDVTGVMSVIQGMPLEALALVNTRAFQVRMATLGAQNVTYDFPATGVH
                     NWRNWEAEVYRMIPDLSANIG"
     gene            415414..416406
                     /locus_tag="H0264_01875"
     CDS             415414..416406
                     /locus_tag="H0264_01875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="QLY31165.1"
                     /translation="MPLGLAAPMTAPAHAAFDPAAFDFWVDSPVMGPIKTRVLRAADG
                     NTNRVVYALDGQRATEIISGWENDTNVPAVLASWNINVVMPVGGQSSFYADWDQPSSW
                     FGVPPGAGSSAANTGSGATEALGAGPGKSYRYAWESFLTNELRWALRDRLGFNPNRNG
                     VFGLSMGGSAALVLANYHPDQFSFAGSFSGYLNISAPGMREAIRLAMIDAGGYNVDCM
                     AVPWGPNWLRMDPFVFAPTLIANNTRLWIAAGSGLPMQQDLEIPFGAAADRLVRGGPL
                     EALALANTRAFQARMLSLGATNAVYSFPNAGLHAWTNWQDEAYRMIPDLSANIG"
     gene            416638..417606
                     /locus_tag="H0264_01880"
     CDS             416638..417606
                     /locus_tag="H0264_01880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010838097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="QLY31166.1"
                     /translation="MRSALRRVFVAVACALALPMTLGAGGVAPVASASFDPAGHDFWV
                     DSSMGPIKTRIFRALDGNTQRVVYALDGLRARNDLSGWEIDTEISRVLTAWNINVVMP
                     VGGQSSFYSDWVAPSNTNGQTFTYAWETFLTRDLRNAMAARLGFNPHGNGVLGLSMGG
                     SAALVLAAYHPDQFRYAASYSGYLNISAPGMREALRAALLDAGGYNIDSMWGPPWSEL
                     WLRNDPFVFAERLRANGTRLWISSGNGVPGTRDAVRSPLDAYNLTNAAGLESVALANT
                     RAFQARMESYGPCNAVFDYTPDGVHSWSYWQDQVFKMLPDMSANLG"
     gene            417793..418827
                     /locus_tag="H0264_01885"
     CDS             417793..418827
                     /locus_tag="H0264_01885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="QLY31167.1"
                     /translation="MRFGRSAVAGGAPSGRSAHRRWSARLLAAGAAALAIPTAAAVAA
                     PSIALAAPAHGPVHRSPAGGFEELMVPSSMGPVKVQVQWAKNGGSKALYLLDGLRARD
                     DRNAWSFETNAMQQFENDDITLVMPVGGQSSWYADWTSASNTNGQKYTYKWETFLTKE
                     LPDFLAGYGVSKTNNAIVGLSMSGPAALRLAAYNRGMFKHASSFSGPLNWNAPGMREA
                     IRVMMLDAGRFNVDSMAAPWSPAWLRMDPAVFAPQLKGLPMYISAASGLPGSHDAPNS
                     AVGVFNTANAMGIEAISMVTTRLFQQRLNSLGINSAVYDFPASGTHSWKYWEDELWKA
                     RPHILGALNG"
     gene            419076..420365
                     /locus_tag="H0264_01890"
     CDS             419076..420365
                     /locus_tag="H0264_01890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006937143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="QLY34055.1"
                     /translation="MAATVAVTAGPAMAEPAAAVASPSIRNVVWLTDRRVALWVDSPA
                     MGTQIQVQLLLARDWNRTPEARFPTLLMLDGLRATDDQSGWTKEAGAEAFYADKNITV
                     VLPVGGMSSFYTDWRRPDNGKTYRWETFLTKELPPLLDKQWRTSNVRGIVGLSMGGTA
                     AMALAARNPGFARYVASFSGLLTLTTLGMPQAIGYAMRDAGGYDAEAMWGTPTDAEWA
                     AHDPYALAEKLKGTSIYVSSGSGLAGPNDIPSGIPGVSTNWTGMALEVLSRLSSLQFV
                     AKLNKLSIPVQINYRPSGTHSWPYWDFEMRQSWPQAAAALGVEAAKPDCAAGGEILVA
                     ALGKSWLGDCLTGEFPVAGGAVQDFRGGRVLWSAATGAHAVGGMIAGAYQGAAGPGGA
                     LGFPTTDESPIPGGGVRQDFQRGYISFREGKAEIHAS"
     gene            420510..421544
                     /locus_tag="H0264_01895"
     CDS             420510..421544
                     /locus_tag="H0264_01895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008712104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="QLY31168.1"
                     /translation="MAAQGVTSCPDLGSNRKAIRRTRVRRGWRRRLLTVAAAVIALPG
                     LAGPALALPAHTPVHRTPQGGFEELMVPSSMGPVKVQVQWARHGGDAALYLLDGLRAR
                     DDFNAWSFETNALQLFAEDDVTLVMPVGGQSSFYTDWRMPSSTNGQKFTYRWETFLTE
                     ELPAFLEQYGVSRTRNAVAGLSMGGSAALALAAYHRDQFKHASSFSGYLNISAPGMRE
                     AIRIAMLDAGRFNVDSMAWPWSPAWLRMDPFVFAPQLRGLPMYISSAWGIPGPYDNPE
                     GPVGYFNTVNAVALEALSMVNTLSFMTRLNNLDIGARYALQTRGTHSWGYWQEQLGAA
                     RPDILASLGL"
     gene            421854..423800
                     /locus_tag="H0264_01900"
     CDS             421854..423800
                     /locus_tag="H0264_01900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="QLY34056.1"
                     /translation="MATPIQVQLLLPRDWRAKPDARYPVLFMLDGLRATDQESGWTKD
                     AGAAGFFADKDVLTVLPVGGQSSFYTDWLQPDNGHTYKWETFLTKELPPLLESQWRAT
                     NVRGVAGLSMGGTAAMMLAARNPEWVRHAASYSGFLTLTTLGMPQMVNFAMRDAGGFN
                     STAMFGPPDSPEWKAHDPYELADKLKGKSLYISSGSGTAGATDAPADLPIPGITTNYA
                     GMGLEVLSRLSSQNFVAKLEDLSIPVQVNYRPSGTHTWPYWDFEMRQSWPQTAAALGV
                     DNTAATCSLAGAIGAAAQANNWLGDCLTGEYQSNNGVAQDFRNGQVFYTPAAGAYPVG
                     GAISGSYAGLGGPDSGLGFPTGAERQLPDGRGRFQPFQSGNIYWTPQTGAHMVRGAIL
                     DEWGRQGFERGPAGYPNGSEIRTPNKDGVVQGFENGPMYFSPKTGAHMVQGLILGKYA
                     QLGFENSPYGFPVAEEAALKDLGRYTSFEGGNIYWSPLSGAAGVRKGLIMDAWGAQGF
                     ENGFLGFPIADEGAVAGGGTQQTFQGGSILLKDGKAQVFGHDGKPIGPPVSAAPAAKP
                     APQPAQATQPNPAPAQPQNQIPATQQDTAPAPQNPVQATQPNADQAVPTAPAPAAATT
                     SDPVPALPPITLPSMPAAPLSNPE"
     gene            424014..424550
                     /locus_tag="H0264_01905"
     CDS             424014..424550
                     /locus_tag="H0264_01905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF732 domain-containing protein"
                     /protein_id="QLY31169.1"
                     /translation="MQRTRGKVLGVVAAVAATAGLLAACGDNDSTATSTPTLAPTTTK
                     PAASSTPGGESPADPSTSEQPQAAAPTTTVAVERPQPVPSQFVTTPSDSPALSDRDKA
                     FIEALKAKGITPATSDIAITAGNLVCQGKSQNAPEDQIITYVTAIAGSDPSFDESKMS
                     VEQAGKIYYDVATSSYCQ"
     gene            424547..425530
                     /locus_tag="H0264_01910"
     CDS             424547..425530
                     /locus_tag="H0264_01910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008712110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cutinase family protein"
                     /protein_id="QLY31170.1"
                     /translation="MTTRRRNGKRRTPLPVKLLLTLLIIGAIIIAILLIWSLAAGLLR
                     PPKPTPPGKEEPTSQPADCPDVFLLSVPGTWESNSNDDPYNPSANPVSLMLNISNPIR
                     ERFPNERLEVYTVPYVAQFSNPIAVPPDGQASYNVSRTEGTGRATARLKEVYDHCPLT
                     TYVFAGFSQGAVIAGDIAESVGAGKGPVPANKVLGVMLIADGRRDVGQPGQATEIGQS
                     PGGVGAEVALKGFNMLGITMTGPRSGFGDLTDRTYTICAPGDLICDAPKNALAPVNVL
                     GSIGTLVKAVGNPVHSLYNGFVVDDNGTTATQWTVGWATGLIENAPHPAHS"
     gene            425934..427856
                     /locus_tag="H0264_01915"
     CDS             425934..427856
                     /locus_tag="H0264_01915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-binding protein"
                     /protein_id="QLY31171.1"
                     /translation="MDETFDDYLDETGNITIPEGRTLVDYVEKHTHGNDADDLAYRYI
                     DYSRERDGEYQDLTWSQFGTRLRAVAARLQQVTKRGDRVAILAPQGLDYVISFFAAIY
                     AGTISVPLFDPDEPGHTDRLHAVLGDCTPAAILTASSSAAGVRQFFRALPAAQRPRII
                     AVDAIPDSVGESWVRPDIAVDDIAYLQYTSGSTRVPAGVEITHRGVGTNVLQMVNALE
                     LTENSRGVTWLPLYHDMGLLTVILPAVGGKYITIMSPSAFVRRPSRWIQELAAVSDGA
                     GTFAAAPNFAFEHAAARALPKQGETLDLSNVIGLINGSEPVTTSSMKKFNEAFAPYGL
                     PKTAIKPCYGMAEATLFVSATRHEDEAKYIYVDRNELNAGRVVKVDQSAPNAIAQVSC
                     GYVALSQWAAIVDGDSIDSPEGARELPEGRVGEIWLHGNNIGIGYWGRAEETQKTFRN
                     RLVHRVETGSHAEGVPADGNWLRTGDYGVYIDGELYITGRVKDLVIVDGRNHYPQDLE
                     YSAQEASKALRPGFVAAFAVPANQLPAEVFAQDSHSGLKFDADDASEQLVIVAERGPG
                     AGKADPGPIADAVRAAVSSRHGVTARDILLVPAGSIPRTSSGKIARRACKAAYLEGTL
                     RGGYTQQAFPDAPDEE"
     gene            427999..433158
                     /locus_tag="H0264_01920"
     CDS             427999..433158
                     /locus_tag="H0264_01920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase domain-containing protein"
                     /protein_id="QLY31172.1"
                     /translation="MAENEGMVPNQTTDDAPVPDAASKPAAAGADMTVAEMREWLRKW
                     VADATGQPLDAITVDRPMEEFGLGSRDGLALGGDIEELTGVVLPVTVVFQHPTIASLS
                     ERIINGEPEVPDEANDESFYTQGYQPGEAHDVAIIGLSTRLPGAGDTPESTWDFIINR
                     GDAIRDLPEGRWDEFKGDPRAAAAIAEANTKGGYLDQEVVKSFDAEFFAMSPMEVERV
                     DPQQRLAMELTWEALEHARIPANTLKGQPVGVYIGSSGNDFQLLAAMGLNKERDENTP
                     VSVEAYAIMGSVSAIIPNRVSYFFDFHGPSVHVDTACATTMTAVHEAVRALRNGDTHL
                     AIAGGVNMLLAPLGSLGMQANGAFAKDGRIKAFSSDADGMIRSEGGGLVVLKRLADAE
                     RDGDKIYAVIKGSAVNSDGRSNALFAPNPVAQAEVLRLAYRDAGIAPSTVDYIEAHGT
                     GTPIGDPIEAEALAKVVGRGREAGKPALLGSAKTNFGHLESAAGAASLAKAIMAFQHN
                     VIPPNINFEGPSPFIPWDQANLEVVTEPTEFPRYSGKATIGISGFGFGGANAHVILQE
                     YVPSQPAAPAEVDPIAEAVGLDTESTGVLTEAEKILEAAAPEPEWVNREEPLPLILPV
                     SAYLPSRRRRAAKDLADWLESDKGKNTPLEDVARALAKRNHGRSRGVVLAKTHEEAVA
                     GLRAIAEGKPGNGVFTADAPVAEAPLWVMGGFGAAHRKMGKQLYNENSIFRKALDEVD
                     ELVQDEAGYSVTEMILDDAQDWDVGTGQVGTFAIQVGLAAVLRAHGAEPGGVVGHSMG
                     EVAGAYISGGLALEDAVRVICSRSRLMGEGEAMLTDDQVRFMAIVEHSAEEVAELQKE
                     FPDIEVSVYAAPTNTVIGGPPASVEAIVKRVEEAGKFARILPTRGAGHTSQMDMLLGE
                     LAAELAGLEPTKLKGALYSTVHQDTVYPAGHAPVHDVDYWVMNMRGSVYFTNAIKQAV
                     NAGITTYIELAPHSVALMQVLGTTFAMGVHNAALIPTLKRKEDESAAVISALAQLYVQ
                     GHSVDLFSLLTPGDYADIPRTAFIRKEYWPKVGVTSGSAGNGFIPGAHVALPDGRHVW
                     EVQAGIVSDLGALVTAAAAQVLSDVTLGASVTHGEMPSTGTLTTTLTPHLGGASVSVH
                     AKEGNVFRPLFDAVVTSGDPLPESVAVQQVSKPAVAPAAEVEVAETPGERWDPNGKQT
                     IEQRLAIIVAESMGYAVEDLPMEIPLMELGLDSLMAMRIKNRVEYEFDIPQLQLQAVR
                     DASLLEVGKVLRYAIEHRDQLEEIAARQAAGEDITVDADFVSAARAALAAGGDPAALL
                     PKVETTDPVAEAEEIVEAAAAEPVTADYEASAPIAETDADNVPPRNAPERLAFATWAL
                     VTGKTAGGIFNPLPELDDATFEKLVARLSERVQAEIPAADVRACKTIERLAELVASYQ
                     EHGNDVEGFVRTLRAPQAGSTSVPVFVFHASGGNTLAYDALVKRLPADTPVFGFERVD
                     GSIEERARQYIPEILKRNPEGPYVLYGWSLGGVFALKVAELMRADGHDVRVVGLIDVA
                     LPSQPHVDTPEERVNRIRRFQSFAQKTYGFSGELDDEQLEELAAASDEEQIEIVLQLV
                     KFAGVDIPGGVLEHQRTSFIDGGELYRLSPMRYEGHVVLYLADRYHDGIIELEPRFGE
                     RLPNGGWDDHISDLEIIHIPGDHLQIIDEPRIATIGADLTKKLEEINTESK"
     gene            433212..434756
                     /locus_tag="H0264_01925"
     CDS             433212..434756
                     /locus_tag="H0264_01925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016692631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA carboxylase subunit beta"
                     /protein_id="QLY31173.1"
                     /translation="MSTTAEKLADLRQKLEVAREPAGAAGVAKRERKGIPSARDRINM
                     LLDPGTFVEIGALVRNPGDKNALYGDGVVVGHGLVEGRPVAVFSHDQTVYGGSVGEMF
                     GRKVAYIMEFAAKVGCPVVGINDSGGARVQEAVTSLAWYAELGRRQEPLSGLVPQISM
                     ILGSCAGGAVYAPINTDVVVATEQAYMFVTGPKVIREVTGEDVSLEELGGANSQAQYG
                     NIHHVAKDEAAAFQWVRDYLSFLPSSCQELPPIVNPGLEPELTDTDLELNGIVPDADN
                     AGYDMHEILIRIFDDGDFHEFGESAGKNVICGFARVDGRSVGVVANQPMVYAGALDAR
                     ASDKAAHFVRICDAFEIPLVFVVDTPGFLPGVEQEKIGVIKRGGRFIFSFVEATVPKV
                     TVVIRKSYGGGYAVMGSKQLGADVNLAWPTARIAVMGAESAVSLIGAKSLEAAPEDQR
                     AAMRQQMIDFYNATVATPWVAAERGYIDAVIEPATTRLEIRRALHLLRDKKQARNPRK
                     HHLLPL"
     gene            434818..435015
                     /locus_tag="H0264_01930"
     CDS             434818..435015
                     /locus_tag="H0264_01930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31174.1"
                     /translation="MSSSPKALLEGGPDGLPTRIVPITPPGIELRVAHNGGYERFKVT
                     PRWQETPEGSLPVYEWVAHID"
     gene            complement(435025..435786)
                     /locus_tag="H0264_01935"
     CDS             complement(435025..435786)
                     /locus_tag="H0264_01935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020666053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QLY31175.1"
                     /translation="MVNVQLGDVATWYNVHGDGEPLVLLHGGFVDSRMFQPALPMLVD
                     RFHAYRVDRRGHGHTPDVDGPMTYDGMADDMIAFLEKVVGEAAHLVGHSDGANVALMV
                     ALKRPDLVRKLVLISGNFHHEGMLPGVLDGFDSPETIEFLGSRYGEVSPDGEDHYPVV
                     VAKIIEMGRTQPTLTSADLAGVRARTLVVSGDDDAIALEHTLELYRGIPDSELAVVPG
                     TSHLLVMEKPERVYPLIADFLLNDPVPTRQPIRRA"
     gene            complement(435856..436287)
                     /locus_tag="H0264_01940"
     CDS             complement(435856..436287)
                     /locus_tag="H0264_01940"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31176.1"
                     /translation="MSDQLLAEAHRFLDWARAEGARLDGSDLSVLFVQGVVESMAEDT
                     EEAPSLRAVKLLGYSVYLAELLARTCPGVRCVIDGEGMRLDDVRAVDDAGVVQFTLNW
                     IYNCLDDPDGDDLGFKFICALRDFGELERARHLKDLLGYEG"
     gene            436513..437229
                     /locus_tag="H0264_01945"
     CDS             436513..437229
                     /locus_tag="H0264_01945"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31177.1"
                     /translation="MAIHKYGGRRTGSRNGGSALVHSEHRIQQRANAVKLNRLAVTAL
                     IAAASTAIVAGVANGAPAEPTHGTDSGVDYVVSSPAAGESSIRVAVTGGHFAMNGDSL
                     DISNNSGQLIGQVPLTFRMADRVVSFTAQLTDSDQAVTIASAGSTETAADIAQEPLTS
                     EQRMYCWNATLGTTVGVIIGILIGAPFLVLPGMLAGIIIGGLVGMGIAMSAPMPGMPS
                     DADLISKYFRCQQGMSPFGG"
     gene            437330..437773
                     /locus_tag="H0264_01950"
     CDS             437330..437773
                     /locus_tag="H0264_01950"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31178.1"
                     /translation="MDRETFLTRISMGILAIVLGVLGIVVAVFWGLSIQGKTMCGFDE
                     MRSGDKCIVTRGGESETRSYDEQKATGPAEPVLIGAIAGFVVFGGAIWILTTIRGKNP
                     QPSAANVTPTPLDYYNMQRYGIALPHQPAPPAETPPPGQWRAEQR"
     gene            437874..438419
                     /locus_tag="H0264_01955"
     CDS             437874..438419
                     /locus_tag="H0264_01955"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31179.1"
                     /translation="MSRQVGKAGLAQVVHALTDPRFGVCFDNVEWMELAKPVVALGGD
                     WPAALALAAMTSIRRPSVDQAVRHLRVQSGQDMGALPAPGFWDAVCGLVGRSWRLGIL
                     DEFTATVRLDRVWWHIRDHEPQDRAEELIWEGMACFELDHFVDMDMTNRALALLVEAD
                     QLIPDNAVDTAFCETVLETFL"
     gene            complement(438826..439308)
                     /locus_tag="H0264_01960"
     CDS             complement(438826..439308)
                     /locus_tag="H0264_01960"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31180.1"
                     /translation="MAIGELQRAALFEIVELWSPFVDESRSDLAAVLDDDDDQGPEGV
                     LVDSLRGYCLTYCDWKSDPPEIRSYLERLPLCPPELTWEWYDWNDQGRWDPDDLRKFL
                     WPLADRCLTLGVAVVGVYVDGDGFTLGFIGVDKLDRLLKLAATAEAKIYVHRTGAPLP
                     "
     gene            complement(439574..439840)
                     /locus_tag="H0264_01965"
     CDS             complement(439574..439840)
                     /locus_tag="H0264_01965"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31181.1"
                     /translation="MATTVTGLTHEDCGTIGFVLSCLFDQVIDMAELRTWCEHVIITN
                     AMEDIPQYIFDLASVDDISKVSGVPSDSDRRMNSHRRKMLRSTA"
     gene            complement(440358..440540)
                     /locus_tag="H0264_01970"
     CDS             complement(440358..440540)
                     /locus_tag="H0264_01970"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31182.1"
                     /translation="MTYERSVLKHERGQFHQAMEYAGTIRSMLWSHRNCVAGNGDTAE
                     SCSRRTYLLEIRHQNG"
     gene            440926..441804
                     /locus_tag="H0264_01975"
     CDS             440926..441804
                     /locus_tag="H0264_01975"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="QLY31183.1"
                     /translation="MDFGNFMKGLREKAPHPAQGAAALHLEISRQVIIRLEEGTPTKL
                     GTIHIRSLLDFYEATPDERTAALALWQEVRDQDKTAKAQGNSKGFWKAYSDQVAPNFP
                     KFLRLEGAADRIFSHQLVIVPGMLQTPDYRRAIIRMTEPGLSAVDVERRVELTARRQT
                     RLDERDFSLNVVLSEAVLRHQPGVPSVMAAQLRSMIEVGERDNVSIRVVPYSVGPHAG
                     LAILAFTLLGFPKGASGLSLPPVVFVEGAIGSMFHEHADEVGQYQQAIDGLRAVALTE
                     QGTRELLLQVAKEYAA"
     gene            441801..441989
                     /locus_tag="H0264_01980"
     CDS             441801..441989
                     /locus_tag="H0264_01980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016699533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF397 domain-containing protein"
                     /protein_id="QLY31184.1"
                     /translation="MKKSVRGEWYKSSRSEGAKQCVEVYHADDAVGVRDSKNPGGPEL
                     FFTGEQWDRFIAGRIWEH"
     gene            complement(442083..442886)
                     /locus_tag="H0264_01985"
     CDS             complement(442083..442886)
                     /locus_tag="H0264_01985"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31185.1"
                     /translation="MPDLRNVDIHIRSTSNASDRGFLALADLHSATAHLDASTYRIIG
                     GHMVQMLQHAYPLQDWQLRGTADADAGIDNQTLVATQAHLDEHLLRLGYTLQSGNRYS
                     RASGTGQLDVDILVAYGRPGRTMTDRSVEIGNRTMDSAPGLHLAIEADALLINATVDL
                     KSTEQIQFRVPIPDVEAAVILKALTWKSRMEGKDVADLATLFEITHQHRPALRTWKLE
                     PTARSTRGETIVALRLLVQNLDQGRWREALTGKASTARLASLIRAHAGL"
     gene            complement(442879..443871)
                     /locus_tag="H0264_01990"
     CDS             complement(442879..443871)
                     /locus_tag="H0264_01990"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QLY31186.1"
                     /translation="MVDVRSDLLSLLRHAGVHVAAGTHEELLLKTPDDRVVAVQIKAT
                     QRRLTLATIAPAMAAQQSHPSQVRLLYIASSASDESVAAAAAGAFDLVTTDPPRVVIA
                     GQVLTEAPEPQSWSSDRRPAWGQWAILRVLALSTRPLRQNELSTIIGISQQAVSHALR
                     KMPGVTQTRNGTLAADGALDMWGHDYPGPGGTVSHWYGLDDPSTQVTKAHQLLDELEL
                     PSVVSGDIAADTYAPWQLPTSVRLYVPEIIDFTPIGFSPADPENATMSVAVPEDPTVM
                     HTAAMLSANPRTDRHHLADAAITWWDLLHTSRSTTAREAADRLKTEIATGAFGA"
     gene            complement(444034..444429)
                     /locus_tag="H0264_01995"
     CDS             complement(444034..444429)
                     /locus_tag="H0264_01995"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinosyltransferase C-terminal
                     domain-containing protein"
                     /protein_id="QLY27532.1"
                     /translation="MPKMQTLDSVIGHDQPVLLDWAVGLQFPCQQPFNHLNGVATVPN
                     YRILPDRPLAITSTNTWQAEEFGGPLGFSEMLASSQTIPTYLKDDWARDWGSLEKYTQ
                     YYSDAKPAELQTSTETRSGWWSPGKMRVF"
     gene            complement(444399..445565)
                     /locus_tag="H0264_02000"
     CDS             complement(444399..445565)
                     /locus_tag="H0264_02000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016692634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinosyltransferase C-terminal
                     domain-containing protein"
                     /protein_id="QLY34057.1"
                     /translation="MATSRLILGWAAIVLPVLAASALALRTVMNDGSSKKALILVALG
                     AIASVVVWILLRNNGKGLTALAAVPLTVIAALMVAIEVLSMAKGAISQYPAYSLARSN
                     FDALGGKACGLANDVLVESDVNGYNLTPIIDPANPPKDGDPLAGVSPVGFSPNGVPEK
                     LDADNVEVKPGTGNTATQTVGPAFEEGQNAGTGGGKGAEGVNGSTVKLPFGLDPATTP
                     VMGSWQDGVQQPAVLTSSWYELPARAADKPLIVFSIAGRVMSFDQVGNMTYGQELFLE
                     YGRRNPDGTVDYLGKYRPLDVGPAPSWRNARVPMDQIPANADVVRIFARDPILIGDQW
                     LAFTPPRITPASPWTKSPPTPTWSASSPATPSSSATSGSPSPRPACRRCKPSTA"
     gene            complement(445593..447644)
                     /locus_tag="H0264_02005"
                     /pseudo
     CDS             complement(445593..447644)
                     /locus_tag="H0264_02005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012691130.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="arabinosyltransferase domain-containing protein"
     gene            complement(447871..451128)
                     /locus_tag="H0264_02010"
     CDS             complement(447871..451128)
                     /locus_tag="H0264_02010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinosyltransferase"
                     /protein_id="QLY31187.1"
                     /translation="MRADTRAFHRIRLIALISGLLGFLLAVITPILPVKQDRPTLVWP
                     QGTTASVEAPLVSYVPLDMSVQLPSSMWFGAGLPSGTTVFSTVPAASGKAVDKGLVVR
                     LADDPEQGRLVEVLVRNIPLVSVPESKLVDFSTILIHSDATATRVEVVGAAGEADAIK
                     GGVDGDSRPQVVGMFTDLSTEQIRTAHAEVHIDARFSSSPSLIKRLAIIGAVLFTVIA
                     LLALHMLDTSDGRKPRRFLPAHWWRIRLADVVVVGTLLVWHVIGANTSDDGYILNMAR
                     ASKDSGYMANYYRWFGVAEAPFGWPYEVLAWMTRISDASPWMRLPALLAGITCWLVIS
                     REVLPRLGSRVRRDNVAVWTAGLVFLAAWLPYDNGLRPEPLIAAGALLTWCSIERAIA
                     TGRLLPAALAVLIAAFSLAAGPTGLICIAALVAGSRPVLQVIIKRAQGQGSALLRFGA
                     LFAPGVAAGTLVLVVVFADQTIATVMEATRVRTLVGPNVAWFDERTRWDSLLMLSPDG
                     SLARRFGILAMLLCLIVCVAVMLRKNGRIPGTSRGPSTRILGIIFMSLFLMMFTPTKW
                     THHFGVYAGLAGSVAALAAVAVGVNGIRSPRNRTLFAAAVFFLLAITFTGPNGWWYVS
                     SYGVPWFDKAPVIAGKGFSTGFLGLAVLCLLIAAYQHYREPYTQPKPVRGFDKFASMP
                     LTIAAAVLVLFEVASMAKGAVTQYPAYSVAKGNIEALTGNRCALADDVLVETNTADSL
                     LQPWTGAAADGLAAENTGFTPDGVASDLTADAEETVMGGANSVGKDSDNKTTNTTGAG
                     TGGGTSEQAGINGSTVSLPFGLQADRTPVLGSYSEDEQQVSHLTTQWYRLDLSQSMRD
                     DPAYRVLVVTAAGRIKSIDKDGVETYGQDLWVQFGNRDDAGNFTELAKLRPIDIGPNP
                     SWRNLRVPIDQIPVQANAVRVIVDDRDITPRQWVAITPPRLPKLATLNSVVGETAPVL
                     EDWHVGLAFPCQRPFDHHDGVAEVPEWRILPDRVGSDASNAWQDDIGGGPLGWTGLLL
                     KAQTIPSYLDDDWHRDWGSLEKFTPYVPDASPRPELKVTVETVSGLAKDAPIKAR"
     gene            451323..453374
                     /locus_tag="H0264_02015"
     CDS             451323..453374
                     /locus_tag="H0264_02015"
                     /inference="COORDINATES: protein motif:HMM:NF012298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="QLY31188.1"
                     /translation="MSELRPGEVIAGYVIARRIGAGGAGVVYAARHPRLPRVTAFKVL
                     KRDDYTVDDDAWRRFEREADIAAHFDHPNIVQVYDRGLDADRLWISMQYIDGTDASEL
                     KGLAPERALRIGAEIAAALDYAHGKGVLHRDVKPSNILLAAPDNGRPERALLTDFGIA
                     RLHDETTALTRTGNISATFAFASPEQVSDQPLGPQSDQYSLACTLFVLLTDQRPFSAN
                     NPLGWVHAHTMKPPLRISHVRPDLPAALDPILDRALAKEPQHRYATCVEFLQAAVNAY
                     YGDSAVTPTAQSVIPADWQATTQVTAPLGVSRQSDPSQPSTPAVSWPGNSISGATPPA
                     SGPTTSMPGSPIPAAAGPPPVHPDGGRRNPAQPSRFRTRVLVLVAVAALAVAGGVGAA
                     FLLRDKGSAAPQAVPDKFLGTWLATEGKTSYRLVVQQGKPGDTVLASTVDGVLGNGAG
                     FHCEFSAPFTEAPAGGERLLVGQSEIITSTPSNACKANAPTTLNLLEDGRLSRKTDVS
                     GLITYSRAADLAQSWGEHSAIAQAFPSLVGKLAASGRSVGWQGASCLKRDPSPTDAAT
                     AQGARRILCNPSDDSGQVRFDFFDFGARPAQSAAAMFFDGTASTTTVTHPDVAGELTI
                     LTEPGVNRATQADSDANRILIAITFPDSDFRSRFVLVVRWPGHTVDDVLNTWLAGAPL
                     K"
     gene            complement(453402..453953)
                     /locus_tag="H0264_02020"
     CDS             complement(453402..453953)
                     /locus_tag="H0264_02020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016907413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="QLY31189.1"
                     /translation="MRDLIVTENITLDGVIDATGGWFAVAEGPDESDQVEAVREQFEA
                     ADAVLFGRVTFEEMRGYWPVQTGDTTGVADYLNKVDKYVTSHTMGDPQWENTTVLRGP
                     LVDEIRLLKSMPGEDIVCTGSITLVHSLVAAGLVDEFRLFQHPVVLGQGARLFPDGVM
                     LPRLRLAEARAFRSGVVLMRYRG"
     gene            complement(454050..455861)
                     /locus_tag="H0264_02025"
     CDS             complement(454050..455861)
                     /locus_tag="H0264_02025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="QLY31190.1"
                     /translation="MVEVLDRSNRTITPAESTRLQRFTGRLRYARADVAVAAVYLTLA
                     ILVLSGQWRHPGSGYLIKSGQDQTMWEWFFAVTAHSVAHLENPLGTNLQNFPDGVNMM
                     ANTAMFGVSVPLTPVTLLFGPTVTFVLVLTLGLFGSAFAWYRLFSSEVVSSKFAAAVG
                     GLVCGFAPAMISHANAHPNFVVLALLPVIALQLIRMVKRTGTERKARRVRNAVVLGLL
                     VAVQIALGEEPLLIFALAFGLFTVVYYLHSPRTGMRAVRAVTPTVLWAGLITLACTAI
                     ALWWQFFGPQSYRSIDHGPMGNDLKALFQFPSESLGGLLLHGQNVAINPTEENSYFGW
                     PLLLLVAVTVAFLWRERIVRAAAAVIAVFTLLSLGSTLVIGKDDTGITLPWSWMEHVP
                     LLNTVLESRLTMAAIPAIALILAVATQRAVDYWRESATDWRPLGWFAALFLALLPLTP
                     TILPVVQRAPTPAFFTDGTVRQYVSGGSVVIAPPPSPPDARALRWQVDSGFEFPLAGG
                     YFVGPTGNDKKGSYGPDARPTAALLTKAQQADQVPVITAAEQRQALDDLRFWRADVVV
                     LPPTDHADVLRRTVDELLGIPARYVDGVWLWDVRGLA"
     gene            complement(456023..458068)
                     /locus_tag="H0264_02030"
     CDS             complement(456023..458068)
                     /locus_tag="H0264_02030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006932743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactan 5-O-arabinofuranosyltransferase"
                     /protein_id="QLY34058.1"
                     /translation="MTPLLRQAGSAAGEAVLGAVVAAVVAGVGLVAFSTVEWPAFNAS
                     NVLRALTTVGQVVALGMLVAAIWLIRVKKWPWVAKVLAWGGLSGFVTVTLGMPLAATK
                     LYLFGMSVDQEFRTQYLTRLTDSAALHDMNYIDLPPFYPAGWFWFGGRFANLTGMAGW
                     EAFKPYAIIALAVAAVVAYVLWSNLIRADWAVAVAAATTAVTLAYGAPEAYGAVLVLL
                     FAPALVLAWGALHRPAALTARTVLAGAGETHEDSETRTAGGWGAVIGVGLFLGLSAAF
                     YTLYFVVAVFSVCLMALIAAALMLRERRRALRTQRHRDAAARSTAGGQTGDAATPSAV
                     VPGAWAELWPILVRLITIGAVAGVLALTVWMPFLVKFLRGEASFAGGSAFHYLPETGS
                     ELALPMFQFSLVGAFCLIGTIWLVLRVGSSRRAQALAIGVVAVYLWSLLSMTATAAGT
                     TLLSFRLEPILYSLLAAAGAFGFVEGARAVYQVLNEPERMRPVVAAVAVLGAVAFSQE
                     IPHVLDAEITTAYTDTDGNGVRADKRPPSAVSHYAKIDAALRDQTGRPRDASVVLTAD
                     TSFLAIYPYYGFQALTSHYANPLADFPGRTAEIKRWAGLKTPEELIQALQRCPWRAPD
                     AFLFRNAGDQYTLRLSEDVYPNDPNVKRFTVAFPKALFEDARFQVTDIGPFTLVVRR"
     gene            458237..458413
                     /locus_tag="H0264_02035"
     CDS             458237..458413
                     /locus_tag="H0264_02035"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31191.1"
                     /translation="MSEHQVDREMWEQSKAVDAMLGITEEWMYNEICLRDAIRAEFAL
                     KGRIDDTITGSIHP"
     gene            458410..458628
                     /locus_tag="H0264_02040"
     CDS             458410..458628
                     /locus_tag="H0264_02040"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31192.1"
                     /translation="MRTTEKLTVTVAKPVAGAARAEAERSGETLSALTNAALREYLIR
                     RAVADEPETDREWLEAAARTIVEDEAAR"
     gene            458649..458924
                     /locus_tag="H0264_02045"
     CDS             458649..458924
                     /locus_tag="H0264_02045"
                     /inference="COORDINATES: protein motif:HMM:NF014505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system PemK/MazF family
                     toxin"
                     /protein_id="QLY31193.1"
                     /translation="MLILGRVERIVLVVGHDTVSESRNDVLCVQVQQAAGKESLLAVH
                     VSSPVEGFARAVTVAPIPKTSFVEQLGQLDAMVMEQVDTALRATLDL"
     gene            complement(459026..459787)
                     /locus_tag="H0264_02050"
     CDS             complement(459026..459787)
                     /locus_tag="H0264_02050"
                     /EC_number="1.1.1.333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005248822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decaprenylphospho-beta-D-erythro-pentofuranosid-
                     2-ulose 2-reductase"
                     /protein_id="QLY31194.1"
                     /translation="MINAVGNPQSILLLGGTSEIGLAIVAEYLKKGPARVVLAALPGD
                     PLRDEAVATAKAAGASEVEVIDFDALDTDSHPKVIDAAFAHGDVDIAIVAFGIDGDGE
                     IFWQDQRKAVMMAEINYTAAVSVGVLLGEKMKAQGFGRILAMSSVAGERVRRFNFVYG
                     STKAGLDGFYLGLGEALAPFGPRVTVIRPGMVRTKLSAHAKENGLTINKEDVAALAVS
                     ASAKGKEIVWAPGQIRIVMAILRHIPRVIFRRLPV"
     gene            complement(459784..461262)
                     /locus_tag="H0264_02055"
     CDS             complement(459784..461262)
                     /locus_tag="H0264_02055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="QLY31195.1"
                     /translation="MSTKAQTTTTAAAEQKPAGEGADTASSGSYELPTQTRRLTGWGR
                     TAATTSEVLSTSDPELIAKAVAMVAEDNDSKPAHLRRGVIARGLGRSYGDHAQNAGGL
                     VVDMTPLNRIHRIDRDSRLVDVDAGVSLDQLMKAALPFGLWVPVLPGTRQVTVGGAIG
                     SDIHGKNHHSAGSFGNHVRSIDLLTADGQVQHITPKKNAKLFWATVGGNGLTGIILRA
                     TIEMTPTETAYFISDGIKTRTLDETIAVHKDGSEENYTYSSTWFDVISGPPKLGRANV
                     SRGRLAKLDELPKKLRKNPLKFDAPNLLTVPPIFPSISANKYTLGMVGEAYYALGGNY
                     TGKVMNLTQFYHMLDVVSEWNRAYGPAGFVQYQFVLPPEALDEFTKIIIDIQKSGHYS
                     ALNVLKFFGPGNQAPLSFPMEGWNICVDFPVRPGLNELVRDLDRRVLEFGGRLYTAKD
                     SRTDAATFHKMYPRIDEWIKIRRNVDPTGVFMSDMARRLELQ"
     gene            461448..461822
                     /locus_tag="H0264_02060"
     CDS             461448..461822
                     /locus_tag="H0264_02060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003420627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA family protein"
                     /protein_id="QLY34059.1"
                     /translation="MRFILTGGFSAIVDLGLYTLLFKVFGVPLPVAKSISFIAGTTTA
                     YLINRRWTFKAEPSRKRFIAVIALYAVTFALQVGINQICYYAIPSSWAESVRLVFAFC
                     VAQGTATVINFIVQRAVIFKIH"
     gene            complement(461848..462468)
                     /locus_tag="H0264_02065"
     CDS             complement(461848..462468)
                     /locus_tag="H0264_02065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase family
                     protein"
                     /protein_id="QLY31196.1"
                     /translation="MPGIRNGSDGERELQQRYGTEERADRFYEDQVRNRLNEHMIDFI
                     RRMDMAFIATSDKHGECDSSFRAGTPGFLHVVDDRTVAYPEYRGNGVMASLGNMLENP
                     HIGILMIDFVRDLIGLHINGTARIVDDTLMRRCVPDLPTQHERGRQPERWVVVDIEEA
                     YIHCRKHIPHLVPAVREARQWGTDNVRAKGGDYFRAKEEARALVEY"
     gene            complement(462852..463532)
                     /locus_tag="H0264_02070"
     CDS             complement(462852..463532)
                     /locus_tag="H0264_02070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020389490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="QLY31197.1"
                     /translation="MSRRGSRVTQFELLDALSPNEQREFIAACTPRRFRRRDIVCHEG
                     DPGDCLHLITTGRLIVRVTTPLGHTATLTILGPGEMFGEQALLSPDARRTATIVAVTD
                     AATLTLNRVQLERLRAEHPQVERFLTNSLAAQVRRLSASVLEALYLPVETRVLRRLSH
                     LARVYGDENGRPAQIRLTQEDLASMAGTTRATANKVLRELEEQGVVRLSRGSVTVLDR
                     ARLERRAR"
     gene            complement(463536..465926)
                     /locus_tag="H0264_02075"
     CDS             complement(463536..465926)
                     /locus_tag="H0264_02075"
                     /inference="COORDINATES: protein motif:HMM:NF012437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate/guanylate cyclase domain-containing
                     protein"
                     /protein_id="QLY31198.1"
                     /translation="MSAIRILVWAVHVALPAIGLWVLVANPHLDHEYMHQGVHFWLIL
                     GAALLSLALGVLLLRAARTHRDMRLILVSLVFQLNAGFLALHALATPGVILPSANVGF
                     TTAVPVGMVLGGFAALASAVEYGPTARIHKYTGVLAALPITVMSAWALLSLTRVPPFD
                     AVPDPSEVQGPLEAAAFLGAACYVAAAIRYAYLYLRNRGTVVLSVLTAFLLLAEALFA
                     VGFGRSWRVSWWEWHVLLGLAFALIAVSAHRTFRKEGSVRGLFDSVTLRSTVAAMERD
                     YASALEEMMTALSQRAAGGVPADEPLGAVGQRLSRRFGLTERQLAVLQQSARALGNER
                     EQVRRLGALVAVGERASVIRGERQLVTEIQRLAGYAFEHDTVRIGMLSGGRLIFEDGG
                     HPNPAAFAFPLTVKGIHTGVLELTRANGSGTAGSGTTGTTTSVGATAVPHPPAGSANP
                     PGPVTAAHRSLGVDGPREGPALPTAPARTVPAPGVAPGPGNSPGLGTARPVPGPGGGR
                     ARRGFGWRPATSAEEGGSGFHTERPPAGPEGGASVLAVYHEYGAAGLGPAEQAVARSF
                     AAQTSVVLENARLCQQLDGLFRSYMSPAVATALLADPSQAGLGGEVHEVSVLMADLRG
                     YTPFAEKAGPVQVMRMLNTYYGAIVPEILAEGGTVVQFVGDAVMAIFNAPVRQRDHAV
                     RAARAGLALQRATAAVRERAGAHGVEWPMFRVGVNTGPAIVGNVGAREMRNFTAIGDT
                     TNLAARLEGLAEPGTVVVGPVTRERLGARADTECLGDFDIKGKSLPVTVYRLVALR"
     gene            complement(465940..468123)
                     /locus_tag="H0264_02080"
     CDS             complement(465940..468123)
                     /locus_tag="H0264_02080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-dependent oxidoreductase"
                     /protein_id="QLY31199.1"
                     /translation="MTPVTDSSRTLLRTCPLCEAVCGLEVTLDSADHITAIRGDQADP
                     FSRGFLCPKGATLGHLDEDPDRLTAPMVRDRATDSWRAVSWDEAFGIIRERLPEITRA
                     HGNQAVGLYLGNPNAHTVAGALYVPLLIRALATRNLYSASTADQMPKQVSSGLMFGDP
                     LTVAVPDLDRTDYLLMLGANPLESNGSLCTAPDFPGRLKALKQRGGRFVVVDPRRTRT
                     AKLADEHLFVRPGSDAYLLFGIVHTLFAENLTDVRVEVEGLDEVRAAAAEFTPETVAA
                     RTGVPAETVMRLARELAAAPTAAVYARIGTCTAEFGTLTQWLVDVINVLTGNLDSPGG
                     AMFPTGAALGIVRSRPFRTGRWASRVRGLPEAMGEFPVATLADEISTPGDGQIRAMVT
                     VAGNPVLSAPGSSRLDAAFADLEFMVSVDRYLNETTRHADVILPPPRIVQAPHYDFAL
                     LQFAVHNYARYSRPLVPLGDNLSEAEVIARLALAVSGQEPTPGLDPLTVVDEIVIAGT
                     LHKAGMADRRTELLGENTTEQRIDMMLKLGPYGEWAGGTLNLQVLLDNPHGIDLGPLQ
                     PRLPGVLRTAGRKVELAPRQLLDDVARLRARLRAAAPEMVLVGRRQLRSNNSWLHNVA
                     PLVGGSNRCTLHMHPDDVARFGIDGQVVVKSAAGTLTVPVEATEDIMPGVVSLPHGWG
                     HSDSAQAVAREHAGVNANVLTDDSLVDAPSGNAVFNGVPVTLTPA"
     gene            468274..468765
                     /locus_tag="H0264_02085"
     CDS             468274..468765
                     /locus_tag="H0264_02085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020512267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31200.1"
                     /translation="MRFLDRTQALDALREAWEDVAAGTGSVVALTIAGEPGLFVRVAD
                     TPPPAPVANPHHLTTRQQDVLDLVCAGLTNAEIADYLVVSVRTVDHHVSAILRKLGVA
                     NRRAARALILDTHPIPLRPSGNPTRPRVPATHHNSRPLRVLRNTEELSRRIAALTERN
                     GAA"
     gene            complement(469208..469693)
                     /locus_tag="H0264_02090"
     CDS             complement(469208..469693)
                     /locus_tag="H0264_02090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31201.1"
                     /translation="MEKPVRTTFSSSVSAAAQEYMQRGWTVAETANGICLITDGDIAG
                     IEVTGDTAAFVRRFLRANDLTGPVIEIPGAERREIHLVTGVRKAAMAIEALRASGVIV
                     HADGAGIPLPPSRVATGPEGHASWAVAPHEARWVPPVVAISAAVRAAAKGVPVKARMA
                     S"
     gene            470033..470614
                     /locus_tag="H0264_02095"
     CDS             470033..470614
                     /locus_tag="H0264_02095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4282 domain-containing protein"
                     /protein_id="QLY31202.1"
                     /translation="MSDQSGSSAPELEEFEELETEGRWAAFKDAATRRMSRRVAEEAA
                     EPEPPVEPFASPSAFGSWAADAARALLDVQFQRAATRTLLPLTYILGLVAAFAVPISA
                     TVLLWRISGVLAVLFAVLLAVPLGLTIAATVRLLLEFVLNASRLATRVEHISEMGDDL
                     FQALSDVAEPVSQLSEDVRSVQFWRYRRRPARK"
     gene            470718..471590
                     /locus_tag="H0264_02100"
     CDS             470718..471590
                     /locus_tag="H0264_02100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="QLY31203.1"
                     /translation="MALPQGITGSTMPRRQLGRHLRDLRNRARMTTRVAAQRLEWSEA
                     KIWRIETGQTSLRSLDVEAMCRIYGAPEDAIEPLTALARETKARGWWTEYSDVIDEGY
                     EVYIGLEEAAAKLTSYENELIPGLLQTEAYMRAVLAVAYPGISPEQMDRRVRVRTARQ
                     ELITRAENPLQLDLVISEAVLWHRIGGEEVTAGQLDRLRKLAELPNVRLRVVPAECGY
                     HHAMDAGRFVLLEFPSAAGDPTEPPVVYVESLTGAAYLDKEHDVERYREAFAATAKLA
                     VDALPTIETIRDSI"
     gene            complement(471642..472055)
                     /locus_tag="H0264_02105"
     CDS             complement(471642..472055)
                     /locus_tag="H0264_02105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="QLY31204.1"
                     /translation="MPKPTTSVEQPTDPRTGAPGLVAEWRDLLARHATTSCALEKELQ
                     GRHHIGLSEFETLDRLIDAGCESYKMSDLANDIYLSQSALSRAVARLERDGLVSRTLC
                     TEDRRAIFVCLTDKGREVYEQAAPTHRAVLEQSLG"
     gene            472223..473617
                     /locus_tag="H0264_02110"
     CDS             472223..473617
                     /locus_tag="H0264_02110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QLY34060.1"
                     /translation="MLITLCIVLFLDGLDVSMIGVALPSIGSELNLETSTLQWLVSGY
                     VLGYGGLLLLGGRTADLLGRRKVFLIALAVFALASLAGALVSSGPLLILTRFIKGLAA
                     AFTAPTGLSIITTNFAEGPARNKALSIYTVFGAGGYSMGLLFGGLMTGLGWRWTFLLP
                     VPIALAALVAAFYLVPKDKPAEEGGHDLFGALLSTAGMLLLVYTVVTAPEVGWTSART
                     LGSFVAVVALFAAFVAVEKRVRYPLIRLGILKKGTLVRASLAIIAVGGSYFSWQFITT
                     LYLQDTLGWSPLKLALALLPVGLLVVASAFVSDKLVDRFGTGPIIAITMVIMGIGYLL
                     YLRIDTAPDYLTVLLPAVLLVGIGWVGFPAINIQATSGIDDDEQGLAAGVLQTAMQVG
                     AAIVLAVTTAIVTSGVHTDASPQAMLDTYRPGLEFAAGVAIVGALVALSVFLPKRTRR
                     AAAEKRELEVELVG"
     gene            complement(473726..474199)
                     /locus_tag="H0264_02115"
     CDS             complement(473726..474199)
                     /locus_tag="H0264_02115"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31205.1"
                     /translation="MAKRVRPPDALGIDITGRIPGLGTTVVGPDEAEWRPAPGAPERS
                     FEMAPLIGSYLRPEFYACYARWYPGWMSAPHTYEVDRFAVVSSGVWTVGAGAEIDLAQ
                     TIPMRAGEFSVRRAGTPHYDGALPEATEPAVFVLFGMGPAVPALADSSDSIYVRL"
     gene            complement(474240..474794)
                     /locus_tag="H0264_02120"
     CDS             complement(474240..474794)
                     /locus_tag="H0264_02120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008712150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase family
                     protein"
                     /protein_id="QLY31206.1"
                     /translation="MQIRELAVPGAWEFTPRLHGDDRGIFFESFKASEFEKAVGRPFD
                     LLQVNISTSAAGVLRGIHYTETPPGQAKYVTCVRGAFLDVVVDLRRDSPTFGRWDAVV
                     IDDVERRSVFLSEGLGHALLSLEDNSTVNYLCSLEYSPEFDRDLDAFDPELGIEWPTV
                     GRNGEPLTFIRSAKDAAAPRLADL"
     gene            complement(474799..475674)
                     /gene="rfbA"
                     /locus_tag="H0264_02125"
     CDS             complement(474799..475674)
                     /gene="rfbA"
                     /locus_tag="H0264_02125"
                     /EC_number="2.7.7.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase RfbA"
                     /protein_id="QLY31207.1"
                     /translation="MRGIILAGGTGSRLHPITRGVSKQLVPVYDKPMVYYPLSTLMLA
                     GIRDILVITTPEDSDAFRRLLGDGSRLGLNLSYIVQPEPDGLARAFVLGADHIGTDSA
                     ALVLGDNIFHGPGLGQNLHRYENLDGGAVFAYRVSDPTAYGVVEFADGKAISIEEKPK
                     APRSNYAIPGLYFYDNDVVEIARELKPSARGEYEITDINRAYLEQNRLSVEVLARGTA
                     WLDTGTFDSLLDAANYVRTIEQRQGLKIGVPEEVAWRMGFIDDDQLRELAEPLVRSGY
                     GTYLLGLLEHGRTWE"
     gene            475916..476986
                     /locus_tag="H0264_02130"
     CDS             475916..476986
                     /locus_tag="H0264_02130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014980999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QLY31208.1"
                     /translation="MVVHGNGIPVSSRVVQAAGSASPSAYALAARIPDDHPVENPQGI
                     SAYARALAMACRTMIRPMGELVPVNAISMAIAGPVINNLAKLRPAPSGVEREQVQLNG
                     FRMEIVRPAGARSSLNDGAVMYMHGGGFFLCGLDTHRPVVAAIARRTGLPVVSVEYRQ
                     LPQTDIAGGVDDCLTAYRWLLQHGVPASRIVFAGDSAGGYMTFATALRARDAGLPVPA
                     GLVGLCPALDLDCTEKRAHPNYHRDALIPLSALESVVKLGAARNGRLEPEMSPVNAAL
                     AGLPPTLLIIAEDEVLRRDSEIMAQRLAASGVPATLEIWRGQVHAFMAIFPGMPESRA
                     ALAHVAQFVRGCMDIAQEARTA"
     gene            complement(477061..477777)
                     /locus_tag="H0264_02135"
     CDS             complement(477061..477777)
                     /locus_tag="H0264_02135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019045350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31209.1"
                     /translation="MLMRKFAATSALVIAAMGITAGTVNAAPAAEPAANDAINYSATT
                     TETNTVIRTDAGSMVVEDGVFKIKAANGTTVAGTELKFRVDDFEFPIAADIAGNTATL
                     TPEFNVEHAVYKPVALPYEDQAPWKNDYEREQAAFNRLKDTIGMGATIGTLVGGIGGA
                     ALGCVLGGIAGATIASATIVGLFGPFVPAAVVGCIAGMGAVGFLGTLAGQLFITAPVA
                     ILAAVQYFTTVNSGMTPGKK"
     gene            478213..479217
                     /gene="rfbB"
                     /locus_tag="H0264_02140"
     CDS             478213..479217
                     /gene="rfbB"
                     /locus_tag="H0264_02140"
                     /EC_number="4.2.1.46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005253236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="QLY31210.1"
                     /translation="MRLLVTGGAGFIGANFVHQTVTRRSGVHVTVLDKLTYAGNRASL
                     APIAGQIEFVHGDIADSALVDRLVGGVDAVVHFAAESHNDNSLADPWPFIQTNIVGTY
                     SLLQAVRKHQVRYHHISTDEVYGDLELDDPAAFSENTPYNPSSPYSASKASSDMLVRA
                     WVRSFGVQATISNCSNNYGPYQHVEKFIPRQITNLIDGVRPRLYGAGHQVRDWIHVDD
                     HNSAVWEILQRGRIGQTYLIGADGERDNKSVVQLILEAFGRDPHDFDHVTDRPGHDLR
                     YAIDSSLLRTELGWEPEYRDFRKGLDATVDWYRENESWWRPQKAATETAYAAAGEKVL
                     "
     gene            complement(479214..480194)
                     /locus_tag="H0264_02145"
     CDS             complement(479214..480194)
                     /locus_tag="H0264_02145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019046152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34061.1"
                     /translation="MVLLVVVCVLLTPVGVAAIYLLRLNAGEPAADARTRGRDAIWLG
                     HAWVDGRKSDADIAQLGVLLSGTGIKDLYVHTGPLEFDGSLRESLYPNARWFVEAVHR
                     TLPGIRVQSWLGQVLAPEFDPGLDVEDAATRDRVVASAAKVLELGFDGIHFDVEPVRS
                     DPAGFLTLLERTRELTRSQGRLLSVSAPVIDPLPGLHSVGLALVDHGKWWSQSYFAEV
                     ARRSDQVAVMSYDTAMPTKALYGGYVAQQTRLALEVTPDSVDLLMGAPAFWADDAGHH
                     GAAETVSAALRGIRLGLGRTDPQRQTFGVALYVDFAATPQDWADFRRDWS"
     gene            complement(480306..481967)
                     /locus_tag="H0264_02150"
     CDS             complement(480306..481967)
                     /locus_tag="H0264_02150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2142 domain-containing protein"
                     /protein_id="QLY31211.1"
                     /translation="MTVRSERPAESDIVVTEASENDSTETQPDAAATANGSVETTVAQ
                     PKKIAAAQPDTKAEPGGLRGAVIRLERRFGSAALVFVLLAGVFGAIFSVVTPPFWGHD
                     EITQFGRAYQVAHGGFTPEKIPDDRGPAWGGYLPASIDALMTHAFEDYNNNTDEPDPM
                     VADRGAYDRLGAAAVGGPEKKVWFTNTAAYSPVPYLPQAAGIRIAEALDLSVGGTVLA
                     TRWAGLLAYLAIVGFAVRMLRGHRIQWLALTVAVLPIAVFQAGTVTADTVTNALALLV
                     SAVIVKALFLGDRLSKPETVAALAATILLPVCKPTYVLLAMLTVLIPARRFGFGNAER
                     PAAWQRALPWLCAVIGGVSFALWMRIAAPTGDGMSLMRPQKQWGTVKPGEQLKEILSD
                     PIQFLSTFGDSIARRDQRWFTQFFGELGFAYVDVPAITILASLLAFAVSLGIADRLTG
                     ARGATNVRTALVALTIAASVAMIYVTLYMSFTPVGYYIIDGVQGRYFVPLALLALTVI
                     LRWMPLRLTDARGRTPSRGPALTVIAATSIALLAAVIKYATIVWG"
     gene            complement(481964..482938)
                     /locus_tag="H0264_02155"
     CDS             complement(481964..482938)
                     /locus_tag="H0264_02155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014981004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="QLY31212.1"
                     /translation="MDSTELRIAAIVPCHNEEAAVAKVVTDLKAAVPGIVVYVYDNRS
                     TDATAERARAAGAIVRTEYRKGKGNVVRRAFADIEADIYLMIDGDDTYDASAAPQMID
                     TLLAGPYDHVLGVRREIEGESAYRAGHETGNKVLNGVVGKVFGENVEDMLSGYRVFSR
                     RFVKSFPAVSREFEIETELTVHSQHLRVPQTAVPVGFRDRPEGSESKLRTYHDGFKIL
                     NLIVGLARHERPVAFYGLFGTLLWLISIILITPIVVEFYRIHEVPRFPTLFLGFTLML
                     LGSLAWTAGLILDGIRRSRHEAARLIYLRYSAVGAEESAHEAANGSRR"
     gene            483055..483522
                     /locus_tag="H0264_02160"
     CDS             483055..483522
                     /locus_tag="H0264_02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA family protein"
                     /protein_id="QLY34062.1"
                     /translation="MTEPGTSLIDKVRALLRKGGAFLVVGLVGLAVDMGAYNALVFWG
                     GHGPLGDHPVPAKAISIAAATVVTYFGNKWWTYNDHEDSGDGRGILVYAVINLMAIGL
                     QLSCLGFSRYVLGLDSPLADNISGVFVGQAVAMVFRFWAYGKFVFTGTREQQG"
     gene            483649..485550
                     /locus_tag="H0264_02165"
     CDS             483649..485550
                     /locus_tag="H0264_02165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="QLY31213.1"
                     /translation="MDASAGQAVTEINDRQSAGAPATLRADHAAPERLVLARGVFTGP
                     APRISPELYAVVKGKSHRERMSLRLEKGSSAHTNTYFGRFAASYWQRWTHVTEVEVAM
                     TLETTGKVKVRLAASDIAGHRRVSDTAQVRETGRVVLKAKLDMFIDGGALWLEFDAVG
                     GDVTISDLEWSAAAPDHVRPVAIAICTFNRAEDCANTVAALASDPTVLGLIDAVYVVD
                     QGTDLVQDRPLFTETAPKFGDKLRYIRQPNLGGAGGFTRGLYEVSAANEHADVILMDD
                     DILCEPETVLRLNAFANLTVEPTLVGAQMLFLFNPDYLNVGAEETDLAKLRHGQKVPK
                     ALRNTSMLKKNQERRVDAGYNAWWTCLIPAEVVKKIGLPVPIFFQWDDVEYGLRAREN
                     GFVTVTLPNAAVWHADFYWKDFDDWARYFSSRNSLIVSSLHADLDPKAITRQLFREIA
                     EYLVGMQYGLAHTTLQGIEDYLRGPEALRDGGIEALAKARTSRSDYPETVKHPAATAP
                     VVNAHVHLRRAGGEPSRPLLILLKRALTQWTGRTIPGVVGITREDAHWWHIALFDHVV
                     VTDASQSGVRIRKRDKETARRLLRRAYKVLKQLRKELPTLQQRWRAAAPELTSRENWE
                     RLYGIDPRD"
     gene            complement(485702..486298)
                     /locus_tag="H0264_02170"
     CDS             complement(485702..486298)
                     /locus_tag="H0264_02170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014984283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QLY31214.1"
                     /translation="MAPPRKHDTDVILDAARTLVLTEGPRAASVAAIAAASGAPVGTL
                     YHRFGNRNGVLSAAWVRALERFQALVLSAAETEDPIEAAVGMSAASLTFGRDFPDDAK
                     LLLNLRPNDLLDGGPDTEFRERLNHMNAPLIEQVQRVARAAYGSAGAREMEAVARAVV
                     DLPYATLRRHAHTGELPEWLDADLVAATRALLASPLAP"
     gene            486320..486718
                     /locus_tag="H0264_02175"
     CDS             486320..486718
                     /locus_tag="H0264_02175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005143253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31215.1"
                     /translation="MERLPYIDQHSRLVAADRAHTWTALLRTTCKNPDDLNTLPHGFS
                     LDEADPPKRLAAEGQHRFSRYALTFTLEEVDSGHTRLVADSYGAFPGLGGRIYRALVV
                     GSGGHALIVRDMVRRIGVAAEKLARTERRS"
     gene            486715..487236
                     /locus_tag="H0264_02180"
     CDS             486715..487236
                     /locus_tag="H0264_02180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014350772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31216.1"
                     /translation="MIPGQVWGARPDELLAELPCDSELSGSVLVCDRAISVDAPAETV
                     FDWCCQLRVASYSYELLDVTWLLGAPLRRRPRTRSPELTDLAVGQRFMGVFDLVNFTP
                     GVQITLRADTVAVTYSVRPYVVGPGSRLHVRVCFSGPGLIAAPLAFGDFFMMRKQLLT
                     LKELAEREALSVR"
     gene            complement(487265..487732)
                     /locus_tag="H0264_02185"
     CDS             complement(487265..487732)
                     /locus_tag="H0264_02185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018546955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="QLY31217.1"
                     /translation="MASITSREDAVTTDPQAEGELSHAISRVARLHRGTAGQLLREMG
                     LYPGQELLLMRLWEAGPQRQTELIQLLGLDPSTVTRMVQRLEQAGFVTRRPHPEDRRA
                     VLVESSDAGNALRDKVGDMWGRLEKRTVAGLSERERRELARLLARVESNLGGP"
     gene            487811..488875
                     /locus_tag="H0264_02190"
     CDS             487811..488875
                     /locus_tag="H0264_02190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003969934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkene reductase"
                     /protein_id="QLY31218.1"
                     /translation="MTTAFDPITVGGTTLASRIAMAPMTRSRAYGGLVSDLTAEYYAQ
                     RATAGLIVTEGIQPAPVGQGYPFTPGLHSLEQVAAWRKVTDAVHERGGRIFAQLMHTG
                     RVGHPVLLPAGLRPVAPSPVAAQGQVFTPEGMQEFVVPDELTADQIRGTIQDFATAAR
                     NAVDAGFDGVELHGANGYLIHQFLAPNSNQRQDEWGGDSTGRIRFATAVVSAVAAEIG
                     AARTGLRISPGAPLNDISEPAPRATYEALVDAISPLGLAYLHLMEAGDRQLTVDLRHR
                     FGGVFILNPATGDRPTGPQDLALIEDGTADLIAFGQLFLANPDLPARLRAGGPFNTAD
                     RATFYGGDATGYTDYPALPA"
     gene            complement(488877..489725)
                     /locus_tag="H0264_02195"
     CDS             complement(488877..489725)
                     /locus_tag="H0264_02195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="QLY31219.1"
                     /translation="MTEALKPLAGRTMIMSGGSRGIGLEIARRAAADGANITLIAKTD
                     LPHPKLPGTIHTAAAELEQAGGSVLKIVGDIRDDEAVADAVRQTVERFGGIDMVVNNA
                     SAIDLSPTELLPMKKYDLMQDINCRGSFLLSKLSIPALKESAEAGRNPHILTLSPPLN
                     LDPKWAGASLGYTIAKYGMSLTTLGLAEELRKYGIGVNSLWPRTTIATAAVENLLGGK
                     EMISTSRTPDIYADAAYLVLTSPAKDNSGNFFIDDEVLAAHGITDLDRYRVTPGDGPL
                     TTDLFL"
     gene            490001..491170
                     /locus_tag="H0264_02200"
     CDS             490001..491170
                     /locus_tag="H0264_02200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase family protein"
                     /protein_id="QLY31220.1"
                     /translation="MTAFRRHRGRTVLAALGVAAATLAAAACTADDSETAAPTTLTRT
                     MDEAVRAGFPGIQVVIDGPKGHRTLSAGVGDLGTGAPIPEHSQVRIGSNTKTFVATVL
                     MQLVAEGKVQLDAPVETYLPGVITGNGNDGNRITVRQLLQHTSGLPEYLIVGDPGYAP
                     DPNSPRVEPGSEQARLVHYTPAELVRSALTLPPQFEPGAKSVYTNTNYILLGMLIERV
                     TGRTYIDEIQTRILTPLGLRDTYSPGSRETGIRGPHPRGYHEIDGKRVDYTEMDVSWA
                     DAAGDMIATPADLNTFFKALLDGKLVPAAQLAEMKKTVPFDRMPGDDYGLALIRHTTS
                     CGTEVWGHGGSIMGFGTRNSVAPDGTAVVVTVNQLQGTEESSKIVQQVLDAALCE"
     gene            491300..492787
                     /locus_tag="H0264_02205"
     CDS             491300..492787
                     /locus_tag="H0264_02205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014981248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold hydrolase"
                     /protein_id="QLY34063.1"
                     /translation="MIAVTAAGLAAATLAATADADRSAGDPGLDRYYSQQLDWKSCED
                     PKLDEAGARCAEVTVPLDYSDPGGRTMTVAISRFASPDPAQRRGIMLSNPGGPGGAGL
                     DFPIDFGAAMTPDVRAQYDLIGMDPRGVGRSTPVNCHWPGGFGLQSAGVDAASYAESV
                     AYQADLAARCATAEGDRLRHITTRNTARDLDVIRGALGENRTSFFGTSYGTYLGAVYT
                     QMFPERSDRIVLDSSVDPARYGAVDMVRDMGPANEAVFETWAEWTAAHDAEYRFGSTR
                     DQVRTSILELIRKAAVQPIRIEGMEVDDHWLPMIMFTGLDDPRNYATVAGNMRQLADA
                     AEGKAVQVDPKLLAELKFVLRADPEDNSSQMAIMCGDKAVERDPTWYWRNIEAARATE
                     PVFGAFANNITPCAFWAPPIEATTVVNNAVPALIVQSTGDTRTTYSNAVGMHKALTAS
                     RMVTLENVAIHYIFGRYPNTCTYAAVNSYLRDGALPATDLTCQAD"
     gene            complement(492788..493432)
                     /locus_tag="H0264_02210"
     CDS             complement(492788..493432)
                     /locus_tag="H0264_02210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005514250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="QLY31221.1"
                     /translation="MRVVIAEDDALLREGLVLLLQTSGIEVVAAVDNADDFLRVVTGE
                     RPDAVVMDVRMPPTNTDDGLRAAVRAREIHPGLPVLILSSWVEDRYAAELLGDGAGGV
                     GYLLKERVGKVDRFLDSLRRVAAGGTAMDPEVISQLLVRRKADDPLSGLTAREREVLA
                     LMAEGLGNATIAERLVVSEGAVLKHIRSIFAKLGLHADDAGHRRVLAVLAYLNA"
     gene            complement(493420..493716)
                     /locus_tag="H0264_02215"
                     /pseudo
     CDS             complement(493420..493716)
                     /locus_tag="H0264_02215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044616.1"
                     /note="incomplete; partial on complete genome; missing
                     N-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
     gene            complement(493897..494838)
                     /locus_tag="H0264_02220"
                     /pseudo
     CDS             complement(493897..494838)
                     /locus_tag="H0264_02220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014981246.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing protein"
     gene            complement(495110..495295)
                     /locus_tag="H0264_02225"
     CDS             complement(495110..495295)
                     /locus_tag="H0264_02225"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31222.1"
                     /translation="MSTESMNLATAPARTASAPVWVSPRTLLSTVMARVFAPVDMSPA
                     AGIDGPLLSVWCNRLNR"
     gene            complement(495292..496398)
                     /gene="rsgA"
                     /locus_tag="H0264_02230"
     CDS             complement(495292..496398)
                     /gene="rsgA"
                     /locus_tag="H0264_02230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012691159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome small subunit-dependent GTPase A"
                     /protein_id="QLY31223.1"
                     /translation="MSLVDFDLLAPYGWNSAVAAEYLPLLGDSHIPARVIRMDRSECD
                     VAAPLPTADYQSRLSAAVIRAKCPRSDSEISGLCTGDWVAIDANRTVVQLFPRRTAIV
                     RAAVSGHSDSKAKSANQVLATNVDVVLVCTAGDGDVDLGRIERLLALAWESGAQPVVV
                     LTKADLAPDLSLDTVRAVAPGAAVVAVSASSGYGMEVLEALLDGTVALIGPSGAGKST
                     LANALLGSEVFATNAVRVGDKRGRHTTVHRELRPLPGGGTLIDTPGLRSVGLWDASEG
                     IERTFSDIESIAAHCRFGDCAHETEPGCAVREAIESGALPQRRFDSYRKLHRENEWMA
                     SRTDNRVRAEREKARKDITKFQRQIYRERGGKRR"
     gene            complement(496627..497562)
                     /locus_tag="H0264_02235"
     CDS             complement(496627..497562)
                     /locus_tag="H0264_02235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="QLY31224.1"
                     /translation="MTESTPHYGDDARIVAIVVTHKRRELLAESLKVLASQTRPIDHL
                     IVVDNGNEPEVGELVKQQPMETTYLGSEHNLGGAGGFALGMLHALTMGADWVWLADDD
                     GRPDGPEVLATLFDCAKRHQLVEVSPVVADIDDPDRLAFPLRRGVVWRRLRSELGDED
                     FLPGIASLFNGALVSAEAVDVIGVPDLRLFVRGDEVEVHRRLVRSGLPFGTCLQTAYL
                     HPNGSEEFKPILGGRMHTQYPDDPVKRYFTYRNRGYLMAQPGMRKLLPQELARFGWFF
                     LLQQKDPAGFIEWLRLQRLGRREQFRKPDANAAKK"
     gene            complement(497559..498380)
                     /locus_tag="H0264_02240"
     CDS             complement(497559..498380)
                     /locus_tag="H0264_02240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QLY31225.1"
                     /translation="MTEHVSIEAQDAWVEFPIFDAKSRSLKKAFLGKAGGAIGRNQSD
                     VVVVEALREINLSLQEGDRIGLVGHNGAGKSTLLRLLSGIYEPTRGSTRIRGRVAPVF
                     DLGVGMDPEISGYDNIIIRGLFLGQTRKQMLAKIDEIAEFTELGEYLAMPLRTYSTGM
                     RVRLAMGVVTSIDPEILLLDEGIGAVDAEFMKKARIRLQELVSRSGILVFASHSNEFL
                     AQLCDSALWIDHGRVRMHGGIEEVVRAYEGPEAGDHVAQVLRDLEREKEPERNPA"
     gene            complement(498388..499242)
                     /locus_tag="H0264_02245"
     CDS             complement(498388..499242)
                     /locus_tag="H0264_02245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010596156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QLY34064.1"
                     /translation="MRPDDAPVPLVSDSQTFRRAWKDFRDGFSQRELWLSLGWQDIKQ
                     RYRRSVLGPFWITIATGLQAAAMGVLYATLLDQPLTDYLPYVTVGLIVWGVISASILE
                     GSDVFIANEGLIKQLPSALSVHVYRLVWRQFLFFLHNMAIYVVMLAAFGVWKHLSFTV
                     LLAIPGILLLFANAMWVSIAFGIFSTRYRDLAPILSSTTLMLFVLTPVMWSTKALHDQ
                     GGAVSERAKLVELVPTFHYLEIVRAPLLGDPIALRSWVIVLAITVVGWAVAILAMKQF
                     RSRVPYWV"
     gene            complement(499375..499971)
                     /locus_tag="H0264_02250"
     CDS             complement(499375..499971)
                     /locus_tag="H0264_02250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial proteasome activator family protein"
                     /protein_id="QLY31226.1"
                     /translation="MTQSDGAPESIVVIGPEGKPLIIPAGAQAGGADEPIALTGQVVG
                     EENSGESGEKEESLADMVEQPAKVMRIGTMIKQLLEEVRHAPLDDASRTRLREIHRTS
                     IRELEQGLAPELREELERLALPFSEETIPSDAELRIAQAQLVGWLEGLFHGIQTALFA
                     QQMAARAQLEQMRQALPPGASHIDPRQPGGSSGSGQYL"
     gene            500035..501240
                     /locus_tag="H0264_02255"
     CDS             500035..501240
                     /locus_tag="H0264_02255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase-like protein"
                     /protein_id="QLY31227.1"
                     /translation="MTYDVARVRGLIPSLGDGWIHLDPQAGMLVPDSVSRAVSTGFRT
                     SAFSHTNRHGAAKRSAAILEAAREAVADLVGGDPAGVVLGPDRAVLLAWLAESLSSRL
                     GLGTGIVLSRLDDEANVAPWLRIANRYGAHVRWAEVEIETCEMPAWQFEELIGPTARL
                     VALTAASPIVGSAPAVRVAADRVHEVGGLLVADCFGAAPYALIDIDELNADVIALSAP
                     AWGGPQIGALVFRDPAFLDRIPSMSLNPYAKGAERLEVGGHQYALLAGLTTSIDYLAG
                     LDERATGTRRERLEVSITSLQDYHDQLFEHLMSVLDTIPNLTVIGRASTRIPTVSFTI
                     SGMQAEKVSAKLADARIGTLSGSHGGSRLLDALGVNDEGGAVTIGLAPYTTKFEIDQL
                     GRALAALDS"
     gene            complement(501237..502223)
                     /locus_tag="H0264_02260"
     CDS             complement(501237..502223)
                     /locus_tag="H0264_02260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005516249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-quinone oxidoreductase"
                     /protein_id="QLY31228.1"
                     /translation="MYAVTLDGFGGPEVMRWEQVADLPAPGPGEVVIEVAAAGVNRAD
                     LLQRLGFYPPPPGASTTLGLECAGVVAEVGAGVRDWRPGDRVCALLSGGGYAERVVVP
                     ESQVLPIPEGISEVQAAGLPEVAATVWSNLVMTAGLHSGQLLLIHGGGSGIGTHAIQI
                     ARVLGARVAVTAGSQYKLDRCHELGATVLINYREHDFVTTLHSEYPGVDIILDNMGAK
                     YLERNVEALAEDGHLVIIGMQGGVKAELNLAALLAKRGSIHATNLRRRPEHGPGSKAA
                     IITELRRHVWPLISDGTVQPVISADLPITDVSKAHELLDAPETVGKVVLRID"
     gene            502619..503794
                     /locus_tag="H0264_02265"
     CDS             502619..503794
                     /locus_tag="H0264_02265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-hydroxy-acid oxidizing protein"
                     /protein_id="QLY31229.1"
                     /translation="MSSFADFQNEIYLSGLAGAVPSLPMTAAGLEARAREVLEPAAYA
                     YVAGSASAERTATANVTAFEKYRLLPRVLRGTSAPGARDLSVEILGTRFAAPILTAPV
                     GVLGLLHERGETVIAEVTRELGIGMVLSTAASSTIEEVGAAAGDWWYQLYWPSDTELA
                     RSFVERAEKSGAKAIVVTADTPSLGWRPRDLQLGHLPFLQGKGIANYLSDPVFRAKLP
                     SPPEESEDAMRMAVLTWIGLFGNHDLRPADIARLRDWTDLPIAVKGVLHPDDARQVVD
                     AGADAVIVSNHGGRQVDGSVAALDALPTIVATVGDRAEVLFDSGVRTGSDVMIALSLG
                     AKAVLYGRPWVYGLGLAGRDGARHALRTLLADFDASMGLSGCSGVADLARTMLSSFR"
     gene            503940..504350
                     /locus_tag="H0264_02270"
     CDS             503940..504350
                     /locus_tag="H0264_02270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014981016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="QLY34065.1"
                     /translation="MDGSQRLMADLNRQLQRDADLTFADYRILVKLSEAPGRSLRMSD
                     LADGVLSSRSRLTHQIRRMEAQHMVRRTACEDDGRGVIAQLTEEGMRRLRAAAPGHVA
                     AVRRFFVDLLTPAQLAAVAAALELVNQAGDYRSE"
     gene            504385..504469
                     /locus_tag="H0264_02275"
     tRNA            504385..504469
                     /locus_tag="H0264_02275"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:504419..504421,aa:Ser,seq:tga)
     gene            504515..505546
                     /locus_tag="H0264_02280"
     CDS             504515..505546
                     /locus_tag="H0264_02280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016895704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HoxN/HupN/NixA family nickel/cobalt transporter"
                     /protein_id="QLY34066.1"
                     /translation="MGLAVLALHILGWGTLLFLVVPGHYEVQGAVFGVGLGVTAYTLG
                     MRHAFDADHIAAIDNTTRKLVAENGRAKTHTVGFWFALGHSTIVFVMVGLLALGVRAL
                     AGPLEDEGSALHTWTGLWGTSVSGTFLIAIGLLNLVSLIGIWRVFKRMRGGDLDEERL
                     ERELNDRGLLNRILGPVVRLVRKPWQMYPVGVLFGLGFDTVTEVGLLVIAGGAAATGL
                     PWYSILVLPVLFSAGMALFDSLDGSFMSYAYDWAFARPVRKIYYNLVVTGLSVTVALL
                     IGVQEIVSIFVEKLGITSGFVGWVGSLDLGDLGFIIVGLFILTWAVAVAVWRLTDMEA
                     RWEKDLAAD"
     gene            505568..506623
                     /locus_tag="H0264_02285"
     CDS             505568..506623
                     /locus_tag="H0264_02285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="QLY34067.1"
                     /translation="MVRRRRTRRRLAGALASAALLLTGAAMIDPTTSRADPPIDSGSN
                     EEPPPEADSVKPTRAAIARVHTLSDRLLNVSVRSPAMERTVDVRVLLPERRDGPRPTV
                     YMLDGRAAPPDSNDWIDKGDALAFFADKPVNVVFPVGGRAAYYTDWQRPDPKLGTNRW
                     ETFLTEELPPLLDARFAGNGANALTGVSMGAEAAMMLAARKPGLYRAVGAHSGCYAMG
                     SDFGEAQARAVVGSYGGDPDNMFGPENDPEWTAHDVLANAEALRGTAIYLSTGSGLPG
                     EYDTPANPDWQETIAAGGPIEAGANLCTRDLAVRLAELGIPAAVEFRPTGTHSWPYWA
                     AELPRSWPTLASALGVS"
     gene            complement(506620..507699)
                     /gene="hisC"
                     /locus_tag="H0264_02290"
     CDS             complement(506620..507699)
                     /gene="hisC"
                     /locus_tag="H0264_02290"
                     /EC_number="2.6.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019931872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate transaminase"
                     /protein_id="QLY31230.1"
                     /translation="MSAHIRPDLDAIPAYVAGRSQPGVVKLASNETTFPPLPSVAKAI
                     AEAAETVNRYPDNAALELRTAIAEFHGVAVENVAAGCGSVALCQELVQITCLAPTDEV
                     LFAWRSFEAYPIVTQVAGAKAVQVPLDGEFAHDLDALAAAVTPNTRVVFVCNPNNPTG
                     TAHGAAAITRFLDAVPANVLVVLDEAYFEYLRMPADDAPNGVELGRNRPNVLVLRTFS
                     KAYGLAGLRVGYAVGAPEVITALMKVHIPFSVNKVAQAAAIASLEARHELLERTNAVV
                     AERDRMAAALRAAGYRVTDSHANFVWLPLGEQSAAFGAASAEAGVLVRPYGTDGVRIT
                     AGDPHENDLFLAFATDPATVARFVG"
     gene            507847..508536
                     /locus_tag="H0264_02295"
     CDS             507847..508536
                     /locus_tag="H0264_02295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019667536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase family protein"
                     /protein_id="QLY31231.1"
                     /translation="MSGIYRELAPVHDTTTVPLVVIEPEGHTRGGIVVLHESREFTEP
                     LLDLMRSLAEDGWTVLAPDLFHRANGVAPDKVFGADLYADFDACFDWLTGRGVFGDCI
                     GVLGFDSAGTAAALVATNRRVGAAVSVAAQGIESALTPQALALAVAAPQLKAPWLALF
                     GADDPHTPPEQVDRLRDAAAHADVATLVVTYPGLHHRPDHPGFDPAALDDIHVVDAQT
                     RIFDWFDSHLR"
     gene            508624..508713
                     /locus_tag="H0264_02300"
     tRNA            508624..508713
                     /locus_tag="H0264_02300"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:508658..508660,aa:Ser,seq:gct)
     gene            508752..508824
                     /locus_tag="H0264_02305"
     tRNA            508752..508824
                     /locus_tag="H0264_02305"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:508785..508787,aa:Arg,seq:acg)
     gene            complement(508923..509609)
                     /locus_tag="H0264_02310"
     CDS             complement(508923..509609)
                     /locus_tag="H0264_02310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maleylpyruvate isomerase family
                     mycothiol-dependent enzyme"
                     /protein_id="QLY34068.1"
                     /translation="MHTQLDIVAAATTRLLDTVAELRDEDLVEPSLLPGWTRGHVLAH
                     LSRNADSLVNLLLWARTGIETPQYASQFLREADIEAGAPRPHREQLEDLTAASERWLA
                     LARVMPEERWETSVRNRKGLEIPATRIPWMRLLEVEIHHTDLDTGYAPAQWPAEFTER
                     LLAEAVSDRATLTGPGFTVAATDTGFTATAGTPVTTITGPAASLAAWLIGRSPGNDLT
                     GDLPDLTAWK"
     gene            complement(509660..510391)
                     /locus_tag="H0264_02315"
     CDS             complement(509660..510391)
                     /locus_tag="H0264_02315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019044468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF998 domain-containing protein"
                     /protein_id="QLY31232.1"
                     /translation="MAASERGTAAVLDQPAVSRTRHRLRLGVALLIAVAGIVYSSWVL
                     EFVLPIDSDPTDTFLSQLAETGAPYRRVFVTGDTLCGALLFVAGIGGLLLFSRRRYST
                     IAWTALACFGAATIADANWPLKEADPNAPAQNSGLFPQLHQVHALTSTLAVFSIFIAM
                     VAFTVAAFKYRRWPILRHSGLWILIIGSLVTAWMLIADNLPGNYGLGIAQRIQVGAMS
                     LWLLALAVQIFVAERHSARATSSDV"
     gene            complement(510530..510949)
                     /locus_tag="H0264_02320"
     CDS             complement(510530..510949)
                     /locus_tag="H0264_02320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="very short patch repair endonuclease"
                     /protein_id="QLY31233.1"
                     /translation="MSSRRPSTDAATSARMARQRRVGTKPEIALRSELHRRGARFFVD
                     RAPLAGLRRRADIVFPRKKVAVYVDGCFWHSCPEHATHPKNNAEWWAAKLAGNVARDR
                     DTDARLVAAGWTVVRVWEHEKAEAAAETVLRALPRRD"
     gene            complement(511004..512146)
                     /gene="dcm"
                     /locus_tag="H0264_02325"
     CDS             complement(511004..512146)
                     /gene="dcm"
                     /locus_tag="H0264_02325"
                     /EC_number="2.1.1.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005561219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA (cytosine-5-)-methyltransferase"
                     /protein_id="QLY34069.1"
                     /translation="MVGLFAGIGGLELGLAAHGWRSELLCEIDTGAQAVLGAHFPGVE
                     LHSDVTRLRSLPAGTELVAAGFPCQDLSQAGRTAGITGARSGLVDEVFRLVRRKRGPR
                     WLLIENVPFMLQLGGGAAMRHITAALEELGYLWAYRVVDARAFGLPQRRERVLMLASR
                     TEDPRPVLFGADAGERTVGDPAQDPCGFYWTEGTRGLGWAVNAVPTLKGGSGLGIASP
                     PAVRLPSGEIVTPGITDAERLQGFDRDWTAPALAVPGIRPGHRWKLVGNAVSVRMAAW
                     AGSRLADPTDADFPEGESHTRRSWPTAAWGRDGVVHRVPVSTWPVHAPYEDLRWFLDD
                     SRLLSARATAGFLRRTRMGSLRFPEGFLDDVETHLDRMGGFPREAA"
     gene            512674..513189
                     /locus_tag="H0264_02330"
     CDS             512674..513189
                     /locus_tag="H0264_02330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011596633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycolipid-binding domain-containing
                     protein"
                     /protein_id="QLY34070.1"
                     /translation="MESARVVLGGNRIRAAGRIVAGACEDHPAFSASYDLVTDENGVT
                     RRLSLRSTVAGGERHASIARDEENYWLIDAGGTHVRSTFGGALDVDVVLSPFFNTLPI
                     RRYGLAHANEDVQVPVVYVRLPDLLVQEASIIYSSGADGIHVLSPVSSATVTVDDDGF
                     VLDYPGLAERI"
     gene            complement(513201..514151)
                     /locus_tag="H0264_02335"
     CDS             complement(513201..514151)
                     /locus_tag="H0264_02335"
                     /EC_number="1.3.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011206765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydrogenase"
                     /protein_id="QLY31234.1"
                     /translation="MTGHPKPAVCVLGTGLIGGSVLRAAAGAGYRAWGYNRSEIGAKA
                     ARADGYDVISDSEEVLRRAAERDALIVIGVPMPALGTILSDIRSFAPDCQLTDVVSVK
                     APVAELVHRHELGKHFVGGHPMAGTSESGWAASTPDLFSGAAWALSVDEGVRAEPWTR
                     VARLALDCGAVVVPVLNAEHDRAVARISHLPHVLAEALAVEGAAGGNLALGLAAGSFR
                     DGTRVAATAPDLVRAICEPNAAALLEVLEDTLRVLGEARDSLRANGTIADLVEAGHAA
                     RVDYDDNQRWAITGIRPGDHDWLAQLAEAGRRGGVVKSLD"
     gene            514210..514749
                     /locus_tag="H0264_02340"
     CDS             514210..514749
                     /locus_tag="H0264_02340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012691269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA adenosine deaminase-associated protein"
                     /protein_id="QLY31235.1"
                     /translation="MAAQRSSTNRAASDEYDDVEGFAVAVVREEANWKVTPLTSAALH
                     SLSAAENELRALRSSGATFGLLDVDDEFFIILRPGPTGSRILLSDATAAIDYDIAADV
                     LEELNIEIPDIDPDELDEVDPWEEGDLGVLADLGLPEPVLAVILAETDLYPDEQLGMI
                     AQRLGFANEFSATLDKLPR"
     gene            514881..515318
                     /locus_tag="H0264_02345"
     CDS             514881..515318
                     /locus_tag="H0264_02345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014981041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside deaminase"
                     /protein_id="QLY34071.1"
                     /translation="MIRAAIAAASLADPRDVPVGAVVFDREGRELARAANAREALGDP
                     TAHAEVLALRQAAHVHGDGWRLEGATLAVTLEPCTMCAGAIVLSRVDKIIFGAWEPKT
                     GAVGSLWDVVRDRRLNHRPQVRAGVLESECAALLDVFFKSQRS"
     gene            515373..515460
                     /locus_tag="H0264_02350"
     tRNA            515373..515460
                     /locus_tag="H0264_02350"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:515407..515409,aa:Ser,seq:cga)
     gene            complement(515516..515755)
                     /locus_tag="H0264_02355"
     CDS             complement(515516..515755)
                     /locus_tag="H0264_02355"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31236.1"
                     /translation="MTANSDGSVGAQIVYDARVINTTVQGALDVMRAVREALRLRETK
                     VAYLSDSESSAAITIGPGIPILFRFPEKFDPRLHR"
     gene            complement(515823..516014)
                     /locus_tag="H0264_02360"
     CDS             complement(515823..516014)
                     /locus_tag="H0264_02360"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31237.1"
                     /translation="MLVMHGIHDPVYDRAHQEALATRFGGPARVETTDAPRAFHTPTL
                     TAPELTDPLLRQFLDGLPA"
     gene            complement(516113..516559)
                     /locus_tag="H0264_02365"
     CDS             complement(516113..516559)
                     /locus_tag="H0264_02365"
                     /inference="COORDINATES: protein motif:HMM:NF012770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold hydrolase"
                     /protein_id="QLY31238.1"
                     /translation="MREARPWTRRCGGCSTSRWRRSIGSSPRLAWARAHGDPGTPFDY
                     WRLADDAWAVIDHLGLDRIAIAGHFSGGWTAMRMALQQPSRVRGLVIVGSRADPYDSY
                     DRIGYEAVIMDGWIQGDNPLEHVAVPIASSTIRPDPEPRRYWLDNG"
     gene            516802..517317
                     /locus_tag="H0264_02370"
     CDS             516802..517317
                     /locus_tag="H0264_02370"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY31239.1"
                     /translation="MESVETGHYLEAVAVLDSLLGDRLTSRYSYVRREDSSELPAVGQ
                     LCDRLLNGYKTKENPHLENDPRFRAIIEEIQKWSATRNQAMHQTAKILANSSAHVRFI
                     EILEEHRQTALDGVSLLRRLDELDTQVRFEAGKRPGTWPDAFFPERSSTRRSDIAWLN
                     RMPAASTTSQV"
     gene            517406..517918
                     /locus_tag="H0264_02375"
     CDS             517406..517918
                     /locus_tag="H0264_02375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014352422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QLY34072.1"
                     /translation="MGAGSTFVATMMTERAKWRRSHDTRWDEKRLAAYSEYANALKQC
                     MDLSFRLAAARGYPAVALPIDIDAGLRALAEAETEKTVKWEALLLLGSPQAVASAREW
                     NRAAWELGWAAKGHTMEHSEYTRLYAETGRRRNAFYEAARADLGVTSGELPPGDRPWQ
                     LPGTSASPAE"
     gene            complement(517985..520288)
                     /locus_tag="H0264_02380"
     CDS             complement(517985..520288)
                     /locus_tag="H0264_02380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014981056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MMPL family transporter"
                     /protein_id="QLY31240.1"
                     /translation="MSVYLYRWGKFAFRRKWIVLPVWLLLFLVLGGLGTALKEPMSND
                     FSMPELPSARANDILDKHFPGASEAFKFEAVTGTYVIQAPAGQKLTDKANVDAINALI
                     DKVGALDIVNHDKPLQNPVTATEEMGCLGTDRDVSKCTSAPLNVLGKTSPDTVAVLNV
                     PFTIPSFNDVTDENRDAAYNAAQVARDAGLTVEMSGSIAQKQEQPSGKSEMIGMAVAL
                     VVMMVAFGAIVASFVPIFTAIIGLGAASSLIFVGTSFIEVPSFTTFLASMIGIALSID
                     YALFIVSRYKSELAVQDSPEEAAGVALGTAGSAVVFAGLTVIIALGALSVVGVEFMTF
                     MGLGGAIAAAFAVLTAITLMPALMGAFGRFLFKPKLPLVAKHDPSDDTSVSNGTRFAR
                     LIGKAPALTLGISVVVLGLLAAPAAGLQLGLPGDDSLPTHSTVRKAYDIRTEGFGEGS
                     NGVLMVVADLADVAPADRENAANALRKKLEGYSGMDYVTAPQFSKDGKGAMLNAVPKF
                     GPNNQDTKDLVSEARDAESGLASDYPGMAYGITGTTAIYADVDHVLLSKIVPYLALVA
                     GAAFLLLILVFRSILVPLTAALGFLLSMAATFGATVLIFQEGALGLIADPHPLVSFLP
                     IMLIGLVFGLAMDYQVFLVTRMREEFVHGKSPKEAMITGYHHGARVVTSAAIIMISVF
                     GSFILESDATAKSFGFALAAGVLFDAFIVRMVLIPSLLVLMGKWAWWMPKWLDRILPD
                     IDVEGAKLRELQQKPAVELTKEPVSVG"
     gene            520494..521081
                     /locus_tag="H0264_02385"
     CDS             520494..521081
                     /locus_tag="H0264_02385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014348524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QLY31241.1"
                     /translation="MTGRAAQGAVVAGRSTKDAIREAAIQLFSAKGFEQSSLREVADA
                     VGITKASLYYHYASKVDLLVAIIEPIFDDMRALVDSLDGREHTPDAVRAVLTAHLEAG
                     LHHRAAGVLCMRDTVAIVNALGNNRYPDMLDMHRRMCEWLAGPGADEERKLRAAAAMQ
                     VLSVALTSQEHMPDTSPEVIERVLLNAALGVLDPE"
     gene            521120..521638
                     /locus_tag="H0264_02390"
     CDS             521120..521638
                     /locus_tag="H0264_02390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009477226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /