LOCUS       CP012882             1741042 bp    DNA     circular BCT 14-AUG-2017
DEFINITION  Vibrio vulnificus NBRC 15645 = ATCC 27562 chromosome 2, complete
            sequence.
ACCESSION   CP012882
VERSION     CP012882.1
DBLINK      BioProject: PRJNA295776
            BioSample: SAMN04097182
KEYWORDS    .
SOURCE      Vibrio vulnificus NBRC 15645 = ATCC 27562
  ORGANISM  Vibrio vulnificus NBRC 15645 = ATCC 27562
            Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales;
            Vibrionaceae; Vibrio.
REFERENCE   1  (bases 1 to 1741042)
  AUTHORS   Rowe-Magnus,D. and Rusch,D.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2015) Biology, Indiana University, 1001 E. Third
            Street, Bloomington, IN 47405, USA
COMMENT     Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Celera Assembler v. 8.1
            Genome Coverage       :: 10x; 100x
            Sequencing Technology :: PacBio; Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 10/06/2015 12:48:27
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 3.0
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,415
            CDS                          :: 4,220
            Pseudo Genes                 :: 45
            rRNAs                        :: 12, 11, 11 (5S, 16S, 23S)
            complete rRNAs               :: 12, 11, 11 (5S, 16S, 23S)
            tRNAs                        :: 115
            ncRNA                        :: 1
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1741042
                     /organism="Vibrio vulnificus NBRC 15645 = ATCC 27562"
                     /mol_type="genomic DNA"
                     /strain="ATCC 27562"
                     /type_material="type strain of Vibrio vulnificus"
                     /db_xref="taxon:1219061"
                     /chromosome="2"
                     /country="USA"
                     /collection_date="1979"
     gene            complement(299..1873)
                     /gene="malF"
                     /locus_tag="AOT11_00005"
                     /note="maltose transporter; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(1945..3122)
                     /gene="malE"
                     /locus_tag="AOT11_00010"
                     /note="sugar ABC transporter substrate-binding protein;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(3339..3536)
                     /locus_tag="AOT11_00015"
     CDS             complement(3339..3536)
                     /locus_tag="AOT11_00015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97863.1"
                     /translation="MAMKTSKNSDQVGLLGKGSYHPLLDGCSFFDIALAYILLRQLIV
                     GGVEKEEGGLRLFPQSGQISQ"
     gene            3792..4907
                     /locus_tag="AOT11_00020"
     CDS             3792..4907
                     /locus_tag="AOT11_00020"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MFC4.1"
                     /note="with malEFG is involved in import of
                     maltose/maltodextrin; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose/maltodextrin transporter ATP-binding
                     protein"
                     /protein_id="ASM97864.1"
                     /translation="MASVTLKNVCKAYGDVLISKNVDLEINEGEFVVFVGPSGCGKST
                     LLRCIAGLEDITSGDLYIGEERMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKL
                     AKADKKEIDKRVEQAAEILQLGHLLERLPKALSGGQRQRVAIGRTLVSQPKVFLLDEP
                     LSNLDAALRVQMRAQITKLQRQLGCTMIYVTHDQVEAMTMADKIVVLDGGFVSQVGKP
                     LELYHYPENRFVAGFIGSPKMNFMSVQIVDVESERVQVKLSNGVTFWVPVDGTTVNKG
                     DRMSLGVRPEHLVSSAQGDAVIDGEVMIVEKLGNETQVYLNLESADADVIYRQPDTLD
                     VDSGDRLEIGIPAHRCHLFHSDGRACKRLFNEKGVER"
     gene            5322..6722
                     /locus_tag="AOT11_00025"
     CDS             5322..6722
                     /locus_tag="AOT11_00025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl-phosphate glucose
                     phosphotransferase"
                     /protein_id="ASM97865.1"
                     /translation="MNNKGLIRSHETEFSFLYRLADLTIIIGFMALLTLYHLAAIPKD
                     YLMLAIVSGLIFILFAESAQLYRSWRTSSIRQQLTLACAAWLATSLLQIAIHFFTKTL
                     DTYNEDIVTPWLLITPILLMCWRILFRSTLSYLRRLGLNTRTAIIVGQTPHGITLANE
                     LKNHTEHGVIFQGFYDERTVERDESNADYPIKGNVADALSKAKNGEVDYVYIAMPMHA
                     NERIAKFLHQFSDTTANTYLIPDFFTYNLLHSRWDQIGQVQTLSVFDTPFAGFSSWLK
                     RFEDIVFSSLILLLISPILIAIAIGIKCTSRGPVIFKQDRYGLDGRKIRVWKFRSMTT
                     MEQGSDVKQATKNDPRITPFGGFLRRTSLDELPQFINVLQGTMSIVGPRPHAVSHNEE
                     YRQIVDRYMLRHKVKPGITGWAQINGYRGETDTLDKMEKRVEFDLDYIHRWSIWMDIK
                     IIFLTVFKGFTGSNAY"
     gene            6757..7971
                     /locus_tag="AOT11_00030"
     CDS             6757..7971
                     /locus_tag="AOT11_00030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular biosynthesis protein"
                     /protein_id="ASM97866.1"
                     /translation="MKRYTGFALGLLPVWVGAVEPLAFTTESGIEFIPTLHTYYRFDD
                     NIAKQEAESSHVSTIGVKPALLARIDRNQYKADFIYVADFGRSSDEQNDYLDHKFQTT
                     NYFTFNHRNRLVLDYQFRLGHETRGEGLTEGEQISLALPELITFQSNQLKSNYVFGAI
                     GSQGRLEFGLNYLDKTFTKYENGTSTLTATKYSDFRTPSLHSEFYYRLRPETYWLVGS
                     QLHLTEYLHERESVASRDGTSTFVYTGVSWEITGKTKGTAKLGYQIKEFDDKQRATFE
                     GLSWDIGLSWQPQEHTIWTLLTTQAAVNPEQDGDYNLQTRYSLQLDQAWNSYFVTSLK
                     GLYQQDDYTGSYQSGVLRKEERFQLSAEAQYQFRRWARIDAAWQYQDKTSNWSGYSFD
                     QHIWTVTARLSL"
     gene            7985..8518
                     /locus_tag="AOT11_00035"
     CDS             7985..8518
                     /locus_tag="AOT11_00035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular biosynthesis protein"
                     /protein_id="ASM97867.1"
                     /translation="MKFLLKVLLGLSLILAPYVSASISDAGYQLNSGDSISILVYGED
                     DLSIPNILLTSDGQIDYPYLGRVLVKGKTPKELKEEIEQKLKGDYLVNPKVMVSINKF
                     RAFYVNGEVRRPGSFEYQPGLTIEKAIAIAGGLTDRASRSNIHLTQSQNGETIKKVSL
                     SQKVSPGDIVVIEQSFF"
     gene            8538..10718
                     /locus_tag="AOT11_00040"
     CDS             8538..10718
                     /locus_tag="AOT11_00040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular biosynthesis protein"
                     /protein_id="ASM97868.1"
                     /translation="MNENQTNRYYIGNKELFQFGSYLKVLRKHWFSIVTLSLVITLAA
                     TWFIYSKPSIYQATATILIQEEQRNALSIEEVYGLDTTKKEYFQTQIAILQSNHIADK
                     IIQQFDLTNHPHFTGSSSLKTKLNELKSVPLIQDLLNVSPNPTETNEYHSSYYEALQS
                     YKNRVDIDPIRNTQLVKVSFRSADPKLAAEIANAIGQAYIDSNFEAKLAVTQNATNWL
                     DSNARQLEDKLHKSEQALQQFLTTEGLVDINGIDDIYANELEELSKKLNIAIEKRIQA
                     QTLSDLLLRKSAQNLDSLLSIDEFANQAQIRELKMLESNAEKLVGELSQRYGPKHDKM
                     IQAKAQLQNIQARSQQLIMEMVLSKQQDLKVAQSFENSIRREMSNKKAEIQLVGGKKA
                     EYEKLKRDVESNRELLKAFVNREKETTATSDFRNVNARFTDKALEPLFPIAPQRLKLV
                     IICAVFALFFSSAAAIILDMIKDVIRTPEDVENKLGLSCIGTIPYVRSRKLRKPGVSF
                     QAYLDPQNRVFSEACRSIRTSLLLRLVNSKQKVLVFTSAIPEEGKTATCINIASTFSN
                     LERVLLIDCDLRRPSLEKRFNIPAQVPGLSNILTMNTPLEECIVRIEEANLDVLTAGL
                     LPPNPQELLSSKRFQNLLNTLQEKYDRIIIDTPPLLSVSDALILGQLAQGLITVIRSD
                     STKVALAKTALSKQRQHDIPSFGVVISQATTPQEEAHYVQKYAY"
     gene            10742..11782
                     /locus_tag="AOT11_00045"
     CDS             10742..11782
                     /locus_tag="AOT11_00045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular biosynthesis protein"
                     /protein_id="ASM97869.1"
                     /translation="MRILHIINDLSKNGGAQKFLVDLVTGEEAKYDIKILVLCHENDY
                     LETLSHHGIECYVWQTLTFKEKWALFRWPDIVHGHLYPSIYLALLALGKKKLQTEHSS
                     SNRRRDYPAFKFMEYLLYLSHDLTVSISEKVQEELIKFMPNFRQKYKVINNGVDLSCF
                     SMSARTGIKHPAQIKIGMVGRLHEHKDHEALIRAVALLPTQYQLHLAGDGQKREALES
                     LAQQLDITNRVFFHGVVTDIPTFLEQMDLYVQSSLIEGFGLAAVEAMAAGLPVLSSNV
                     PGLDDVIGNASYLFEVSNSEELANKIIQVCDSNENYSVASKYSISRCKEFTIEKFRDS
                     YYKAYDGLFIQG"
     gene            12000..12833
                     /locus_tag="AOT11_00050"
     CDS             12000..12833
                     /locus_tag="AOT11_00050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular biosynthesis protein"
                     /protein_id="ASM97870.1"
                     /translation="MKYSLNRQFEKNKELKSDNFVLVYQMGKVGSSSIEHTLSDYNIP
                     SYHIHTFDDHEEFQMYHNRQDVKKFFDFKNRTMYRVILNHRKRLLQNRNHLKIVTLVR
                     DPIATVLSRFFQDLHIQFIEGKKNDSIHRDMERTYQHLEFCFDHYINLNYFANWFDNE
                     LNKNFGIDVIKSDIDNKEQFYLFKNKKTEVMLIKCEHLNKLDSDIAKFLNVDGFILKN
                     SNEAKNKWYSNIYSHFKNNYDFSKLFYMYDLPLYRHLYSEEERAQFKNKWLKTPGTSQ
                     K"
     gene            12830..13861
                     /locus_tag="AOT11_00055"
     CDS             12830..13861
                     /locus_tag="AOT11_00055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular biosynthesis protein"
                     /protein_id="ASM97871.1"
                     /translation="MKKVLHITEAFGGGVQTALYSYVYSSRNEPIEHHLFARAREEDS
                     TKENGNNQFQSSTFIDGNLVQFFLSANQRIKQLQPEVIHLHSSKAGFLGRFLTVGNAK
                     LIYTPHCYAFEREDISVYAQKFYRILEGIRIKKFTAIAGCSQRECDLAISLGAKKAEL
                     LNNYVTYQSNAGNSVPRGEKINLVALGRVAKQKDPQFLCQVAEHILQHNSAIQLNITW
                     IGGGDPSLEQQLRDKGIEVTGMLPRTEVVERLRNADIYLHTAAWEGMPLTILEAAKLT
                     RPMVIRKIGATKDLDYPFLASTPQEMAKQIIHCVEHFDTIPFQQYCSDMNNTYSEEKQ
                     RLALSSLYI"
     gene            13872..15185
                     /locus_tag="AOT11_00060"
     CDS             13872..15185
                     /locus_tag="AOT11_00060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular biosynthesis protein"
                     /protein_id="ASM97872.1"
                     /translation="MLSALNQKLSGLSHEKKKLVSIGVQTGIMRILSALFAFILTIAV
                     ARFSDATVAGQFFYLFNLVSFVAIVSQLGFNVSLVKYNAIAFSQNSIQQQSENYTISV
                     QRSLAFSFSLCILAFIVQFTFGASLINVNITPSLFALFSLTIPLIVLAQLNSYALQAI
                     RHVTPAIFALQMGVSCFLVLFITILHFFEIISLISMLLALLLSASMVALISTIQWLRS
                     GQYSTVPLPVAHNAELTDSAKQVWIGNIFTNVIQWGSLIIAGFYLTDSDLGLLAAAQR
                     TSLLIGFVLISVNFIVAPMFASLYQQGEMKKLKKLSTNAFRLNISLSLIPVIACTFYS
                     QEVMTLFGAEFESAGILLAILALGQLVNVATGSVGFLLLMSGYEKTMKYITIASGSIA
                     IILLLALSQMYGVIGAASSIAIGMAIQNLAALYYVKRYLGFVPIG"
     gene            15259..15582
                     /locus_tag="AOT11_00065"
     CDS             15259..15582
                     /locus_tag="AOT11_00065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97873.1"
                     /translation="MESHVYEQFEYYIGGSRALHSTLSFLIAYMAVLAFPSMCKAISN
                     DIFAIRLLVLLLFIVSLDELSQLFLSHRTFSTSDMMTNWFGITTGYLLARLYLFKFKP
                     LLKQH"
     gene            complement(15769..17109)
                     /locus_tag="AOT11_00070"
     CDS             complement(15769..17109)
                     /locus_tag="AOT11_00070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97874.1"
                     /translation="MANQLAERNGETLDVVERFSPQDTLNIKGPIVMGFLSIALFGGG
                     IGYWAATAKLESAAIAYGDLSVSSQRQAIQHLEGGIVERLMIQEGDYVEKGQLLIQLS
                     EQQSLSRLESLKGRFVHAVAKESRLKAEFNNTSEIVWESDLEKMAISNTLLEAQQIQK
                     KIFEARARYFESKLNIVHQTISGAKLELNNLNQTKKIERERLSLIEEEILSNQTLVKQ
                     GFSGKSTLLQFKRLATEVRSTLSQLDRQTLTVQKRIDENQSRLEEMALERINEVVVEL
                     REAQNEIVSIREEYRVAQDIYTRTGIRAPISGKVVNMKVFTEQGVIRSGETLLELVPD
                     DDSLIVEARVSPQDIDLISPGLDARVRLTALNARIQEPLNGKVLTVSADKLSEQNKED
                     YYLARIALNDQDAQQHQLTAGMNAEVLILSRPRTPISYLLKPITESFNRAFREE"
     gene            complement(17102..18814)
                     /locus_tag="AOT11_00075"
     CDS             complement(17102..18814)
                     /locus_tag="AOT11_00075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="ASM97875.1"
                     /translation="MGSNLQNSAFKEVKKKLRTLFVWSLFFSFFINILVLSIPIYMLQ
                     IYNRVISSYSVDTLVLLTVIVLLALLTMSALEVVRAHISKRFGFWIDNRLSSLMLRQT
                     VHFKTHTGRNYTAQVLRDLQTLKSFFSGSSLYPLLDAPWTPLFVFFVYMLHPVLGQIA
                     LGGAFTLLSLGLFNEFAIRKAALDSDNRAVNAIANAETAAQNADSMLAMGMMNDYLRN
                     WYQYNQQTQVVEDNAVSRSILIANISKFIRSGLQILLLGGGAWLVIEHEITAGAMIAA
                     SILMGRALSPMEQAITTWRSASLAKSAYGRLKEISDKVQVDELNMPLPRPRGHFELAN
                     VSYRHPGVAEPVLSGAQFSIPPGCAVGIIGPSGTGKSTLAKLLVGNIKPLAGKVTLDG
                     MDVSLWASEDLGRHVGYLSQEIELFPGTIRENIARLKIEQPEKVIRAAQLAGCHEMIL
                     KKPKGYDFEIGEGGRGLSGGERQRVALARAIYDDPSVVILDEANSNLDGEGEAAYQNV
                     ITHLKNQKATVIVIAHNPSTMRNMDRLLYLSEGRVKLYGEKNEVLKRLMGSSQTDIPR
                     VNHG"
     gene            complement(18859..19431)
                     /locus_tag="AOT11_00080"
     CDS             complement(18859..19431)
                     /locus_tag="AOT11_00080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding protein"
                     /protein_id="ASM97876.1"
                     /translation="MAVYSGTADVDVLSNYTGSDDKFVGHGDNDNIVGGGGNDLIIGG
                     AGDDRLVGGRGNDILKAGLGDDYLGGGSGDDLLLGLYGNNHMNGGLDNDILVAGSGDN
                     VLIGGKGADKFIFTDKFDGHGTAKVVDFTIGEDTVRIDSATIHSVDDLSVSYDAVGNL
                     VLSDGGAFTVKLIGVTEADFVAHADDMFQF"
     gene            complement(19719..20378)
                     /locus_tag="AOT11_00085"
     CDS             complement(19719..20378)
                     /locus_tag="AOT11_00085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM97877.1"
                     /translation="MRRFSMGCNMADTTIVLVTQQSLQSENLKNILMAETGMTIEILD
                     AKKPISKERINAESILLVDLSVDISMDNIDIIKNRSDLRGTILLNLLEDLEPEELIKW
                     PYIKGVFGAKDNIDKLCRGIEAIARGDNWLPRRLMMQLISYYEEKGGAKKEEPQLDIE
                     LTRREIQVLQFLKAGGSNMEIADSLFISEHTIKSHLYNIFRKIDVKNRTQATAWAKRN
                     L"
     gene            complement(20573..21238)
                     /locus_tag="AOT11_00090"
     CDS             complement(20573..21238)
                     /locus_tag="AOT11_00090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="ASM97878.1"
                     /translation="MESQNKEVILITEDSLQSSLLKEILEKKLNMVVHLLTPKELDER
                     TTSYSSIKAILVDYSVVEEDFYSSYLNFIDENFSEVQEVLINCQNNISIEELCIWRSL
                     TGIFYLSDDISTLELGIDKILSGDMWFSRKISQEFISTLRQHSKPISKTVSTKLTKRE
                     QQIITLLSLGNSNQQIARKLFVRENTVKTHLHNIFKKIDVKNRVQALIWAKEHLSPTS
                     STI"
     gene            complement(21414..21614)
                     /locus_tag="AOT11_00095"
     CDS             complement(21414..21614)
                     /locus_tag="AOT11_00095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="ASM97879.1"
                     /translation="MSDFEKELQMMSEEASQEPEVKLPSIEEQKQIAAELKRLEAEGK
                     LTPEVLEHYFGKYAQKGETPIH"
     gene            complement(21662..23575)
                     /locus_tag="AOT11_00100"
     CDS             complement(21662..23575)
                     /locus_tag="AOT11_00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM97880.1"
                     /translation="MINLNSLSIKQKVVLGITFAVLASTIILGFMAQKQSREVISHRL
                     VDIELPLILSQINLQVDKDVSQLLSAAEQLAKNEFVRESVVQTENPEGQTKLVQQLNN
                     VKDQYRLNDASVANRKTAYYWNQNGFLRQLTQSQDGWFFGFTNSGQATMVSIFTEANG
                     EVKMFANYQHLSGFTMSGVSKSMDEMVSKLNSFKIEKTGYVFLVDSQGNIQIHKDRQA
                     VGKPLSSYVAENPSSLLNKQQDVVFETEVDGERVFVASAYVPSMNWYVVGIVPVDEVF
                     ADLDAAAQQMLITTLVVAAVFIFMGVILANSITKPIQQIAERFTDLGRGDGDLAQRID
                     IKGKDEIAQLSMGFNGFIEKIHTTMKEVAATSNSLNSAAETVSSKAATTHDNSQEQRD
                     QTIQVVTAINQMGATISEIASNAATAADTANQASDNTQLGREVVTKAKNVISRLADDV
                     ETTSQVVSQLATTTQEIGSILDVIRDISDQTNLLALNAAIEAARAGEQGRGFAVVADE
                     VRNLASRTADSTEEIQKMINQLQNDAKDAVSAMDAGKAVTFEGVGATDEAVNVLMSIS
                     ERIADISDRNTQVATATEEQSTVVHTINQNIEEINAINEVTTSTAEELADASQELREL
                     SRRLDSMVGSFKL"
     gene            23875..24831
                     /locus_tag="AOT11_00105"
     CDS             23875..24831
                     /locus_tag="AOT11_00105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="ASM99230.1"
                     /translation="MQQRSFDALANYLQSQIVGQPELVKQLLIALLADGHILVEGPPG
                     LAKTRAVKALSECIEGNFHRIQFTPDLLPADLTGTDIFRPEKGDFKFQAGPIFNHLIL
                     ADEINRAPAKVQAAMLEAMAEGQVTAGRNTYPLPELFLVMATQNPIEQEGTYPLPEAQ
                     LDRFLLHLNVDYPDAAHELAILRINRGEAKGEQAPEKPLVTQQEIFSARQEVLNIQMA
                     ESLEHYLVRLVMATRQPSHYNGELAEWISMGVSPRATIALDRCARAYAWLDGRDYVTP
                     GDIQTMAYPVLRHRLLLSYRAQAEGISANQVIDKLISLVGSA"
     gene            24835..25752
                     /locus_tag="AOT11_00110"
     CDS             24835..25752
                     /locus_tag="AOT11_00110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosolic protein"
                     /protein_id="ASM97881.1"
                     /translation="MTPVTLPPHCNGVALSLEELLCYQSQAVRWIPPARSVWSHLSGG
                     HASRVRGRGMDFEEVRQYQQGDDIRSIDWRVTARTGKAHTKLFSEDKEQAVILYLDLN
                     SSMFFGSRYVYKSVQAAHLASVILWTTLAKKDRFGAMIDDGKTLFEHKPSALVRNGLA
                     FLNQLTQRHNEQLGRATESRLPFSQTIERLKRMSPKGCEIIFISDFIKMNEQELNQIT
                     QLRQHNNLRLVQLYDPLEQGETRYRGSVLASDGQHSRWFDFGSKKQKLALKNNFDQHQ
                     QSLRLLSYRNGIPFSTLSSAESLINQLSV"
     gene            25758..26228
                     /locus_tag="AOT11_00115"
     CDS             25758..26228
                     /locus_tag="AOT11_00115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97882.1"
                     /translation="MTTNSTPLELQPLILPAVPSWFPLAWGWWASFASVVVALLLLTA
                     FFLWRKKRLKAKRAALKLFVKPITPHTPSSAIELLRQAALCYYPREAIASLHGEQWYQ
                     FLDLQLGETRFSDKMPLWQAALYQNKHGEHDSELVNDCLVWVEKALPPKRGMRG"
     gene            26221..27192
                     /locus_tag="AOT11_00120"
     CDS             26221..27192
                     /locus_tag="AOT11_00120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="ASM97883.1"
                     /translation="MAEGFEFLWWWAFFLLPLPFLAYHWLPQVSNKNTLRLAYLPKEI
                     EAAGVKNKFSKLVTLLIWCSLIVASARPVWFGEPIEHFPEYRDLMLVVDLSGSMQQED
                     ILQEGDYIDRLRAVKNVVTQFIEQRQGDRLGLVLFADHAYLQTPLTADRQTVANQLNQ
                     TIIGLIGQKTAIGDGLALATKTFVDSEAPQRVVILLSDGSNTAGTLDPIEAANIAKKY
                     GVKIYTIGIGAGEMEVKQFFMTRKVNTSADLDEKTLTKIATMTGGQYFRARDAQELQT
                     IYQAINQLEPVSKDAQVWRPQQEWFVYPLSFAFVLSILLFVLRRNHV"
     gene            27185..29047
                     /locus_tag="AOT11_00125"
     CDS             27185..29047
                     /locus_tag="AOT11_00125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97884.1"
                     /translation="MSELIFLEPKWLFGLIVLPVAWLFWRFKRQTSQGPVAAHLSQTP
                     TKGAKSTWSILLWLSAWVVAILALASPSWQHTTRPNFNNHQNRVLVMDMSQSMYAQDI
                     APSRLQQARYKVLDLLPQWKEGNTALIAYAGDAYLLSPLTSDSQTLANLIQNLSPDIM
                     PYQGSRLTSALMLAKAQLEKAGAAKGDIIVISDDIDDQELQAALKLVANSAIRVSILG
                     VGTPNGSPVPLPNGSLLTSSTGQVVVAKSDFNNMAALAQKTGGYFAPIQFSNQDVVEI
                     AAATQANSEMHQAKANNTQQSEVRENGGYWLLPLLLLAGLGLFRRGFVWMAFVLSLPL
                     TQIPSAHASAFLTADQQGKSLFDQGQYKAAAEQFSNPQWKGSAAYKAGEYEQAATLFA
                     QSDSAESLYNLGNALAQNGQYDDALEAYQKALAKNPNLKQAKTNREVVEKAKQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSNRDNQS
                     QSENRENAQNKAKEKARESDEQGDAQRQKKPSEQGEEQVKSSDKPAQERAPKREAEPE
                     NVEAQQPAPKNADDPDFKKLESVENARDPAYLLKAQMLLQAQQKPAPDNKDKTW"
     gene            29058..30689
                     /locus_tag="AOT11_00130"
     CDS             29058..30689
                     /locus_tag="AOT11_00130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein BatD"
                     /protein_id="ASM97885.1"
                     /translation="MNRMTPFFILLSTLFFTPFLAAKSLVASVNKTKVSKNEVIQLTV
                     RADYSLDANDIDFSSLSQDFFTSSPRFVNSSNYINGQSSKLSEWTLSIAPNRAGIVTI
                     PAFSVDGESTAPIPLEVSVDQHEPNVSDIIQYSMQLETSTLYPQQSTQLKVEIRILAD
                     PRRLENPRITPPSIQGVEIEPQGQTRQFQRVEQGLQVTIIEQNYQLTANQPGLFELKG
                     PLLRGSYIYGDSLTGSTKILTLDGKPQSQSIKVKAIPNNAAQPWLPAQQLSLVQQWHQ
                     DDGENNTVEQGSSITREITLTAKGLNENQLPTLKFDYPASVRVYDEKPVFKTLENGTT
                     QMTLKQVLIPTETGDLSLPSLQLAWWNTVSDQQETAALEGRQLKVTPGSAQVFTLPEQ
                     PTLASETNLRPDSTHQEPIQNTTIWFYLTWTFASLWILTLIAALYCYKHRGTSADKPQ
                     NATSNNALESMQALQKAIADNDAVKIEALVRQWMKTATVSQPVKQAIESELKAMHQAT
                     YSRQPSPWQADHLLSLIKQSRSASSDKASFDMPKL"
     gene            complement(30773..32893)
                     /locus_tag="AOT11_00135"
     CDS             complement(30773..32893)
                     /locus_tag="AOT11_00135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM97886.1"
                     /translation="MNFRSFMRKVSATRDHRLLAETMFEYLAELMEVDAMAIFDDPCV
                     NTSLSLRFWSGQPAPLVDFPSSFWQWARQFDTSESLIPLAINTCNWDHRDLLGGNSYI
                     MMLDNFPMLRTYILIQGVKAGSADHIYEKTHDAMQLIAARWQCIRAEKQASLEIKNRD
                     IREAQYIDEINHRERFIDNMKLVQEVALEISNPSTLNDLYRKAVEALRDRLGFDRSTF
                     MLLDMKKRCFNGTYGTDEHGNTISEFHTQYDLHQLGEEFVTALSSRDTNLVISNETPL
                     YTAGKVVGQGWNLMLILRDGHEPFGWLALDNFIHRKPITSYQKQMLQSFGSLLSQIYI
                     RKRQEQNVRMLHSSMVELSRCTTVSDVCKSAVSFAIQHLGVDRMAVFLTDENCTYMQG
                     TWGTDIQGNVVDESYFFGETQDFALINLARSMPNEVAFEDSVPIYHDCNIVGFGWGAM
                     TLLTSNTNGPIAFIAVDNLLTRSPLTSQLREVIRMFASSLAEVLQRTQAQEAIRELNE
                     NLEKEVRKRTQELEEANRQLEVLSKLDPLTRLGNRRMLEHVMESICHSEEEKVLAFGL
                     ILIDIDHFGLFNNHYGHLEGDIALMRIGHILEHHSNGKEEVFCRIGGEEFVMLMAGSE
                     ASGVLQRAECIRQCIEQEQIKHQVNPNGDRLTVSIGVAVDQVQARNLHFDKLYQQADV
                     ALYRAKAEGRNRVCSYESLSVEAM"
     gene            complement(33142..33891)
                     /gene="pstB"
                     /locus_tag="AOT11_00140"
     CDS             complement(33142..33891)
                     /gene="pstB"
                     /locus_tag="AOT11_00140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005452851.1"
                     /note="ATP-binding protein; PstABCS is an ATP dependent
                     phosphate uptake system which is responsible for inorganic
                     phosphate uptake during phosphate starvation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter ATP-binding protein"
                     /protein_id="ASM97887.1"
                     /translation="MNKFDIENLDLYYGENQALKAINLPIPVRQVTALIGPSGCGKST
                     LLRCLNRMNDLIEGVKITGKLAMDGEDIYGNVDVADLRIKVGMVFQKPNPFPMSIYEN
                     VAYGLRAQGIKDKKHIDEVVERSLRGAALWDEVKDRLKSHAFGLSGGQQQRLCIARTI
                     AMEPDVILMDEPTSALDPIATHKIEELMEELKKNYTIVIVTHSMQQARRISDRTAFFL
                     MGELVEHNDTQVIFSQPSDDRTRGYVNGDFG"
     gene            complement(33950..34813)
                     /locus_tag="AOT11_00145"
     CDS             complement(33950..34813)
                     /locus_tag="AOT11_00145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="ASM97888.1"
                     /translation="MERAKLKQSRQVKDNILNALVWAAAALTVGFLFWIIWYILSNGL
                     QHVDWSFISDNYTRTGEEHGIFPMIISTIYMVVASIAVAAPLGIMTAIYLTEYAKVGS
                     RLVKVIRFCTESLAGIPSIIFGLFGMTFFVAILGLGFSILSGALTLSILILPVIIRTT
                     EEALMAVPQTYREGSYGLGASKIYTIWRLILPSAMPGILTSVILSIGRVIGESAPVFL
                     TAGMVARIPDSLLDSGRTLTVHLYKLTTELFTIDEWNQAYGTATVLIVVVLLINMVTK
                     LIAKRFNTATY"
     gene            complement(34835..35767)
                     /locus_tag="AOT11_00150"
     CDS             complement(34835..35767)
                     /locus_tag="AOT11_00150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014234911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="ASM97889.1"
                     /translation="MTIATNSEKLMNNEAKAIDKPRLRTQKRIDWRERIFHGLFLTSA
                     VIGIVSLAVIAYFIIRESIPAFQEAGVSGIVLGQDWLPPALYGVATMIVASMVSTFGA
                     VLVGVPVGVLTAVFIAEIAPKRVADIIRPAVELLAGIPSVVYGFFGLVIIVPLIQNVF
                     DVPAGNTILAGIIVLGVMILPTVITVSETSIRAVPRAYKEGSLALGASKIFTIFKLLV
                     PAARSGIMTGVILGIGRALGETMAIIMVMGNAPAMPEGLLDSARTLTANIAIEMSYAS
                     GVHANALYATGVVLLVFIMVLNAALLYLNREKAK"
     gene            complement(35856..36677)
                     /locus_tag="AOT11_00155"
     CDS             complement(35856..36677)
                     /locus_tag="AOT11_00155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter substrate-binding
                     protein"
                     /protein_id="ASM97890.1"
                     /translation="MKKTVIGAIALMSALTVTTASAKETISAVGSSSVTPLMEVFSET
                     YMKKNPEVFIEVQGPGSSAGVKAAKNGSADLGMSSRDLKSSEKETALVEEVIARDGIA
                     VVVNPKNTLKGLTAEQVSAIYKGEVTNWKQVGGEDKPIVAITRDTASGTRGAFEDILK
                     LKKKISGKEVSAISQRAQVANGNGALKTMVASNPYAIGYISLGTVDESVHPLAIDGTD
                     ASIPNVKNGSYKVARPFLVLYKQGKPSAETQKFLDWMLTPEAQAIVEKKGYISVN"
     gene            37147..38790
                     /locus_tag="AOT11_00160"
     CDS             37147..38790
                     /locus_tag="AOT11_00160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM97891.1"
                     /translation="MRRFLNTLSIKAQVLVPVAFTIVLLLGGVTLGASNLKHAFERVT
                     ISTEQLIVHKGELGEIVDNMYGMRIKAIYSLFRPDDLTTLISVLSDKQNEIRSLLNAI
                     ETVPGLKNEVEQMRQALNHYVDYSRDVMLPLLKVKHGESYLSSDFQQQYDVAMTAYRK
                     AGEEMVKAIDVLSQKLNQIAIEDVKDNGNQHNATLTFSVFAMLGILAIAAIISMALAH
                     MIVKPIRSLQTTMQAVAKGDLLVEAQAEGKNEVAQLAQDVNTTIHQLRNTVDALVRIS
                     VDVASASTELAAVMAQSSVNSDQEKNEVEQVASAVSQLESTAADVTANAVKADTASSQ
                     ANQLAKHTLSMFEQNNRANDKMAEQLNQAAGVVTSLKVQSEQIGKVIEVIQSISEQTN
                     LLALNAAIEAARAGESGRGFAVVADEVRMLAARTQDSTKEIQAIIEELQTQSGRANES
                     MNSSLETLASNQTLAGEVSQSLSEISHSIEELTLISAQVATASEEQNQVTKDINQNLS
                     NIYELVSQNVTGITQAAAASQELSSLAENQKEQLGYFKV"
     gene            39102..40991
                     /locus_tag="AOT11_00165"
     CDS             39102..40991
                     /locus_tag="AOT11_00165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM97892.1"
                     /translation="MKQSMLTLKNKIILSVLLCVLTITGVFIWQSSSILWQQTRSGIY
                     ARATSVSEAAAPALQYWLENNIQILESAAHIEQLTQAKEAMRHAKESAKYLDVYYATR
                     DGSLYLSGQDAKYPNYDARNAEWYQQALQENRSIVSAPYVSTETQQAMITLATPVKVR
                     GEIIAIMGADISLKSVQDNISGYKVGDNAYAMLINEQGTIVAHPQTSLEMQPFSAYSS
                     EISLAGIHQAMENNEIQRLSRNGAEKLIYFDKINHTDWILAIEMDRQTEEQSYSELLQ
                     KLLLEGVVMTLVLIVIISLFINYLLKDFYQVSHALKAIAQGEGDLTHEIQISSKDEVG
                     QLAQNFNTFVKNMHDMVSQIVALSQQLNQQAQDAAQQAQHRSQRIATQQDEINMVATA
                     VTEMSTATHEIALNAENTSKEGEATVDVSRQGVSEVQRSQQSILALASDVERSAAELQ
                     ELEHHVHSISNILSVISEIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRILSQRT
                     HTSTSEIQKTIETLQSATHKVVNTMTASHANAQQSVSDAETACQSLENIMASVQRIND
                     MSTQIATAAEEQSLVTEEITRNTQAVNDVSNELAQAAVTATEQAKQLSDYSKQLHQLV
                     SQFKL"
     gene            complement(41102..41821)
                     /locus_tag="AOT11_00170"
     CDS             complement(41102..41821)
                     /locus_tag="AOT11_00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97893.1"
                     /translation="MLPKAVSNRRRCDCWVKTAAKSNTLKFIPTWWKPITAPLSNYPS
                     VWLQQKGTKMKKTLTTLALLLASSSVWAEQQCLDGLTPTASNARFSYSDLGTVTDKQT
                     GLTWMRCAVGQQWNQAQERCEGEAQLENWQSALQTAQAVDDENANHALFNFAGKRGWR
                     MANIKELVSLTEAACHSPSLNARAWGSAYTVELGNLAVYIWSNTPSTQGASALSFDSA
                     NGEVYHHAQTQGLSVLLVTEQ"
     gene            complement(43137..45422)
                     /locus_tag="AOT11_00175"
     CDS             complement(43137..45422)
                     /locus_tag="AOT11_00175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propeptide, peptidase"
                     /protein_id="ASM97894.1"
                     /translation="MKTKLTLLALLLAMNPMVDAAQWDYPEERVTLNSVEQVQQFVQQ
                     HYADLGEFKLRYQTTSLLGHHYNFDVWQHGQYQQQKSLVVTTDQQHRVARVFRSLENT
                     VLLNGEPTTAVELEHPRRLEADFPPALEQGELETVEIQVFDPDLRTQQQLPAPSSGWN
                     SMDDYPGAMEYQRRKVSLLKTDQGYFLRNRNVVEVDAKALISVETQDGVPVRDESGFA
                     APSGISHFAALTDLQTLDSNDPRFLAVMAFYHLDHSLEYTKTLGYALFNEPLKFDGRG
                     LSANNSTYYKGPQAAMFGLGGVSPDAMDADVILHELGHGIHYQIVPDWAYGHSGAIGE
                     GFGDYWAGSNSYRQQYLDAARRGQEFELDTVFNWDGVFGNRLSTRSLWNQRARYFEHG
                     HYRAHESVGGELGDELWSTPLFQALKESVSLLGDGDERVFHQFDTIVLQGMYGLGRGV
                     KMHDLAESTVLAAATLYPEKPYAEILQRHFKRHGLLKAPFTSRLESKYITDAKPLSIE
                     LVANGRAAEVEARLSLQQQILVEKQSQLTHSLTLSSELPEGLVCGQPFVAQVETDYRH
                     QPWLAKQQWQESITLVRGVPQLVNSAQQMDARLNDAGTDAQGRFNVGQQIFSQTFLDR
                     DVTIGEQFAIYLDIDHASMADLSITLTSPKGDKLVLWNHQISQGNGFKGYFTVAHDAQ
                     LAPLLGQQAWGRWRLEIMDSIEGNQGRLNAWGISQFEQYQCNETRADSTSKKSGGQLN
                     LFVLWALFSIFVARAFCSRQN"
     gene            complement(45439..47574)
                     /locus_tag="AOT11_00180"
     CDS             complement(45439..47574)
                     /locus_tag="AOT11_00180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel"
                     /protein_id="ASM97895.1"
                     /translation="MKLTPVSAAVLSVLAANFVHAENDHAVMEEVVVTANQIEQPLSE
                     VAGSVSVISGKELEKKGQTELYDALRNEPGVSVTGGAGRPQNIAIRGMTGNRIMIVRD
                     GVQSADGFGANDINDKVGRNSFDLVNVKSIEVVKGASSSIHGSGALGGTVVIESMQPS
                     DYLKNDDFYADVATTYTGISDKTQLMSNLAFRSGNTDSLLTVAYWQGEETRNFHQDNY
                     QRELEGASANYQLNHFVGDALMLSIAADAYREGQIRREGSPGIHADGKWDQNQYYEDS
                     HVTDLGVSAGLEYQPVDAFWFDEAKAKLYWRDMADVEDINRLYGRLDQNGITEQKRSL
                     DNNEFRDQLVGFRADMTKAFATAQTEHQLAYGLKVNSNRYSRTSERQSLVSGGSSAFS
                     KQPFTPAKALSVGVYGLEMMQYGRWTTTLGLRFDAHRLTPDGDAHSNGFAMKNIDSQE
                     WSPSFSIARKVADAHQIYFSYNHGYRAPTYDKAYGYVSHEDIPFTPFVIIPNMDLKAE
                     TSDSFEVGHKFDNGTSRLYVALFYQQFDDFIDVKEVGMAGPVTLKQYQNLNGVETYGA
                     ELSAAHQINEQWLLATKAGYVDGKNDQGEYIRTLTPVEGNVELSYAKQNWSASLLWNW
                     AASMDRVPVCVNDFNQEVSCAKTESWHSFDLFASYQWNKDLTLSASIVNLFDNEYIRY
                     QDVAGISQAHTTYSTEPGRYFTANVKYQF"
     gene            complement(47575..49629)
                     /locus_tag="AOT11_00185"
     CDS             complement(47575..49629)
                     /locus_tag="AOT11_00185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="ASM97896.1"
                     /translation="MKFIHLLLMLAWLPAGLSFAQNSSVTDKDAKDKYEWLRDDSRSS
                     PRVRAYLEEQNQLTAQRLLESESLAHMLEEQWQAMQPEKGEEPWGYREGEEWKLTNQG
                     GSLQLMRRDPFTQQAEVVFSFAERQNNTAYYQVGEWAISAKRTHLLFTEDRQGSERYQ
                     AVLVDLKQGHMVEIAKDLDTPVLLSRDGLTVYVIEKDQSQRPSNIMAIELETGRQHSL
                     WQETRADWLMSFYAASDANYALLQSNNENSSEQKILDLRTGEVSAVLRKAEQGMEYYA
                     DISQQTLFVQSNHAGDFQLYQAPLQAPTDWQRFSDHITTLNQFYLFSAGVVVSASQGP
                     DSLLSVLSYRGELRKQIPLNHAGEAAWVSRNGDFASNKVRIRSMSMTTPPTWRELDVS
                     SLSIKAIAQDRYANYQPSLYRTEQILVQSSGVEVPVTLAYRRDKLTATSPVILYGYGA
                     YGFTMKPYFMPQTISLLDQGAIYAVAHVRGGGYFGASWHDAGKGINKSNAIADFVAAA
                     QTLRHVRLNAKGAEPVQRDIYLMGSSAGGTLVAAAINQKPELFSGAVIKVPFVDVLNS
                     MSDSRLPLTEQQYGEWGNPELPAQRKAMQDYDPYLNLQSATYPPMLVQIGWHDQRVPY
                     WEGAKYLTKLAALSTGTGPYLLQTDFDSGHAMDRRKGLAQQAKEYAFLLSLIKTSNKS
                     EQ"
     gene            complement(49858..51201)
                     /locus_tag="AOT11_00190"
     CDS             complement(49858..51201)
                     /locus_tag="AOT11_00190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase"
                     /protein_id="ASM97897.1"
                     /translation="MEKPLQFKDLGLDNRLLKNLKHLDFQKATKIQQQAIPVAIAGKD
                     LLASSKTGSGKTLAFVLPMLHKSLKTKALSARDPRGVILAPTRELAKQVYGELRTMLG
                     GLSYDATLIVGGENFNDQVKALARYPKFIVATPGRLADHLEHKSVFLEGLETLVLDEA
                     DRMLDLGFAPELRRIHNAAKHRRRQTLMFSATLDHAEVNDIASEMLDAPKRIAIGVSN
                     EEHKDITQRFYLCDHLDHKEALLERVLSEAEYRQVIIFTATRSDTDRLTEKLNEKKLK
                     AIALSGSLNQNQRNTIMSQFERTVFKILVTTDVASRGLDISTVTHVINFDMPKHTEEY
                     VHRIGRTGRAGNKGDAISLVGPKDWDSFKRVEAYLQQDIAFSEFDDLKGKFKGIKPRK
                     PDFRAKKQDTTKKARPQKKAVSKAPAKRDKSFYQNVAVGDSVFIPKKKPAAPTEE"
     gene            51558..51836
                     /locus_tag="AOT11_00195"
     CDS             51558..51836
                     /locus_tag="AOT11_00195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97898.1"
                     /translation="MNKILIAAATSSVLLLAGCASGPDEQTKAAMAQVEDLKNQVDVL
                     TKEVAALKSNQADAEMKAKEAATAAMAAQEEAERANERIDNIAQSYTK"
     gene            complement(51857..52768)
                     /locus_tag="AOT11_00200"
     CDS             complement(51857..52768)
                     /locus_tag="AOT11_00200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="ASM99231.1"
                     /translation="MPKPTLITLFCAALLSWTSDAATYDLPAEGSRLIGRIQHHVVEK
                     GETMANIAKQYDVGFLALMAANKGVDPFLPQEGYVLSIPSEMVLPPVEYQGIVINLAE
                     LRLYYFEPELGKVHVFPVGIGRVGRDTPEMVTSIREKRPNPTWTPPASIRKEYREKGI
                     ELPKIVPAGPDNPLGEYALRLAYGSGDYLIHGTNKDFGIGLRVSAGCIRMEPKDIEWL
                     FSQVDKGQRVKIINQPVKVSLEPGRIVYLEAHEPLTRSNGVQDELVVPIELDWWLSEL
                     NLNDSKAKAVIAAQNGVPVEVAAPGFE"
     gene            complement(52775..54184)
                     /locus_tag="AOT11_00205"
     CDS             complement(52775..54184)
                     /locus_tag="AOT11_00205"
                     /EC_number="4.1.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422375.1"
                     /note="UV-induced DNA repair; converts cyclobutane-type
                     pyrimidine dimers created during exposure to UV ratiation
                     to monomers; light dependent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photolyase"
                     /protein_id="ASM97899.1"
                     /translation="MKLVWLRRDLRSVDNTALNHAIATSQEVVACFVATRLQWRDHHM
                     APMQADLIARRLAVLAEELNALNIPLLYDEVDDYAQSATRVASWAEQLAVSEVVFNRE
                     YEVNERVRDEQLINQLASSEIGALDVEDKCVQAPGSVLNKQGDYFKVFTPFKKAWLKS
                     FVPPQIIKTSAAQPVVLPEALQSSLWHEQAPFSYPRESSEAWSVDSQQIRETLRRFCH
                     EEVDRYHEQRDFPATAGTSVLSPYLAIGAISVRQCIARLYWQQSYLSNGREVWLSELI
                     WREFYHHLIHFEPKLVKGQGFVEWEKHLLWPAKPDWFERWCRGETGYPIVDAAMRQLN
                     QTGWMHNRLRMIVASFLTKDLHVNWRLGEQYFMQKLVDGDFAANNGGWQWCASTGCDG
                     QPYFRIFNPITQGEKFDPNGEFVKHWLPELAQVPSKFVHQPWNWPGHMQLDYPAPMVD
                     HKQEREITLSLFTQAKDCL"
     gene            complement(54193..54999)
                     /locus_tag="AOT11_00210"
     CDS             complement(54193..54999)
                     /locus_tag="AOT11_00210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="ASM97900.1"
                     /translation="MVCNEENAVEKWYAIREVSEITGVKPVTLRAWQRRYNLVQPERT
                     EKGHRLYSEDNIEMIREIQGWLAKGIAIGKVKDLLVNPDAEGALAAESRELDEVERML
                     TALSVLNAGKAESVLNTVLKEYPFSVVCDQFLYPVMTALERVKSTTRSLQKGLLRSML
                     HTRLTFIVEAERKAASKGKCLLLSYEGGDFIAGWMEAVTLSEQGWYVTLIDGVEDLSG
                     LDFADVTEHYQRVHIFSHRALQEKQMNMVKSMLDNNKVTLSDVLARLQFG"
     gene            complement(54989..55942)
                     /locus_tag="AOT11_00215"
     CDS             complement(54989..55942)
                     /locus_tag="AOT11_00215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97901.1"
                     /translation="MSSSTLKIGISACVLGDQVRFDGGHKQSRFVVQELMPHFSFVPV
                     CPEVGMGMPVPRPTIRLISNEERIAMVETKNPDKDYTEQMLSYSEQQVDRLMAHSLSG
                     YIVCAKSPTCGMEKVKVYKAHGAEKEGVGLYTQTLMRKMPWLPVEEDGRLNDPVLREN
                     FVTRVYCLHDFNTNVLNQLSRKSIVEFHSRYKLTLMAHHPESYKTLGRLVAKIADYDI
                     NEFAVEYRQGLMVALTHRASRKNNTNVLMHVQGYFKTALNKEQKSELAQVIDDYRTGM
                     LPLLAPLTLIRHYLNTHPDGYLESQKYLKPYPQELKLRYGL"
     gene            56358..57068
                     /gene="deoD"
                     /locus_tag="AOT11_00220"
     CDS             56358..57068
                     /gene="deoD"
                     /locus_tag="AOT11_00220"
                     /EC_number="2.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004407647.1"
                     /note="catalyzes the reversible phosphorolysis of
                     ribonucleosides and 2'- deoxyribonucleosides to the free
                     base and (2'-deoxy)ribose-1- phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine nucleoside phosphorylase"
                     /protein_id="ASM97902.1"
                     /translation="MATPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVR
                     NMFGFTGTYKGKKVSVMGHGMGIPSACIYVHELIAEYGVKNVIRVGSCGAVRDDVNLM
                     DVVIGMGASTDSKVNRIRFNDHDFAALADYGLLEEAVKQARAQNVPVKVGNVFSADLF
                     YTPEADIFEKMEKLGILGVDMEAAGIYGVAADLKAKALTILTVSDHIIRGEKLSSEDR
                     QKSFNDMMKVALETAINL"
     gene            57119..58588
                     /locus_tag="AOT11_00225"
     CDS             57119..58588
                     /locus_tag="AOT11_00225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate dehydrogenase"
                     /protein_id="ASM97903.1"
                     /translation="MSNGELPKDADGLQLNFCKTLACDNFGLSDAKRYVLQHANPKRP
                     AMVCRECGAFPPLLNNREVLNELHRLRQLHSDGLPACRNDDCANFGLSVHTHKHLYHA
                     FGYSGDRQRYRCKACQSTFVDKWSGANKKLQFQENLMGLLFTGYSVREICRKLAINPK
                     TFYDHVEHIASRCRRKLATIDARWVNHALNYELASHYQRLQPNSDNGVYWMATGDAHS
                     GYILCQHVNYSAKEEPLGTVDHNPYEAISRFVSPQYTAEAKEPENTPSDYLRERIDQK
                     YQTILARGNVEDPMGNMATFNYPTKGAVVRPPYTSYAHYLHVLDMCNEAGRVSLYMPQ
                     DPLLRSAALSVCLPRIQSQNVDLLYVDEDPSWDLNQSFEKFDIVYMSWWRDRWAIANQ
                     GSKLKGICYLAGNKNLPEQWFNKATTRNISFYQSRFQLLFEGFVNEPRRKLRPGGVLP
                     LLDIFRAWHNLCYQDKHGQTPAQRLGVTESPLTIKQLLS"
     gene            58749..60248
                     /locus_tag="AOT11_00230"
     CDS             58749..60248
                     /locus_tag="AOT11_00230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM99232.1"
                     /translation="MDKSQLQLDAELRQIKARVNSEPAEVLKIAEQCYIRAEQIVYPE
                     AEIEALLIQSHCCWCLMDYRRGLKLIKEAHSKQNRLDNDDRLPQILHLYALQYWGQAK
                     YYSAQQYWINALEQSALIDETEIQIEALIGLGNVWRITNDYKLAASTHELAVKVANNA
                     RINWAEGKARILLAWDYYLLNNYVEMLTILDGASEVLKDYPDNTWQAEIWDFRGLALL
                     GLERLDAADEATKKAHDLAVEHNLTWMKAHSFISRARLELLRKNTLNASVLLDQAEIS
                     ALQFDNGELLSQICFQQSKVAEEQGNFEVAYQAFRKYRHYSLQMLREQTNRVGLDKAR
                     SSKRQLEQRARKLINRIRAQHEYDPERQFSNVVSETYWWEQLVLFKTELKQANHSIIM
                     IQHADPAYLEVCTELAHSLSTPKDLISRLSSDRVAMLIREKDEPADALFHVVSTMISI
                     YPWQRRGLNGPLPQLSLQDILTFPFTLEQLEDSHRTKTKGKKKHGKAAE"
     gene            60229..61812
                     /locus_tag="AOT11_00235"
     CDS             60229..61812
                     /locus_tag="AOT11_00235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM97904.1"
                     /translation="MEKLLSKVTDAGFDPTSVSGEEAIILWNHVRQHVASTNTEKAHC
                     YIISAEYRFKLKQVQLSIDELKEALSLLTLPENAEDILTVKANLSERLVDIGDYAGAL
                     NEYVGASNIAVEHGFLDEYVTSVLGMGNLCDAYGDHQRALRYYQKIDGIDHAISSRSL
                     RLRYKLYMLACYINLGRISAAKDLLKECEELSILVSDKILSGQILLYQAKIHRLEKDY
                     VSALLSLSKVQYISGNLNSTWLSVMNRIEMTYSLCAIGKKELANLLLTSSSKNIEMKA
                     SPIIAKQFYQAMSEVLAAQGLFKEALVFEKKGFRIESDLMKHIPISELGAAQLRRISR
                     FELQLKLILSEIENKELKETTQQHKNTVAQLQQDVFTDPLTALHNRRWLDVKLKDLLL
                     HDTTFALMVIDIDHFKSINDELSHLVGDKAIVNVSSELAAYFRFRGASCVRFGGEEFL
                     VILENTDLAKAELHAENYRERIFQFGWREILGERGLTVSIGITMHRDGENTQRTFYRA
                     DKALYRAKANGRNQVCIEE"
     gene            62019..62399
                     /locus_tag="AOT11_00240"
     CDS             62019..62399
                     /locus_tag="AOT11_00240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="ASM97905.1"
                     /translation="MFLDYFALGLLVFVALVIFYGIIVIHDIPYEIAKEREHPHQDAI
                     HYAGWVSLFTLHTIWPFLWIWATLWRKERGWGFQKLEEEQHDMHHRVDQLIDEVKQLR
                     EEVDQLRNAQRVPATLVITSEEEK"
     gene            62402..63532
                     /locus_tag="AOT11_00245"
     CDS             62402..63532
                     /locus_tag="AOT11_00245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97906.1"
                     /translation="MDLLLILTYTALCIAIFKIFKIPLNKWTVPTAVLGGVVLIGTLI
                     LLMNYNHPFTQLGNQVYSTTPIVSGVRGRVIEVPVQANQTLKQGDVLFRIDPIPFEAE
                     VAKLEAKVKEASQGALGLESTLKEAEAAVIKAIAERDKAKREYERYKRGYEKGAFTEQ
                     QMDTTRQAFKAAQAALEVAQSKQDQAQIALDSEVGGENTQVAQLLAELRKAQFDLEQT
                     VVRAPTDGYVTQLALRPGVMSVPLPLAPVMTFVHSEEKIYTAAFRQNSLQRLQPGFEA
                     EFMFRALPGKVFKGEVIEVLPAIGESQFQARGALLGTEALRTSGRVFATLRITDDLSE
                     YHLPMGTAVEVAVYSDSFTHVSIMRKVLIRMKSWQNYLYLDH"
     gene            63766..64314
                     /locus_tag="AOT11_00250"
     CDS             63766..64314
                     /locus_tag="AOT11_00250"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7N6E0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97907.1"
                     /translation="MNLSAKTVVVIAIGAALYGIGGLPMFGIPVFANTTLKPAMAVLA
                     LFSVLFGPLVGFLVGFIGHWVTDLFAGWGVWLTWVLGSGIVGLIIGLFPSLTRNRLDK
                     GEFNLKDFSLFIVLALLGNVFGYGCSAFLDTILYAEPFTKVFTQLTIIASGNTVLIAI
                     VGYFILKSVAKRNKQSRNLTEA"
     gene            64321..66045
                     /locus_tag="AOT11_00255"
     CDS             64321..66045
                     /locus_tag="AOT11_00255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATP-binding protein"
                     /protein_id="ASM97908.1"
                     /translation="MTIEFSNFSFRYESLDKPTLRNINLRIEKGEKIVIIGQSGSGKS
                     TLGQCLNGLIPHAIKGEVSGSLTINGQETAAFAMHQFTEQVGTVLQDTDSQFVGLSIG
                     EDIAFALENQLTSNIEMYSLVKATAKMVDLQQMLQRSPHDLSGGQKQRVSLAGILVDD
                     VDILLFDEPLAALDPKTGKRTIEIIDELHRKTGKTVVIIEHRLEDVLHRHVDRIILMD
                     GGEIIADTTPDELLASPLLAQYGIREPLYLTALKSAGCHLALDDHPSSLSKLPLANYQ
                     HAMTDWFHQANTTSHHASSETLLDVRNLTYSYDGEKNALEGVSFDVQRGEFVSILGKN
                     GSGKSTITKLIMGVIEPDNGTIHLNGQDLSELTIFERSQKVGVVMQNPNHMISHHMIF
                     DEVAFGLRNRGGDEQQVNSKVLEVLELCGLSKYRHWPIEALSYGQKKRVTIASILALE
                     PELLILDEPTAGQDYRNYTSMLSFIEKLNRALGITVVIISHDMHLVLEYTTRSIVIAD
                     SQLVADAPMTDVFSNPALLDRANLTTTSLYELATRLNIAETNAFMQHFIDVEKASRRE
                     KTVERNVA"
     gene            66042..66884
                     /locus_tag="AOT11_00260"
     CDS             66042..66884
                     /locus_tag="AOT11_00260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97909.1"
                     /translation="MKDNKMKFGINYIDTQSPLHKLNGITKFLLFIAWVTVVLTTFDL
                     RLISVLIIVGLGLLKMTKVPFHVYKPLLLGTASVLLINALFMFALAPQQGSEFMGSTT
                     VLLPLPGQYSLTQETLFYLLTVTLKYFSMFPIALVFVFTTHPTEFAASLNRLGVPYKI
                     AYAVSLTLRYLPEVKKDFVNIMHAQQARGVELSKKAPLFTRMKNVAKILGPLIFSSLD
                     RADQISNAMTLRGFGRHNQRTWYSLRPLSRSDKLCMMGIALMVTLAIAKRLLEPQLFW
                     YPFS"
     gene            complement(66942..68123)
                     /locus_tag="AOT11_00265"
     CDS             complement(66942..68123)
                     /locus_tag="AOT11_00265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97910.1"
                     /translation="MRAHRHRWQTPQNFLLLISIIVPIAFSTWMALLNNFVIEKAQFD
                     GADIGLLQSVREIPGFLAFTVVFVLLFVREQRFMLISLAMLTLGTALTGFFPSLFGLL
                     ATTLLMSTGFHYFETLKQSLSLQWLSKEEAPEMLGKLVSIGALASLVTYGAIWLLLEV
                     WQLSFQMVYLLAGGVGFVLVMLMAFAFPQFHTTVVQNKKLVLRKRYWLYYALTFMSGA
                     RRQIFTVFAGFLMVEKFGYSAADITLLFLANYLFNFLFAKRIGRFIGVVGERKALTFE
                     YVGLIFVFVGYALVQSAEWAAALYIIDHLFFALALAIKTYFQKIADPADMASTAGVAF
                     TINHIAAVVIPVTFGVIWLVSPASVFYIGAFMAAISLLLSFNIPAKPEEGNETRILKW
                     S"
     gene            complement(68275..71541)
                     /locus_tag="AOT11_00270"
     CDS             complement(68275..71541)
                     /locus_tag="AOT11_00270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="ASM97911.1"
                     /translation="MRIQRFTANSIALVLLASLSNPSLAQESVATTTTNSQPTWLRDI
                     ALSPDGQRIAFTYAGQIWLIASKGGEAIPLTSADSYSENPIWSPDGESIAFTTDRFGP
                     GDVFLVSANGGDAKRLTYHFSKDVPYAFSPNGQEIYFRSSRIGDIESSVNNGFAGSAS
                     AQIYSVDVSGGREKLLLANPISSLSINGQTGEYLYTDLPSPMEQEWRKRDVSDAARDI
                     WRFDPKTAKHTKLTNYRGEDRNAVWAEDGRSMYYLSERSGSFNVWQRVLSDPSAEPVQ
                     ITQHEFLPVRFLSISQQGDLAYGYDGDIWFKGKDEADAKPLQVTIRQSFLSKGKRFVN
                     LNHEATEIAVSPVAPEVAVVARGDVYVVSLLSGATKRVTKTPQAERYLSFSNDGLSLL
                     YASERNGNWDVFHSYINDTGRSFSTSFDVVEEQLSDEAVDQTQPLYSPDGSKIAYREN
                     SNSIKVYDIKNDSYHVLLDSSQLYSYVDQDLSYEWSPDSQYLVTRNRASYNADIVLLK
                     ADGSEKPLQITNTGFIEGEPKFSHDGQMIYWSTDRNSLREIDKWAVQSDIYLTVLNQE
                     ADFNWKKDDEQRWLEEERAADSGEEPGEQAPQETVVESKGLKHRTYRVTPYSMTPIFS
                     YLSPDNQSLLVANLVGDEVEFTDINTQTGETNVLFTRSSEDVAAVKMEPDIETLVIIG
                     AHGIEELHLPSGEGNYVDYQADANYDFRAEVEYIFDHAWRQTDTRFYDKGMHGVDWQG
                     YGEAYKRYLPGIHNYQDFAELLSEMSGELNASHTGASYGRYQSTWSEPASLGLFYDDQ
                     YRGKGVRVKAVIPGGPADIYQSPIKAGSIIYSVDGIEVAPEMDIYPLLDNKAGKRVRL
                     SVLKPGDKAAQSVLLVPTSLEQEAQLAYELWVEQRKALTEERSQGRLGYIHIPEMGPA
                     SYETLVNELFGEYNDKEGVIIDIRYNMGGNLHDQLMETLSGTRHSAQVTRDGYQLSTF
                     PERRWAKPSIMLANAASYSDGSIVPYFYQREGIGQLVGERVPGTGTAVLWEPQQEQSL
                     VYGIPQLGFKDDQGRWFENQEVVPDVLVYNSPEDIAKNYDRQLKVAIESLLAQLDKTQ
                     "
     gene            71830..72330
                     /locus_tag="AOT11_00275"
     CDS             71830..72330
                     /locus_tag="AOT11_00275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="ASM97912.1"
                     /translation="MEITIRPTSIEDAEALVELYSQPKAQRETLQLPKPSVAMWKERL
                     ASIPAGVYSYVALVDGKVVGNIGFQHSQRPRTAHCASFGIGVHDDFHGLGIGSKLIET
                     VTELADNWLNVRRIQIEVNVDNEKAISLYKKHGFVIEGEAVDSSFREGRFINTYYMAR
                     INPNTQ"
     gene            complement(72385..72660)
                     /locus_tag="AOT11_00280"
     CDS             complement(72385..72660)
                     /locus_tag="AOT11_00280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="ASM97913.1"
                     /translation="MNHVTHDEKNALFQVHLEGGYYATVRYQLHDDVMSITSTRVPEE
                     LRGGGYGKLMMEAVLPIIEAQGYKIVPVCSYVKHYLERHSEWHHLKA"
     gene            72839..73585
                     /locus_tag="AOT11_00285"
     CDS             72839..73585
                     /locus_tag="AOT11_00285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation tolerance protein CutA"
                     /protein_id="ASM97914.1"
                     /translation="MNLPMAKLQGRNHALAPNHAQRLTSTFNSTDALAMIEHGSEITL
                     NVTTPVGTKFLTTSLFVGSHSGNAMLVEIPQISEDDLKFYFQEGFWINVKALSHRGEG
                     AIIHFRSQLTHRLGDPFPVLVLSVPSTMQVAQLRKETRYEVNLPAKAYVNDYKVECEI
                     RDLSRGGCRFVTAPMSRTFTVGDEVSLEILLGKAGGPTLAPLKGKVCNLQRSTHYARY
                     GVEFDDFGKHNAKNLLGHLKFDGTKLKLKH"
     gene            complement(73657..75285)
                     /locus_tag="AOT11_00290"
     CDS             complement(73657..75285)
                     /locus_tag="AOT11_00290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM97915.1"
                     /translation="MQFSLKNLSVRTQVLVPVMLTALALLVSLWITKDKLQAEQDVIT
                     HNTNSLVFYKDTLAKIDDAVYPLRISAVYAIYDANRRDAFLAQLKQGAKEINLDLDQM
                     AKQGDFRTEAAEVRKAINNYIDYSTSAVSFFGRHDQGTVSAAEYNRFIADYRKVGDDM
                     VSAINAMSQKVNRVASETMAKSNRDNVHVQNMATITVLGVLALSLLVAWFLSGMIVTP
                     VIKLQAVMRELSQGNLSVRADVDGDNEIAHLSKDVNTTASQLHSTVEHLIRISEEVAS
                     ASTELAAVMTQSEANAQQELAEIEQVASAVNELASTANNVSDNATSADATARETDGLA
                     KSGLAIFKESAEASQQMSSALNDAARVVLTLKEQSVQINDVIEVIRGVSEQTNLLALN
                     AAIEAARAGESGRGFAVVADEVRMLAARTQDSTKEIQEIIEQLQLQSGLANDSMQESL
                     NMLERNNELTQRANDALVGITEAVANINDSNAQVATAAEEQSQVTQDINRNVVNMSEL
                     VNQNVAGISQSASASNELSHLAEKQKAQLSFFRL"
     gene            complement(75494..75841)
                     /locus_tag="AOT11_00295"
     CDS             complement(75494..75841)
                     /locus_tag="AOT11_00295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine 3-dehydrogenase"
                     /protein_id="ASM97916.1"
                     /translation="MEFTEKDRIALYDIWMSQKAKMHITQMEMTRRLGLNHHEFSAYL
                     RGDTPLTLGFINQLCEQLHVQPFKVIPSLSRRDLSTSQTIFLQNKVTVDGVIRNVYVE
                     GNQVIIEYEHPIN"
     gene            76101..77204
                     /locus_tag="AOT11_00300"
     CDS             76101..77204
                     /locus_tag="AOT11_00300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="ASM97917.1"
                     /translation="MNDWLIELQRALFSNHKDWFGSVLFITGCSAIAWIVWRVIASRL
                     HQLAEKTRLHWDDLLLEAFRAPISTFIWLWPGTISLGIIVQSQTGQSLAWLGTAKLIM
                     VISLLVWIVMRFVNHAEEYVLAAQSYDETTVQATAKVARLFILTIGALTMMQVFGVSL
                     SGLLTFGGVGGLIVGLAAKDLLSNFFGGLMIYFDRPFKVGDWVRSPDRQIEGTVERIG
                     WRMTIIRTFDKRPLYVPNSVFSNIVVENPSRMLNRRIYETIGVRYDDCNKLPQIIEQV
                     REMLKHHPDIDTDQTLIVNFNSFGSSSLNFFVYTFTKTVNWVEYHGVKQDVLLKVMEI
                     VQKNGADIAFPTQTLKFDPVQAGLVESNRSQSE"
     gene            complement(77332..78054)
                     /locus_tag="AOT11_00305"
     CDS             complement(77332..78054)
                     /locus_tag="AOT11_00305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="ASM97918.1"
                     /translation="MKKTVIAAVLATGLTAMGCHAAEWGYEGKHGPEHWGEIAKECAM
                     GKNQSPIDIRQPTQADLKGLDLHYSGQVIALSNNGHTLQGSLSGKNVLDIDGKSFELK
                     QFHFHTPSENLIQGKQYPLEAHFVHADKAGNLAVVAVMFESGSQNQALNSLIAKVPKA
                     GEAVKLAQAFDVNDLIPVHAEYYRFNGSLTTPPCSEGVRWFVIKEASELSSTQTHVLM
                     QAMGQNNRPVQPLNARVVLSKE"
     gene            complement(78287..79195)
                     /locus_tag="AOT11_00310"
     CDS             complement(78287..79195)
                     /locus_tag="AOT11_00310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter substrate-binding
                     protein"
                     /protein_id="ASM97919.1"
                     /translation="MKLINGCIATLAGLSLSAGAWAQESSRILVEQELMVVANDLIQS
                     AELDITARKSADVQGAMIDNQARLGISSRKWLDSEIALFEHKYGYRPTELFFTSDVIS
                     IVVNQENPIGAVTIDELELIFGCHEQPELMQWNKILGEEYQTIKPVAVENELAKHLNF
                     AKLVECESPQSSLTQFYPEREQLIDAIADDKNLMGYTVYAELESGVRRLDIINRNGER
                     FDLNKETILSGRYPLSNVYYLYLNLPPNRHYLTDAEKYFVGLTLGEEGQETIAEHGFI
                     SLPPEAIHRNRVRLSLDAPIVYGGYK"
     gene            complement(79223..79846)
                     /locus_tag="AOT11_00315"
     CDS             complement(79223..79846)
                     /locus_tag="AOT11_00315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97920.1"
                     /translation="MRLNLLACAVLPVLPVLLAACAQMPDTTMTRHQIDDLRDSDKDG
                     VINQRDICADTPLGAEVDSKGCTRWTIYQKVDIKTVYFNFDDAHIHLDQSSEFDELLA
                     LLNQGTEAKVILVGDTSPEGSDEYNQVLAKKRTSVLKEALIENGIAPERISEQEFTQV
                     TALTEKLKDRKRRTIAVITQPDMKTEAKWTIYTSEQESSNLKRTVRQ"
     gene            complement(79848..81158)
                     /locus_tag="AOT11_00320"
     CDS             complement(79848..81158)
                     /locus_tag="AOT11_00320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agglutination protein"
                     /protein_id="ASM97921.1"
                     /translation="MRSKLLMVSWALALPHAHAISLEESVAAAIDYSPEVLAQYSRYQ
                     SVIRDMDGAEGFYLPQVKLYGAIGYEETYYNSGRKIDDDDRGLTRSELGVKVSQLLFD
                     GMKTTANVDRLSFEAESERLALFSDVENVALDVVKVYLEYLKAQTMLDLAERNVSEHE
                     EIYQDILERTGKGLSSHSDLAQISARVATSKSSMIAAQNNLYDLETQFIRLVGKPARE
                     LVDPVFDLALLPPSREVAVQQAVDNHPEIRAAIQDIEAARKEIKREKSGYYPEIKLEL
                     QANKNENIGGAEGRDEDARIMLTLDYDLFNGGSTNARVESSAWRAEQARAIRIRTERQ
                     VREGTELAWHAYDMLAKQKQLLQQNVDSAKVAEQGYIQQFTVGRRSLLDVLDAKVEVF
                     LARRNYVAAQYDHTLSAYRLLNAMGLLTYALRVEHPQEWQAKEK"
     gene            complement(81176..82504)
                     /locus_tag="AOT11_00325"
     CDS             complement(81176..82504)
                     /locus_tag="AOT11_00325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="ASM97922.1"
                     /translation="MSSQIMWSNNRIAYRSRRLIWLCAALVMAIVVWASWATLDEVVV
                     GDGKVVPSLSIQTIQSLEGGIIKQVLVSQGEKVVKGQPLMVLDDTRFRASYQESDQQL
                     QTLLAQKKRLELELQSIVVDGRSTDWQQQVRIAKQPYPSGQDEVTRAEFNARENYHQR
                     LEQLDSELEESALRIEQQSQAYQDTLNSIRTLENSMAIVQKELNMLEDVVKTGAVAEV
                     ELLKLKRDYVKLQGDISSAKVLAQKQKAAYSESIADYRGIALDFRTKARGQLNEVVAE
                     LARLQESQSAIADQLRRTEILSPVDGTVKDVLIRSIGGVVRPGEPIMELVPLDSRLIV
                     EARIAPQDIAYVKVGLEATVKFTAYDFVIYGGQKGKVVYVSADSLKTEEGDPYYRAHI
                     ELMADDASQQNFRIIPGMQAMVDILSGEKTVLSYWLKPLLRAKETALREP"
     gene            complement(82501..84654)
                     /locus_tag="AOT11_00330"
     CDS             complement(82501..84654)
                     /locus_tag="AOT11_00330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C39"
                     /protein_id="ASM97923.1"
                     /translation="MNTIVEERQDHWLTAILWACQHFGIRCHALKVVNGLPLENGQLS
                     EALFQRAAEQAQLEVGLTNLSLLEQATFPCLAVEKQGSPLLILGREGERYRCLSPHEA
                     NSDLTLSLDELKTQVKEGVWQLSTQVAADGRVESLIEEKPVHWFRQVLMEVRPWYRDL
                     LLASFVINLLAMVVPLFTMNVYDRVVPNQAFHTLWVLSVGVIIVVVFDWVLREARSSV
                     TDMAGRYVENKLSAQLFQKVLGMRLEQRPQSVGAFARQLQDFDSVKDFLTSVSLVTLV
                     DLPFTLFFLLLIGWLGGAMMLIPLAVMAALLLLSFVMKGRIAQTFTESARLSTQRQAH
                     VYDSLSALTDIKQNNAEGMTQKRWEQTVSALSEWQTRSRFYSNIVSHSIMSSQQVVTI
                     ALIIFGVYQIAEGRLSMGGLIAIVMLSGRAASSINQLSMLMLRYQQTQTAMEGLNQIM
                     ATPQESTSHQVMDRGEFHGNVALRNVSFAYPEMQIHALEAISLDIKAGEKIGVIGNAG
                     SGKSTLMALLARQLLPTAGQMYYETIDAQLWPPSVIRAGIGWVGQNPGLIYGTIYENI
                     TFGDQSIDEQRLLNAVMLSGLNDYMPRLANGLETQVGEQGRFLSGGQRQAVAIARAIY
                     RDPAMLLLDEPTSALDKAAEERFFHALQRLPANKTVVISSHKQSFLTLCDRILVLDKG
                     KLVAQGTPHEIFTQQGSARVRSRVKSVSVVKGGQS"
     gene            complement(84666..98630)
                     /locus_tag="AOT11_00335"
     CDS             complement(84666..98630)
                     /locus_tag="AOT11_00335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RTX toxin"
                     /protein_id="ASM97924.1"
                     /translation="MKPVLYIEIDGVLWKVMPDGQWVAVQADEVVDPTVKYVKETPLP
                     INDSDAVNIDDPIDAEPVYQRPTTPNEAQSSDQDLASESASLLGFIRPELREVLAQSG
                     YDTLPTDYENTPERESPDAQFYLLDDDATITVTIADGGDGYENALEVPSIAIFGTTTD
                     VEDGRIVQLVLSDASGQQQVFSATVFQGEYRIEGIDASGFDEGTLTVTATITDELDNF
                     IQASDTTIKDTLAEITTEFDGRGDEFFNRFEISSSGLTGTVSHVEDGQRIDIEVIDSL
                     GQTLRFTTTVNGGTWSINEDLSSLAEGPLTIHAQTIDVAGNPASASDTIVKDTQASIT
                     VAIDSADDDLVSDAESGNVRVYGEVTNVEDGQAIRVVLVDSAGHAQWFVTSVSGNQWS
                     IDNIDVSQFADGDFRVLAMTKDVAGNPAVATDSAGLDTTFPTIDIDTLTGLQIIDFKS
                     GADTALQGTTSGAEAGQPVLVTITDGVNTVEALTQVDAAGNWSFDSIDLSTLDANLEW
                     QLNATVTDLAGNRASDGMPSLMVPDMVNVNEDIAVALGSSDALSQINIDNADFTFIDE
                     QSSLSSLTSLGQSISVVLSADGLSLSALRADGQVVLSAHILNNQEVKIQLFLPVDHGD
                     TQRLLTELMIQGTQTDSDGTSETVVAPVAVVIGDAIVFPPLVDSAAITVTIDDGGDGY
                     ENAQETPAVVIHGTTTDVENLRLVTITVTDVDGNTLTFTTRVENNRYQISPVDLTGLT
                     EGPLSVEAHIDDVYGKTIQATDSTIKDTLADITAEFEGNGDAFLNQFEVSKTVLTGRV
                     TEVEDGQRIDIEVIDALGNTLTFSTLVAGNTWTIEADLSSLVDGELTLNTETIDVAGN
                     VTTASDTIIKDTQAAITIAIDSGEDEALNPTELSSVTLSGVVSHVEDGQAVQVVVTDA
                     SGAKLVFTTVVVSGAWSLTDLDLSSLTDGDIHATASTIDVAGNPATAEDTAIVDTTAP
                     TIDIDTLTGLGIVQFKQGTETALQGSTTGAEPGQPVVVTISDGTQTISVTTTVDASGL
                     WSFSSIDVSALDAAKSWTLTATVTDAAGNSASDETPTLDIPDTVSLWEDISVILDSSE
                     ALSDINIDNAQFTFHDTQSDLAALTSLGQSVSVVISTDGLSLSLVRGDGATVLTAAIE
                     TNSQVKLSLFLPVDHGEAQRLLTQILLEGTQTDADGTTETVIAPLPIVIEDSIVFPPL
                     VDSASLTVTIDDGGDGYENALEVPGTRIHGNTVDVQDLRLVTITVTDSLGATLTFTTR
                     VENNQYQFFPVDLSSLAEGPLTVEAEIHDAYGNVITANDATIKDTLAEMDVAFDGQGD
                     AFLNQFEVATTMLNGHVANVEDGQTINVEIIDGQGGRLTFTTVVSGEQWSLEVDLSTL
                     SDGELTVHAQTLDVAGNPTTSHHTIVKDTQASITVEIESGDDDLLNPEELTSVKIGGL
                     VSHIEDGQSVNVVLSDSAGNTMTLQTTIVGGAWAIENLDLSGFVDGEISATVSTVDVA
                     GNPATATDSATVDTTAPTIDIDTLDGLNILQFKLGTSTALQGTTTGAEVGQPVVVTIS
                     DGTQSISVTTSVDAAGNWQFAAIDVSDLNNRATWTLTATVTDAAGNSAVDDMPTLTFP
                     DVVTVYEDLTVAIGSSGATSDINVEQAQFRFHDVQTDLESLTSFGQSITTTLSADGLT
                     LTAIRADGEILLTAHIASNAQVQLQLFLPVDHGDSQRLLTDLMIAGTQTDADGTTETV
                     LTPLPIVIEDAIVFPPLVDSAEITVVIDDGGDGYENQFEVPAVRIHGNTVDVENLRLV
                     TITVTDVDGKVLTFTTRVSDNAYQVSPVDLSSLAEGPLMVEAEIHDVYGHSVSASDST
                     IKDTLAEISTDFQGNGDEFFNKAEITTSGIAGTVSNVEDGQRIDIEVIDHLGHRLTFT
                     TTVSGNSWSISEDLSALAEGELIVNTQTIDVAGNPTVDTDTIVKDTRAVISVNVASGS
                     DALLNATEVTATDLFGRVFFVEEGQTVSVTVTDQAGKVLTFSSTVVNGRWEVADADLS
                     SLADGPIVVTASVSDVAGNVATASDSLHVIDTLPPQIDIDTLDGLSVVDFRSGSLTTL
                     QGTTSAEENQTVTVTITDGTNTLTYTTLVDVSGSWTINGVDIASLDQNAEWQIQADVT
                     DLAGNPATDTMPTVIYPDGAVFIEALVGILGQQNATVDLNIQFGDFAFHADQSAFTEL
                     TSQGQAITIAISTDGLSLTATRTDGAQVLTAEIVDDQVKISLKKPLDEIRDLDSTHTS
                     LLIQATQTDTDGTSETVVAPVSIVVLDSQPISFDDHYLTTEGHNEFGNLLANDFDLDA
                     PLLVKSIFINGETHVVSQSAPLSLVLPEGILTIYSDGRWTMAVSRDLDHSQSQQVTFS
                     YIAGDKNYDYDSANVVIDIHDGEAGRIEPGSQTLTENLLSDGAQVVTTSITVTGGSDN
                     PDANSLRFDEKALADFESLNLTSGESLLTLSYQLSSDGKTISATAHNGDVIFTLTLSD
                     AAISGSDVNASLTLTLNRPINQYNGDDVTRLPVTITGTDSDGTALISGDFVWRIEDGT
                     NPTLSNANGVFLNEEGLLTQSSISDSGSVNVAVGSDPIGSLYFELAGQPTLTSGGEEI
                     SYVVSPDGNTLQAYVGDLNHLVFEVRIQEPNAENNSLINYDFILYRALDQHDEDEIDA
                     IPLVITIRDTDGDIQRLPLDIEIQDGHQGELTSATLVVTELPKDNLIPAGITSEASVN
                     LVVSADTDPIVAVTLSVSNGQAVVDRNNNALTHNGEALVWRVNGDGSYDAILSDGTAV
                     FSVQLPDGVNFAPDSTNQVTLSVHLYLPVDHSKLTNDKQLSVALPVTATDTDGTSVTS
                     NSTLIIFDGETPTLSVAGQVVVDEHGITDDGIASGSETVTHVLNVDGGSDDVADIQID
                     IAAFNAQGFTSGGLAITLYAQNSNGWFVAKSSDGEVVFKIRPNNNGKVDFVLSGALDH
                     PDGNGTNLLDLPFDMWVIDADGDISSTETLTVTVTDDVPIAQNTSVELVEGDSYTTNL
                     LPESVMGADGAEISSVTYRGTTYPLSADGTPVTIQLVNPNVPSEVYGSLVVHQDGTFE
                     LTTNPNVTTVPAISDTVSYVVIDGDGDQVTSTATLVLDDTAGILRVDDVEMREDEQGT
                     LSIVVALGDRDQGETVDSIEIDANSLQGGTLYLDGVALNAVGGKVILSGSQLLMIGNQ
                     VTVSGALTYQPATHLASNTATIVLAVSAIIASTTGSETLADTINVNVFPVADVPTWQA
                     DSQYDYTLVEDASEPLLLTLNADLVDSDSSESLSYLISGIPAGITVWLDGSQVNETTA
                     YSEEELNRMTIRSDTNISGQFTFTVTAVATEAGSSFASPSDQTAVASQQVTINVRPDA
                     DTPSLSVKNIAGLEDQPLNLHDAIKGHLTDSDGSETLYYKLEVAEGWSVEGGSSLRLE
                     DGTYWFSDAELVAGHIYLIPKEDISSVTETLTVKVTAVSLESTVDGLVPVTPTANSST
                     ETITIRLTGVVDEPHAIDGGAGHWGYDAESKVISNQTDFIEDQLIPLDFELITSDDDG
                     SEVINILITGIPDGVMLVDASGQPVSLPISGEDPTTGIIYQVTNSDLANLYLKVPEDY
                     SGQLQLSLKVISTEPDGDSGEFPMTVDIEIKPQVDQNSGSIISSLGVEDNRVPLSLWP
                     SLGADNDGSEEVIGYVINAPEQGITLYFDGVEITIPTGGLDVASLTDSLSPDLESLLN
                     SGRLTAKGPMDFSGTLDIPVTYLVQDTSGTGAIDQKYVDATIAVNFDARVELDTRLEG
                     NPRVLANSEGGAVDLTYAVRFVDMDVDGSEYLDYIVIKVPTGLTLIVDHPNGATQDGE
                     GNWVIPAHGLTSDSVRELAALILKDATISSTQNTEIINLVVSARVIDGEDARFIDAPI
                     RVQFTGHDDGGGSCEPVGPPGDLTPGDDALQFNEGEDLDLSGLLDGNIGSDPNNELSF
                     FISADKLPDGVMIEGEGVTIEYDSAGNIVGFVIPPEAMASLKITGLDEDFAGCLSLEV
                     DIKETSGCNGDSVTTTQAIDIEILPIVDDMLVSSVTTMDEDGVTDLNLSLILGDSVEA
                     GQTISGEGNSATGKETINSLMIKVPSGVTLVETPADTGLLTDNGDGTYTINDATRLGD
                     ISLVPPAHYSGDIRLEVHANITDAADCVAQTDTQDKVSIITIHIDPVTDAANINASNV
                     LGDEDSYIALSGLDVSLIDQDGSETLSVMIKGVPDGAVLVYKVGASYELLPNNGADGG
                     SFDGMPSSEWQLDPSRLADLYILPPLDFSGDIPLTINAITQEIGTTDIVHTSGSMTVG
                     VLPVGDDVQFFGLDSQYTGMEGEALSIPVTISSNETNSDEFIVLTLHAELTSDPSALS
                     GLDKIIVDGHEASFNQHGDGSWVARVIVRASEVGNIQLYSGDAFGTLNLTMTAQTFDK
                     SIVLGSLATDLGEAQTQSIVVELAPVPDEPILTLDYVTIVAEASGSIPLNLDMSMVNP
                     ADGEEGYLTISGLPDGLLLSAGSKESGEWLVPVNDVANLSIVSGYTGAESFTLTLTPS
                     AQLGGQTATGLSQVLDVQLLAIGDSSLTATSGDDLFVFNSDSLGSVGDATVDTIAGFD
                     MSANSDTIDLSAILSGLGVSDGASADPFVDLVQTGTDLHINIKTDGVNAVQTIVLTDL
                     NLEDYYGAGLTEAQILQQMIDDQNLIVQ"
     gene            98932..99294
                     /locus_tag="AOT11_00340"
     CDS             98932..99294
                     /locus_tag="AOT11_00340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97925.1"
                     /translation="MKKILLVPFVLLASHSAFAAFDAQQQQGGFTGPTVGGVNTVANA
                     LTARDDTAVELTGNIVQSLGNEIYLFKDATGEIQVEIDHEDWRGQNVAPKDKVLIIGE
                     VDSELVSTKIDVDSIQKL"
     gene            99498..100532
                     /locus_tag="AOT11_00345"
     CDS             99498..100532
                     /locus_tag="AOT11_00345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM97926.1"
                     /translation="MPIKVVGIDIAKNLFQVCVLGTNGQILSNRKVKRDKLLDTVRQL
                     PEQTALAMESCATSHHWGRIFQELGYTVALIPAQHVKPFVGRQKNDANDARAICEAYS
                     RPNLHFVPVKSVEQQDLKAIRSVRKRLVENRTALANQIRGLAAEYGVVFPLSIKALRS
                     HLPLALEDAENALSPVMRNLLQTLYCDFVSLSEEIDEMTQSVTMLSQQNPKYEAIRNI
                     PGFGPILTAALISEVGAGNQFQNGRQFSAWCGLVPKQNSTGGKSSLGSLSKNGNRELR
                     ALLIHGARAVVRCGANKADAMGVWLRGLIARRGKAKAIVALANKLGRVAWHILAKNSE
                     YDINQAFKPV"
     gene            100859..101779
                     /locus_tag="AOT11_00350"
     CDS             100859..101779
                     /locus_tag="AOT11_00350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM97927.1"
                     /translation="MPKPRYKTTNWKQYNKALINRGSLTFWIDEEAIRQWKQSKQDKR
                     GRPRQFSDLAITTALMVKRVFSMPLRALQGFIDSVFSLANVPIVCPHYSCISRRAKQV
                     EVSFKPKSRGAIQHLAIDATGLKVYGEGEWKVKKHGTDGKRRVWRKLHLAVDTSTHEI
                     VAAELSLSNVTDAEVLPNLLKQTRRRIIEISGDGAYDTRDCYDAIRFKRAVPLIPPRE
                     GAAFWENGHPRNLAVGCQKLYGSNNKWKKRYGYHQRSLSETAMHRVKQLLGGRLSLRN
                     YNAQVGETYAMIKALNKLTGLGIPETMVIT"
     gene            102294..102716
                     /locus_tag="AOT11_00355"
     CDS             102294..102716
                     /locus_tag="AOT11_00355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97928.1"
                     /translation="MKTIKLLGLLTLIASSVASANTAITFPGEGSSVPNAPVTFPTSS
                     KTPITFYNGYTIKDGIFRSEVNTCVVEVANPEYEAKLIWEGKTPKLLIVGNTDPFPCR
                     AGFTEAMEVNLTAFLQNIPTHIFEYLEVANRVNMQRSF"
     gene            102769..103473
                     /locus_tag="AOT11_00360"
     CDS             102769..103473
                     /locus_tag="AOT11_00360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97929.1"
                     /translation="MHRVTVSTHVFTPSLKALIEDNQAEITRILLLESGFNLLCVVAL
                     LHLLPLALMDKAFMVFFVLQAGGFLLVQRRKKAWLSFAVSVCLSFAILVWISQAEQTQ
                     VLGSGQLQLFGTAVLWQLKAIYTLWLLQLLLVEYRYILPKVTILLADLASLIIALQAE
                     DFFHARIVTASHFLFLSLCFDFKSRDWGGREFAVLPSLVAIQKPNIAKWINYSCLALA
                     LLCALHLASSLAIFPQ"
     gene            complement(103588..104520)
                     /locus_tag="AOT11_00365"
     CDS             complement(103588..104520)
                     /locus_tag="AOT11_00365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM97930.1"
                     /translation="MVAPEINLRSIDLNLLTILEKLLIHKHISQAAQALNMSQPAVSR
                     ALMRLREQFGDPLLVKVNREYRLTAKGEYLRRELESSLNTIRQMLVDDAFDPLQHAGV
                     FTIGALDFEMMMIVPKLLARFQQRAPKLKLQIVPYNAYMPLHDYLEKVADLLLYSTDD
                     SPTNVFKQRLFNDNYAVVMCRNHALANQSMTLERYCQSRHVIVSGNGLGKTDIDHELK
                     RLNQQREVVASLPHFSMVPELLINTDLIATLPRRLVSHLSHRYEITVAELPFYTADFR
                     VEQFWHLIHHSNPAHQWVRQEIKNMVDEEIEARR"
     gene            104634..105770
                     /locus_tag="AOT11_00370"
     CDS             104634..105770
                     /locus_tag="AOT11_00370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="ASM97931.1"
                     /translation="MKRFTFALAPITAALLSFNAGAANHNHNHSHDQQRAIVFPGETV
                     QSTLPSEVEPSATQVLKVGQKINNLYERQFDDSKATVQKLGKNTYWIGVNYYNATVIV
                     NEDSVMLIDPLGDGRIDALFKGVQSITNKPITTIMYSHYHLDHVGGGNQLVELIKQNY
                     PSVNKVRVIASQAVANKIAQHAETNENGVKTTKVPAPTDVYDLRKPKVVKFGSVKVHL
                     IAPAGSGHTPDNTMILIPSDRVLHFADMINPDQLPFYNFAGAEHFHGYEEDLENLLGK
                     HLGWQWDFINGGHGNIGSKQDVKDLLQYIADVRAEVGKQLEVVPYTPMLSDGNHFVWF
                     KRWQEEITRNVHTALASKYGHMYGFNSGAVETHAAMILADMIDH"
     gene            105984..106712
                     /locus_tag="AOT11_00375"
     CDS             105984..106712
                     /locus_tag="AOT11_00375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97932.1"
                     /translation="MKNLMRGMRVSIPLLVLSAPVWAQEQYQDYAFVGAGVTYGESAF
                     STDGAKAGIEPSLFYNGQYGFIDGSLANYSLTPWLGLSGNLRFAEVSDDFDDIPRGIK
                     NRDGNADLGITVGTVGARLTYLQDVTNVHDGYEIQLHLGRAFDTPFDQWVLSPYVEVD
                     YRSKKLSQHLYNVSAQESAASGLAQFDADETWVYKAGLISLYDITEQWLAIAKVEFEH
                     HDSSSPLIQNDLAWQISLGGAYKF"
     gene            106962..107426
                     /locus_tag="AOT11_00380"
     CDS             106962..107426
                     /locus_tag="AOT11_00380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97933.1"
                     /translation="MFRPLISLAFLATLTGCVSTPYVEPTGENVSTIKFHNQGRGNAE
                     VFIYKEAAQCTGKQKAAEVEKMAYKNVTVLSDTPQSFSFGFGFSDYVSQKSCSITGTF
                     TPKAKTDYEVLIVSSYGGCVVYLYEIQNGQKVPAQGEQREYSEPVAGDSWCE"
     gene            107463..108086
                     /locus_tag="AOT11_00385"
     CDS             107463..108086
                     /locus_tag="AOT11_00385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97934.1"
                     /translation="MIKLWQIVLAALALTGCAATGTTPQDTTTENNAPSDAAPVESSP
                     VTEETDAYFVLGNVTSIYDIKLSLGSVDFETGRFTEDWFSSLWYRYTEDRRYIVGKAK
                     PGSFIAITSTKATDASGTHLGTFTPCNQTLVFRLPYLGPDFYVTDVNYHWHNTSISPV
                     YSDGIEEAKKAFAVQYLEQAPYRQLDADLYKDCETLSADPTILTRPF"
     gene            108203..108718
                     /locus_tag="AOT11_00390"
     CDS             108203..108718
                     /locus_tag="AOT11_00390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipocalin"
                     /protein_id="ASM97935.1"
                     /translation="MRKILLLALSMTLTGCLGMPETVKPVDEFNLQNYLGKWYEIARL
                     DHSFEEGLTQVTAEYTLKDDGGVAVLNKGFLADENQWKEAEGKAYFVNGDSEGYLKVS
                     FFGPFYGSYVVFALDKTDYQYAFVSGPNTDYLWLLARTPTVDQSLIDTFVSMAKERGF
                     DTERLIFVEQK"
     gene            109840..110265
                     /locus_tag="AOT11_00395"
     CDS             109840..110265
                     /locus_tag="AOT11_00395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97936.1"
                     /translation="MDQIKVTNAIVTFLLGLVIAVTVSGGAFLTTAIKYPFDFIFIGL
                     GGFLAFGVSHFSVKYMQRGFWKESVLMYLLYYYGSFGLFSDGHAAGWAHSEGILEKLV
                     MSQMYILISVFSLFIPLLFIALTITHTFWLYSEVKKART"
     gene            complement(110401..110679)
                     /locus_tag="AOT11_00400"
     CDS             complement(110401..110679)
                     /locus_tag="AOT11_00400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017035198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein ParE"
                     /protein_id="ASM97937.1"
                     /translation="MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQ
                     PLMGVQRDGILGRLLIIPEISMVISYWVEGDIIRVMRVLHQKQKFPTD"
     gene            complement(110676..110960)
                     /locus_tag="AOT11_00405"
     CDS             complement(110676..110960)
                     /locus_tag="AOT11_00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017067566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="damage-inducible protein J"
                     /protein_id="ASM97938.1"
                     /translation="MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQR
                     KTLSHDAWLTEQVNLAFEKFDSGKSVFIEHQTAKSRMEERKARIRNRGKQ"
     gene            111178..111786
                     /locus_tag="AOT11_00410"
     CDS             111178..111786
                     /locus_tag="AOT11_00410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97939.1"
                     /translation="MSEVISSISDIIVGLSALGTFGIACYGVTNWKRELKGKNNFEIS
                     KNLMKSVYNYRDAIQSSRSMIILGSSQYLEELDNNKEQKLEVWKKLFDKRWKPVRESV
                     QELSSLSLETEVLLGKEVKKLIVALKDIALDLRHAMDAVIEYQNDPKPEILDFYKKHP
                     DVWKHIEFKVVKDPYEKDNMSIEIKDTINKLESILISHLKRN"
     gene            111921..112454
                     /locus_tag="AOT11_00415"
     CDS             111921..112454
                     /locus_tag="AOT11_00415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97940.1"
                     /translation="MKIEDLINKIEEDKFNEKQLINLYNNAFSKQEIDEAEKESLIEA
                     IEKNTRLRFPRAAKRIFGAKESVASQKLESLYVKLASKYDFTHNRLKNGVKAGGRMIS
                     GEYYIDVYLSYKNFQNQGAAIALTQENIDAELEVTVKRYCTHNENSGEIKKRTDTMDA
                     FESCANTYDEYLSEVIN"
     gene            112640..112903
                     /locus_tag="AOT11_00420"
     CDS             112640..112903
                     /locus_tag="AOT11_00420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97941.1"
                     /translation="MVFTSKVKVVISAIAIVLSSILISIDMFGVIPFLVLVVSLFTLI
                     IQGGLCLLGYKNGDAFDAYQDLERTEATALTNLFKDKKECEKR"
     gene            112980..113480
                     /locus_tag="AOT11_00425"
     CDS             112980..113480
                     /locus_tag="AOT11_00425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97942.1"
                     /translation="MSEIARFISGEAPDKFGRNIEQLLAYNHFWLEHDHKYIQVLFPI
                     DEGTKFNQHAPLVTVQDREQFANSLALRTAHLKALDLMLEFWGMVRNGDEISSLLPLS
                     PTNHVWLKHHDHNQLRLTRAIRSLYLLGNERIARNLCDFLLSAAKQVGSVSEKTQQYW
                     CHALEE"
     gene            complement(113560..114591)
                     /gene="tdh"
                     /locus_tag="AOT11_00430"
     CDS             complement(113560..114591)
                     /gene="tdh"
                     /locus_tag="AOT11_00430"
                     /EC_number="1.1.1.103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020332488.1"
                     /note="converts threonine and NAD to
                     1,2-amino-3-oxobutanoate and NADH; functions in threonine
                     catabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine 3-dehydrogenase"
                     /protein_id="ASM97943.1"
                     /translation="MKIKALSKLKPEEGIWMTEVDKPVLGHNDLLIKIKKTAICGTDV
                     HIYNWDEWSQKTIPVPMVVGHEYVGEVVGIGQEVRGFEIGDRVSGEGHITCGHCRNCR
                     GGRTHLCRNTIGVGVNRTGCFSEYLVIPAFNAFKIPANISDDLASIFDPFGNAVHTAL
                     SFDLVGEDVLITGAGPIGIMAAAVAKHVGARHVVITDVNEYRLDLARKMGVTRAVNVA
                     EQKLDDVMAELSMTEGFDVGLEMSGNPSAFNSMLKTMNHGGRIALLGIPPSDMGIDWN
                     QVIFKGLVIKGIYGREMFETWYKMASLIQSGLDLTPIITHHFKVDDFQQGFDIMRSGM
                     SGKVILDWE"
     gene            complement(114706..115899)
                     /locus_tag="AOT11_00435"
     CDS             complement(114706..115899)
                     /locus_tag="AOT11_00435"
                     /EC_number="2.3.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017043792.1"
                     /note="catalyzes the formation of 2-amino-3-oxobutanoate
                     from acetyl-CoA and glycine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="ASM97944.1"
                     /translation="MSSAFYQQIRDQLEDVKAEGLYKSERIITSHQQAAVKIASGEEV
                     LNFCANNYLGLANHPALIEAAKEGMDGHGFGMASVRFICGTQDIHKELEQKLSQFLGK
                     EDTILYTSCFDANAGLFETLLDKEDAIISDALNHASIIDGVRLCKAMRFRYSNNNMAE
                     LEEQLIAADAAGARHKLIVTDGVFSMDGVVANLPAICDLADKYNALVMVDDSHAVGFM
                     GKNGAGTHEYHNVMDRIDIITGTLGKAMGGASGGYTSAKAEVIDWLRQRSRPYLFSNS
                     VAPAIVAASIRVLDLLQESGDLRERLWENAAHFRTRMEAAGFTMGGADHAIIPIMLGD
                     AKVAAEFAERALAKGIYVIGFSFPVVPKGQARIRTQMSAAHSREQLDRAIDAFIEVGK
                     DMGII"
     gene            complement(116173..117426)
                     /locus_tag="AOT11_00440"
     CDS             complement(116173..117426)
                     /locus_tag="AOT11_00440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermolabile hemolysin"
                     /protein_id="ASM97945.1"
                     /translation="MKKITILLGALLPFTSAVADEPALSPEAITSAQVFSTQSKETYT
                     YVRCWYRTGNSHDESATDWEWAENPDGSYFTIDGYWWSSVRLKNMFYTNTSQNVIKQR
                     CEETLGVTHDAADITYFAADNRWSYNHTIWTNDPVMQADQINKIVAFGDSLSDTGNIF
                     NAAQWRFPNPDTWFLGHFSNGFVWTEYIAQAKKLPLYNWAVGGAAGSNQYVALTGVKD
                     QVLSYLTYAKMAKNYKPENTLFTLEFGLNDFMNYNREVVDVKTDFSTALIKLTDAGAK
                     NIMLMTLPDATKAPQFKYSTQAEIEKVRAKIVEFNEFIKAQAAFYIIQGYNITLYDTH
                     GLFEQLTQNPQQHGFVNASDACLNINRASSADYLYSHSLTNECATHSSDKYVFWGVTH
                     PTTAVHKYIAEKMLAPGAGMQRFNF"
     gene            117867..119891
                     /locus_tag="AOT11_00445"
     CDS             117867..119891
                     /locus_tag="AOT11_00445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="ASM97946.1"
                     /translation="MHYTTTKASGILSLTALAAAIMTSTSAHAVPPMAFDESDLPTKY
                     IVKFKEGSNARSAMTHNRFFAPNMVREAVLDKVKARKVERLGNQAIYSVEIDNSELGE
                     LRNHTDVEYVEVDPPRYLLSETTPWGYGAVNAQLLMDSDAGNRTVCIIDSGYDLSHND
                     LSGNRVNGSNDSGTGSWSDPGNNNAHGTHVAGTIAAIANNEGVKGIMPNQNVNLHIVK
                     VFNESGWGYSSSLVKAIQTCADNGANVVNMSLGGSQSSRTEENALKTIYDQGVLLIAA
                     AGNSGNTAHSYPASYDSVMSVAAVDSNNDHAAFSQATNQVEIAAPGVAILSTVTVGEG
                     VLSDISLNGSSYFDRGVVPHNRLIVSGSNYVPAPVAGNVTAALASCDVSSGQYVCGDM
                     SGKICLTERIDNQTASARPEINAVKACHDAGASAAIVYSNSALPGLQNPFVLDNNDSY
                     RMVSMTVDRTLGLELANVVGQTLTVSTTTGRDYEYYNGTSMATPHVTGVAGLVWSFHP
                     TCTAQQVRKALTATATDIDVAGRDNRTGYGLINADAAKAYLDAGCNGPVGTGGDTYTN
                     SNVVSIPDNSRAGVISVLDVARSGDAGVVSIDLDISHTYIGDLKVTLTSPTGGEVVLH
                     NNSGGSANDIRQSYQVDFSGFESQGVWELKAVDSARRDTGTINSWTLTFQ"
     gene            119898..120245
                     /locus_tag="AOT11_00450"
     CDS             119898..120245
                     /locus_tag="AOT11_00450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ASM97947.1"
                     /translation="MMKKFTAKTTAMTTTILALTIAAGYSFANNKGFPVDGQNEAFAT
                     QQPARYFVKYQAGKESEVRELLRSLKIEVVDALVKQRVLVVSGSQEQMDQLAQSEWID
                     YTEQEPVRQLYTQ"
     gene            complement(120368..121609)
                     /locus_tag="AOT11_00455"
     CDS             complement(120368..121609)
                     /locus_tag="AOT11_00455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="ASM97948.1"
                     /translation="MERESLFQRERIRRFNFSIWTVLSGTLLARTSYFMAWPFLIVFL
                     YQDYNASAAQIGGMLAGSAIVGAVTGLYSGYLSDKFGRKWVMVSGSLVASAAYTGIAL
                     ADQLWHFYFLMLVTGLMRPMIEAPAKAVIGDNLANVKDRELALNIRYFLLNLGGAIGP
                     LLGVTIGLSSPQHLFYITGVTYLLYTVWLFFGIERKQTFTKPDPSLLPNFRATMKVIS
                     RDAIFVKLMIANFLMMFVYAQLESSIPQVIVRSDITDAATLVAGLVLVNTLTIIIFQF
                     PMLKWLEHVPLFLRTRIGMMLMALAQIGFMLTPADLPWGWALACFVMSLGEVIAFPTL
                     NVQIDRLAPAHLRGSYFGASALYSLGFAVSPLVGGMVIDSLNSNWLFGLCFALCLMMI
                     WLYWLAENSQDNVEREQAIAQ"
     gene            121917..122828
                     /locus_tag="AOT11_00460"
     CDS             121917..122828
                     /locus_tag="AOT11_00460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM99233.1"
                     /translation="MVNPKLIALLPDLASFILVVNEGSFTAAAKKLDVTPSALSKLIT
                     RLEQALQVKLFERTTRKLLITQAGQKVYDQSIAMVNAAQQAIEISASDHSEPAGALTV
                     AAPEAFLNSVLQPFVVPFLQQYPNIQLKLRAADGQIDLFRDNIDVAFKLTDKPDENLV
                     LKELSKTHLVLCASPDYLTQRGMPTHPTELTEHDCLYLAENDKDNLWSFFKDEAFYSV
                     AVSGRYAVNHSQMRLNGVKQGLGIGIFHDFVIRDALERGEVVKVLDDWMIKSNYHGAI
                     AMQYPQTKYMPARLRVFIDFINQKLVL"
     gene            122828..123211
                     /locus_tag="AOT11_00465"
     CDS             122828..123211
                     /locus_tag="AOT11_00465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97949.1"
                     /translation="MLKAIHHVAIICSDYPRSKQFYSELLGLTIIAENYREARDSYKL
                     DLALPCGTQIELFSFPNAPERPSFPEAQGLRHLAFVVEDIVQMKHYLESHDVLVEPIR
                     IDEFTGKPYTFFADPDGLPLELYQQ"
     gene            complement(123407..124822)
                     /locus_tag="AOT11_00470"
     CDS             complement(123407..124822)
                     /locus_tag="AOT11_00470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97950.1"
                     /translation="MLSDHSKTAKPSSRAKSRYFLTWRWHFYAGLFVIPFMLMLSVTG
                     LVMLFDDEIELARYQSILQVTPQHHEVLPSLQLANVQARYPEGTISQFVPAKQADLAN
                     RFNVKFADGTSRFVTVDPYTGAVLGTIDRSDSWYQLANDIHGELLMGEYGDYLIEVAA
                     SLSILLLVTGIYLWWPRDNASRAGFLRVRLHSGKRVMMRDLHANLGGLTSIILLFFLL
                     SGLAWAGIWGGKFVQPWSSFPAQKWDDVPLSTLTHQDLNHGSEEEMPWNLEQTPLPVS
                     HDHSKMADSAHHSMMENIGIDAMVNKARELGFTHYKLNFPRSDTGVFTLSANTMSGDI
                     IDPTQDRTSHFDQYSGAILADVTWKDYNLVAKAMAAGIALHQGDISVFNKVANALLCL
                     AFVVIAVTGGIMWWLRRPVGQGKLGVPAKFASDGVWKTALVTLVVIGVLFPLAGASIA
                     VALLLDWLLFNRVERLKAVFS"
     gene            complement(124930..125289)
                     /locus_tag="AOT11_00475"
     CDS             complement(124930..125289)
                     /locus_tag="AOT11_00475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97951.1"
                     /translation="MMRLSSFHRSMLVATALSWVLVTLMPVINAHGSSAGVWATLCTV
                     NGFELVQIKEGEEVPTHSGKPCPFSHFSTFHQDSLPTALALTRQSLVISDRYTFLALS
                     VRFERQVPRAPPFTTLT"
     gene            125360..125560
                     /locus_tag="AOT11_00480"
     CDS             125360..125560
                     /locus_tag="AOT11_00480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97952.1"
                     /translation="MIRLSQEITHWVTVLITMLLPFKFDLASITAKQLDLHRFYLLNL
                     SIIPIKQMRFIGIYFPWAEKSF"
     gene            125617..127161
                     /locus_tag="AOT11_00485"
     CDS             125617..127161
                     /locus_tag="AOT11_00485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="ASM97953.1"
                     /translation="MHMSKSFLLISMGLASISVHAQTLTRDNGAPVGDNQNSITAGEN
                     GSVLLQDVHLIQKLQRFARERIPERVVHARGTGAHGEFVASGDFSDLTLSSPFAQSGK
                     VTPVFVRFSTVIHSKGSPETLRDPRGFATKFYTEQGNWDLVGNNLPVFFIRDSIKFPD
                     MVHSLKPSPVTNLQDPNRFFDFFSSQPSATNMLTWVYTNLGTPASYRTMDGFGVHAYK
                     WINQKGEVNYVKFHWKSQQGVKSLRPAEVTRVQGEDFNHLTNDLYTQINAGNFPKWDL
                     YVKVLSPKALSKLDYNGLDATKVWLDVPEKKVGTMTLNRVPDNFFLETEQSAFAPSNI
                     IPGIEPSEDRLLQGRLFAYADTQLYRLGANLFQLPVNSPKSPVANHNQDGPSTNSTGL
                     SDATGLRNVDSLDVNYEPSRLVNLTVDKQARAVETPLSGHVQQQAIRNPRDFFQAGVL
                     YRSLSEQDKTDLIHNLSGDLNKVNDAEVKAIMVSYFYRADKEYGTRLAKATDVNLKQV
                     TKLASM"
     gene            127254..127760
                     /locus_tag="AOT11_00490"
     CDS             127254..127760
                     /locus_tag="AOT11_00490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97954.1"
                     /translation="MKRFTHIILFCSVTIYSIFAISSETDTVQEDLYQSLIGLFFDAT
                     RIGNGEVINEFLDAGFPINQRNYQSYTALMVAAYQGQREIVQLLLARGANACLQDKRG
                     NTALMGALLKREIGIAKDLYQADCPSDLLNKAGLDLKQFAEIYGQSEVLKSLAKQQPI
                     TSISSGGK"
     gene            127760..128272
                     /locus_tag="AOT11_00495"
     CDS             127760..128272
                     /locus_tag="AOT11_00495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="ASM97955.1"
                     /translation="MNKHTLLAAVLLYSTSSFAQSLSVEMKDLSSNQTLGTVTITSSD
                     YGTVLTPNLKGLPSGLHGFHLHANGSCESSNKDGKVVLGGAAGGHYDPQNSGKHGYPW
                     TDDNHLGDLPALFVDASGNASQPVLAPRVALKDVQGRALMIHAGADNHSDHPMPLGGG
                     GARIVCGVIN"
     gene            complement(128445..128846)
                     /locus_tag="AOT11_00500"
     CDS             complement(128445..128846)
                     /locus_tag="AOT11_00500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b562 family protein"
                     /protein_id="ASM97956.1"
                     /translation="MKLSKVLLGSALVMVSFTGFANQESKVDLKANMKEMKLEFRQAA
                     EAQDIESMQAAVNQLRSLVANSKTGEYAPEKNDLYHEGFNKLTVALDKVNGELEQGNL
                     EAAKQALVEVDELRKEYHEKKKTSIWGKLFG"
     gene            complement(128932..129681)
                     /locus_tag="AOT11_00505"
     CDS             complement(128932..129681)
                     /locus_tag="AOT11_00505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ASM97957.1"
                     /translation="MELKIDTHSHTYASGHAYSTLIENARSAKENGLAMFCTTDHAES
                     MPGAPHYWFFANQRVLPRFLEGVAILRGVEANILNTEGEIDLPLSVDPNLDWAIASFH
                     EPVFAPSNKEAHTQALLNVIQGGRIDALGHLGNPHFDFDFHAVLHCAKEHNVAIEINN
                     STLKGHSRVGSVERCYEIARVGKALGAYFTTGSDAHFCQDVGKLDLASELLDSVGIDS
                     HRVITHSPSQFLDFLELRGRGPIDELASLRQ"
     gene            complement(129764..130204)
                     /locus_tag="AOT11_00510"
     CDS             complement(129764..130204)
                     /locus_tag="AOT11_00510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate kinase"
                     /protein_id="ASM97958.1"
                     /translation="MLTLNYHVEIDATPEKVWQVLTDLELYKQWAKAFSPHSQFDGVW
                     QEGEDIKFFDPDMGGTRAVIDAIEPQQRIELHHVAIFNPEHVQDIDSDVAMKWIGSTE
                     SYQLRPKDGKLLLMVTITTHSDFVSMFNHGWEKALPLIKALSEE"
     gene            130397..133276
                     /locus_tag="AOT11_00515"
     CDS             130397..133276
                     /locus_tag="AOT11_00515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent phosphohydrolase"
                     /protein_id="ASM97959.1"
                     /translation="MKKQRYPLSIHITSLFLVLTTVVGIVLITISYNHSQTLLTKSAE
                     GLSNEHAHKLESAFQTSVGPILTTLDFMAVSAFLDEYNNENKLKPWLSALAHIFEENP
                     NLVALYHASESGTFTQYRMLNSPTIRQSFSAPANALFLINNTHVDGTNEFIFLDSQFE
                     RMDYKKTNDNTFDPRVRPWFINAEMDGEIRLTEPYFFYFLKTNGVTLSRRSVNGQYVV
                     GADFTLATLSNQLEQLAYSDRTRLALLDKEGRLLAQHQVGIDIQADVSEQQQVLKTSI
                     FASLLAKVGYPTTLFETATFNGLDWSITMTPVFLTDKVQLSLAEASPTDEILADLLSM
                     RDKQVLTAILLLAICFCVVWLVANRLSKPLINLVYLTDNIARFNFKKTRYPQSMIKEV
                     SNLTSSIELMEHTLHDLLRLLRDTAGNQEFEVLAKTIAHQAYLVTKAETILLYIQSEE
                     EKKLILAANHAIIPFKVDINDFVNETPWLMAQLKEGDTIHLDRSTNALKRHQDTIFNS
                     DIFLFPLLNREKQLVGIVTVGYERPPSETELAKHAFLRELLSFAEIAKDNIDQMQQQK
                     EMLNAFIELIASAIDTKSPYTGGHCQRVPQLVTWLTEVVEKDNKYFPSFKVNAKQWEE
                     IRLAAWMHDCGKVTTPEYVVDKATKLETIYDRIHEVRMRFELLKLQGEVDYWRARSQG
                     EDPDAAKAHLTMLHRQLDDEFAFVARCNAGGESMAEADIEKLNTIANRQWKRTLDDQL
                     GVSWIEQQRHRNKPELPVMEPLLADKDVHKVPWEAGFHPSQHWQQAYVLKPGAYKYDR
                     GELHNLTVRYGTLTDEERFIINDHIIQTQIMLNRLPYPEHLKNIPEIAGGHHERMDGK
                     GYPLGLHEEELSVPARIMAIADVFEALTSADRPYKKGKTLAESLEIMTNMATSGHIDP
                     KIYLLFLIQKVDQKYASAFVNRSQLSEIDRESHIERVKNYMRNQF"
     gene            complement(133279..134202)
                     /locus_tag="AOT11_00520"
     CDS             complement(133279..134202)
                     /locus_tag="AOT11_00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97960.1"
                     /translation="MHTLDKSILYMLLSTLSLSVTGLISKYLVDIVPIEWFSFLRFAL
                     PAVLLLALLRITKIKIPNKAEMKPLLGRALCIALCQLFFLWSLQHLSLVESVVLFATG
                     PLFMPLLERLFFKTSVSKLTIAALVATFVGVILLAGKEGEFSLRLELLAGLAGGVFNS
                     GSQLTLYRASKSALSPKEINFWTFSLAALLLLPVLVFVDIAASEATATLQTWLSLPVA
                     IALLTISCLIINTQVNRAKAYRLANSGSQLAPLIFTNLLFTSAWQWLFFDESFSLWQI
                     TGLGLIIFATMLNVLWPMIMSRPPFLKQRQA"
     gene            134293..135183
                     /locus_tag="AOT11_00525"
     CDS             134293..135183
                     /locus_tag="AOT11_00525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM97961.1"
                     /translation="MRKQVPLKSLYAFVAVAETGSMTEAASLLHVSHSAISQAVKSLE
                     TQVNRPLFERVGRHVRLNNHGKKYYKQVAPALEQIVKATEELAQSNDIGRITLNMVNS
                     LALHWWIPRLDDLQQFAPNLDVRLSNLTGIFHLEQQGVDVALVHGSPDEWQDYYCEKL
                     SDDELILVCSPELLAHQPSVPELLTQSRIITVTNERRKNDWDIWCQAQQFPLPKTDKH
                     LQFLVSVQAVQATIRRLGVLVTHKLFVKDDIDAGLLTQVGTSVVNPDLAFYWVCHPSK
                     LKNESVLTLRNWIRNDFIPK"
     gene            135286..135606
                     /locus_tag="AOT11_00530"
     CDS             135286..135606
                     /locus_tag="AOT11_00530"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97962.1"
                     /translation="MIVTTTQHIEGKKIIAYKGVIAGEAILGANLFKDLFAGIRDMVG
                     GRSGTYERELERARTISFQELEQKARELGANAIVGVDIDYEVLGQSNGMLMVSASGTA
                     VVIE"
     gene            complement(135855..137132)
                     /locus_tag="AOT11_00535"
     CDS             complement(135855..137132)
                     /locus_tag="AOT11_00535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97963.1"
                     /translation="MVFGGILDMNGAIALFVSNQIIEGHQMKKKIILSALCTLALVGC
                     QSEETKVTNISNEKAEDIVNTKRELAKQLGENYSSVESTLRQNINAQQLNVPISTLVE
                     QKPQAQMSRRFVQADEQIRTWKGVSEYTDELLEVRLANEAMLAAWQKGDVSPLFAFEP
                     SGDDELWQYIEAFDVNGQIHQLDVYNMPDVPVIVVDNNSTKELKAGLQAMQAEMKRLG
                     QLTQIQPYVVEKERNAAPRMAPQYSLSAETTAPIQTTQLKKIRLSDDQEPWISGKAEI
                     YAIVTGVNPSRDEPALDLVEMPYLDYDNKDYYPNQIVIHWSRYRWGAADMVLMEQDDG
                     TDYKQLAKLLVQVAEEVLKAIPDPEVQAYAIIPQITNKIIDAIPDGVLTNDDDFVDVY
                     YTLMQDTSYVDHPGAGVNAVVTLEPLTINPTRP"
     gene            complement(137239..139158)
                     /locus_tag="AOT11_00540"
     CDS             complement(137239..139158)
                     /locus_tag="AOT11_00540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM97964.1"
                     /translation="MMTKRFARLPLRYKMTLPTWLLFTVIFICVGGAAIKVISLSHYD
                     GLHGRIKILSQGVASTLQAALTFADAATAKEQLNILTFDPDIIAAQVKSTDLLTKAAI
                     HRLPQDCYWDELNVLCRNEEIMSLSQEIVLGSEVLGELEVWVSLEAYFERKRRMWLTL
                     GVIAVTLSFMVWWFARVLHNVFVMPLTSLHRSMEQMSRFGVLKKELPIYHDDELGKLT
                     HCFNEMVISLRDRESDLQNVLNDLEARNRYIQRALGAMRRGVLVVSENKTISYFNPAA
                     QKELKIENEGENIAQRLEAYYEPKMAVDALMHSIVNGCKGKAVELRARDGERRYRVTC
                     HPMSEGKETLVQFEDISEAYLAEQRRKLIDLMFEQNQDAILVLSRTFSVETQNLTSLR
                     WFGEVHRLEEIHDYDSLQFTQAELKALMKSGGLIRAMEVKCQGGSLLPCQLKLRVLKS
                     TSGRVEAFVVTLSDLSVERELKRLNYVANHDPLTGLANRSHAFQSLQSEHDQGKDQYL
                     LFLDLDGFKAVNDQFGHAIGDDLLRVVAKRLKNSVFNRDLVARLAGDEFLIGIRDAHT
                     YVPVVERILEQLQQPISIDGCLCDVTASIGVSHWAVKDGVSLEERIHHADEAMYVAKR
                     LGKNQYCCLQDELTV"
     gene            complement(139155..139694)
                     /locus_tag="AOT11_00545"
     CDS             complement(139155..139694)
                     /locus_tag="AOT11_00545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97965.1"
                     /translation="MRQRRLSTKLLCRIALFLGVYCLAVPAWPKYSDEDLKAVYLYRF
                     ASLADWQSTPLAQQKTRYCGEFNSVIAERLKAIVETQPEAATFSYLEEVDPQESCHLV
                     FVESNPQTALPTLKLRYPHALLVGNGEEFVRLGGMIAFIKVNNRILPLISRKHVEPSQ
                     IRLRAQLLSIAQLFEEPTQ"
     gene            complement(139691..141841)
                     /locus_tag="AOT11_00550"
     CDS             complement(139691..141841)
                     /locus_tag="AOT11_00550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="ASM97966.1"
                     /translation="MRSIPFYSVLLPSILILPSSVASEDLLSLLDMPLSSLAETKVVS
                     ATKTSQSLADTPASVYVITAKEINRSGARSVADVLALAPGLHVAKFSNYDWGITARGS
                     NQPLSNTLLVMVDGRSVFNPMFSGVDWDLIPVSLANIAQIEIVLGPVGTIWGGNAVTG
                     VVNIITKDPEEADKATVTAQVGNFDYQEYQMRHAAPLGEYAYVSGYLEFVEHKPWTSE
                     EARVQPHQDYAVYTERFGARLDYQYLANTVSAQVGGIRSKEDYQWGTLNPYFLFPDKA
                     DIEFYDTKMTMEEYFAGVQHIYDHHSGNRWHNEAWLTYSANDSTDRNARFTRLDLDSH
                     IVVQGWFGSQLTIGGNVRLIDEEFGTYSPQEHFSMPYLRIAQQADFFSQSYGVYVNWD
                     LEVTEKTDLILGSRWQYNNLTKEIDAQPQVRASYELADNQRIWAGWGKAIVTPSRLEL
                     TTSLQSNNYIEGALFSDGNRYDYFYSFIYQGSEDLRVENVETYELGYRIWSDEVWQFS
                     AGTYYSKHHNIRAYAGVSSSQIVLPGNSSPGTVGTVIEQYVSQMVDPLWSETVGGELA
                     FKWAPIDAVQLNMNYSYKRIIGHCEGAICGSNQAVKRELENQPNHFVNAQLMWDITPQ
                     WWASSTLQYISESQMHSDYTSDERYQWPEVFSVDIALSWQHSKAYPRLTAVVENLGAD
                     QSTEFPQAFSPYQNGVQYWLTLAWSPSMEQGSAL"
     gene            complement(142124..143158)
                     /gene="potD"
                     /locus_tag="AOT11_00555"
     CDS             complement(142124..143158)
                     /gene="potD"
                     /locus_tag="AOT11_00555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727516.1"
                     /note="can transport spermidine and putrescine but
                     affinity is higher for spermidine; forms a complex of
                     PotA2BCD; PotD is a periplasmic component that binds the
                     substrate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="ASM97967.1"
                     /translation="MNMFIKGLVLSALSFSSLSQAENEVLNVYAWGSYLPEASLKAFE
                     KQEGVTINYSTFENNESMYTKLKLLKGTGYDVVFASAYFIEKMGREGLLTKLDHSKIP
                     NMQDTMDGLLGQAHDPSNDYSLPYIWGITGISYNESMVDAPVTRWADLWDKKYAQQVM
                     LIDDIRDVFGMALKLNGYSINTKNEDEIKKAYESLVALKNNVLLYNSDAPQVPYVSGE
                     TSVGMQWNGNAYQGQVEMPELKFVMPEEGAVMWMDNFTIPSGSKHKELAHKFINFMYQ
                     PEHQAEIVNSLGYASATNAGRALLPDELKNNPTIFPADADVKKGEFINDVGPEALAIY
                     EKYWQRLRTQ"
     gene            complement(143392..144348)
                     /locus_tag="AOT11_00560"
     CDS             complement(143392..144348)
                     /locus_tag="AOT11_00560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase"
                     /protein_id="ASM97968.1"
                     /translation="MMKIGVIGAGSVGVGICNYLLTMGSVSELVLLDQNLERAEGEVF
                     DFRHTAALTFSKNTHIIPTKDYLDLLAADIVVITAGAQIKQGQTRIDIAEINAKIGVD
                     IARQVERVAPNAILIVVSNPCDLVSHFIVSNTTFKPNKVISSGCVIDTARLMTIVANR
                     VQLDPKNVFGYVLGEHGSHCFTPKSLISIAGQSADYYCDINHIKRIDADELLESVKQA
                     GYEIFKRKHNTTHGISASVFRIIQAIMINEKSVLPIGTMLSGQYGLDNVLMSLPTVVG
                     KQGAEKVLMHPFSDEELATLARIAENVTAVVNEVAQVTGLKA"
     gene            complement(144507..145394)
                     /locus_tag="AOT11_00565"
     CDS             complement(144507..145394)
                     /locus_tag="AOT11_00565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97969.1"
                     /translation="MNSERKAASILILATILSAFGWIFSKETIQGLPPFGFVGLRFLL
                     ASLCLLPFCYRSLFKASWRDIRSAALVGLLLATALMSWIHAISISDTLGEGAFILSLS
                     MLMVPFVAWVLFKQRPKRIFWVSLPIAASGLAFLSLADGWQSSVSQLWFLFNAVVLAL
                     HFNINSKYSQTLPILVLTCIQLFVTGIIGLSASLLFESVPTHIEPTIWAWFAASTILA
                     TALRYVMQTMAQKQINPGNAALIMILEPVWTVILSVLWYSESLSTNKLVGCGLILFSL
                     ILYRTDGKLSLLVKSRKSV"
     gene            complement(145643..146125)
                     /locus_tag="AOT11_00570"
     CDS             complement(145643..146125)
                     /locus_tag="AOT11_00570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM99234.1"
                     /translation="MRLLLMLLILSTGSGCFASEQVDWVKVDKSKRRLYLMSGEEVIR
                     EYRIALGKQPQGHKVQEGDQRTPEGIYTLDYVTEESAFYRSVHISYPNPIDSLLAKER
                     GISPGGDIKVHGLRDGEQRDPRFVQSFDWTNGCIALTNQEMDEFIRLVKMGTPIHIEW
                     "
     gene            complement(146199..147404)
                     /locus_tag="AOT11_00575"
     CDS             complement(146199..147404)
                     /locus_tag="AOT11_00575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="ASM97970.1"
                     /translation="MSMLQDRTAILFVITATIIGLCGAFFYPLTSLFLVEQLNASPMM
                     LSLYMVVAVISSVSVSQVIAGKSDRGWQRKTILLISVSCQLVTVVSFIFIRDYWIAIA
                     VVALLGSISGAAFGQLFALGREYGDKYVTDSASFVSTMRAGIAIAWVFGPPLAFLLKA
                     AYGFEASFTVAAIVIALSILVIFRGIPNVERNLRVEKEPSRANGGWVSSVNPLVFIYC
                     LIIVLAFAANNLYIVSMPLYLSQELKVDANWLGVLFGVAALCEIPVMLWAGKLARRWS
                     ALTIMKVGIASGVLFYSAMLVATNYTHLIVAQILNGIFIGTCATLGMVVMQDMMKDKL
                     GTASTLFSNMLQLSMLVSSLSVGIVGELFNYYSSFYVSLLGVSLALILLICCQTKLAA
                     SSKLVPNSN"
     gene            147542..148429
                     /locus_tag="AOT11_00580"
     CDS             147542..148429
                     /locus_tag="AOT11_00580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ASM97971.1"
                     /translation="MKPFVENVLLEESFNWLVKRYHCEVPLEEFACPWHYHTEYELVF
                     YLDSDGIFEGKYFAGDAIGTTSHNTLLLYGPGLPHMVAGQSTSHVANPLETVIIWFSH
                     RWILDVVSTIPDAQSIVALLEESKYGLLFSPSIVNELSACLIGLEQKQRKYQALDIIH
                     ILMCLSDDKAAQRVSYTPYQLKAVNEQGATNKRLQLARAFIESHYSKNIRMEDFCRAL
                     HLSESSAYRLFDKHYGCSFSEHLKQYRIGKACEKLTRTDLPIQLIAEQTGFQNLSNFN
                     RHFKSLKQMTPKQFRIQFR"
     gene            148535..148891
                     /locus_tag="AOT11_00585"
     CDS             148535..148891
                     /locus_tag="AOT11_00585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97972.1"
                     /translation="MSLKTDIQQLHNRLDACQRKLDAARSRGDHEMISKFTDEVDQVS
                     KKLSQLKHKQSYERNKERKSILDLPFSREITKAEQADIGKLKKSVKGLVIVHPMTKMG
                     KELRLEVMTGFAPKPF"
     gene            complement(149191..149281)
                     /locus_tag="AOT11_00590"
     tRNA            complement(149191..149281)
                     /locus_tag="AOT11_00590"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(149245..149247),aa:Ser,seq:tga)
     gene            complement(149370..149485)
                     /locus_tag="AOT11_00595"
     rRNA            complement(149370..149485)
                     /locus_tag="AOT11_00595"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(149592..152506)
                     /locus_tag="AOT11_00600"
     rRNA            complement(149592..152506)
                     /locus_tag="AOT11_00600"
                     /product="23S ribosomal RNA"
     gene            complement(152840..152914)
                     /locus_tag="AOT11_00605"
     tRNA            complement(152840..152914)
                     /locus_tag="AOT11_00605"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(152879..152881),aa:Val,seq:tac)
     gene            complement(152929..153004)
                     /locus_tag="AOT11_00610"
     tRNA            complement(152929..153004)
                     /locus_tag="AOT11_00610"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(152969..152971),aa:Ala,seq:tgc)
     gene            complement(153019..153094)
                     /locus_tag="AOT11_00615"
     tRNA            complement(153019..153094)
                     /locus_tag="AOT11_00615"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(153059..153061),aa:Lys,seq:ttt)
     gene            complement(153096..153171)
                     /locus_tag="AOT11_00620"
     tRNA            complement(153096..153171)
                     /locus_tag="AOT11_00620"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(153135..153137),aa:Glu,seq:ttc)
     gene            complement(153230..154781)
                     /locus_tag="AOT11_00625"
     rRNA            complement(153230..154781)
                     /locus_tag="AOT11_00625"
                     /product="16S ribosomal RNA"
     gene            complement(155223..155741)
                     /locus_tag="AOT11_00630"
     CDS             complement(155223..155741)
                     /locus_tag="AOT11_00630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="medium chain reductase/dehydrogenase"
                     /protein_id="ASM97973.1"
                     /translation="MRQINKEEYRKKGNMVIVAFLLAFACSAIAFSTLLIALFGNTEI
                     VEGESTGNFVWNLLGVLIAFVSTLSIMNQIKTHRYFDELLYVWKLKQTHLKIYRKLNI
                     LKNAAHNEHNEKAITILKFYYQTQQQVFELDNNTLTIKSVLNELERIHQWEESHRVLN
                     VSDFQDAWLNDF"
     gene            155930..156526
                     /locus_tag="AOT11_00635"
     CDS             155930..156526
                     /locus_tag="AOT11_00635"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97974.1"
                     /translation="MRTFVLRARAAPTNSRALLEGVGNEAHTEILAHTLMNTMFVAQS
                     HRQDVVVHLVLESTKDFSRTITIHSNEVSNVGGFHEANLLNIVVRALDASTGMGKEEL
                     RNVEPGVTVRTISFERLVQQLAEDHQLYMLEKKGEFVRDIKFAANPCFLLTDHIPMPK
                     KTFNSLKRLGTQNISLGPKMLFASQCVTLIQNELDLQE"
     gene            156861..157700
                     /locus_tag="AOT11_00640"
     CDS             156861..157700
                     /locus_tag="AOT11_00640"
                     /EC_number="2.7.4.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421887.1"
                     /note="catalyzes the formation hydroxymethylpyrimidine
                     phosphate from hydroxymethylpyrimidine and the formation
                     of of 4-amino-2-methyl-5-diphosphomethylpyrimidine from
                     hydroxymethylpyrimidine phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylpyrimidine kinase"
                     /protein_id="ASM97975.1"
                     /translation="MLLTSTTQSLIPCVLTIAGSDSGGGAGIQADIKAISATGSYASS
                     VITAITAQNTMGVNAVFPIPTEFVAAQLDAVFSDLNIQAVKIGMLADRHIIRLVAEKI
                     RQYSPAKVVLDPVMISTSGHALLQPDAIAALKEHLIPLADIVTPNIPEYVALTGMPIP
                     NTEQEMISSVESLKALNCPAILLKGGHLYNESHSSDLLITPQFCEFIRSKRHSTRNTH
                     GTGCTLSSAIASYLAQGHRLHKAVFLAKQYISQAIAHADELSVGQGHGPVNHFFAGHM
                     NVR"
     gene            157872..158621
                     /locus_tag="AOT11_00645"
     CDS             157872..158621
                     /locus_tag="AOT11_00645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid phosphatase"
                     /protein_id="ASM97976.1"
                     /translation="MKTVFTPKRYSLVALSCFAALLTLVTWFASGIDLRSPVPDFLGL
                     TFTLVTDSAGSKGFAITLVALSLLVLRQHSGRYFVVGRFAVLALMLVLSFAGKTGLKQ
                     LTESPRPYTEWMASEHLVDTPQAFYNLDATQQVTLVKTQEETISPWRLQHWEGETDYS
                     FPSGHTIFASLCVAFFGGIFLMQKRYVAFVTTLAWASLVAYSRLWIGMHRPEDLFGSL
                     AFIAMITALLPNFLPIPTSVRKFLRIRESTV"
     gene            complement(158954..159397)
                     /locus_tag="AOT11_00650"
     CDS             complement(158954..159397)
                     /locus_tag="AOT11_00650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM97977.1"
                     /translation="MPRVSQAVAKKTHQNIIDASFKILLLEGYEHLTYTHIAEKTGVS
                     RSCVNGHFKKKEELLDELKPKAVEHIIQALEFSSPEAFYLSWVNAVNEDRMFRNLIQN
                     VGEIICSAEGRMSLTNRISGDPKEAEKALYMAIGYAVVHISCPIC"
     gene            complement(159782..160072)
                     /locus_tag="AOT11_00655"
     CDS             complement(159782..160072)
                     /locus_tag="AOT11_00655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97978.1"
                     /translation="MITVHRDYRVSIKPERYAHVEINPVGKLDVEIKGQRQHYVADFE
                     QLAFSSDKQGVALVCQQAHSPWKVMLATADAQELKSLVKEAQEEYEILMRDL"
     gene            complement(160225..161028)
                     /locus_tag="AOT11_00660"
     CDS             complement(160225..161028)
                     /locus_tag="AOT11_00660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="ASM97979.1"
                     /translation="MSLSEIKFIAADMDGTLLDPSGKLAPEFFHIYQTLEDKGIIFAA
                     ASGRQYYSLRETFSPINERMMFIAENGTLVMHQGKELYSCGLASTDIKDIIQLARTID
                     GAHIVLCGKESAYVETKHPEAIEEISKYYHRCQYVPDLLDVDEAFIKVAICHFEGSQE
                     KLHTSFSERFDATHQVVVSAKIWLDVMNAEASKGAAIRHLQQTLGFTRQQTMSFGDYF
                     NDVEMLKQSYHSYAMANAHPEVKALARFIAPSNEESGVLQVIQQQVLSD"
     gene            complement(161125..161664)
                     /locus_tag="AOT11_00665"
     CDS             complement(161125..161664)
                     /locus_tag="AOT11_00665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="ASM97980.1"
                     /translation="MLEKEKTGLIVVDVQGKLAQMVDQSEQMITNITKLIEGAKMLGL
                     PIIWLEQIPENLGATVGPIANALQGYQPFHKSTFSGCGTATISNAIQASEVEQWLLCG
                     IEAHICVYQTAVDLKQMGYQVEVVTDCVSSRDPQNKALALRKFEANGIGLSGLEMALF
                     ELMRDGKCPEFKQLLPLFK"
     misc_binding    161863..162003
                     /note="FMN riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="flavin mononucleotide"
     gene            162100..162756
                     /locus_tag="AOT11_00670"
     CDS             162100..162756
                     /locus_tag="AOT11_00670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001076639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="ASM97981.1"
                     /translation="MNQSSLLAEFGDPITRVENALLALKEGRGVLLLDDEDRENEGDI
                     IYSVEHLTNAQMALMIRECSGIVCLCLTDEHANKLELPPMVVNNNSANQTAFTVSIEA
                     KQGVTTGVSAQDRVTTIKTAANPHAKPDDLARPGHVFPLRARPGGVLARRGHTEGTVD
                     LMQMAGLQPAGVLCEVTNPDGTMAKTPEIVAFGKQHNMPVLTIEDMVMYRNQYDLKLA
                     "
     gene            complement(162883..164823)
                     /locus_tag="AOT11_00675"
     CDS             complement(162883..164823)
                     /locus_tag="AOT11_00675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate decarboxylase"
                     /protein_id="ASM97982.1"
                     /translation="MTEKHNVTIGYGPKQLPWYQQVPEFAQGLISPPEEDPVKVYLRG
                     NESFGLEEQSIRQASFEIPPTGQCACEQSAAFQEILQYVNQQKKRFLGYQTEEKINYR
                     ERIAPFLDISMNNVGDPFVDGNYTVNTKFVERMVLDYFASLWNAKWPSQGPYLKGDGT
                     WDRGDPESYWGYVLTMGSTEGNLYAMLNARDYLSGQTLLDDEICGEDAEGKVVKSSQL
                     YAHYPQAPEDNPNAYTPVAFFSEDTHYSIVKAMAVEKIETFGSLGNRLYPNENPCGEG
                     DVWPSEVPSEAPTVEFDDDKPQINDKPSNKLVGSGAIDIKKLKAYVKFFAEKGYPIIV
                     VLNYGTTFKGAYDNINEATQMLEEVFRENGLYERQVPIDPSDPSKTETRTGYWIHIDG
                     ALGASYMPFVKMAAKLPKYEAFFEENHCYTGPDFDFRNPMVHSIVTSGHKWPGAPWPT
                     GVYMTKHKFMVSPPDNPTYIGSPDTTFAGSRSGISPLILWDYFAKHSYEKQIKLAMRG
                     QKMAQYAYQKLQEVADYWKNEKPDSGVPEGLWLQRTPLSLSLIFCQPKDEIIFKYSLA
                     KEEIDEPDSSSGLKTRKYVHMFTMWDVTKKLIDKLCDDLKKDDAFNAEDFKPLTNVRR
                     TRELPHSSAHLVKLPTKGRSFR"
     gene            complement(164956..165558)
                     /locus_tag="AOT11_00680"
     CDS             complement(164956..165558)
                     /locus_tag="AOT11_00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="ASM97983.1"
                     /translation="MIKKIVFMFSALLLSVSAYAAKFEQGTHYTVLPTAKSQKPVVTE
                     YFSFYCPHCYRFEGVVESMKKSLPEEARFEKVHVSFMGGEMGVPVAKAYATMVSLDAE
                     KTMVPAMFTQIHEKRKAPQTEAELRQLFIDNGVDAKKYDAAYNSFAVNSMQKRFDKQF
                     KESTLTGVPGVIVNNKYIVKADKITTIQEYNELVNYLLTL"
     gene            complement(165610..165936)
                     /locus_tag="AOT11_00685"
     CDS             complement(165610..165936)
                     /locus_tag="AOT11_00685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97984.1"
                     /translation="MPLLIVLAVAIIFMASSEMIKNTLSFSESVAVQATETTCPDVHH
                     DIKLESSQPSHGCHSVCIGKMPASKAQLASLQQAFALALISRDQSVKAFSMNESLFRP
                     PISTFV"
     gene            166180..166476
                     /locus_tag="AOT11_00690"
     CDS             166180..166476
                     /locus_tag="AOT11_00690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-alpha-glucan branching protein"
                     /protein_id="ASM97985.1"
                     /translation="MLKKRFFKTKDEVEVTFEVQQENWESAHVVGEFNNWKPEPMTLV
                     KKSGLFKFKTRLPREQKVEFRYLFNQNQWGNDPQADGYVANGFGSDNGFVLTSE"
     gene            166605..166955
                     /locus_tag="AOT11_00695"
     CDS             166605..166955
                     /locus_tag="AOT11_00695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97986.1"
                     /translation="MYWIVTKYLITAAIVVFISEVAKRSDKAGALIAALPTVTILALI
                     WMYLEGQGNEKLTNHAYYTFWYVLPTLPMFLIFPYLMERFSFWISLFFCALISVSSFA
                     CVAFIVKHFGIKLT"
     gene            complement(166942..167856)
                     /locus_tag="AOT11_00700"
     CDS             complement(166942..167856)
                     /locus_tag="AOT11_00700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM97987.1"
                     /translation="MQTQINLADIRSFVLIAQLGNFTKAAEALGVSRSHVSRQISQLE
                     KQMGVTLLIRTTRTLKLTDAGKALFAQCEMALHSIDQAVLAAVDDIEAVRGEIRINCV
                     GGYLGEEVIAEVVGQFMQQYPQVRVDLDFSSHRVDLIEDEFDIAFRMGKLEDSGFVAR
                     KLIDVEMGTYASPSYLAMHGRPDHPKELDQHACLTGSVTRWTFQHRHTKQTSDCQVRG
                     KLRCKNGRVMLKGALAGNGIIRVPTLYCMQELEQGLLREVFEDWHVPSVAFSALYHRD
                     RYQPKRLRTFIEFTSDYFRQLQKSIKSA"
     gene            167997..168716
                     /locus_tag="AOT11_00705"
     CDS             167997..168716
                     /locus_tag="AOT11_00705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017188700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="ASM97988.1"
                     /translation="MKKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLEALNL
                     PNTLCAQVDVTDKSTFDAAIARAEEIYGPADVLVNNAGVMLLGQIDTQEANEWQRMFD
                     VNVLGLLNGMQAVLAPMKARNSGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVR
                     EEVAASNVRVTTIAPGAVETELLSHTTSQQIKDGYDAWKVDMGGVLAADDVARAVLFA
                     YQQPQNVCIREIALAPTKQQP"
     gene            complement(168751..169653)
                     /locus_tag="AOT11_00710"
     CDS             complement(168751..169653)
                     /locus_tag="AOT11_00710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM97989.1"
                     /translation="MDRLDAIKSFIEVANCRSFTQAAETLSLSRLQVTRHVQEVESWL
                     QQRLLHRTTRKVSLTHAGEQAFIRCQRILDEAAALELDAVQSRDSLTGSIRISAPIGF
                     SQHHLIDAVSAFTGLHPLVTVDILASDRFSQLVDERVDVALRYTDQPDETLIARKLMD
                     IDAVVCATQGYLDEHEPIVEPEDLANHNCLVHLSTHLWRFVADNQISEVSVKGNIRAN
                     DLSTLLGAALAGKGVIRLPCDLANPLLQQGKLVALLNRYTLPSSSLWAVYLSRSYQTP
                     VVRQFIDFIAQRWDQNVQLWQRPA"
     gene            169773..170408
                     /locus_tag="AOT11_00715"
     CDS             169773..170408
                     /locus_tag="AOT11_00715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="ASM97990.1"
                     /translation="MKIAILGATGWIGSTLVNEARERGHDVIAIARNPNAIERDDVEK
                     RPFDVRQPHNLAQTFQDADYVIAAIGGRANGDHSIVAETAQLLLTQLADVGVKRLLWV
                     GGAGSLEVAPGVKLVTVPEFPEEYKAEALAQSDALDRFRSTSSPLTWTFISPAAEIFP
                     AEKRHQYRVGGDQLLSDDDGKSQISVADYAAALLDVLETNQYLNQRIGVAY"
     gene            170721..171425
                     /locus_tag="AOT11_00720"
     CDS             170721..171425
                     /locus_tag="AOT11_00720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator"
                     /protein_id="ASM97991.1"
                     /translation="MVEDQKLIIVEDDIKLQQMLSDYFMSQGFSVITVDNGTDAPEMI
                     LNEKPALVLLDLMLPGQDGLSVCRQIRDAYNGKILMLTASDDDFDHVAALEIGADDFV
                     NKPIKPRVLLARVRMLLRRPDVAVNQDANNCRYGTLKLNRIRRECQLADQTINLTDGE
                     FDLLWLLATSAEQVLSRESLTKALRGIEYDGVDRTIDNRVVTLRKKLNDTTTPPKKIL
                     TVRGKGYMFMPDTWNE"
     gene            171435..172715
                     /locus_tag="AOT11_00725"
     CDS             171435..172715
                     /locus_tag="AOT11_00725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM97992.1"
                     /translation="MKRIYLEAFFGLILLFFATLWGYEVIVYQLNTDYDRVLTEFEIN
                     AFHDLLTPLYQEKGQAYFTEAMENYAEATRSILTIYEQKQLPKEIAAVFVDPAMLVYL
                     DDDFDVWMRFSANSTIYHLKEDLQSPLRQAIDFSGNLVWVFFIIGFAIYCVILIWFLS
                     RRVRELERVTLAFASGDLSARARTTARYSVGSLNKSFNLMADKIANLITSNKVLTNAV
                     AHELRTPIFRLQWQADLLADSPLTEMQQKSVSSMVEDIDEMEAMVEEMLYYAKMERPE
                     AQLHTQAISLLPWCETLVRKWQSETYHPIHLQIDSCCDQANVDPHLVKRALDNLVRNA
                     MRYTQTQVRIQVTHTAEQLEFQVHDDGKGVAEQDWPYLFDAFYSADKSRNKSTSGYGL
                     GLAIVKQICQIHNGSAQVAHSPLGGACFIIRFSL"
     gene            173047..173403
                     /locus_tag="AOT11_00730"
     CDS             173047..173403
                     /locus_tag="AOT11_00730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="ASM97993.1"
                     /translation="MKPGKTGIRRIVDATGYSMKGLKAAWINEAAFRQEILLTAALTI
                     TAFFLPVTTIERILMVSSLLLVVIVELINSAVEAVVDRISDDWHELSGRAKDIGSAAV
                     FVALALALFVWASVLL"
     gene            173409..175061
                     /locus_tag="AOT11_00735"
     CDS             173409..175061
                     /locus_tag="AOT11_00735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ASM99235.1"
                     /translation="MNRIKSLFNRECSYTTFTLVLAIYFATIVNLPIYKELFSIISHL
                     DSVKVGFVISVPIFFLAALNFLFNLFSWPWLSKPFFAVLLLLSAMVSYAGYNYGTLFD
                     YGMIANIMETDSSEAGSYLSAYSVIWTLLMGVVPALLVCKLNLCLSGSTLHMVAKKAA
                     SMLASLAVIAVIAGLYYQDYASIGRNNTHLKKMIIPTQYVYSATKYVRDTYFSTPQPY
                     RQLGLDAKQSELALKQAEQKPTLLVFVVGETARSQNYQANGYARPTNQYTNELGMISF
                     QDVSSCGTATAVSVPCMFSNMTRSNFDRPTADNQDNALDILNRAGVSLLWKENDGGDK
                     DVAKNIRLVTIDRSRKDALCNGSTCFDMALLENFEQDVESLNGNRVIALHLIGSHGPT
                     YFQRYPKDKAAFMPDCPRADIENCSVEQIVNTYDNTILYSDYVLSQTINKLKALEERY
                     NTALIYVSDHGESLGENGLFLHGMPYSLAPEYQTKVPLMLWMSPGFAQTKQINADCLE
                     QQAKQTDTYSHDYIFHSLLGVMDVSTSEYDATLDLFKQCRAQ"
     gene            175072..177003
                     /locus_tag="AOT11_00740"
     CDS             175072..177003
                     /locus_tag="AOT11_00740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97994.1"
                     /translation="MRKINLGPLQPIAAFAAVALGLVTLSRFLLALWQFDRITAADGW
                     SDLLFQGLRVDIATLCWLFILPCLLAAILPVDGMVGKIWRAVLRVWLVAGLWIMVYME
                     LATPPFIMEYDLRPNRLFVEYLIYPKEVFSMLWQGYKIELFIGLVGSIATLWLGWIFS
                     GKVTENVRQIKWQWRPVLATAVVLLGVLGARSSLGHRPLNPAMVAFSSDPLVNDLVLN
                     SSYSVFFAINNMKSERSADKFYGQMSQDKIIELVKASSAKHDFVQGSLPTLNVNNATY
                     QGKPKNLVILLQESLGARFVGGLGGLPLTPNLDKLLEEGWNFTQMYATGTRSVRGIEA
                     ITTGFPPSPSRAVVKLSKSQTGFFTIADLLKKQGYHTQFIYGGEAHFDNMKSFFLGNG
                     FEQIVDEPQYQNPEFTGSWGVSDEDLYNKADEEFTRLNKEGKPFFSLVFTSSNHSPFE
                     YPAGKIEPYESEFNTRNNTVKYSDYALGTFFDKAKQSDYWENTIFIVIADHDARVFGS
                     QLVPVDRFHIPAVILGKGIEPRKDDRLANNIDMPPTLLSLIGIDATSPMIGRDLTKPL
                     ARKDERAMMQFDKNYGYLTRDSLVVFSPGEKVSSYHYNFEDKSLTPKEVSQESLDKAK
                     ANALFGSMAYKYNWYKSDY"
     gene            177141..177575
                     /locus_tag="AOT11_00745"
     CDS             177141..177575
                     /locus_tag="AOT11_00745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97995.1"
                     /translation="MRTLGNIIWFLFGGVFMGLAWWFFGILAFISIIGIPWGRACFVI
                     GNFSFFPFGSEAVYRDELTNKRDIGTGPLGLIGNVIWFLVAGVWLAIGHILSAVACFI
                     TIIGIPFALQHLKLAVISLAPIGQTIVPVEVAEAARYHNRSR"
     gene            177790..179841
                     /locus_tag="AOT11_00750"
     CDS             177790..179841
                     /locus_tag="AOT11_00750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosidase"
                     /protein_id="ASM97996.1"
                     /translation="MSEKSNKEINVKQVLTTLSLAVTAALLAGCNASSKIDTPPTANA
                     YRCDAVAMNKADDLRIYQVMVESFVNGNDQIGHGTGYGTSHHKGDIQGIIDSLDYIQS
                     LGMNGIWLTPIFNSKPKAGQDHWADRLDATGYFATNYFEVDPRFGTMDDAKRLVEEAH
                     ARGLYVFFDGVFGHHKGDVAASPTGKLPEGSNNPVDYPESLAFYQEVAEFWIKELKID
                     GWRLDQAYQVPKEAWVEIRKTVDNASKAVTYTNSKGETVNPLGYMVAEIWAGENRIIE
                     TGYGSNENPALCSAFDFPVRYRLVETFGVNEAGVGGKSGEWLAEGMNLHALYPEHAKP
                     NLMIGNHDLVRFGDLLQRGNIAQPQDEEYWLRHKAVFAFQAAYTGPITLYYGDEIGDQ
                     VENFAAKVEQDCAVKGLCDDHVARSSGKVEGVTATLNANEQDLKHYIQQLMNLRNQHP
                     ALSQGKRVNVLADNKTYIDHKSTDSEAILYVANISKHLQYLQLDAVKAGSEGHLTDLI
                     NDEEIKLIDGQYLIPLAPLEARFLSIEQPSKAGPQIAKMALASGIGEGFMAQCDNPTV
                     DEKGPMRKKLYVVGDFSDSSWQHKDHRQFEYKGDGIYQVVTNEKPGSYRMQYAAKTWT
                     PQFTAKGLSLKLGQENPLIKGGYGKDTAVTIMDEGRYVWSLQFDEQGTPLNVMASKCA
                     E"
     gene            180119..181750
                     /locus_tag="AOT11_00755"
     CDS             180119..181750
                     /locus_tag="AOT11_00755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease I"
                     /protein_id="ASM97997.1"
                     /translation="MLNRIITLSTLALLSANPASAQLLNGDFETWSGNSPQGWSTIDS
                     GIAVSSATTPLKTGKLAAAIAVNTGTQGNTDFLQMVNVEQGKTYQFSVSVYHTEGKVM
                     ARLIADGYQGYSNNGLTNQWQELTFSYTATSTKSIPVGLRFYDVSGFDGSEVVYIDNF
                     QPTESATTPTEPESCSATTATLSLTTDQYASETSWLLKNSSGTTLFSGSGYENSTTYN
                     QEMCLSDGQYTFEILDSYGDGICCGVGNGSYSLVANGNTLASGGEFTQSQLTSFTIGD
                     SGTTTPTEPPVLGDYYKAAEGKSGFALKTALYNIITNHNSQGYSAIWELAKVADLDLY
                     YENDGSILDMYSEKASGADSVHFTKGTNQCGQYSKEGDCYNREHSFPKSWFGGTVEPM
                     NSDGHHIFATDGYVNAKRSNWPFGEVGSATYVSSNGSKLGSAKSDLGYAGTVFEPVDE
                     FKGDFARAYFYMATRYENAIANWEGNTTNANDVLNGTSTTVFEPWMLNMLKRWHNADP
                     VSQKERDRNQAVYEFQGNRNPFIDHPEFVTAIWGN"
     gene            complement(181832..182617)
                     /locus_tag="AOT11_00760"
     CDS             complement(181832..182617)
                     /locus_tag="AOT11_00760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="ASM97998.1"
                     /translation="MNGFQKSGLALCGLLAFTFSVSAATPPVTSLQQLTFFSESYPPA
                     NYLENKMPRGYSVDVLRQAASIVGTNIKDEQIVIQPWPRSYRATLTHDDAALFSTTRT
                     EHREHLFQWAGPISDIKAVVMARVDSDIVINDPIDMANYRIGVIRDDVGEQMLLDLGV
                     PREAMQEANYVTQLAEQLMKKRIDLLAYDESAALWFTSQAGLDPKLFKTVYILKEGEL
                     YFAFNKNVPKKLVDQLQKGIDILKQQTNEEGVTLHQAILNRYR"
     gene            complement(182737..183021)
                     /locus_tag="AOT11_00765"
     CDS             complement(182737..183021)
                     /locus_tag="AOT11_00765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97999.1"
                     /translation="MTKKPDRQTAMRNIIDAVKKELPLYESETFVCGPKGECVGCPKK
                     LLEMVDGELSYWEHAMNRGVIPHFDEIRRFGKLCSSVRKGLVRNNLISST"
     gene            183207..184280
                     /locus_tag="AOT11_00770"
     CDS             183207..184280
                     /locus_tag="AOT11_00770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM98000.1"
                     /translation="MESYLSKKVVPPKESGGNNDARENKNNFAALPLGFLEELAQSNS
                     LEDILLCTSYWIREIFQADRSSIALRENDAYLKLYALDGNDVLPKDCLIPIQSSFVGQ
                     VFSQQKTAISPDNRKSNMIDCQWLVDGGLLCCMDTPLKYKEECYGTLNVAHKQVDSYS
                     EIDAKILETIAKWVAAQIYKHKQINKMIELAHLDPLTGALNRRAFVEATYFINDKPRQ
                     YDHKTALLMLDLDKFKAINDAYGHPVGDKVLIEIAQILKNSVRSDDLVARLGGEEFAI
                     LLRHVNADEALRLAELLRAMVEQTVVEHQNQAIHCTISIGIALPLPTDQGFEELMQRA
                     DNALYVAKRKGRNQIILSGMSET"
     gene            complement(184252..185160)
                     /locus_tag="AOT11_00775"
     CDS             complement(184252..185160)
                     /locus_tag="AOT11_00775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="ASM98001.1"
                     /translation="MLLRLIPFLFVLLWASGFVGARLGLQYAEPATLLAIRMLANIAL
                     FLLLIVLLRRRVPTGAAFWHSCVVGLSIHGLYLGGTYWAISLGMPAGLSSLLVGIQPI
                     LTALILVVTVQERFRFSQWLGLALGLLGISLVLSGKMDWQTEAHKTLAITLCLMALVG
                     ITLGTLYQKRFCHGVDMVGGAMVQYFAAACLFLPFAWQFETMQVQWTTTFVLTLLWLV
                     VVLSCAAILLLLYMVKNGASSSVASVFYLVPPVTALQAWLMFGESFDTKAMVGFLLAA
                     VAVYLVVRKPKKVKNESVKSHSYLTE"
     gene            185248..186696
                     /locus_tag="AOT11_00780"
     CDS             185248..186696
                     /locus_tag="AOT11_00780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98002.1"
                     /translation="MGTDERDITHNKYLVVEQYVRSAIQSGLFQHDERLPSIRRLQQE
                     LSVSKNTVIRAYQELEAQGWVYSVERSGYRVKPALISPERTHTKPTKVDLLSVCKEFL
                     TYPHEKEQLPTGSAHPNIDAPAIKSLYAEIGRHSRRQSQLPSHYQLPPGDTLLVKQLA
                     KITADLGVPVQLSEIITTHGAQQAISLALRATTVTGDIVAVESPCYFGNLLLLESLGL
                     NVLEIPSCPKTGMEVDALAKAMEEWPIKAILVTPNFTNPTGATMTLEKRLALLQVSHD
                     VPIIEDDVFGALSFEEPLPTLKSLDKANRVIYVNSLSKTLDSRLRIGWLLAGRYQAQI
                     EKLLLCDNMGSLNLMQSAIASFLTTGKYRAHTARMRRQYQCQSKRFHAMLSKALNQIP
                     ALENRYQLHLNQGSFLLWLILPEGVDSHALYLDCRKEKISLLPGTVFGTHNQYQHCVR
                     FCVANFSHDRDWTLPISQLAKLIRHHSRKAAT"
     gene            186821..191407
                     /locus_tag="AOT11_00785"
     CDS             186821..191407
                     /locus_tag="AOT11_00785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98003.1"
                     /translation="MKKRTMLLLGFVAVFSIGCDNNTTTQQEILPIANAGHPISSGRG
                     TTVVLNGSQSHDPDEKSLTYQWTIIEKPSGSLSTLIDNTSPFPSLYLDKVGIYKAQLI
                     VSNGEKESQPSIVTISDADTPPVANAGKDIKLSDLGFVVLDGTGSFDSDGDKLEYRWT
                     LVKKPQGSSASILQPTSATPTLNYDSSGEYIAELVVSDGVYQSTPDRVVLTDSNIAPI
                     AKPKAAAFMTLGQAVALSGSESFDADGDTLSYQWHMVARPNGSQANLLDATTPQTSIT
                     PDVAGDYIVALVVKDGNNASSPATVTIHAASSLNQAPIAVTGHDRQITTSQEVHLDGS
                     ASHDPEGNSLTYRWSLVHKPSGSLAQLSEPFSVHPFFTPDIPGSYVAQLIVNDGTRDS
                     LPTSVLLSDSNLPPVAHAGGDLKGTPGQTVQLDGSSSTDGNGDPLSYRWHIVSQPSGS
                     QAVLANSTAAQPSFTLDVQGHYVVQLVVNDGYADSAPDTVVITDVNLAPIADAGSDQK
                     ISKGSTVNLSGSRSTDPEGQPLSYRWKLLSQPAGSAALLSATDTITTDFVADVGGDYI
                     VQLVVNDGELDSTPATVIVRDFDKNTLPVASAGADLAAEAGQSILLDGSASYDADGDN
                     LSYQWALLTRPTGSAAQLTDAVSANPTLKTDVVGDYVVQLVVSDGKGNSLPDTVLIHD
                     VAKNVAPVADAGNDRQVDLGSVVTLNGQASFDANGDSLSYRWALISKPAASAASLSST
                     NQASSQFTLDIAGSYVAQLIVNDGKLDSSPVTVSISNKPSSGIGANPVPSGHTLILSS
                     SLGGDEQVGGLYSISEKNLNEIHPLMSLKGKPGVQTTDYLGLVFSPERGKFFFMLPNE
                     GLYGGATVMSFDPATKAVEVLRHIEYEVVNSNRVYGFASRLLIHPSGKALFGLAKYGS
                     LLNAGRVFYLNIDPASPDYLTFTWIADLGTPDVLGDTFGRGPLAHMQWNGDNRIFIAN
                     QSKVNATKTNVFELTPSNSADLSQPWVPSPFLNSRYINSFIYSYSGNYISASGDSFVS
                     ANNFDGKTIFDVSTREGGGSGTVNFDCRRSLGVFSWLGRNRYSVCRGDSSRTPLLTEV
                     NTVNGGSSDVRRFSGWGGAIATGFAPSSTGGALYIANGDDAASAFADGVRSSGSNVIA
                     GFTIKPSQIRSVGGLNYADSAFIVGGADRGYIFVGDPGIADFPNDSINDRYVSILSYD
                     GGATRNGAIVTKDRLDDSVTVTSLGYAAGAYPIGKPLVHSSGNIISSVWFAPGFEGWG
                     ATFSYDPTNALIKYGTGNQSVRPGIALKEDSQGQLIGLGTDTNDAFRQVLYSIDPDTL
                     TYSAIASFDSTGQAEATTEVAVKDSQAWVISDSNLYCFDLLTKARANTGSFTSNGAHS
                     PVRALTYSAASSLWYLPTAASGVSGQGTIQQITDDCSAPIRTDAVTGLVDIPSTALLA
                     ASDGKLYYGTENGKLMQFDPMLNQVQQFAALGVGKVVGYLTEDSNGDILGILRLDGSD
                     VLFAAPLAGGTVTSKALPSSSPVDAYYPGVVELK"
     gene            191578..193425
                     /locus_tag="AOT11_00790"
     CDS             191578..193425
                     /locus_tag="AOT11_00790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="ASM98004.1"
                     /translation="MTATAYLNELNQQYLTIHRTKEDFFWETYMGISDDHQGSTKAQT
                     EWTNFLSQASKINEIRQQLEAAETIADSSEKAQTIQGLNGWLAMFQSHAIESPEAGEL
                     KNDLIQFEAEIFEKKQKHVLTYVNEKGETVEGSLPILSSAIRANNQESVRQSAHQALL
                     DLEQWLLQNGFLELVKKRNAFARTMGYANFFDYSVVKTEHMTSDELFVILDDFEQRTR
                     QNHQNSLDALAQEKGKDALKGHNFVYSFSGDVMRDLDPYVPFSKSLRRWVESFGRLNI
                     DYSGAELTLDLLDRKGKYPNGFCHGPIPSFYDQGEWIAAKVNFTSNAKPDQVGCGYDG
                     MNTLFHEGGHAAHFANVKLNAPCFSQEFAPTSMAYAETQSMFCDSLLDDADWLKRYAL
                     DDAGNPVPDSIIQAMVNNRQPFKAYAERSILVVPYFERALYQMSDEQLTAESVTQLAR
                     DTEMRILGLACSPRPLMAIPHLLSDEASCAYQGYLLAHMAVYQTRAYFTEKFGYLCDN
                     PEIGPLLAEHYWHAGNSVSHSESIKRLTGEGFNAKYLADACNQTAQQAWEKEQQKIAA
                     LAEREIHTPASLNATITIVDGSKVLASNAISDADMCDQFEAYIVKTYGR"
     gene            193722..195464
                     /locus_tag="AOT11_00795"
     CDS             193722..195464
                     /locus_tag="AOT11_00795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98005.1"
                     /translation="MVVNKIILASAVAAAAASGAYFYKVGLNTQAGDDFLAYVPADTP
                     LISLQTNAINHYEYLTSMGYQNESFADAFDLKELTPEQAFLLAYFDGYLNSASNEQSL
                     KNYLGTGDNVKPLLYTLGMVPVYKFEIENPTAFWATIDKKEKETGATHEVGKLGQADY
                     RRYVLASEPSAEQNLGFVIALEGKVVTFTLDVPMFGAENTLKMALGAEKPQHSFADSG
                     KLAALQTKYGPNYQFYAYLDNQEVIKGITLKGSNQLARQIDVLQQLSPEDQIDVLRQP
                     TCHSELTTIANNWPRIVSIASYQSKDKQLVMDGSIVVESNNQVLINALKTVRGFIPSD
                     EINRDSIFGMSFGLDVAKLAPAISNIWNDLTQPSYSCELLADVQREIRGENPAAAVSM
                     GAGMVNGVKGIQFSLNDITMNLQGQYGPEFEKLDFLFSLSADDPSLLVQTAKMFVPQL
                     AEVNIEPNGQAVDLSALVEAQTGMKTPLFARMNDKHLTLYAGEKAAAESEVVLKQPLE
                     AGGLWQAYMNTSRVLEFATMAAELSGEPIPEEVSEALTVDATLNFVFDANDKGLEMRY
                     DYRIDKSSMNVANQ"
     gene            complement(195778..195987)
                     /locus_tag="AOT11_00800"
     CDS             complement(195778..195987)
                     /locus_tag="AOT11_00800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98006.1"
                     /translation="MKVVVEFLESGRFRDNFWDGEFRVEKGEHRAVSPSLAAQLIHNR
                     QASLYHSDDPDQTAFINPADGTPMK"
     gene            complement(196192..199860)
                     /locus_tag="AOT11_00805"
     CDS             complement(196192..199860)
                     /locus_tag="AOT11_00805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98007.1"
                     /translation="MRANKIVIALSVAGMVSLVGCGSDSSDSSTPTVPDTYSVTAIDG
                     YLHNAKVWLDTTPNWVHDDGEPIAYSNQQGVAQLDVSNVANYQSFPVIVQAIAGETID
                     TEGGNVDPITAGYTMSAPAGEAAITPLSTLVHVDMVNRLQGETNPILIAAQQQQSVKR
                     IAEQLGLTDEQVLGDFLDEEHQQAAFAARSLVTVGVVLAETPEQYQTTMDDPEASQKM
                     AHTAEQVNKGIKKTIEDTSAEDLADKKPEFNYDADNDGNMDDDGDGVPDLFDEYPDDA
                     TEYRNFDGDELGDNADPDDDNDGVKDVDDLFPNDNTQAGDPDKDGFDSLVDQYPTDPK
                     LAGDHDQDGYDSVVDEFPNDNTQAGDHDNDGVDSLVDAYPDNADKSTQDQSTELSYRW
                     PTVTHLGKEARVLDVTYHTSVETFNSGLVTTEVERTFRTVEGDLLGEEHSIEQTQKDG
                     SFSRISEWRYDFNLDGEILFVGRSLDIGKKTAQGEQYWKYIDEADAALEGADNGGGRT
                     FDGVNFTSRQHPQTLLGIDTIQYVTVTQGTDGELASVTTQLDQFAVNGFKIDDDATHV
                     KDYAYRGVEKRREQIPVWLEEHRDWQANGSTNQYRLFVADSENTYRLTEHQPIWSSPT
                     DNSYEEYADYNYNNQKWENRTAYWVERTTELLADSSTKVSGSRYLLADSDAIKRTSSE
                     KPDGEKFSEFSLHERTISATEKRAYETWHHIALEGYDFTASENVFGHQYTVFNLYDDI
                     WMGYSYTQWFDRNIDLIAEVDSLLEQGVPVDQITSEMIPNLNLYAKPAFTPSFRYHDN
                     GDPRVWYLVTDDPFYDASGYVMQAITFTPGGLANAFDVFDVVNGIYLLKGKVEQPQQW
                     QEIIPRAIFMQNAQADSSGISFMTERGDEYFASREKAQQRLKVLQAQQSLCTYGDTGW
                     DEQNNRPAGSPTEADFYQALETCLYLPLTPEQLVTMQWHYYDAEDRVHESYLFYEEGA
                     GVMLENGNYLKDLTWTINEKGIVTIRFPLDDDVDMFALTGEHKTGYYLKGYFQWNKVV
                     TEEESERLSEIVAVDYMKYAPQSDPAVSCDTGNTPWDEPNDKPVYYESFEAYQAAVAQ
                     CKSQMGDGSVLTAELMAGTDSGKSAYWAVGYYEYIDQQRVFTADEWLYFNPQGTGAFV
                     DAEDGEFPFNWAIENGQLRIDVTHADYVGSYEISELINSDATDLSLKSFWHSTEWSDV
                     NAGEGEILDQVYRFDGFR"
     gene            complement(200038..200793)
                     /locus_tag="AOT11_00810"
     CDS             complement(200038..200793)
                     /locus_tag="AOT11_00810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="ASM98008.1"
                     /translation="MKSDFSTLLDFNHVNISPIELEEIVLRELAQAGIENVVFMILDP
                     YQVPRLQFDFGFSSQQLDIYQQNQHHDSFLQYYLRKGLIGQYLYMQEMLPVKQIRNPV
                     FREVLIPTMKLHHSYCGLFRLVEHHYLMLSCHGFSALPPKQRDHLKRLWQFLISWGNC
                     WVAQQSMVKRLAQLSPIRSIVHNGDVLTDAELEVLELLVQGMDGSEIAHYRSVSKETV
                     RTQIKRILHKTGCRHQNQLISRYYRIGSYSLVV"
     gene            201032..201874
                     /locus_tag="AOT11_00815"
     CDS             201032..201874
                     /locus_tag="AOT11_00815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine catabolism dioxygenase"
                     /protein_id="ASM99236.1"
                     /translation="MKITPVAASFGALVEDVQLGAINERQFEALYQAFLHYKVLFFRD
                     QLLTAEQHLAIGQCFGELEPIHPFFPHLADAPQVVVIETREGLPPGESYWHTDLTWKA
                     RPSKCALLHAQHCPASGGDTIWTDMEAVWQSLDDSLKQQLRPLLATHALHAFENSRYD
                     HKDEDGESYVVKKSREFPAVHHPVVAQHPETGRETLYINEQFTRCIDGLEEAQSQALL
                     ETLFATAREEKFQVRFQWQANSLAIWDNRATQHFAVTDYGDQPRRLHRVTITGDAPQA
                     TQLK"
     gene            complement(201900..203030)
                     /gene="rumB"
                     /locus_tag="AOT11_00820"
     CDS             complement(201900..203030)
                     /gene="rumB"
                     /locus_tag="AOT11_00820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421854.1"
                     /note="RNA uridine methyltransferase B; catalyzes the
                     formation of 5-methyl-uridine at position 747 in 23S rRNA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="ASM98009.1"
                     /translation="MSCPYFEQKSCTSCTHMNTPYFQQLEMKDNALHTLFSDVAQSAW
                     LAPVQSDSMHCRNKAKMVALGAAHQPTLGIESVQDGTPISLVHCPLYTQDSQALLAYL
                     QEWIRTSGIPPYNKVKKKGELKFVLLTRSQARGEFMLRFVVRSEAALERIRHNLPRLQ
                     QAFPAIRVISANIQPIHMARLEGEQEIFLTDAQYLLEEFNGVPMVVRPKSFFQTNPHV
                     AAQLYATARDWVAELKPRQMWDLFCGVGGFALHCAPHAEQVIGIEIEEEAINSAKLSA
                     QQLGIDNLSFSALDSAAYSQAQTQAADLILVNPPRRGLGQALTAQLEQLAPQYLIYSS
                     CNPVTMQQDLAHLPSYRVERAQWFDMFPHTDHAEVMMLLVRQ"
     gene            203192..203914
                     /locus_tag="AOT11_00825"
     CDS             203192..203914
                     /locus_tag="AOT11_00825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-flavin oxidoreductase"
                     /protein_id="ASM98010.1"
                     /translation="MNAVIDTLLSHRSIRKFTDQAITPEQLDTIIRAGLAASSSSLLQ
                     VVSIIRITDPAKRQQLAELAGPQHYVETAAEFLVFCIDYQRHATLNSEVQAGFTELTL
                     IGAVDAGIMAQNCLLAAESMGLGGVYIGGLRNKAAEVDALLELPPFSAVLFGMCLGHP
                     DQDPDLKPRLPAEVILHENHYQPLDLNKVEQYDQTMLDYYGKRSSNQKQASWSEQVTG
                     KLAGESRPHILPYLHSKGLATK"
     gene            complement(204011..204856)
                     /locus_tag="AOT11_00830"
     CDS             complement(204011..204856)
                     /locus_tag="AOT11_00830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="ASM98011.1"
                     /translation="MKKILAVAVLATLSQPALAALKLTTYNPQEKAIFPVSSTLISGK
                     KEAILFDAQFSTTEGKALVELIRQSGKELTTVYITGGDPDFYFGLQPIVEAFPQVKIK
                     ATATIVDHINHTKDQKIGYWGPILGEGAPSQLYVPEVYNGDILLEGEKIELKEAGTHN
                     AYYWIPSLKTALGGVSTYSGIHVWMADSQTKEERLEWVASLDRMKQLKPKRVIPGHYL
                     GQVPPRVEAVDFTKQYVMDWQRYVEQSSNSTQLIEKITAQYPLLTADEGVTIGAKVSM
                     GEMKW"
     gene            complement(204988..205890)
                     /locus_tag="AOT11_00835"
     CDS             complement(204988..205890)
                     /locus_tag="AOT11_00835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM98012.1"
                     /translation="MDRLEALRAFVAIAEQGSLSGAANVLEIERTKVSRYLSELEEWV
                     GSRLLHRTTRKQSLTDAGEQTLELAYQMLSLSNEVSAIRDRQNNTLSGKLRIASAYSL
                     IEHFLLQAVEAFCAQWPEVQIELLVADSSTHLIEEGVDLAVRITNDLAPGLIARQMGV
                     CRSALVATPAYLEQFGHPQQPSDLPAHRCLSFSYFGKNRWYLTRDNRRESIDIQGPIT
                     ANISTIVLSATLHGSGISQQPYAAVAPHLAQGRLLPVLPDWQPDELGVYLVYSSRKQI
                     TPLHRQFIDFICQRMASDPLWQAL"
     gene            206285..206599
                     /locus_tag="AOT11_00840"
     CDS             206285..206599
                     /locus_tag="AOT11_00840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98013.1"
                     /translation="MITITSDSLNIALALLKEANFTRDQIFYNDGVRSHQVLGLNVKY
                     EDFEIGGMYLRQETRYTLVLHAADCIEFWFDREQVRFESRKIVLPHSNVGLPSELAQH
                     NF"
     gene            complement(206704..207309)
                     /locus_tag="AOT11_00845"
     CDS             complement(206704..207309)
                     /locus_tag="AOT11_00845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="ASM98014.1"
                     /translation="MAMKVTEQKRLALIEAAKDEFIEFGFNAANMDRVCEKASTSKRT
                     LYRHFESKELLFTAAINAMVEKQKEHTTFVYQAHGALDSQLKAYLQRKVIGLYSEVGL
                     PVVRMIVGEFIREPELAQRYLALMGGKDVELKQWIENAISDGRLISGDSQQIMATLLN
                     LFHGQFLWPQLVANLAQPNEQDQQTHINEMVRIFLRAYVAD"
     gene            207511..208359
                     /locus_tag="AOT11_00850"
     CDS             207511..208359
                     /locus_tag="AOT11_00850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98015.1"
                     /translation="MKKAVLLSLLFAACSTPTVADSFSLPIWKEDAEALGYTLPKPIG
                     FNLSYMTMEQGINVDSIDLQGLDFNYLDIGLDAEPGRQYTEVLTLRADVWLFPFLNLY
                     GLVGKLDGYSTTDVTLTAGFNPNRPIITHKIQDFRLDLDGYTTGFGAVLVGGYENWFA
                     LVDASFTQSRLTVIDGTIDAIVVSPRVGYDFNRHGTPLRIWAGAMYQDVEQTLKGSLS
                     DLGLPSSLTSLLPSDARFEVQQHLQTPWNPIVGMQYQINESWYLLGEFGFGDRQSMFF
                     SVDRRF"
     gene            208363..209478
                     /locus_tag="AOT11_00855"
     CDS             208363..209478
                     /locus_tag="AOT11_00855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98016.1"
                     /translation="MGKVGCCALLALTSVSAFAKPQSSWVDNLLEKLGASDTVDTRKL
                     IDWGVLPGPFVNPEQGLGIGIAAVGLYTPTGWQSTDPYSTLTLTSYASTSGSYGLGVE
                     NRTYLSGDRIRLLIDGWVSHTPGYYWGQGESAAQTDNNKTQYNAQRYQFNPKIAYQIA
                     PNVYLKAGWHWQTYQGVTVDDETPVAKALSNGRSSGMVLGMEYDSRDFEPNPAMGSYW
                     NLEWSDFRQQYGSDTNYQQWLMNVRHYLQVSSQTIVAMELYSQAFTGDVPWYDQAMLG
                     DDQRMRGYYQGQYRDRNQLSTQVEVRHSFNQRHGMVAWVGAGTIAPHYNELLEQSWLP
                     TVGIGYRFAFKARINVRVDMGFGKESSGFYFHVNEAF"
     gene            209485..210585
                     /locus_tag="AOT11_00860"
     CDS             209485..210585
                     /locus_tag="AOT11_00860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98017.1"
                     /translation="MMKMNKTTLLLLLASFSSSVLAEVDAPVGVRPCCAFGYDLKAQL
                     GGIPVPFFSVGNVVDADKIGQHRYNDGSQSVSGNLLGLGDESNGLIFTQHAGFIDTAH
                     VRDTADYTFYLYQENLTHLGQEYQVELKQELRVRQIHWQPQFQAESLSQAEKVQRSAD
                     AAAFIAFQLAQWHEIAQWFGLMSVGGFDELASAFSPEDLYSNMLGAQLAKQVILATPT
                     LDKKTFSKNVDHVLQQRLSELKAQSKKITQQKIEALDGLWWDSARRLPDKWLLLKRDY
                     QLAYTLQPNYPGSEHTLSLNAHFSDGSPISDWVSLKLIASNEEKHFSALPDTLKKAQV
                     WTHQNFANLADFAYQQDARHHPKSFSPQVGEE"
     gene            210886..212190
                     /locus_tag="AOT11_00865"
     CDS             210886..212190
                     /locus_tag="AOT11_00865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006960105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter"
                     /protein_id="ASM98018.1"
                     /translation="MNTKKPMSLTGRVILGMVAGILTGFAIRALFADNGFVDAYIVNG
                     LFEVGGKIFIASLKMLVVPLIFVSLVCGTSSLKDISTLGRMGGKTLAFYITTTAVAIT
                     LALTMGTVFQPGSGADLTAASSFKSAEAPSLGQVIIDMFPTNPISAMAEGKTLQVIVF
                     ALLFGIAISAAGKPGERIAAIFSDLNEVIMKLVALLMNLAPYGVFFLMAKLFTGLGLG
                     AIINLGEYFLVLTATLLIHGLVTYSLMLKGFTGLSPLTFLKKMEDAIMFAFSTASSNA
                     TIPATMETVKNRLGVDNKIASFTVPLGATVNMDGTAIMQGVATAFIAQAFNIDLSMGD
                     YVMVILTATLASIGTAGVPGVGLVMLAMVLNQVGLPLEGIALIMGVDRLLDMIRTAVN
                     ITGDACVSVIVAKSEGALDLDRFADPKAGEKEEEVHLKRADA"
     gene            complement(212305..213219)
                     /locus_tag="AOT11_00870"
     CDS             complement(212305..213219)
                     /locus_tag="AOT11_00870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM98019.1"
                     /translation="MDTNRLIPLLSEMAIFVNVVESGSFSKTAQKLGVSPSSVSRSIT
                     RLENVLEKKLLERTTRQMRLSATGQEVYSLCSDMMNAAKMAVSAAQTDKSEASGSLRI
                     AAPKALSRQVLMPFVLDFIADHPKVALQLKVADHYIDPIGDEVDVIIQITDKPTEGLV
                     ARSLGRCRLVLCASPEYLQQQGTPNHPDDLVGHNCLCLGENPRDRVWDFTIGSRKISV
                     NVKGSFAVNHSEIRREAVLRGFGISVFPEFAIRPYIESGALTELLSDWHLGGNYQGQI
                     LAQYAQSKYVPQQIKTFIEYLQQRMVLS"
     gene            213324..214538
                     /locus_tag="AOT11_00875"
     CDS             213324..214538
                     /locus_tag="AOT11_00875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="ASM98020.1"
                     /translation="MKKIRSIEDVQNVASQAKHVLTLFSGGLDSSYLLEILKNSRAKV
                     TAVAIDLGDDIEESKLKLITDHYGFDLKILDAKQEFVEHSLFCAIQAQALYLGDYPVS
                     SSLSRPIIVKKAVELAQNLGCDAIIHTANQSQNSLRRLNGAIERSGYQGFYGSPYEYS
                     AISREEKAQTLFHSGLVGFKSRNVSGDSNLWCREFESGILDDPENFTLADSLFTWSRW
                     QPEHHLEGNSIKIGFKQGYPVTLNDKPITLLELIAFINNHVGAYEIGRYVGFDHLDQD
                     EKVLEVREAPAAMLLMKAYKLLETATLPTDVLKAKAWHNETWTQEAVEGRFGSLLQNA
                     SYAFIAHTAEHVSGSVLFQLSRGNAIATSIVADNARYLRDRDNWEINVAHTRSMRSVQ
                     LEPTSDKQHQVA"
     gene            214550..215302
                     /locus_tag="AOT11_00880"
     CDS             214550..215302
                     /locus_tag="AOT11_00880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98021.1"
                     /translation="MTMTESTTHKTKQSVLPISQQLKKYKYVFINGRQMTLLLSTHVG
                     EVIRFKNCWNQLERDRYMADGGTYRYRRYGQFTKLARSKEIVMMPHEPYVQPAYINTL
                     NGDIERHFEPLTDRFVTSPVLEKLLKMMSEIYDDVEGEPQNWNIRLHPYRITATEAEA
                     GEPTPEGLHRDGVTYIASMMINKINVSGGETRITDDNQNELERITLDKTFDIVMADDA
                     ATMHEVSTITPASSETSASRDVLVIAFTKMEK"
     gene            215304..216209
                     /locus_tag="AOT11_00885"
     CDS             215304..216209
                     /locus_tag="AOT11_00885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98022.1"
                     /translation="MTIATSSLKKGSFKFPLTETLLLLVAVFWGTSYGLTKSALVYTS
                     VLLFISIRFSITFLCMLPVVIRDFRQGLNKDWKIAIPTGFILSAIFFCEVFGVSQTSA
                     SNAAFLISLTVILTAFAELVINKKRISNTLLALTVCSVIGVLLLTSEQGIELSLNTGD
                     YFILTAALLRALMVTMTKRFTEGKEITTTTLTSLQSFVVASCAIVGVLVYVPAAEIVL
                     PVSLEFWLTVAYLVLFCTLFAFYVQNYAVRKTSPTRVSLLMGSEPLFGAIFAMVWLQE
                     SLTALQLLGGALILFSVIVTSTRDN"
     gene            complement(216352..217245)
                     /locus_tag="AOT11_00890"
     CDS             complement(216352..217245)
                     /locus_tag="AOT11_00890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM98023.1"
                     /translation="MDNRLRYLSALRFFESASRLKSYSKAAEELHVTQAAISQKLRQL
                     EDRLGCKLFVRRGREMHLTDKGQILQKHVNDGFKNIVTGLNRIQNEPLEGVLNVSAPR
                     SFSTRWLMPRLWKFTMEFPHVPIRVQNAKGIDIRHTETDVLIWQGDDTVEHLELEQET
                     LFEEAIFPYCSPQLAESMKFTEPEQLLRCWLIDFNSTSFNWDQWFHCANVQAKREGIQ
                     WMEVSTFDMAINAVVAGHGACLATESITADFVERGLLVKPFNIGLKPGVRISVISDPS
                     SSRVLRINAFKEWLQRELHFQ"
     gene            217343..217522
                     /locus_tag="AOT11_00895"
     CDS             217343..217522
                     /locus_tag="AOT11_00895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98024.1"
                     /translation="MKPAKYIHIKKMFNVLKFRLIFSSSSRKEKCTTTMSDHLKKDIG
                     LECDEKDKSHHSRFL"
     gene            complement(217617..218297)
                     /locus_tag="AOT11_00900"
     CDS             complement(217617..218297)
                     /locus_tag="AOT11_00900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="ASM98025.1"
                     /translation="MRITPSSTGRFSAYLAEQSKAFRELIYRCQVSSYYVDAGTEILR
                     QGEKLEQLFVVPVGRVSMNIIAANGRRFQLGEANCDDHIFGEMEFFTQTPCQWTVTAD
                     EHLQVDLICIHRLAQALEQQPEMMVFFASALAEDYQDSMEIYTSRLLHPIAYNIAFDL
                     LQQKQHPVMLGGFDKVNQEAERFGTSSRVYRRAVKELMDKGLVSKGENGLEIVDEEQL
                     RRFLESSE"
     gene            218555..219151
                     /locus_tag="AOT11_00905"
     CDS             218555..219151
                     /locus_tag="AOT11_00905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98026.1"
                     /translation="MAIKGQIIEWNDEKGYGFISAIGGELKVFFHISSVTNRGYRPKI
                     KDSVTFDVAEDKKGRFNAENVVVLGVHGFPFTVLFGFSFLVAATASVVLFDGAKILIP
                     LYVVLSMFTYLMFAKDKQAAQENSWRTPENTLHLLSLLGGWPGALLAQFSLRHKSKKQ
                     PFKLILWLTITLNIAGFLWLFTESGRHLVQFVFDAFLL"
     gene            complement(219339..220067)
                     /locus_tag="AOT11_00910"
     CDS             complement(219339..220067)
                     /locus_tag="AOT11_00910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridine phosphorylase"
                     /protein_id="ASM98027.1"
                     /translation="MSKQPHLCVDETQVAERVIVCGEPDRANRIAALLENAELIAENR
                     EYRLFNGEFQGKAITVCSTGIGAPSMIIAVEELKQCGAKYIIRVGSAGAMQPNIALGE
                     LIVAEGAVRDEGGSKAYIDAAYPAYASFSLLKGLDGYLQMQTVPYHMGVVRSHDSFYT
                     DDEETLCQYWNKKGILGADMETSALFTVGRLRGLHVASVLNNVVRYQQDVKEGVSQYV
                     NDDDAMMAGEKRASLAALTALSCQ"
     gene            complement(220064..220816)
                     /locus_tag="AOT11_00915"
     CDS             complement(220064..220816)
                     /locus_tag="AOT11_00915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamide mononucleotide transporter"
                     /protein_id="ASM98028.1"
                     /translation="MELFSLFDINNTLVNIPIGDGYAMSWIEAIGTIFGLLCIWFASQ
                     EKTINYLFGLINVTLFAVIFFQIQLYGLLLLQLFFFCANVYGWYAWTRPNAEGDLLEV
                     RWLSQKKMVITAGLCVCAIALLTVYIDPFFFALANIAVDTMNVFGAGLAEPVLEPDAF
                     PFWDSTMTVLSIVAQILMTRKYVENWVLWVVINIISVGIYAMQGVYAMSLQYAILMFI
                     AANGTREWARTAKRNQASTQQKSEKSADEAVA"
     gene            complement(220989..221831)
                     /locus_tag="AOT11_00920"
     CDS             complement(220989..221831)
                     /locus_tag="AOT11_00920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98029.1"
                     /translation="MMRLLLILLLFSSQSFALVLPVVVEEKVLKDYLAFVNDRDPLTI
                     DDFTGPKARRSTVEIVLLQQAFMLGGVPVTLEFHTAPVAERIRRMSMLPDYAMAANTI
                     WDSAVGGDGDRLWVSDAVIRQGEFEAGLYTVSTREDLLNEQQPIHIDQLSAVSSSQWV
                     SDWNTLKALPLSNLLNVADWGNMVDMVGRHRVDFLLAPFQVSDDLSFTTRGFQFYPIP
                     KVKIGLTGSRHFILSRQFPESEKLAQALNQGIAILRQKGTIERALIECGFINTKVSSW
                     SKIN"
     gene            221938..222129
                     /locus_tag="AOT11_00925"
     CDS             221938..222129
                     /locus_tag="AOT11_00925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98030.1"
                     /translation="MTGKLKQTAAQFAFHCLLEVFAANRLGIRYLILPSTHHRVCVVA
                     QPSSAHSLNSVRWLKRSVS"
     gene            complement(222122..222505)
                     /locus_tag="AOT11_00930"
     CDS             complement(222122..222505)
                     /locus_tag="AOT11_00930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98031.1"
                     /translation="MMMYLLLLKAHIGLIVLSFFSFALRAYWGFKASTWLMKEWPLKV
                     HKVITLVMLISAIALCLTISQYPFADTWLTEKLLLLVAYVGFAQLAFKPQLNRQLRMV
                     FTSVTCILFVMIFYIAKTHMPILLS"
     gene            222904..225051
                     /locus_tag="AOT11_00935"
     CDS             222904..225051
                     /locus_tag="AOT11_00935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="collagenase"
                     /protein_id="ASM98032.1"
                     /translation="MDIIMTLQQNKRSILALAIILGLSGCGGDSGGSSSSPTVQPDKP
                     DTPTTNPDDRFTKSGQCAATQLIADTSSFASQIANADYDCMSSWFSASQIEADALFSE
                     KNLTLVNEALLETVNQYQGEEKTAKHIYYLAEFIKAAYKNRHDTYARKLAPFSTELSQ
                     NIATTSAIFLRNTHALEMGDEQMKALGSMLIIVDSVRQLHVAANDVFALLNQFEQRLT
                     ENYYYRKAINNIFVAMAGHSQSDGFYQLLANDHRYIDTLSTFVSQNQWALGTDSEFLI
                     GNAARELARLIKTDDDKLKEKMTQTLAALLQQFPLGGQSDRVWVGIAEMVNAYAPERA
                     AELGLQDAKERLRQRIMTFSYDCQGPAQILAQTMTLGQAEQVCRTLNDKEVDFHTVAK
                     TNQQPVPDDNSDKVDVIVFKTKDDYSTYSSFLFGNTTNNGGQFLERDPSQANNVPRFV
                     AYQNGWDDDFSILNLEHEYVHYLDGRFNQYGDFHTTMREGHIVWWLEGFAEYMYYKEG
                     YHAALVLGKEKTHTLPEVFATSYNDGVNRIYRWGYLGVRFLFEKHPEAVEQLLQHSRL
                     GEYKQWVDYLDQIGPIYANEFSLWLDDVTKDIDDTVTPPSKEEKPQELAINTPFSVSG
                     AQFSEKLFFVDVAANTRELTLTIQGSGDADLYACFDKVCHYHDYQWTNFTQGSNESIQ
                     IEKESDGYVKAGRYYLSISGREAFDVHVTAQAQ"
     gene            complement(225073..226017)
                     /locus_tag="AOT11_00940"
     CDS             complement(225073..226017)
                     /locus_tag="AOT11_00940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM98033.1"
                     /translation="MEERITLKMLRYFDKVAQLGQFSRAAEQLNITKSPLSAQIKELE
                     EVLGTALFERNTRNVQLTKAGEQLQAECITLFTQFERSIHRVKQCAREEKQQLDIGLM
                     SSIFWAGFGPAFHALQQLMPHATLNLLEISPEKQVRQLLMHQIDLGLVRFADTRDVAP
                     LMSECLYQEFMVVALPNEHPLAQRGQLTLSDLKSADFVMLKQENSSSTRLIVEYCAKA
                     GYRPNIVQEVVEPNTLLAVISARQAVSIVPQSYANLSWPQVRFIPLKQRIPAGVYALY
                     HPETQSNIKRMIDELKQAIEKREKQSEREPGRMNRQPQ"
     gene            226131..226961
                     /locus_tag="AOT11_00945"
     CDS             226131..226961
                     /locus_tag="AOT11_00945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine nucleoside phosphorylase"
                     /protein_id="ASM98034.1"
                     /translation="MTFDPVNQALETIYSYKPNYQPKVAFILGSGLGVIADELDDKIV
                     IPYQELEGFPVSTVEGHSGELVLGKLFGIDVICMKGRGHYYEHQTMKVMTNPVRTFKR
                     LGCEFLLVTNAAGSLRPERIDVGSLVVFSDHINTMPESPMTGPNDDTYGPRFFSLANA
                     YDKSLRSEALTVAEAEGILLNQGVFVSYTGPNFETAAEIRMMQIIGGDVVGMSVVPEV
                     ISAAHCGLPVLALCAITNMAEGLSDVTLSHAQTLACAKLAEADFIKLIKAFIKSHFSL
                     "
     gene            complement(227067..228254)
                     /locus_tag="AOT11_00950"
     CDS             complement(227067..228254)
                     /locus_tag="AOT11_00950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421830.1"
                     /note="catalyzes the formation of of fructose 6-phosphate
                     from mannose 6-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="ASM98035.1"
                     /translation="MSLLKLDNVIQNYAWGSKESISKLFGIENTHAQPQAEIWMGAHP
                     NGCSRVAATGELLSDVIAKDRKNMFGDYTVMRFGELPYLFKVLAADSPLSIQVHPSKR
                     KAEVGFARENEQGIALNAPHRNYKDANHKPELVYALTFYRAMNGFRPIEQTLSLFRHL
                     AICSLEKELNALEAQPNPNGLRTFFSSIMSLCEERQHQALLELDLALARGPKTALERE
                     VLSYVADFKVHYPNDIGLLSPLFLNTVELEPGEAMFLQAETPHAYVQGTALEIMANSD
                     NVLRAGLTPKHIDVAELVENTSFHITPPEQIKLAPIHKENKLSYPIPVDDFGFDILYS
                     NQDTQQQFVRGAEIVFCVEGCVAVTVAETSITLKAGESVFITNDSKVYQYQGDGMLAR
                     AYN"
     gene            complement(228265..229452)
                     /locus_tag="AOT11_00955"
     CDS             complement(228265..229452)
                     /locus_tag="AOT11_00955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421829.1"
                     /note="catalyzes the formation of homocysteine and
                     pyruvate from cystathionine; also acts a a negative
                     regulator for the mal regulon but interacting with the
                     transcriptional activator MalT; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98036.1"
                     /translation="MNQNVDFDTPIDRTGTYCTQWDYVQDRFGKSGLLPFTISDMDFA
                     APDVVLKALKQRLEHPVLGYSRWNHDDFKSAISHWYQTRFNCSIDQEQLVYGPSVIYI
                     ISKLIELWTTPGQGVVFHTPAYDAFDNMIEGQARQCVRTPLIKQRNRFEIDWQDLESK
                     LADANNRVLLLCSPHNPTGRVWSQEELQRIADLCDKHDVKVISDEIHMDVSFQCHTPY
                     VGFGRQPWAVVTSASKSFNIPALNGAYALISEQSTREQYLHKLKAVDGLSSPSILGVL
                     ATMAAYREGEVWLDALKDYVRANHQFVRDSLEQAFPEVHYVIPEATYLAWIDLSPLNL
                     DMVKLNRELIDHFNVAIMSGDVYGEVGKGYLRLNLGCPRSKVELGVKSLSGAIKLLRE
                     SDV"
     gene            complement(229532..231103)
                     /locus_tag="AOT11_00960"
     CDS             complement(229532..231103)
                     /locus_tag="AOT11_00960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005436347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS maltose transporter subunit IICB"
                     /protein_id="ASM98037.1"
                     /translation="MSNPTKSTMWEFLQSLGKTFMLPVALLAFSGILLGVGSSFSSAA
                     IKEAIPLLDNTLLQYLFMWMTKIGLVAFIYLPVMFAVAIPLGLAREEKGVAGFAGFVG
                     YAAFNLAINFFLTVAGVLDSQAERAAYGVKSIIGIESIDTGILGAVIVGVIVAKLHQR
                     FYTFKMPDALAFFGGARFVPIISAIVLGVVGVFIPFVWPYFAAGINGIGHVIEGAGDF
                     GPMLFGTGERLLLPIGLHHILVALIRFTEAGGTMEVCGQTVSGALNIFYSELSCPEVT
                     NFTPEVTAFLSQGKMPTFLGGLPGAALAMYHCARPENRSKIKALLISGVVACVVGGIT
                     EPLEFLFLFVAPALYLVHAVLTGVGFMVMGMLDVTIGNTDGNLIDFLVFGILQGTATK
                     WYLVPVVAGIWFVVYYSVFKFAITRFNLKTPGREVDTAEVDKELEAAFINESGKGAAV
                     LAALGGKENITALDNCITRLRMSVKDMSLVDDAKLKANGALGVVKLDEHNLQVVIGTQ
                     VHLVKNEMQAIMSAS"
     gene            231341..232363
                     /locus_tag="AOT11_00965"
     CDS             231341..232363
                     /locus_tag="AOT11_00965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421827.1"
                     /note="regulates malXY which are involved in
                     maltose-glucose transport; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98038.1"
                     /translation="MSLKKVTITEVAKHADVSVTTVSMVLGNKGRISPDTIERVNAAV
                     EELGYIRNRAAANLRSNTSEIIGLILKDISDPYYAEVAAGLSEEIEQQGYMLFLAQSG
                     DSQEKFEKCVLTMARQGVGGIAFCPIGESQQFNVENLKQHSLPMVCISRASVDKQIDY
                     VGPDNMYAAKLATEHLIKNGHRRIAYVGGTISSLCRAERIGGYCSTLMQFGLPFKPEW
                     VVECGKSQAAAAQAVQQLLIEHPHVTAILCHHSSTALGAVYGIHRAGRSIGKDQFIGE
                     QVSVIGFDDVEEAELTEPSLTFINSNAREMGRQAAKRLINQLKQEDSEPYSLILPPKL
                     IVRESA"
     gene            complement(232436..235015)
                     /locus_tag="AOT11_00970"
     CDS             complement(232436..235015)
                     /locus_tag="AOT11_00970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-mannosidase"
                     /protein_id="ASM98039.1"
                     /translation="MRRNLSVVNNAMKKSGIFATKLSKADNNTIGFLMPSHSTSASHC
                     LHSAEINLNGEWRLTSPQRPDICVPMPIPGDNVSALLQAGIIDDPYWGENEKQAQWIA
                     EVDWHIERSLWLDESLLQAQAIWMSLTRVDTLMTLFINEHKVLECSNMFARHQVDIRP
                     FLQRGENQVRAEFRRVDEEANQRAKALPFVIPSAMGNNQLPHMNLIRKTQCHSGWDWG
                     ICLMVSGIYDDIELQVVNHTWLKSFTTEQQWHEDGSVKVLLSADIETTLPTSLQFRLA
                     EQEQRVEVTKTGVVVCEFEIEKPQLWWPNGYGEQPLYTASVRCEEQHLCRRIGLRQLS
                     LNTQQDDIGSAMEFVVNGVPIFAKGANWIPVDAMPSRETPARYRQRLQSAVDANMNMI
                     RVWGGGQYESDVFYRFCDELGLLVWQDMMFACSLYPSHDAFLAEVSQELAYQIPRLRE
                     HPSVALWCGDNEVIGAIGWYDESRQNKVKYTVNYDRLNRHIEKTIAGIDGSRAFWPSS
                     PCNGELDFGDAWHDDNKGDMHFWDVWHSGKPFTAYQSVNPRFCSEFGFQSWPSLAEVK
                     SFVPEEDWNITSPTFEVHQKNPRGNSIITEMFTRYFRFPTSFEQMLYLSQVQQSMAIK
                     TASEHWRAISPVCRGILYWQLNDNWPVSSWSSLEYSGRWKQLHYQAKRFFAPVHLIFS
                     QPQTSQNEARGAALNLHLLNDTRQACEVSGRVSWINWQGEVEQSWCFTQSAGADSNQV
                     VWQHELNLAHLKHGFFYVEASVNGDTITALSPLNNTWFSTHELKNLPMAKADIEVTIE
                     GNHITLIADKPAFYVHLECDTEGRFSDSSITLLANQAVTIEFLGEDTEAMANTLKVHH
                     LMQ"
     gene            complement(235084..239283)
                     /locus_tag="AOT11_00975"
     CDS             complement(235084..239283)
                     /locus_tag="AOT11_00975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="ASM98040.1"
                     /translation="MIQIVIDGKYRIVEAGQTVLQAAKVCGVEIPSLCGMNRSGEKIP
                     CDLCVVEVESGGPRRACELEVYNGLTVKTQSEALSAHRKQALNRIMSDHYADCEAPCK
                     TACPAGVDIQSYLYHIAQNDHQKAIEVIKRTLPMPLSIGRVCPAFCESECRRSLVDDA
                     IAIRQLKRHAADADLAAQEAYTPEKKADKNKRVAIVGSGPGGLTAGYYLTNEGYQVDV
                     FEAMPQAGGWLRYGIPEYRLPKSILDKEIELMCRNGMTIHTDKKLGRDISLSQLSQDY
                     DAVCLAVGASKAVAMDYPGSDLDGCYLGVDYLKDFVTEQRFITGKKVAVIGGGNTAID
                     CARTAVRTGADTTLIYRRTRDEMPAEDYEIEEAEHEGVKFHFLTNPAENIADEQGRVC
                     SVKLEKMALGAPDASGRRRPEATGEYFTEAFDTVIAAVSQQADLSFMQGEALTLPLTR
                     WNTADANPETMHSGTGNIFSIGDFRRGPATAVEAVADGRIAAQAIDRFFDGDMENIPL
                     KPFNSRKEQKLKQVDPLHFSHLQKVARTIMPELTSQQREQSFEEVELGFDNAEAMAEA
                     ARCLECGCQVNTSCDLRDYATEYGAEQHFHYSVDIKSHDEWQALRQNDPRHKYPIDHS
                     SEFIVFDANRCISCGQCIQACREQSVQGVLSFMNLEKGRPVVRPDCRPNFGGQGVMMG
                     DSRCVQCGACVQACPVGAMTDGRDRSQGRETLLKKVDTICTYCGVGCKLTMHVDEAAN
                     QIRYVEGAHSPVNEGMLCVKGRYGFDFVASEERLTTPLIRKDGWLQPASWQEAIRLIA
                     DKFSTIKQDFGGRALAGFSSAKTTNEDNYAFQKFMRRELGTNNVDHCARLCHASTVTG
                     LEASLGSGAMTNDIPSIKHSDVIFIIGSDTSAAHPVIASHIKQAVRHHGARLIVADPK
                     RIGMADHAELYLAHRPGTDVMLINGVMQQIIKNGWYDMEYIEERVDGFDTMLQEVMSP
                     AYSLDKVELVTGVKADDIFAMARMIGTAKRTAVYYSMGITQHTTGHDNVRSIANLQLL
                     CGNIGIEGGGINPLRGQSNVQGACDMGALPNNYPGYQKVYNPLVREKFVIEWDAPHLS
                     AEPGLTLTEIIDGACRCDVRALYVMGENPVLSDPNQAHVIEGLEALDFLVVQDIFLTE
                     TAQYADVVLPSCSFAEKSGHFTNTERRVQRISPAVNPPGEAKEDWRIIQEIANAMGSD
                     WHYRSVADITNEITRVTPQYAGLKWENITPEGVQWPSNKNNPAGTRIMHQTQFTRGKG
                     QMEAIPFRYAAELPDEEYPLVLTTGRVLEQFHTGTMTRKTQGLNNLAGPRAMISVQDA
                     EALGIGNGDMLKVSTRRGEIEIAAFVTKRMQAGVVFIPFHFVESPVNRLTTTATDPHA
                     KIPEFKVAAVRIEKLHTALVE"
     gene            complement(239577..239873)
                     /locus_tag="AOT11_00980"
     CDS             complement(239577..239873)
                     /locus_tag="AOT11_00980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98041.1"
                     /translation="MKSLFAVLCAVSLPVWAQESEIFLHQLTESKLLEEAPIPPECFS
                     DACLEKGMRSTVPTADAPPREPNETLAVIGSVVYVLGEFGLADQRFKESEQPLN"
     gene            240131..240790
                     /locus_tag="AOT11_00985"
     CDS             240131..240790
                     /locus_tag="AOT11_00985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="ASM98042.1"
                     /translation="MSSPLYVFDLDETLIQGDCAMIWNAFLVDKGIATSADFIAEDRR
                     LMALYAQGKMDMEDYLRFSIAPLANLTTSEVEQLVKECVETRIVDKLFPQANTLINHL
                     ANEGIDMLIISASVSFLVAEVGRCIGIRQTLGINMREVHGHYSAEIEGVPSYRQGKVT
                     RLQQWQETQPKHYSEIHFYTDSINDLPLCEYADFAYLVNPCPQLKQHAHRPNWTVLHW
                     G"
     gene            241056..241496
                     /locus_tag="AOT11_00990"
     CDS             241056..241496
                     /locus_tag="AOT11_00990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="ASM98043.1"
                     /translation="MITKLTNVNLIKGNLQANNKNEVFAELAQMLFENNRISSKEAFL
                     TDIEAREALSITSMDGIAYPHAKSKAVIEPAIAVGVKREGIEYGDEEGVKPTVFFMIA
                     SPDNGADHHIYVLQELFGKFSEEFIEDIHNAKDELQILNILIQS"
     gene            241508..242911
                     /locus_tag="AOT11_00995"
     CDS             241508..242911
                     /locus_tag="AOT11_00995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIC"
                     /protein_id="ASM98044.1"
                     /translation="MSTLTAQATNNSSDFKKILSTMKGHLLFGTSHMLPFIVAGGVLL
                     ALAVMASGKGAVPADGLLADISNIGIKGLVLFPIILGGFIGYSIADKPALAPAMISSG
                     IMADMGGGFLGCIVAGFIAGGVVFQLKKIPLSANMTALGAYFIYPLIGTLISAGIVLW
                     GIGEPIKIFMASMNEFLASMAGASKVVLGTILGGMTAFDMGGPINKVATLFAQTQVDT
                     QPWLMGGVGIAICTPPLGMALATFLFKKKFTKQEQEAGKAAAIMGSIGISEGAIPFAA
                     NDPMRVLPSIVAGGIVGCVFGFLTDVLLHAPWGGLITAPVSSNIPMYVVGIALGSLTT
                     ALIVGFWKPVAEEEAEDEIAEAASTQAQAAPAAGEGEYDIVAVTCCPSGVAHTFMAAK
                     ALEKAGAAAGIKIKVETQGQNGIQNRITDLDVANAKLVILAHDIQVKDAHRFAKANVV
                     ECSTKEAMRNATTLVKA"
     gene            243033..245853
                     /locus_tag="AOT11_01000"
                     /note="alpha-mannosidase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            245987..248407
                     /locus_tag="AOT11_01005"
     CDS             245987..248407
                     /locus_tag="AOT11_01005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009697928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-mannosidase"
                     /protein_id="ASM98045.1"
                     /translation="MFKRNLISLAILVGLTGGLAGCNSDNDSSSSLPGDPIVDLAVLK
                     YVDPMIGTAASGHTFPGATVPAGMVQLSPDTFIGSNIDHESGLNPWHSASGHWDSSNY
                     ETGEVVNTDVPLYGFSHTHLSGTGATDLGDILVLPYADMANTQLNSFDKANEEASAGY
                     YKTKLKQGQIEVELSATKRVGLHKYTFADGADRNVKFDLGHTLMNNNGKSLKNKVEVV
                     DEYTIRGRKTSTGWFQGQDHQGQDIFFYAKFNQPIAKALLGEQDLEPTREMRNGAVYS
                     GDDLTAYLNFGTGEEPIEIRVGISPVNWQGAQKNLEAEAPSFDLAQVKEDAEYAWAEK
                     LAKIKVEGGTDAEKTNFYTGMYHMMIAPIEFYDVDGQYVDMLGTVRTLKDGDTPNYSI
                     YSTWDTFRAVHPMWTIIDPDQATLYVKDLIRKSNDEFGLLPKWEGHGSETGTMIGYPS
                     AAILGDAVTKGLIDAEQAYTASVKSARYTPHEYPQIHDDILSSLMAGQLNYHEKEQCV
                     RYPNWNSVSYSLEFSFYDWTIAEMAKAAGDMDAYEEFKARSYNSLKHWDAEAGNADGT
                     GFFVPTELKEGDPCALKYASTDFDPYKSDAFYYTEGNAWQWQWAFMQDLDKLTEIMGG
                     TQGLNDKLNNLFTADPNGGEAHQDMTGYIGQYIHGNEPSHHVIYLYNRTEESYKAQEY
                     LDQVYDQFYKPTPDGIIGNEDVGQMSAWYLMSALGFYQISPTDPTYSIGRPIFDKATV
                     DIGSGTFTVTAENNGPDNMYIKEVTINGKPLDVYNTFQHSEFKAGGELHFVMTADKSE
                     AMQANLGE"
     gene            248455..251163
                     /locus_tag="AOT11_01010"
     CDS             248455..251163
                     /locus_tag="AOT11_01010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-mannosidase"
                     /protein_id="ASM98046.1"
                     /translation="MKLKRTLLSTAVLTAMLGLAGCGSDSDPETPVISTPTLEFVDTL
                     IGTKGLGNVNPSPVMPEGMIQPSPDNFDPNGWNGKGSPVEYDPVHSLLSGFSMTHISG
                     AGKGDLNDFAFLPYTGFNTDAVTMDKSSEVAEVGYYSVDLVETGVKAELSATDRVAFQ
                     RYTFKPGEDRKVRIDLQHELLEQYGNHSRSIYYKRVNDTTVVGARTSNEWGQWQTVFF
                     AAEFSDPIIEENLYTKLASESKLTPTDATEVGLEDYRGYAEHKPMPGEPEPDPERLAK
                     RANDVLTHLNFGKSDEPLVVKVAISGTGVDGALKNLEADTNGWDFDTVVQQNRVAWEN
                     ILGEFELEGGNKADKTMFYTSLYRTFVAPFLYQDVDGKYRGMDGKVHQAEDGLVNYSV
                     YSMWDTFRAAHPLKTIIDKDRAIEHARDLLNKYQTGGVLPKWELHSDYTGEMVGHPAV
                     SVIADIMVKHPEAFTAAEFDLALKAADETVNFNLDKTESWVPYQDAWNGDKRFTIMTR
                     HNDYQEDVGFIPANTKWAPDSGDKPGYVEGLKVDKYDELVNESVSYGLENAYYDWCIA
                     QIAKLAGNDQQYDRYMARSESFKNYFDYNPEQYGKLQDTKGNALGATGFMRPAYMNSG
                     SKVWANNLKAECLDENMALSIPDGMDYNACKDRKALNESDVFWPYRAEHRGEDFTEGN
                     TWQWTWFAPHNLNGLANVMGGEHIDRTDFSLPEDVTEQGKAAFLANLNALFNADSNAD
                     TSQSHDMSGYIGQFVMGNEPDHHVPYLYNWTAEPWKTQEIVDQAMNEFYHPTHEGLIG
                     NEDVGQMSAWYVMSALGFYQVIPGEASYTIGRPLFDKAVIPVADGKFTITSENNSQES
                     IYVKSVTINGKQLSDNFSFAHSDLKDGGELHFVMTSDKSEAMKAPQ"
     gene            complement(251271..253136)
                     /locus_tag="AOT11_01015"
     CDS             complement(251271..253136)
                     /locus_tag="AOT11_01015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="ASM98047.1"
                     /translation="MDMTNLIEPEVICLDLKANSKEDVLIELVEMLDKAGKLTDKQQF
                     LRDIWLREEIGNTGFEEGIAIPHAKSHAVALPAVVVGISRQGIDYGAEDGQLSDVFFM
                     LASPDGEDHHHIEVLAQISSKLIEEGFVEKLKAAEDIDQARALFVGHNGVDTLQERGM
                     GEFVHQPLSPMAQRVARIKEHLLFGTSHMMPFIVAGGVLLSLSVMISGHGAVPEQGVL
                     ADIAQMGIAGLTLFTVVLGGYIAYSMADKPGLAPGMIGTWIAVNQYHTGFLGAIIVGF
                     WAGFVVRQLKKIELPDSMSSLGSIFIYPLLGTFITCGAIMWVIGSPIASSMLWLNQFL
                     ASMADSGKVALGAVLGAMTAFDMGGPINKVATLFAQTQVNTQPWLMGGVGIAICTPPL
                     GMALATLLSPSKFKRDEREAGKAAGIMGMIGISEGAIPFAAADPARVLPAIVAGGIVG
                     NVIGFLFQVLNHAPWGGWIVLPVVDGKVGYIVGTLAGAMTTALIAIALKKTVNEDENS
                     QGDTLAYSSVVGEGQADILAVTSCPSGVAHTFLAAKSLEKAACLLGVKIKVETQGANG
                     IINRITAKDVQRAKFVIFAHDVAIKEPERFKHIKVIDVTTKDAILNAAALMQMKK"
     gene            253378..253677
                     /locus_tag="AOT11_01020"
     CDS             253378..253677
                     /locus_tag="AOT11_01020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIB"
                     /protein_id="ASM98048.1"
                     /translation="MKVVAVTACPTGIAHTYMAADALTKAAPKYNVQIKVETQGAMGI
                     ENQLTPYDVAHADKVLIVSDIEIEQPGRFEGMNVVKLAIEDVLLNVDKVFLVHCR"
     gene            253686..254465
                     /locus_tag="AOT11_01025"
     CDS             253686..254465
                     /locus_tag="AOT11_01025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000972038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="ASM98049.1"
                     /translation="MMHEYQVTFLVNDVNASAHVAQPLSRVARKFKSTLHIINITQNR
                     SAELAKSLSVLQVGLQEGDFCQITAIGIDAELACFVIKDMLSDHFTVVGSKINYEFSS
                     HLAERLPQICPPAEVKWHYAKAHTELTKFECLKGLAQLIYPVSPDELILAFIKREERS
                     STCVAPGIAIPHVMFEGIEHIAVAVIKNDESMDWASKMGDVHLAIALVMPSKPNREQI
                     IAATNLTRNLLCDQMVERLLLTHSGVDLQALLMYAMSRLLN"
     gene            complement(254457..255296)
                     /locus_tag="AOT11_01030"
     CDS             complement(254457..255296)
                     /locus_tag="AOT11_01030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ASM98050.1"
                     /translation="MMFDDLISSVLNERESFHHIWFAGDFHTPPEFSYQVNFPRLELV
                     LDGEYINEMESHDRKVSKIVAKAGDAIFIPSNCWNKPNWDTDCSVLSMLFGRRQLGLS
                     LVSKRKGEANFYDIQKHSIQTRSGFAIDNILEALSSLARENHKKPMDELLLQALLQYA
                     KTMLNAPVEQSHNRVQDLYQGICIYIQENFHRPITRESIASRFSISANHLSRLFRQQG
                     HMTLADYITWVRVDRAKFMLKKYNFKLNEVALRCGFKDVNYFCRVFKNRTGRTPSDYR
                     ASI"
     gene            255713..257614
                     /locus_tag="AOT11_01035"
     CDS             255713..257614
                     /locus_tag="AOT11_01035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIC"
                     /protein_id="ASM98051.1"
                     /translation="MINQLINANLIQLDLQANNKQAVFEELIDILHSQGRISDKAAFL
                     QDIQAREELGNTGFEDGVAIPHAKSAAVTQPAVAIGVSKQGIEYGAEDGLPSKLFFMI
                     ASPDGGDNHHIEVLAELSSKLIEEGFIDTFLNAENAEQALQLLLKKAEPAPDTTPSES
                     KGLIIGVTGCPAGIAHTYLAAEALEKGAAALGYEIKVETNGSIGVKNSPTEEEIARAE
                     AIVVACDKQVDMARFAGKRVVKTNVKAPIRDAQKLINEALNAPSYQAESASTQSVANK
                     ASQARSDLYRFLMNGVSHMIPFVVTGGLLIALALAVGGEPTEAGMAIPPGSMWNQILE
                     VGVVAFTLMIPILAGYIAYAIADRPALAPGLIGGWIANNGSFYGAEAGTGFIGAIIAG
                     LLVGYFVKWITSINYHKFIQPLVPIMIAPITASLFIAGLFIFVIGAPIASLMDGLTAL
                     LTSMSTGNVILLGIVLGGMAGFDMGGPFNKVAFLFSVGMIASGQTQFMGAMACAIPVA
                     PLGMALATAMGRKFDLFESSEIEAGKAAGAMGLVGISEGAIPFAAQDPMSVIPANVLG
                     SMVAAVMAFSFGITNSVAHGGPVVALLGAMNYPLLALVCMASGAGVTAITCVTLKKIR
                     AQKLAAATA"
     gene            257723..258940
                     /locus_tag="AOT11_01040"
     CDS             257723..258940
                     /locus_tag="AOT11_01040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082231.1"
                     /note="catalyzes the formation of of fructose 6-phosphate
                     from mannose 6-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="ASM98052.1"
                     /translation="MSEILASQATLPQAVFFPMTNPIQNYAWGSKTAMQQLFAIENPT
                     NEPQAELWMGAHPNGCSCVTMAGQQVKLSDFIAQNPALILGEQTAAQFGELPYLFKIL
                     AAENALSIQVHPNKQQAELGFAREEQQGIALTAANRNYKDPNHKPELVYALTEYHAMN
                     GFRAIDEILNVFTELAIDELSSLVDAFSTNPTEPGLSDFFSGLLSLQGEAKTNAVEAL
                     IHQAKQVDLPLFALIVELEKQYPNDIGLFAPLMLNVITLQPGEAMFLHAETPHAYLHG
                     TGLEIMANSDNVLRAGLTPKYMDIDELVACTQFKHKPLEQLRLEPNLRDGSLHYPIPV
                     ADFKFAILPPAETLTVNVSSAEILLPLDGDLELNHANGERCLLKKGESVFIPAYSEHY
                     TITSQGRVARALS"
     gene            259642..261186
                     /locus_tag="AOT11_01045"
     CDS             259642..261186
                     /locus_tag="AOT11_01045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98053.1"
                     /translation="MKRRVLCFCATLCVAIGFPAVSQDFLPVQQACDKRYTNDLEELK
                     TTEPSNYYYYHYIASGGCPGIELKEGRFERINYHFAKLGNFDAQWELNKDYATLVEKA
                     VAGSISARAKIVLSNTVPQTTQYSRDKGLEKLQLSDEIKQRYTPQILELADRGDIRVL
                     QIAMAYYLRKPISLSGDDDDALMAAERLKKARRLMELYGNDYLWLNILYNNWLLEAKN
                     ISWCAENIKGRQYSSEFEKGLYSFSRPLFCSSVFNKELFNGIELMSNVSRLRFFKEQV
                     ASLEFDFSGSHQARLDQLKKWDRTLNKLALLAHFDVPLVRETIAFSLMSLPYEPNRDL
                     AGFYWLDTEHSPSPLMRLVSSMYGKNGYDVELNVDEQIIPEILASEKYFGLAYAYLDR
                     NDEYYQFTLNRVLPKGDWGSLYTFYLMYKYEDNTRAWAMIKTLEQYDEYIAKQVEEDF
                     FLGGLSEPDKKAVENAMEEIRPYLPEKSKEHFSKVSWQGDIKTYLLKQLSLLIEQEEK
                     KSRLKG"
     gene            complement(261319..262443)
                     /locus_tag="AOT11_01050"
     CDS             complement(261319..262443)
                     /locus_tag="AOT11_01050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="ASM98054.1"
                     /translation="MSQVDKVDIVKQIYSTIEKPELWQEVLVRLSEVLGSSHAFIASR
                     SSVDHSPSRFVAHGFESGHFETYQEHFYKVDLWTQGLARHDANQFHASHLVCNDKDFV
                     GSEIYSDFAKPAAIRNSIGCLLAKPDSQLITEIAFMSGPDTAYYSQQQVAAANAFLPH
                     IDHALGMSLRMQQSNAAGAQHALLDVLPEAIFVCDYHAELRYLNASAQRLLSDSTLFQ
                     SSAFFSRRLSFALAETDAQFKLGLNQSAAILGAEFDKRFYAWDAHMVYRVTLKPWFYQ
                     VVTPIGPHNVACCLVMVQACASRFKIHPQEIMSLFSLTLAEAEVTSLLCSGSLVDEIA
                     VLRAATSNTIRQQIKACLAKTATRNQAELVAKVIRSFTLS"
     gene            262766..263836
                     /locus_tag="AOT11_01055"
     CDS             262766..263836
                     /locus_tag="AOT11_01055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin"
                     /protein_id="ASM98055.1"
                     /translation="MNYRTATISDGMTTEDGKFTYLEGETVTFYLGDLTLPAVKAGAQ
                     VTPADIGGGLATTTTVNILQLLQSLDDNGDLSDGITIIDTSKDAFVGTGLDLSSDTFD
                     ASVSAILTSIGKTLVTEEAAQTHFTDTLKGQLTGSWLFSEGAGKRNILTFFNDNNYII
                     VHEHSDFPDDGDQPAGSAEYGTYTYDPATQMLALNVIRESDNSGGLADDFGSITLEVQ
                     ATQTTLDITFADEDGEQVRFSKITDSSNAMVGAWYLREDDISSDNILTILPNNQYVIV
                     HTNNQEAYNGAEVMATSGEFGSFSLNGGVFTVTSITSEADGPGGLYDQDSPMFSATIT
                     VTDNESLNFTNSDENFTFSRIK"
     gene            complement(264043..264885)
                     /locus_tag="AOT11_01060"
     CDS             complement(264043..264885)
                     /locus_tag="AOT11_01060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mg-dependent DNase"
                     /protein_id="ASM98056.1"
                     /translation="MFIKNFRDGFRGKPNFERLELAQYKIDDYFYECSFPNNYSSFVY
                     EMECVSLPISNDAFVNEGHEEIVHLGFVSYRFSNVIKNPLLPCSSQGLLLAIVRIKQV
                     KENIADVESLGRILEKEYVDYYHDPNPDNKSQRGRHTEDMENAYRYANKVWGNVPDSD
                     DDSIEKNDYLLGSYLRSYPPIKCESVKIGKYCYSKYAEGNIDYKNTFRRLYNLPIKDN
                     YILSFEFKYRLEGEASKKKFRKWLLSSDETFEHKILETLDISRLVDASTEHEIVFISS
                     QGEQ"
     gene            complement(264896..265432)
                     /locus_tag="AOT11_01065"
     CDS             complement(264896..265432)
                     /locus_tag="AOT11_01065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98057.1"
                     /translation="MIVRLKKVPQSFDGVESLNAVIEKEYLDFYHDPVPVERTLRGRH
                     TEDMNHAFEYAKKRWDKYSDDEDKKSRDAYILGNYMRAYPPIKCTSITLGKQTYSKYV
                     EGDINYKHIFQRVYNLPLKDNYMLSFLFKYRLEGESSKKKFRKWLLSSDETFEHIVLE
                     TLEISRLFDSHLNSISVK"
     gene            265628..265888
                     /locus_tag="AOT11_01070"
     CDS             265628..265888
                     /locus_tag="AOT11_01070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020480168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98058.1"
                     /translation="MITDSISSMRSAYKIGFSPKAINKILNNDIFPLIKITISPSMTF
                     AFSFMDLSNRFVIANINIKLKIHSLRSNAHFIQKNETYLSHL"
     gene            complement(266019..266774)
                     /locus_tag="AOT11_01075"
     CDS             complement(266019..266774)
                     /locus_tag="AOT11_01075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="ASM98059.1"
                     /translation="MRPEWLKLFWFRPPPPAIYQLIFTHSKQVSPYLKGSFGELPKAC
                     ILVGNPNSTAIIQSIYHQLAQANPEAGSGYWLTRTWDLLCWQPIYLSFLSIYGLKSLP
                     DFANFAQFQHRGFIAGYRFASEMHWHGEPEVLVPRAGEQLLRLFEQYRQQINQWTRIR
                     PGFTNHLLADLILSCLIKLQSMRPELDNSYIEQQAKLWLDAFHLSDKHLASLIKEDTE
                     SGLKHIRMSCCLAYKCRNGTLCQDCPRLSTNKH"
     gene            266947..267876
                     /locus_tag="AOT11_01080"
     CDS             266947..267876
                     /locus_tag="AOT11_01080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ASM98060.1"
                     /translation="MATAQSKNRSISTFNRISKVLSFIHNNLDASLSLEEIAEQSCWS
                     RWQLQRVFQSETGLTVAHYVRELKLSTAAEMLLDTDQRVIDIALSLGFNSEIAFSRAF
                     KQLFGDSPRLYRKQAQRFGLKKPIEISEVNHAGINTSSFVEVKVDTKEAFLLKGVHGE
                     INGLFSLKPNFAQVVPLLWKSLEEAATNLPPLTNRRLGVVDVTQASFDGSRIKYWAGI
                     ELDSNISLPELPSLISDQLETLAVPEQTYAIVKHKGPIERLPRTLEWFIIHWLPNSGY
                     RGIDGYELEVYPSDYQLNSLNAEMEYWVPIQKV"
     gene            268019..270184
                     /locus_tag="AOT11_01085"
     CDS             268019..270184
                     /locus_tag="AOT11_01085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel protein"
                     /protein_id="ASM98061.1"
                     /translation="MNTTTPFKTSSIALAIMATFTTPLVAGAQSSVENTQLETTQLET
                     ITVLGKVYRNTATKTALEPEETPQGVTIIDKELLDQRGVKSVNEALRYAPGVVTEQKG
                     AAVTMYDNFSIRGFETNNQNYYDGLILPYLAGWNLHPQIDPVAIQQIEVFKGPTSVLY
                     GTMPPGGMVNIIAKSPQQEQSTSVGLATGSRHLVQASLDSAGQIGDSNLSYRLVAMAR
                     KQDSQVNGAEEERYLIAPSLDWQVTDRTLINVNLYYQNDPAMGINSSMPVEVVKRQSP
                     SVSMGDTNWSTFERDVLMLGYKLNHEFNDNWSFLQNARYTDASLYQENTYHLDTGFTA
                     ATGALSRNIYTTDESYKSVVIDNQLSGLVTMGNWQHNLLVGVDYQDLDGDSSYKEFAG
                     NAAFYTFNAYQPNNHLLDKSQLNEVYSERHDIGFEQLGVYFQDQIRHGQLILLAGGRY
                     DLFKSHDDKTSTAPTYDGKETSDHNQFSYRVGALYELGNGLSPFANYATSFEPAAGTD
                     INGKSLKPQTGEQIEVGFKYMSADMANMLTASYFHITKFDSIAADPNDPTFRAKIQLG
                     EVTSQGVELEGQAYLADNWDVLASYTYLDMEVKKATDATLVGTTPIYVPKHSANLWTN
                     YYLTSGALSGVRIGGGVRYVGEMEMDATNTQGKVPSYTVTDLSLGYDLGNASDSLNGA
                     QVNLVVNNLFNEQYYSCYNQTNCWFGAEQTVELNVNYGF"
     gene            complement(270250..271866)
                     /locus_tag="AOT11_01090"
     CDS             complement(270250..271866)
                     /locus_tag="AOT11_01090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98062.1"
                     /translation="MIRLTELRLPLDHEEGALLEAITAKLGIPAEQVLSFSMFRRGYD
                     ARKKTNIQLIYTLDIEVANQDKLLAKFSKDPHVRETPDMEYKYVAQAPANLTERPIVI
                     GFGPCGLFAGLVLAQMGFNPIIVERGKEVRERTKDTFGFWRKRTLNPESNVQFGEGGA
                     GTFSDGKLYSQVKDPNFYGRKVITEFVAAGAPEEILYVSKPHIGTFKLVTMIEKMRAK
                     ILELGGEIRFSTRVDDIHMEDGQITGVTLSNGEELKSRHVVLAVGHSARDTFEMLHER
                     GVYMEAKPFSVGFRIEHKQSMIDEARFGPNAGNPILGAADYKLVHHCKNGRTVYSFCM
                     CPGGTVVAATSEEGRVVTNGMSQYSRAERNANSAIVVGISPEIDYPGDPLAGIRFQRE
                     LESNAYRLGGENYDAPAQKIGDFLKGRDPSALGDVEPSFTPGIKLTDLEKALPSFAIE
                     AIREAIPAFDRKIKGFASEDGLLTGVETRTSSPVCIKRDKEYQSVNLKGFYPAGEGAG
                     YAGGILSAGIDGIKVAEAVARSMVAQLENA"
     gene            272155..272478
                     /locus_tag="AOT11_01095"
     CDS             272155..272478
                     /locus_tag="AOT11_01095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="ASM98063.1"
                     /translation="MAFVVTDNCIQCKYTDCVAVCPADAFHEGPNFMVINPIECIDCG
                     LCVDECAAAAIFQEDELPEDQVIYKELNAELAELWPVQTEVKPAMDEAEKWNGVPNKL
                     DMLER"
     gene            complement(272590..273324)
                     /locus_tag="AOT11_01100"
     CDS             complement(272590..273324)
                     /locus_tag="AOT11_01100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020332836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="ASM98064.1"
                     /translation="MISKNQLKLLRALGQKKQRKALGLFLVQGEKNVLELANSTLKVK
                     QVFATAEFLQQHAVELAGYECIEASLDDLTKASTLVSNNAAIAVVEIPAIETPKAQGL
                     MIALDGVSDPGNLGTIIRVADWYGIKHIVASSDCADPYNPKTISATMGSFGRVQVSLV
                     DLPSYLEQANLPIYGAFLEGESVHKTTFSAQGILLMGSESHGVREQASKFVTDKITIP
                     AFGGAESLNVAMATGIILDNIRRQHS"
     gene            complement(273452..274825)
                     /locus_tag="AOT11_01105"
     CDS             complement(273452..274825)
                     /locus_tag="AOT11_01105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="melibiose:sodium symporter"
                     /protein_id="ASM98065.1"
                     /translation="MSEKITLQTKLSYGLGALGKDFACAPIYIFLMFYFTDVAGLSAA
                     FVGTIFLAARIIDAITDPMMGVIVDNTRSKFGKFRPWIVIGTLLNAIVLVGLFSTHMF
                     EGTTLYIYAAAAYILWGLTYTIMDIPYWSMIPALSSSRQEREKLVVWPRLFASLAWFI
                     TGTYGLHIVGELGNGNQGDGFFNVAMLIAVLFVMSAFLIARNVKEKAAPANAKPAEKF
                     SFKDVLTIIGKNDQLKALIGTVLSFQIANLLVGGFAIYYFSYALGNAELFPVYMAVAG
                     AAEVAGVFLFPRIAALLPRKLLWPIACGFPILSCVLLLLMGFVAPANALMIGMAGAAI
                     KFGVGIANALQTVMLADVVDYGEHKTGRRSESVIFSVQTMLVKFAGAAGGFIVGVGLS
                     VVGYVPNVEQSASTIMGLEFMMIGLPAIMMTISAVIYQRYYHLHEGFDKSAVESEVKG
                     TASLAQA"
     gene            complement(275160..277280)
                     /locus_tag="AOT11_01110"
     CDS             complement(275160..277280)
                     /locus_tag="AOT11_01110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="ASM98066.1"
                     /translation="MMTNKTVIELSGRETQLMVELGEYAEILHWGNKIQGKLESARIA
                     LHRPVPYGRLDTDVAMTLHPELGRGVFSSPGVEGHRDGQDWAPVFVISHIEHGQGFII
                     IQSEDAIAGLRLTTELMLDLHDVIKTRHTLTNIKAGLYQVNRLANTLPLPARANELMT
                     YYGRWVHEFQTVRQPLLQGGYQQENRRGRTSHEHYPALVAGSAHFDEMSGDVWGFHFA
                     WSGNHRLRVDVKADGRRYMQAEVIYLPGEVALKEGESLTTPWLYASYSNCGLNGMSHH
                     FHSHVRDSILPEDFTNKLRPIHLNTWEGIYFDHDPEYIMSMATQSAEMGVERFIIDDG
                     WFKGRNGDKAGLGDWFLCETKYPNGLQPIVEHVNKLGMEFGLWFEPEMINKDSDLYRA
                     HPDWLLAVEGYQQPTGRNQYVINLQNDDAFNFLFERLDHFLSTYNIAYIKWDMNREVV
                     QPAHLGQAAGHNQTQRYYQLVDKVREKHPKVEIESCAAGGGRIDFEVLKRTHRFWASD
                     NNDALERQTIQRGMSYFFPPEVMGSHIGASHCHSTRRRHSIEFRGLTALFGHMGIELD
                     PVKEAQAEKEGFERYIKLHKMLRPLLHSGRTWRVPTDDKAHQIHAVVANDHSQAVVMI
                     AQLAMPTNSLSGHLRIPGLDPQATYRVTVLDKPSNYDDIVNYQPPWTESGCELSGAWC
                     EEVGLTMPILDAESAMLLMFERIH"
     gene            277356..277607
                     /locus_tag="AOT11_01115"
     CDS             277356..277607
                     /locus_tag="AOT11_01115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98067.1"
                     /translation="MKTFPDLFKLSAIAPFKTKTEALIQHFKHSHASPWLVAKQRSFS
                     HCYGFILCEWKNATRIMKTFPNLHYTQAQLRTCYLLALL"
     gene            277658..280753
                     /gene="lacZ"
                     /locus_tag="AOT11_01120"
     CDS             277658..280753
                     /gene="lacZ"
                     /locus_tag="AOT11_01120"
                     /EC_number="3.2.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727440.1"
                     /note="forms a homotetramer; hydrolyzes lactose
                     disaccharide to galactose and glucose; converts lactose to
                     allolactose which is the natural inducer of the lac
                     operon; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-D-galactosidase"
                     /protein_id="ASM98068.1"
                     /translation="MTAFSEILQRRDWENPQSVNIHCLKAHSPLASFRDMAHARDGIH
                     AQRQSLNGQWKFKLFDAPEQVEGQFTQADFNDAEWDEIPVPSNWQLHGYDKPIYANIK
                     YPFDVNPPFVPRENPTGCYRTRVSLSPEDLLNTQRIIFDGVNSAFHLWCNGTWVGYSQ
                     DSRLPAEFDLTSHLVAGKNTLAVMVMRWCDGSYLEDQDMWWLSGIFRDVTLLSKPQHC
                     IEDVFITPELDACYRDGSLSVVTTITAPETYQVQAQLFEGKQAVTEPNIARPHNRRID
                     ERGTWNDVVFQTLHLREPKKWSAETPNLYRLVVSLLDENGTHLESEAYPVGFRKVEIS
                     EGQLKLNGKPLLIRGVNRHEHHPELGHVMTEEDMIRDICLMKQYNFNAVRTAHYPNHP
                     RWYELCDQYGLYVCDEANIETHGMQPMSRLSSDPQWAHAYMSRYTQMVLRDKNHPSII
                     IWSLGNESGHGSNHNAMYAWSKNFDPSRPVQYEGGGSNTSATDIIAPMYARVNTLVAD
                     EAVPKWPIKKWISLPNETRPLILCEYAHAMGNSLGSFNDYWTAFREFPRLQGGFIWDW
                     VDQGLSQWDENGQHFWAYGGDFGDEINDRQFCINGLIFPDRTVHPTLEEAKYCQRMIT
                     VSLQAQTQAACTLLVTNENLFRATDNEQLNWSLLENGQVIQTGSQVLNVGADSQTSLE
                     IALNFTPKAQAQYHLNIDICLIEATSWASEGHVVATEQIALRNHAGLAMPTLRTQPAP
                     KLTQNGHAIVVRSLDEKHQWRWDSQSGLLVEWNVDGKAQMLAAPQDNFFRAPLDNDIG
                     ISEVDNVDPNAWVCRWEMAGIGQWQRHCVHCESETLAHAVVVTTTFAYHFGGEVQAIT
                     KWTHTLSNDGEMQWDVDVTLADALPPMPRIGLELQLPLHQTDTPITWQGLGPFENYPD
                     RLAAARFGLHTQTLTQMHTPYIFPTDSGLRCGTHWLQVNELAISGDFQFSVSQYAQQQ
                     LAEAKHTHDLVAQEQIYLRLDHQHMGVGGDDSWSPSVHKEFQLTEKHYRYQLRFSPAS
                     R"
     gene            281097..282071
                     /locus_tag="AOT11_01125"
     CDS             281097..282071
                     /locus_tag="AOT11_01125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082209.1"
                     /note="wtih MglAC is involved in the transport of
                     beta-methylgalactoside; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="ASM98069.1"
                     /translation="MRKVTLLALLTAGVGFGTQALADTTLGFTIYKYDDNFMSVVRQA
                     IEKEAASDKSTRILMNDSQNSQSMQNDQVDVMLARGVQALAINLVDPAAAPTIIQKAK
                     MDDVPIVFYNKEPSPQALASYDKAYYVGTDSKESGIIQGDLIAQAWKANPAWDKNGDG
                     VLQYVMLKGEPGHPDAEARTTYSVQTINENGIKTEELHMDTGMWDTAMAKDKMDAWLS
                     GPNGSKIEVVIANNDGMAMGAVEALRGAGVKLPVYGVDALAEALALVKSGDMAGTVLN
                     DAESQAKATFELSRNLADGKQPAEGTRWQVVNKIVRVPYVGVDKDTLN"
     gene            282177..283685
                     /locus_tag="AOT11_01130"
     CDS             282177..283685
                     /locus_tag="AOT11_01130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004725771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ASM98070.1"
                     /translation="MVNQTHEFLLEMTGVSKEFPGVKALDKVNLKVRPHSIHALMGEN
                     GAGKSTLLKCLFGIYEKNEGNILFLGKEVNFTSSKEALESGVSMVHQELNQVKQCSVM
                     DNIWLGRYPKKGFFVDHDKMYRDTKEIFAELDIDIDPKVKVATLSVSQMQMVEIAKAF
                     SYDAKIVIMDEPTSSLTEKEVGHLFTIINKLKEKGCGVVYISHKMEEIFAICDEITIL
                     RDGQWVDTRPLKGLDMDQIIAMMVGRELTHRFPEKTNTPKDVILQVENLTALNQPSIQ
                     DVSFELKAGEILGVAGLVGSRRTDIVETIFGVRERSEGHIRLHGREMKNRDAHEAINN
                     GFALVTEERRSTGIYGNLDITFNALVANVDEYKTKMGLLSDKKMKSDTQWVIDSMRVK
                     TPSHQTHISSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDVGAKFEIYQLILELAK
                     KNKGIIIISSEMPELLGITDRILVMSNGRAAGIVNTKETSQNEILELASRYL"
     gene            283696..284703
                     /gene="mglC"
                     /locus_tag="AOT11_01135"
     CDS             283696..284703
                     /gene="mglC"
                     /locus_tag="AOT11_01135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000340256.1"
                     /note="ABC transporter; functions in galactose transport;
                     part of MglA2C2B transporter complex; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-methylgalactoside transporter permease"
                     /protein_id="ASM98071.1"
                     /translation="MDAVKSFALKHLKESAIYAVLLILLAVIVIQEPSFLSLRNLSNI
                     LTQSSVRVIIALGVAGLIVTQGTDLSAGRQVGLAAVISATLLQSIDNVNKVFPGIGEV
                     PIVAVIICVCLIGAIIGLVNGVIVAYLKVTPFIATLGTMIIVYGINSLYYDAVGASPI
                     AGFDERFTTFTQGFINLGGFRFSYITFYAIIAIVFMWVLWNKTVFGKNIFAVGGNPEA
                     AKVSGVNVPLTLLKVYALSGVLYAFGGMLEAGRIGSATNNLGFLYELDAIAACVVGGV
                     SFAGGVGSIAGVVTGVLIFTVINYGMTYIGVSPYWQYIIKGSIIVFAVALDSMKYANK
                     K"
     gene            284885..285892
                     /locus_tag="AOT11_01140"
     CDS             284885..285892
                     /locus_tag="AOT11_01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421793.1"
                     /note="controls transcription of galETKM; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98072.1"
                     /translation="MATIKDVAKLAGVSIATASRVINNAPHTSEAAIVAVKEAMQSLG
                     YRPNANARALVSKSSHTIGVLVNDVSAPFFGTMVKAIDTVACEQGKQLLIGSGYHDAN
                     KERNAIELLINSRCESLVVHSKGMSDQELVSLADEIPAMVVINRVVKGIESRCIALDN
                     HRGSYLATEFLIRSGHKHIGYICSSHNIDDAKDRLAGYRDALRDNGIAIREEYIEYGE
                     PDETGGEQAMISIMAKNLPITALATYNDYMAAGCLSLLLENGIRIPEEMSLIGFDDGH
                     VARYIYPRLTTVRYPIQVMASEAVKLSLQLANGEVPDRKEHKLFMPMLIRRASVGAPA
                     K"
     gene            286016..286672
                     /locus_tag="AOT11_01145"
     CDS             286016..286672
                     /locus_tag="AOT11_01145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="ASM98073.1"
                     /translation="MTELNPRRGRPTHNIDTRQLLIHHARELFTVMEYNNVSTRLVAQ
                     KAGVNVAMIRYYFGSKEGLFETMLRETLAPMQKQMQALVLESSEKNLLDIMRTYYREM
                     VKVPQFPRLIAQVMRMAPSDTQRKLMEKVMNDITQPMQGLIFDRLLEGGILRQGVDAK
                     LARITFISLMVFPFMAPPALLSIHGIELNEAFLNRLFEHNIQLMKYGFLDSGAAHDPQ
                     "
     gene            286659..287981
                     /locus_tag="AOT11_01150"
     CDS             286659..287981
                     /locus_tag="AOT11_01150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="ASM98074.1"
                     /translation="MTLNKKWLFFPALAVGVLVLVLAVKLKPELPVKPADDRARLVET
                     LPLELKAVAPLAIGFGKVAPKVEWKAIAEVSGKVIYRHPRLEKGQVLKAGTEILRIDP
                     LDYQLKLVQAQADLKSSQTSLAKLNQEEQNLKSSLKIESNRLAIANKELERKQNLRKK
                     GLNSQSDVDQQEQTTLSQRKLVLDIENQIALMPDEKRVADALIKVNNAKVDEAKRALE
                     KTIITLPYDLRIAQVDIEQDQVVNQQQTMVTAHGIDVMEVEAQLSIHDMQTLAASLGE
                     FARDESGIPQPDMTFIQAYIELSSGNLSASWPAKVARVSETVDANQATAGVILEIEQD
                     YRELNPTSLPPLVNGMFVRAYIEGQANPNWVIPERALHGGKIYLMDEQNRLRIVPVTV
                     LFRRDNQVVIDGELSHGQKLIVNDLLPAIEGMLLKEATSEANPEESGS"
     gene            287978..291079
                     /locus_tag="AOT11_01155"
     CDS             287978..291079
                     /locus_tag="AOT11_01155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012129964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="ASM98075.1"
                     /translation="MIRFFAKHPTAANLLMLALLILGISSLSTIKRETFPEFDPPYIM
                     AAVVYPGASPQEVEESICVRMEDAVDGLANIVETQCEAIEGSARLILKLNEKADISRM
                     LVDVQTQINAINDFPKEIESPVVQELDWNEPVVDVAITADTTWPELKAYAEQLKRTLK
                     LDYGVSLVSVAGFSDHQYRVELDTQAMRQLGLSVGDIAEQIGRQNVKLPSGNVETPDK
                     HFLIRFDERRVTPQELSTIVVGSGPNGSLIRLGDIATISDRFELDEQKVLFDGHPSAL
                     LKISKNKEDDALRIKDRVTQFVADQQAIAPDGVQLEMTNDLSSVLWDRLTMMVRNGWQ
                     GIVLVFATMWLFFSLRYSFWVAAGLPVAFLGGLFLMAQLGLSINIMSLVGLLMAIGIM
                     MDDAIVIAESIAAHLDRGEKIDDAVIKGVNKVLPGVISSFLTTVCIFGSLLFLQGEMG
                     AVLKAVPQVLILVLTLSLVEAFLILPNHLAHSLHKQKQERPDLKFKQTLLEHFEHFRN
                     TTLVNAVEKVVEFRYAFMGGVLALLLISAATLAGGLLKFQPFPELDGDIAEARIILPP
                     GASLAQTEAVVDKIVASAQRLDRQWSEEKENGTPLVRHITSQFNANADANESGPHIAT
                     VRLDLLGAESRNTVIDEFITAWRDDVGELADPISLVFKQPTMGPGGRSIEIRAKHDDL
                     DALKAASIDIQQYLNQFAGVHGVLDDMRMGKEEVLVKLRPGAEVYGINGQLIANQLRA
                     AFFGQTADEIQLGVENISIEVRLDKVQAGDLQQLANFPIMMADGSQIPLATIATLDFQ
                     RNYVRIQRIDGLRTISVFGDVDNTQANSTAIIRQFQQQEAPKLMQKYPGLRFDFEGEA
                     KDTAETGSSMGKGFLLGLFGVFAILSYQFRSYLEPFVVMLAIPLAFIGVVWGHILLGH
                     SLSMPSMMGFVSLAGIVVNDSILLVQYIRHHVDEGDSVHDSVVKASRERFRAVFLTSM
                     TTAAGLLPLLTETSLQAQVIQPLVISIVFGILASTLLVLFMIPAAYAILADFGLVHKH
                     QEI"
     gene            291211..292179
                     /locus_tag="AOT11_01160"
     CDS             291211..292179
                     /locus_tag="AOT11_01160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM98076.1"
                     /translation="MQTPEKPDNEPQRIADLHSLHILDTAAEERFDRITRIARRLFDV
                     PIALVSLVDEDRQWFKSCIGLNASETPRDISFCGHAILGTDTLIVEDASQDARFADNP
                     LVTGEPHIRFYAGVPLMFEHSSCLGTLCIIDSKPRTLNEDERLDLIDLAKMAERELAA
                     THSAAIDDLTQISNRRGFMTLAKKSMAYCEVGGYPYSIAYLDLNGFKPINDQFGHQEG
                     DLALKAFADTMKKSFRESDVFARLGGDEFVVFMSGASRSVAQIAIQRFTEALQRYNQS
                     ANRGYDLSFCAGIVSVEPDANISLDELLSQADKAMYQQKGNKTPRS"
     gene            292266..293963
                     /locus_tag="AOT11_01165"
     CDS             292266..293963
                     /locus_tag="AOT11_01165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="ASM98077.1"
                     /translation="MHTPDPCFTSFTTAIDGYALPERFTFPFYYTPHPLCVLAAEQLQ
                     QHLLTQQEWQHNFGLLSGEVVSDDESAIGKMFGVLLVENAQGDIGFLSAFSGKIADQN
                     LLPGFVPPVFDMLAEESFFRRELSEITDINHQVKQLSQSAELAQLRQQIEADRQAYQT
                     QEQAQRQAMIEGRAARKQQREQAEATLTGDALKAVLDDLAKQSVAEKNVLKYLKLEWD
                     EKLASEEARLQVLLTQLDTLKEQRKTLSNALQHKLFAQYRFLNVRGEQSDLNAIFAPT
                     TSPVPPAGSGECAAPKLLQYAFTHGLKPLAMAEFWWGVSPKSEVRQHKKFYPSCHSKC
                     HPILGHMLQGLNMDPNPLEENWAEDKELEIVYQDEAMVVVNKPSGLLSVPGKTITDSA
                     YTRLQALFPDVEGPFVIHRLDMATSGLLVFALTRRANKSLQKQFISRGVQKRYVAMLE
                     GEVSQSQGEITLPMRGDPDDRPRQLVCFEHGKPAHTDWQLIEIRDGRSKLYLYPRTGR
                     THQLRVHCAHHLGLNMPMVGDGLYGEKANRLHLHAESLELDHPYSKERMHFQVDAEF"
     gene            complement(294118..295035)
                     /locus_tag="AOT11_01170"
     CDS             complement(294118..295035)
                     /locus_tag="AOT11_01170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98078.1"
                     /translation="MAKRILFIHGRAPKPDKNDLQTLWFNAIEHGLQRDYGESRVQAF
                     KQIEKRFIYYGDLSNELLEAPTEHPQSRIDALDKLKQYTRNGFTKTNYKKVSKAGFLA
                     EALADTFSAVLGHLKLAEPLITSVAPDMAHYWNEDSYYGSDLRSRLTKELKEALDSGD
                     EVMMVAHSLGSMISYDCLWKLSHYGEYRHDYGAEKKVDLLVTLGSPLGDENVKARLKG
                     SSLSGKKRYPLNLHQWCNISAEDDYISHDNRIKNDFKEMLQLGLVKGGMKDIYPIYNL
                     CVRDGQSNPHSAIGYLIHPKFITLLNQWM"
     gene            complement(295273..296670)
                     /locus_tag="AOT11_01175"
     CDS             complement(295273..296670)
                     /locus_tag="AOT11_01175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="ASM98079.1"
                     /translation="MAEEEVAKYREKYAKVIDLEAECEQIKKQLESDKKEIEDKERQT
                     LREIELKRDEVVANRQLEEQQIEDLKSDYKTKKATYDSLTHQIAIFSEDIELIELGFY
                     ESKFDFDASEVFKEEIIKCKEVQKVLLKINSASGAIYCSREWTVDGSRSEGKKMTHKS
                     IRLTARAFNNECEAAIANCTWKNVTKMEERIKKAFAAINKLNEPNAIHITEFYLMEKL
                     KELQLTYEYREKKQREKEEQAEIKAQMREEAKVEAEIKKAEEEAIKEEKRYHKALEAA
                     RKELEKASDELKAELEKQIVHLQANLEEAEKKHQRAQSMAEQTKQGHVYIISNIGSFG
                     DDVYKIGMTRRLEPMDRVRELGDASVPFTFDVHAMIHTDDAPMLEKKLHDRFDSQRLN
                     MINRRKEFFGVSLEEIKCAVNDFTGQSVEFIETAVAQDYYETQAMNKQRLVREGKLNQ
                     ELSQSNSLPQFADVL"
     gene            297224..298222
                     /locus_tag="AOT11_01180"
     CDS             297224..298222
                     /locus_tag="AOT11_01180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98080.1"
                     /translation="MQFSTISRALLAVSTMTLAMPTQAIKLTENQIELGINTQIAWMK
                     DSGAFTQLAACSGKSEATIIQGFRKFMDKCARGDESQYELCYNNELKSLLGVTDARLE
                     ACINQYGDDDEERYYALKEKEEKLQAELDQLNSRNDDSDAHWNKIEALEKQLQDLYAE
                     MEPLEQAEADRTQREWEIATNEVRKMNKKLAPLKEHAPHNLPTGLDEPWLGMTPSFDH
                     LPPELASAKESQWAICANMIKDVTLSAESIGAVKHQPEAYGITDEQNQQALREMYHAS
                     SGTFLDKIDAKIVEISLKDWQFAHTEKGMYDISKKAWDWCQAQPAENFVGLDDSRL"
     gene            complement(298326..299336)
                     /locus_tag="AOT11_01185"
     CDS             complement(298326..299336)
                     /locus_tag="AOT11_01185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="ASM98081.1"
                     /translation="MYRSAANPLIRVALFPILLLFWQYVFGTDLPLLAPAMCVVFLTT
                     THEPPPPVMILVMGGILFATAWMQAFVSNLLIDYPHVYYLFLFGVFYWCMERTKKNTQ
                     DVLAILLVVSTAMIAVFTQQKGIDVEQIPFALLANIFIAGFVAYLAYFLFPGGEPMAA
                     NVQGRTSTIRYTLDWQTMAKTVLIMAVLVTTIRMDLEQSTIITIIVALVLKDPDPIVG
                     HDYGIRRLITTYASVLYAIPPLVVSLFQVNLVGSMGAAIVSALFMGIHAIERKASFNS
                     IQLMYSSYVVLVFYGITSTSISAIADDLVRFASVMLAVLLGIMSLIILHPKTRPASQN
                     AA"
     gene            complement(299326..300432)
                     /locus_tag="AOT11_01190"
     CDS             complement(299326..300432)
                     /locus_tag="AOT11_01190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="ASM98082.1"
                     /translation="MSEQNTTTSASDDNKKLKQARSFTYYIFAAVLVLWVYTLWADRV
                     TPMTDQARINGQVIRISPEVSGPISEIHIVNNSAVKAGDALLNIDDRPFELAVKAARF
                     DLQKAAQSYQADSAAINVAKANEVAARVKVANARKNVERNRVLAERGTISEATLDNIV
                     AELDTAEANLAQASSALEKAKQEFGPRGKENPEIQAVLNRLEQALLNLNHTKLTAPAD
                     GVITNMDLAVGDYAGAGQPLLTFVNNHNLWLTAMVRENSLAYLQTGDKVKIVFDAYPG
                     EVFEGNITSIGWGSSGNGSLAVDAGTGLMTSPTNNPKAQRFPVNIEFSDLPDNITLRY
                     SGRAVVGFYPEESYIAERLQDLWMWAWSYISYVS"
     gene            complement(300446..300943)
                     /locus_tag="AOT11_01195"
     CDS             complement(300446..300943)
                     /locus_tag="AOT11_01195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="ASM98083.1"
                     /translation="MNIQVKDSFIAGLINGAINGYIASHHFKGMSSVPMSMEMISNSQ
                     VTVWGQAISLTFGLGIILSLITSTLFLRQLKISHPQYRHELQRSFWKDLLPIALMQAG
                     ALFGWFVALAVIWTKYAGVVMVSPMAAVVLTGLFAFVITIVVEVRTKSSIIYKKVNIL
                     EQKMI"
     gene            complement(301104..302444)
                     /locus_tag="AOT11_01200"
     CDS             complement(301104..302444)
                     /locus_tag="AOT11_01200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="ASM98084.1"
                     /translation="MAKTQNINQRMSIVTLAWPILVEILLRTALGTSDVFMLSGYSDK
                     AVSAVGVITQLTFFLIIVSTFVSSGTGILIAQYNGAGRDQDATHVGVASIALSSVIGV
                     ILSVLAVLGATHLLPYYGLEAQVEQYAQEYLLISGAMTFNVTIGIVFTTILRSHGYSR
                     SPMTVNLISGVLNIIGNYIALYQPFGLPVYGVQGVAIATVASQVIGTTILGVLLWRSS
                     IDLPMRSLAQVPSAVYKKILKIGGMNAGEVLSYNMAQITIVYFVVQMGTSSLAAFTYA
                     QNIARFSFAFALAIGQATQIQTGYYIGKGWIENITKRVQIYFLVGFASSVTVASTIYF
                     MRDAILTLFTQQPEILMLAGSLVMGSIVLEAGRVFNLIFISALKGAGDIKFPVQMGIL
                     SMWGLGVVFSYLLGIHWGYGVFGAWMAIALDEWFRGLIMARRWRSQVWTRYKLS"
     gene            complement(302619..305435)
                     /locus_tag="AOT11_01205"
     CDS             complement(302619..305435)
                     /locus_tag="AOT11_01205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-glucosidase"
                     /protein_id="ASM98085.1"
                     /translation="MRNPAIDKAQQALVSVSRQAAAEGIVLLKNDDQALPIQPSEVVS
                     LFGRCQVDTYRSGTGSGGAVNVPYAVNALQGLQSNASFTLNQALIATYQAWLAHHPFD
                     DGGGGWAAEPWFQHEMPLTDELVAQAALQSDKAIVFIGRTAGEDKDYADEAGSYRLTE
                     LETDMLTKVCRHFTSVIVVMNVTNIIDMSWLTDLENHQAIKAVLYSWAAGMEGGHALA
                     DVLSGTVSPSGRLTDTIAYRLQDYPSSAHFGRKDFNLYVEDIYVGYRYFETFAPEAVQ
                     FEFGAGLSYTQFERRLVQCSSDVADAGGDLTNANALTFDIEVRNVGQQFSSKEVVQLY
                     VEAPQGKLGKPARVLCGFDKSGEIAPNGRERVQITVPVWALASYDDSGVTGHKNSYVL
                     EAGEYRFYLGGSVRQAELLDAVWQLDQLRVLETLAEACAPTREFERLVPAERQANGVY
                     QTGYQPVPLRTVDLAQRIEANLPPTYAFTGDQGIKLADVAQDQADLEAFIAQLTPAQL
                     ATLVRGEGMCSPKVTPGTAAAFGGVCDSLFELGIPVAAAADGPSGIRMDSGHQATQVP
                     IGTLLACTWNSALNQQLYYLVGQELQAYQIDTLLGPGINIHRHPLNGRNFEYFSEDPL
                     LTGWIAAAQTTGLKQAGVSGTIKHFAANDQETARVDVDSVMSQRALREIHIKPFEMAV
                     KYGQASTIMTSYNPVNGHWAASNYDLNTTILRGEWGYTGIVMTDWWAKMNHPVDGGEE
                     SKRFTGYMLRAQNDLYMVVENDAAERNPMDDDTLQALAQGELTLGELQRSAMNICRFI
                     LQAPVMQRPLQAYQAVKPFAPLSAQARHAVPESAPICFADQTIELNSQSASQCLLQVE
                     HSGTYLCFAQMAYDREALAQSSCSLSINGEIAMSLSTNGTNGQSVKVEGRAISLSSGV
                     YWLESQFVKKGAVLQTLRFERQEQ"
     gene            305548..306417
                     /locus_tag="AOT11_01210"
     CDS             305548..306417
                     /locus_tag="AOT11_01210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ASM98086.1"
                     /translation="MSITYQLQEHLRYPHVKFAYVDGHHHSDFGLHKHDFSELFLVVS
                     GKGNHVVASHVYPLSAGDVFVINGDIEHAFQDVEQLEIINLMFEAGTPFFETPSLRML
                     SGYQAMFKVEPIARQTGEYRAKLTLDSGQLPQIARLIDAIRIEYQQGENGFETMLTSL
                     MQQLVITLARMYQQQTHDLPKTTLALSRALIFIEQHFTDAGLHSGEIAQAAFVSQRQL
                     ERLFKQFLNTSPNLYLREMQLNYGRDLLSNDRGVSIQHIAERCGFNDSNYFSKCFKQK
                     FGQSPRQYMTQQK"
     gene            complement(306585..307868)
                     /locus_tag="AOT11_01215"
     CDS             complement(306585..307868)
                     /locus_tag="AOT11_01215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltoporin"
                     /protein_id="ASM98087.1"
                     /translation="MKLSKLTLACLVATAGLSAAPVVHAEKSDGFEFHGYFRAGALYS
                     KNDDFKRSKFPASKERLGRLGIESDNHFELALQKNFENDDGQKIRIKTRVGADNAQSG
                     GNNQLGTNADAANSSIGMVETFVEFDGVTETGTVWGGTRFYGKDNYIFMTDFFYTDMS
                     GTGVGIEGVQLGDYKWDFAYIASDNAEDSFWATNSNNPMHAVHVGVDFDGVELHAMGK
                     YLPDNFVDGTEYASNGVEMTAIVHSDKVFGLSDKGFTKYIAQAGKGLGSGQLLGGTLT
                     TYNAWKPGNGALEGPSKMKKVESGDVSARALVWGGYFFENGVSIFHSIQGQYNDLDNG
                     GKDSWASAMIRPSFPVSKNFFIATEAGFQYNKWEDSNGVGDDATNYKLTVAPTIIVPT
                     GFGPAPEIRFLATYLDGSMRDKADVLVGIQADMWW"
     gene            complement(308251..309852)
                     /locus_tag="AOT11_01220"
     CDS             complement(308251..309852)
                     /locus_tag="AOT11_01220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-glucanase"
                     /protein_id="ASM98088.1"
                     /translation="MTSNNRNRINQLALAVSLGLLAGCSQTGDSASGTDFVQTKKPVM
                     LLDQPTPPSAQWQLVWADEFDGDKINKRNWSLEENCWGGGNNEQQCYTKRARNAYVQD
                     GYLHIVAHKESYSGPDNPEGKVGAGANKTLPFTSARLRSKDKRDHKYGRFEIRAKLPS
                     GQGTWPAIWMLPTDNKYGTWAASGEIDIMEAVNLKAQSDAPGAQAGDGENRIYGSLHY
                     GKAWPDNVYSGQGASLPNNINPADDFHTYAIEWEEGEIRWYVDNIHYATQTQDEWYSQ
                     YKVDGALVNAKGAAPFDERFHLLLNLAVGGSWSANANQKGIDKSDFPKTMLVDYVKVY
                     RCSADRWKGKGCATIGEQAVKVKGHQAPAILAQDDRYADGPNLDIFSESLNSNLAYGS
                     YDPMDIVSHQEVADGDHGQVLKITKKNGAGNLYFRSPTTDVSHWLESGELIFDIKVES
                     MTDGSELMVKIDSGWPKTSDMTVALPAMGQWGEVRIKLADLLAQSNRFVAGNQADPTM
                     INNLLVFEPTAAMTFSLDNIRFEKR"
     gene            complement(309957..311804)
                     /locus_tag="AOT11_01225"
     CDS             complement(309957..311804)
                     /locus_tag="AOT11_01225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98089.1"
                     /translation="MNLMKNIIKSALLLGFSGLLVACGSDSKTEADSNTGTPNEVVLA
                     PQPAPEGNYPTARNGEPLLGNANYPAISYGAFRTTERTEANVPSVAELKEDLRLMEAM
                     GIKVLRTYNTQGFSDTANLLIAIDELMAEDENFEMYVMLGIWIDALNSWTSNPIDPTQ
                     NNPANYAEVAKAIEMVNAYPEIIKVLAVGNEAMVHWAPYHVTPTIILEHVNTLREKRD
                     NGEIPANVWITSSDNFASWAGQGDYNHPDLAKLVEAVDYISLHSYPFHDTHYANAFWL
                     VPEEEQSLTTIEKVDAAMLRAKQHLLSQVKLVQDYLAGLGVNKQIHIGETGWASETNV
                     MYGDEGSKAADEYKQKAFFDLMRAWSQEFGASLFFFQAFDEPWKGAADNPGDSEKHFG
                     LIDINGNAKYVIWDLVDAGAFNGITRAGLNIVKSQGGVEQNVLDSVLAPNAKPVVDQP
                     SDADQFIVLDSTLLNGGEAIAWEGTAYLAEESGVLTLTTPPTAGTAKDWGWGAGVVLA
                     GQAGANLTGFENGSLSFELKGTTGSVLNIGFQTGLWGNNDRPQTNNFVLFGPTGRAIS
                     TEWTAYTIPMSELIKGNPDFSDVTSLIYFSGTADIDGGVVEVRNVVFNK"
     gene            312217..313227
                     /locus_tag="AOT11_01230"
     CDS             312217..313227
                     /locus_tag="AOT11_01230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="ASM98090.1"
                     /translation="MITIKEVSELANVSQSTVSRALNGHPTVKEANRKKVFEAIEKLG
                     YKPNAFAQALASSRSNSIGMLVGSLDGPFYGPLMHHAEDTVRQNNIHLIVTSGQESHT
                     KEQDSINFLRSKQVDGLIVHSDTLSDDELIDVVERQNATIVLNRYIPEIADHCIFIDN
                     ELGGYLATKHLLEHGHKKVACITGQLSKVDSRDRLQGYRNALAEFGIAYDASLIVEGR
                     FDHQGNHEAARRLLDRDPQISAIFCQNDNIALAVYDVAAERGLAIGEDLSVVGFDNDT
                     HSQHIRPRLTTVNFPVMEMGCEAAKGVLALVNKQSYPLKHKLTPELVVRDSVKPHQSK
                     AN"
     gene            complement(313477..316926)
                     /locus_tag="AOT11_01235"
     CDS             complement(313477..316926)
                     /locus_tag="AOT11_01235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98091.1"
                     /translation="MKLEHQKNQNVEGSFVDLLGERYYKIAHVDKMAPFFISVVSSSD
                     HWLFISSTGSLSAGRIRPENALFPYKSVDHIHESAENTGSKTIVRVQQDGRWVLWEPF
                     NRFHDGLYQVERNLYKNSIGDKIVFEEINHTLKLKFQYAWASSDDFGFVRRAQISDLS
                     GQERELDILDGLQNLLPSGAPLAALQTRSALVDAYKWNEQVEGTSLALYTMYAKLSDR
                     AEPAESLLATTVFSIDNDYGQILLSSEQLGAFRCGEPIVNEPLTRGVRGSYLINKTIK
                     LPAGQSKHWLIVADIDKNHCDVRALEQQLATPVKVEQQIEASIAQNQQELIALMSGGD
                     AWQVTAEETTFVHHYANVLFNSMRGGVIENNYQLDKQDVLKTMRKTNQQVVARQQTFF
                     ADLPASFTHAELVRLAKLTGDAQLVRLSYEYLPLTFGRRHGDPSRPWNHYEIKLKDEK
                     GERLLSYQGNWRDIFQNWEALALSYPGFISSFMAKFVNASTMDGYNPYRITKDGIDWE
                     LLEADDPWSNIGYWGDHQIIYLLKFLELAKKYQREELSELLTSDLFSYANVPYELCGV
                     DKLFANPKDTVSFNHELQQRIEERVAQLGSDGRLILEGEDRVYMVNLCEKVLVPLLSK
                     LSNLVLDGGIWLNTQRPEWNDANNAIVGNGLSMVTLYYMRRYVAFLQGLMSELPSSVS
                     MSKEVFDWMLSITRILQDATKEIRQGTVNRQTRKAILTLLEKSADEFRQRVYRMNGFS
                     GKTKVEKSALEKLLEASLVVLDSSIENNLREDGLYNAYNILTYSGESLNIENLYPMLE
                     GQVAVLSAGVLTPKQAVELLDKLFSSDMYRDDQQSFMLYPDRELPAFVERNRIAPAQV
                     ETNRVISEMLAKGDQRIVQRDIQGDCHFHATFENVDGLRKAVAQVKMDYPELSKEQWD
                     ELDALYEQVFNHRAFTGRSGTMFGYEGLGCIYWHMVSKLLLAVQENYQFALEQDANSE
                     ETKQLAHYYYRVRQGIGFNKTPQNYGAFPTDPYSHTPKHAGAQQPGMTGQVKEEVLTR
                     FAELGIEVNAQRIGIQPTLLRKQEFLTQATTFSCLGVSGEKRSYVVEAGQLAFTYCQV
                     PFVYELSEQAQGHIEVMMRDDSVQLFEQLELDERISQAIFARTGEVEKVVVSLPESML
                     YRG"
     gene            complement(316990..317976)
                     /locus_tag="AOT11_01240"
     CDS             complement(316990..317976)
                     /locus_tag="AOT11_01240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98092.1"
                     /translation="MQQVNTPEVILSIKNLVKDFPLGQSVKSNLMRAVNDVSFDLRKG
                     EALAIVGESGSGKSTGARILTRIYDKTAGEVTFKGQPLADYIKENGELEYARQVQMIF
                     QDPFGSLNPVHTIYHHIARPLQIHKRADNAAIPKLVYELLELVGLSPAKETAEKYPHE
                     LSGGQRQRVAIARAIAVDPEVILADEPISMLDVSVRLGILNLMADLKDKHGISFMYIT
                     HDIATARYFAEKTAVMYVGHMVEWGDSDSVTQNPQHPYSQLLLSAVPEVGNSGKRELQ
                     AKKGEIPLWKPSSVGCPFAARCLKATELCTRSLPEPTQIAENHFARCHHLAG"
     gene            complement(317988..318941)
                     /locus_tag="AOT11_01245"
     CDS             complement(317988..318941)
                     /locus_tag="AOT11_01245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ASM98093.1"
                     /translation="MSHLLEINNLCVDYVSPNGVARAVNNVSLTISPGETVGLAGESG
                     CGKSTLAFAISRLHKAPALISEGEILYKGQDVLKMNDRQLRDFRWNDVSVVFQSAMNS
                     LNPVITIGEQLTDVILAHRKVPYKQAHERAVELLKIVGIHGDRMSSFPHQLSGGMRQR
                     VVIAVALALEPKLIIMDEPTTALDVVVEREILNELYELKNKFGFSILFISHDLSLMGE
                     IADRIGVMYAGNLIELGEAKQVFGNPQHPYTKGLISSFPTIHGPKECLYGIPGNPVNL
                     LNIPTGCNFQERCGVCTSVCKQQDPHLMRADNGSLVSCHLV"
     gene            complement(318938..319930)
                     /locus_tag="AOT11_01250"
     CDS             complement(318938..319930)
                     /locus_tag="AOT11_01250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ASM98094.1"
                     /translation="MDKTINTNNASEPSEMIAREPRFSWKKTKKTLGKIYAFFYGNPP
                     AIIGGLLLTIILCGALFAPVLATHNPEKRVARPHVAPNAEYVLGTTRSGRDVYSQVLH
                     GARKSLTVAIAAGVIAMSLAVIIGVSAGYFGGKIDERLNFLTNVFLVFPQLPLLIVLA
                     AFLGQVGSLVITVLLGITSWPWGARLIRSQTMAIRNKEFIISAEVMGESKIRIILVEI
                     LPNLVSIVFGGFLGTVIYAMGAEAGLGILGLGDATEVSWGSMLYWAQTSSSLYTGAWW
                     EMLVPASALAITGGALALINMSIDQVSNPKLRTGPHIKLWHQLKKQADKRRGLL"
     gene            complement(319939..320913)
                     /locus_tag="AOT11_01255"
     CDS             complement(319939..320913)
                     /locus_tag="AOT11_01255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ASM98095.1"
                     /translation="MSFLVRRFGFYFTAFLIAISFNFMLPRLMPGDPVDALFAAAQGR
                     MDPAQMDAVREMYGFVDGNLFEQYLAYMKSVFTLDLGPSVLMFPVSVSDVIAMALPWT
                     MFLALGSLIVALIIGVSIGTYASYHRQGLFGQVVPPVLAFISNFPYVVTALLLFYFFG
                     LKLELLPLAYTYDPSLEPGFNLEFITSVAKHAILPVGSMVVVGIATWVFNMRNAMINV
                     LGEDYVTMAEAKGLSSFRVMYRYAGRNAILPVATAIAMAIGFSFAGSIMTEVVFNYQG
                     LGNILLKGIVARDYPLIQAILLILVTAVLTANFIADLLYVWLDPRISN"
     gene            complement(320981..322618)
                     /locus_tag="AOT11_01260"
     CDS             complement(320981..322618)
                     /locus_tag="AOT11_01260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="ASM98096.1"
                     /translation="MQKKTLLATLAAGLMLTATATTAAEIKQGGTLTVPIINTGFVDN
                     FNPYTTKDLLHGVMFEPLMVFNNMTGETDFRLAKSVAYSDDLKTITLKLRDGLKWSDG
                     SPLTAEDVVYSFMLTKDAPAFDQKGIWSGKNLQTITAKDATTVVFALNEADSTFVWNL
                     ERYHIVPKHIWSKVADLTTFTNPNPVGSGPMTVVKYVKPQQMELCRNPNYYLEGRPYL
                     DCVNFRSYNDNSQIQPALIKGEIDWGSNFIADVESTFVAQDKANNHFWYPANDAIHLY
                     VNTKKAPFDDLRVRQALSIALDREAIVDIAAYGYPTPNYNVGGIGELYKTHIDPQISK
                     KYGYLTQYDAEKAKQLLEEAGIVDRNGDGFRDNKDGSTVEFDIEVVNGWTDWIQVVQM
                     VTEYFEEVGIKANVKTVDWAVYDANLKESKYTMSINWSMVATNPILAYQEYFATSRIG
                     KTWHAGHGVNSPEIDKLIESFGKIGDAKKQEAIISQLQEYTAENLPFIPLFSNPTWFQ
                     YSTKKIVGWPNAENPYVQPVWYDGGKRVIILNNLHLK"
     gene            323109..323882
                     /locus_tag="AOT11_01265"
     CDS             323109..323882
                     /locus_tag="AOT11_01265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="ASM98097.1"
                     /translation="MIRFWNGNKSPTRQQHELDVLLALRSTLQAYWPMVEDTTPYPNA
                     KDEGAVFEKGADLLTTVAGNQKFAPGQFLEVSHALCGGVLGCRVLVIRAADTTHFADV
                     TETQLKAMIAGIPATWADADLLRHNGYRVLEKGSLDEMFLLLQEGLCDFIPLGINEAK
                     SLLDASPNASDKLTVEPSIMIYYPLPVVFYLAPQHSELKEIIEMSLNELEQQGKLQSL
                     YNKHYAQSVQKMDPQARRVFELFNPNLGHAWQAFQPRYL"
     gene            complement(323905..324927)
                     /locus_tag="AOT11_01270"
     CDS             complement(323905..324927)
                     /locus_tag="AOT11_01270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="ASM98098.1"
                     /translation="MNTQKKKKRAPSIYDVAKLADVSPSTVSRFLNRTTYVADDKSDR
                     IEKAIKSLNYKPNYLMNRDKNTRSMTIGVLVQHPESPYTSRILNDMEKVLNEQGYSLV
                     IATGHWQRSLETHALEYLAKSHVDGVIIVTGSLSEEQILAYAERIPVIAVGYQVSGPN
                     VRSVNVDNVLAGYMATLHLLQQGHVNIAHIKGLLNQPDAVARFVGYKKALKEAGIKVQ
                     SPLIKQGDFSSETGYEKTVELIQSRSYFSAIFAANDQTAYGAIKALHDHGLRVPQDVS
                     VIGFDDLPVSQYFTPALTTMRQPIEEIGEISARSILNLLNGDRQVQRLPPIELVVRES
                     TQSKFR"
     gene            complement(325080..326177)
                     /locus_tag="AOT11_01275"
     CDS             complement(325080..326177)
                     /locus_tag="AOT11_01275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ASM98099.1"
                     /translation="MARVEFRDIKKSYDDVEVVKHFDFTVEDGEFVVFLGPSGCGKST
                     TLRMLAGLESITSGEIYVGDKLMNKIDAKDRDLAMVFQSYALYPHMTVYENIAFALKL
                     KGMAKAQIDVEVRKAAKMLELEALLERKPKELSGGQRQRVAMGRAMVRTPKVFLFDEP
                     LSNLDAKLRGTMREEIKQLHRELKTTTIYVTHDQIEAMTLADRIVILKDGYVAQVGTP
                     TEVFKRPANKFVAQFIGNPSMNMLDAKLIGEEGDWNIQLGEISIPLPERFHVHASKNL
                     ALHFGIRPTDIHLRAEQVAHERVLPIDVAIKDKELLGASILLKTEVAGQPLMVETQAA
                     EVDVNHITLYLDLDAIHLFDSLSEKSLATFA"
     gene            complement(326177..327526)
                     /locus_tag="AOT11_01280"
     CDS             complement(326177..327526)
                     /locus_tag="AOT11_01280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-glucosidase"
                     /protein_id="ASM98100.1"
                     /translation="MNKYQLPQDSQLRQADFLFGVATSSYQIEGGAQLGGRTPSIWDT
                     FCNQPGAVDNMDNGDVACDHFHLWQQDIELIQGLGVDAYRLSMAWPRILPHDGQINQD
                     GLKFYERIIDECHARGLKVFVTLYHWDLPQYLEDKGGWLNRETAYKFAEYAEVVSGYF
                     GNKIDSYATLNEPFCSAYLGYRWGMHAPGKKGEREGFLSAHHLMLAHGLAMPIMRKNA
                     PQSMHGCVFNATPAYPYSEQDVAAAQYSDAEGFHWFIDPVLKGEYPQSVLERQAHNMP
                     MILDGDLDIIRGDLDFIGINFYTRCVVRFDANGALESIPQPDAEHTYIGWEIYPQALT
                     DLLLRLKQRYPNLPPVYITENGAAGEDTCINGEVNDEQRVRYFQSHLLALDEAIRAGV
                     NVQGYFAWSLMDNFEWAYGYKQRFGIVHVDYATQKRTLKQSAIAYRNTLLARAEEKQ"
     gene            complement(327557..328438)
                     /locus_tag="AOT11_01285"
     CDS             complement(327557..328438)
                     /locus_tag="AOT11_01285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="ASM98101.1"
                     /translation="MSTKHNALLPWKPSEQALALLTKSLMVLLAVVLIVSAIMTVFPF
                     LWSALLSTRDRTEIFGTGISFAIGDSLAVNYAKLLEIMPFWQAMFNSIYIAFLGTTIS
                     LLFCSMGGYAFAVYQFKGKNFLFGMLVGSMMIPPVLSLIPYFMIVKFLGLLDNHMAVW
                     LPFTTTPFGIFLMRQHVVASIPKELLEAAKLDGAGEFRTYWSVVLPLMKPALATLAIV
                     QFVFFWNSFMNPLVVLTTPENYVITQALRSVQGIPNTPWGAVMLGTTISILPLVITYL
                     FASKQMISGLTSGAVKG"
     gene            complement(328440..329429)
                     /locus_tag="AOT11_01290"
     CDS             complement(328440..329429)
                     /locus_tag="AOT11_01290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="ASM98102.1"
                     /translation="MNHAASKVMETSQRKSFFSRLNLKALTPYGFLLPFLIIFSVFGV
                     FPLLFSIFLSFHEWNPVEGLGAMNYVGLENYHIALTDPWLWRSLKNTLWLAITSGVAQ
                     HLVALPVAYILVSMSDRLRHWLTSAYFLPFITSTVAASLIFFNMYSPNSGIINQSLMA
                     LADSSLLGWAFSWVNDYQPVRWLDDASMVKPSIAIMVFWKYTGFNIVLYTTGLMTIPK
                     EILEAARMDGANAWRRFWSISLPMIRPFVFFAVTMTIIGNLQLFEEPFVLTRGTGGTG
                     QSGLTISMYLYKVGWEWLEMGTASAISWLLFILIAGCTAVQFFFFGKKGLGEQ"
     gene            complement(329520..330764)
                     /locus_tag="AOT11_01295"
     CDS             complement(329520..330764)
                     /locus_tag="AOT11_01295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="ASM98103.1"
                     /translation="MKLTSLTLACSVALGLAATVNAAEQKIRFDGFPDFDSSLKVLLP
                     EFEQETGIKVDYLMNNHGDHHTKLTTNLATGSGAGDVIVVDVEKIGPFVASGGLVNLS
                     QQYGADKYQERFAPYAWAQGKGADGNMYGIPVDLGPGVMYYRSDIFAKAGIDVKEAIK
                     DWDSYIAAGEKLKQQNVQLIASAADVAQAIIFTTVPEGEGLYFDKEGNPVVTSERFVH
                     AFEVAKTIRDKGLDGRILAWSNEWYEGFRNGTFATQLSGAWLLGHLNNWIAPETAGKW
                     GVSHLPDGIYGSWGGSFLSIPTQSKHQDEAWKLIEYMTTRRDIQLQHFATIAAFPANT
                     TTYDDPMFQEEIAFLGGQKARLLFADVAKNIKPVAPAKGDHVARSIILENALMEVLDE
                     GKDIKTALKEAERLIKRRTRNM"
     gene            complement(330785..331789)
                     /locus_tag="AOT11_01300"
     CDS             complement(330785..331789)
                     /locus_tag="AOT11_01300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="ASM98104.1"
                     /translation="MATIKDVSEYAGVSQATVSRVVNGSCRVSHDKKLRVEKAIQVLG
                     YRPNAIAQALASSRTGSIGIIVPELGGPFYSGILHCIEEQFRRFGYHVIVTAGNNSEE
                     SQRESVEFLLGRRVDAMILHTQNLSDDYLIELESKGIPLVLVNRFIPELASSCIDIDN
                     ELGGRMATEYLLQRGHHSIACITGPLDKSDARGRLQGYRKALEAAGIEYDEALVSEAG
                     FTEESGASAMRKLLNRGHTFSAVFACNDHMAFGAFEVMKEQRIRVPEDVSLVGFDDIL
                     FARYLTPALTTVNFPIEQMSLEAVQLTLQILNKNKRDVNFRLSPTLVIRESVNVSSTL
                     "
     gene            331834..332055
                     /locus_tag="AOT11_01305"
     CDS             331834..332055
                     /locus_tag="AOT11_01305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98105.1"
                     /translation="MLLSISDLPTNSRDRDRIKLGVKMSKCLNNEGQLTLFASHETVS
                     WWHFTAKRRLLLLSSLGKCMAKDSPGHAR"
     gene            complement(332060..333340)
                     /locus_tag="AOT11_01310"
     CDS             complement(332060..333340)
                     /locus_tag="AOT11_01310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactam utilization protein LamB"
                     /protein_id="ASM98106.1"
                     /translation="MKTLRLLPLALAVASSLASVSAFATSESDLDALEKRIQELEAKL
                     ETAYVYDQQPAVLTPDTEVPLGIVFSGYARYGAHYAAGDNRYVQVGSSGAAVGRLGNE
                     ANGGEFQLAKAFKTDGGAIWDIVFMMDQWGIDQWSSPGGLNLKKAYAGATNLFESQPE
                     LYVWAGRDFHQRPQQGLNDYFWMSHDGQGGGFKNLNLGGAKFDFGFVGQVDNGDGGAL
                     GNDTGIYALTSRLHAMDLGAATLDLYANYGFASDEADAAKQGETAWQVGAVVDFGGGN
                     KLTMKYADGADNSAFDLAGDQQVTYLSWEGSFNPSEPLYIDYLASFKNIAGKDVDEKN
                     EYSAIVRPMYNWSDVHSTWLEAGYALEDFDNGDEKSGWKVTLSQNISMGGLPWSRPML
                     RFYATVGDVESTVSGVDQAKQDTLSVGAMWEAWW"
     gene            333870..334331
                     /locus_tag="AOT11_01315"
     CDS             333870..334331
                     /locus_tag="AOT11_01315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="ASM98107.1"
                     /translation="MKYLALVWGLLIAPQVYSYNLQMDIPHAPAVVLTVQDLEQMEAT
                     QYTTMLPWLSAPATFTGVKLSTLLAQQYGFIPNRVTLRALNDYAADIDLSDIEKYQPI
                     VAYWQDGKPMRVRDKGPFWLIYPQSSFPKELNIERYHSQMVWQLKQIHIAK"
     gene            334346..335437
                     /locus_tag="AOT11_01320"
     CDS             334346..335437
                     /locus_tag="AOT11_01320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM98108.1"
                     /translation="MQKTNLNLYKGPFSTSAKLTLLAVTVCLLIANLALLQETRTLAR
                     SYSDSQNQATWFLFNLSKELSELVSESSRAEDSSYDLKRVELKYELTWSRFDLLINSR
                     ESDTFLSRNEVKSFFVDLFYQFQTLEQPLQLALNGDDNAAKLFYRETSRLYLSMIDYV
                     TRNFRVASPLYKEQQMRAQLLFQAQFVLLGIFVLCAGFMAYFFYKEARFHKKMSLTDP
                     LTQLPNRIGMFLHMDKYIQDKEHFSIYLLDLNGFKAINDNLGHQAGDAALQEVALRLK
                     KLENASVRVCRMGGDEFAVLCKHVTNDEHQVLNQAIHQLFVPPIALEQGPAKLSTSLG
                     RACFPDDSENVDALINLADKRMYRMKFSR"
     gene            335556..336212
                     /locus_tag="AOT11_01325"
     CDS             335556..336212
                     /locus_tag="AOT11_01325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="ASM98109.1"
                     /translation="MRLLLIEDDTLLGQSMVTSLSRHGYTVDWLEKGSGVTSALKTED
                     FTAVILDLTLPDIDGLDVLRNIRSAGFNLPVVILTARDDIKDRVQGLDRGADDYLGKP
                     FALEELLARLRVVIRRQSGSATEVIDVGELSLSLSEQSIRYQEAVLKLTRNEFKILAA
                     LMTNAGRVMSKDQLQQSLHGWDDSASDNAIEVHIHNLRKKAPNVPIKNIRGVGYIIEK
                     "
     gene            336202..337620
                     /locus_tag="AOT11_01330"
     CDS             336202..337620
                     /locus_tag="AOT11_01330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM98110.1"
                     /translation="MKSSQPFSIKRRLTLSVSLLSCFLLIMTMYFSYSSAQHEVGEVY
                     DARLGQTAKLMLMAWSIAPEKDSLQQHQQQFEQWRTNLRRLAREDDDEGTAFGHPYEQ
                     NLVLQFFRHGDLIWSSDSSLTALGSEKQKNGFRDTQMNGERWRIFQLYSPPDSGHSEW
                     IVVAENHRIRNEIISEIALSTALPQLILLPALLVLLLWLIDKHFHPIEELRTAISHRS
                     VSKLDRINVEHPTLELDPLVDTLNQLLNELEQAWQREKRFTRTAAHELKTPLTILRLN
                     AENALASESPQQLSHDLNNILKGIDRTDRLIHQLLTLAKVDNASDLACDSVELDKLLQ
                     SVMADMALLALKQQQELSLQSEEVSLQGDKTLLETLFRNLLDNAIRYSGAQSEIDISV
                     METHQYVDVLVADNGSAIDEASRGKLFEPFFRANSEKGDGAGLGMAICQDIAKLHNAT
                     LELLPRSEHRNVFRVRFWRTHP"
     gene            complement(337714..338520)
                     /locus_tag="AOT11_01335"
     CDS             complement(337714..338520)
                     /locus_tag="AOT11_01335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="ASM98111.1"
                     /translation="MRFGLLLLLCGFIYPSLATTEIIMGYRTTEKMPYIHAEPSDDGF
                     YFELYDEAAKRIGAKLKVVRLPKLRVLLALEAGEIDFYPGFAFDLERVKYAYWVPNGT
                     YQRDVAVTLKGRPLMTQATSLDGFTQLVALGNPDYLVGRDTSKMNQFTVSELDVGRAM
                     TFLRRGRADFYVYEEDTLRYYLKTEGLNDMMIHPQFVDRSTPSWAGFSRNSALFQGQE
                     NPAYDPNLPLAWNNMPMELVPGSVIDEFRQALHQMEMEGWTQALYRKYFE"
     gene            complement(338598..339476)
                     /locus_tag="AOT11_01340"
     CDS             complement(338598..339476)
                     /locus_tag="AOT11_01340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM98112.1"
                     /translation="MLNPVWLTTFKTLIEVGHFTKTAEKLFMTQPGVSQHIRKLEESC
                     GAALIERDKKSFEITEAGLRVYQYAKQLESEQAELLQSLQFDNPHAGVFRVACSGALG
                     LKLYPQLLDLQCKYPELIPQLEVAPNHKIIQEVLNGDVDLGIVTHLPQPALFEVEKMG
                     TDELCLFYPAQYQGKTLDDIIALGLIEHPDAHHYLELYLTLCGETDQSQMDTRHIPAR
                     GYVNQLSQILLPVAQGLGFTVLPHSAMSQFSLTEHLAIYPSAQRVEESLYLISKKART
                     LPARFEVIAHAMRQAL"
     gene            339665..340150
                     /locus_tag="AOT11_01345"
     CDS             339665..340150
                     /locus_tag="AOT11_01345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017030954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="ASM98113.1"
                     /translation="MKMNHVGIMVGDMDKAVEFYTHALGLKIVMNNTKVVEERESAIG
                     RMCIAVFGEGFKGFNIAHLVTTDGIGVELFEMKERQERHVVDFSRLGIFHFCLQTDDF
                     EGVIKRTEEFGGKVRMDIMRYHPEDDSKPAKMVYLEDPFGNLFELYSHTYEETYASDY
                     E"
     gene            complement(340261..343008)
                     /locus_tag="AOT11_01350"
     CDS             complement(340261..343008)
                     /locus_tag="AOT11_01350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="ASM98114.1"
                     /translation="MRNMLFFPALLLSGCALTPNSPPLQQDANWSVGQLPNGMKYHIY
                     PTDDQEISLRFTVNIGSFQENEQQKGYAHFVEHMAFNGSQHFSGNEVIKLFAQAGGSF
                     GADINAFTAYQQTTYKLELNDSAHLQDALTWMRDVSDGIEFAPQEVEKEKGVILGEWR
                     RSRPEDTSFSFNAYYASIDGTVYEKHDPIGDQESIENATAESLKSFYQTWYQPQYSEL
                     IITGNVRVEEIATIIDEKFASWQATANNTVEKRRDIPVKTEPRVLFSSVMESPSVHFA
                     IDRGFVGMRTQAQQQQMWHDDVSAQLIQQRLYSVLNDAAEPFQYAYANAFANNYSRLI
                     AGGVSFAPGQRHDMHRLFVETLASLRDYGVSQQELDSVMSGYRSELTNLESDWQQRKP
                     FHFADSRMIDLDQNNVTQSKQDYQANLTQFIELNSLETANKQLQGVLDQPVPFIMGLG
                     PGDRMATWATTPMKIAEAYQRPGVKPLTLAAKDEGFLQPQQAGQIVDVQDHEGGFKVY
                     SLSNGVEVWFQQDSKAGDRAYINFASLGGKAAIDPSLYPAYELATHTAVRSGLGDFSG
                     TELDSYLRKNDLMLNPILGTTYHGVEMIGAKEKLAITLNALYNLATEINIDPRQLQAV
                     KKEFEQNRSAYLKSGVGQLVLKGNQSSYPDHTRHRLVTADEVIPVTVEQIDAIHQTLF
                     GQNRGFKMVLIADLTPEQVAPLLRQYVASIEMQPAPALDYAVVYKDNLPAYSVVKEGS
                     EKSTLHLVRVLNPHVAAKVGKDMFIEDMLQRISLARVLTQLREEASLDYSPAVYPMMQ
                     DQETVSDWFFESQIAPKDAKLMDQQIEQVIAELAKNITQEEVDTAAKQLSVDLRSLDS
                     DPRFRNGFYTRYLINHYGIDALLNYKQTAQSVTLEEVQQRAKNTFGEGTKRMTLLLEP
                     K"
     gene            343198..345006
                     /locus_tag="AOT11_01355"
     CDS             343198..345006
                     /locus_tag="AOT11_01355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD+ kinase"
                     /protein_id="ASM98115.1"
                     /translation="MMILSRFFAFLRSALFVLALFPSFPILADTGAQEIDYLPMTVGL
                     LGGLAIFLYGMEKMSDALKRAAGNKMKQWLAKLTTNRVAGVLTGTGITAIIQSSSVTT
                     VLLVGFISAGLMSLPQAVGVIMGANIGTTVTAQIIAFKVTKAALVMVAIGFMMFFTSK
                     KETTQHYGNMLFGLGLIFLGMNLMSEAMAPLRSYQPFIDLMAHMDNLLLAILIAAAFT
                     ALVQSSSATTGIVIVLAGQGFIPLDTGIALAMGANIGTCVTAVLASIGKPREAVQAAA
                     IHIIFNVMGVVIWLPLIGILSELAMFISPLHPELVGAERMAAELPRQIANANTLFNML
                     NTLIMLPFASVFVWLVRKLLPHTSTEKSEASIQTKYINDAFLPTPDIALDQAQLELGR
                     VGRRVCNMLNMLPPLAPECKDANETSLVRESLNQIELIEEEVDQLHSTILSYLGRLRR
                     EPLSDAQSARQIKLISITDQLESIADLVVNSLLPLAYKALNDDIVVSPQMRTTLDTVQ
                     DKVNRTLLDCVNAIRRDDPATAQLVLNAKRELNSLIDAVLAHQAQRLSEEQPNRLRIF
                     RYEMEWVETLKRIYTLTKRISKLQLRQRDISTPTQG"
     gene            345150..346475
                     /locus_tag="AOT11_01360"
     CDS             345150..346475
                     /locus_tag="AOT11_01360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ASM98116.1"
                     /translation="MEAIKPAMHEPFCVDLKHALIWVARALDYVGMDDLHHNHRVAYT
                     AYECAKLLGWEKKKQEFSFLAGLIHDCGVSQTAEHSHLISDMLPSESEQHCRVGFQAL
                     EQCDMLAQFANIILYHHTDWLHLQHAPISPYEKDVAALIYLADRLDFLRAKYLSHTQP
                     DLITLYKKAISEELYFYRGTLFCPTFVDALVTLIHRDGFWFAMDSTHIETVPFSFSQL
                     KWLHQDLSISALIQLGRFIAGIVDAKSPFTYQHSLKVAELSEYLALQMGLPKSTSKLI
                     YVAGLVHDIGKLRTPDSILHKEGPLSEIEYIHIKRHTVDTAVALNMIFPHSNIAQWAA
                     NHHERLDGSGYPYNKSAEQLDLPSRIIAIADVFQALSQNRPYRSKLSPQEITDIMWPM
                     VEQNQLDGDVYAKLEQNLNHCYAMSTALSLKVSEGETSVDEASSLVYSQ"
     gene            complement(346613..347470)
                     /locus_tag="AOT11_01365"
     CDS             complement(346613..347470)
                     /locus_tag="AOT11_01365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082155.1"
                     /note="YghU; B2989; one of eight putative glutathione
                     transferase proteins from E. coli; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-transferase"
                     /protein_id="ASM98117.1"
                     /translation="MANTYTPPAVWTMNEENGGQWASINRPDSGARFERELPVGSHPL
                     QLYSMGTPNGQKVTIMLEELLALGVKEAEYDAHIIKIGDADQFSSGFVAVNPNSKIPA
                     LVDRSAAEPINVFESGHILVYLAEKFGKLLPTDLAARTQVMNWLFWLQGSAPYLGGGF
                     GHFYAYAPEKFEYPINRFTMEAKRQLDVLDKQLAKHRYLGGDEYSIADIAVWPWYGNL
                     VLGKLYNAAEFLDVASYQNVVRWAKDIEQRDAVKRGRIVNKTWGESWEMVEERHSASD
                     IDQALATQP"
     gene            complement(347624..349051)
                     /gene="gabD"
                     /locus_tag="AOT11_01370"
     CDS             complement(347624..349051)
                     /gene="gabD"
                     /locus_tag="AOT11_01370"
                     /EC_number="1.2.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151523.1"
                     /note="catalyzes the formation of succinate from succinate
                     semialdehyde; NADP dependent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-semialdehyde dehydrogenase"
                     /protein_id="ASM98118.1"
                     /translation="MNSLFRQQCYLLGEWRSAPQTMTITNPFNDEVIGTVPNMGEKET
                     QEVIAGADKAFQQFKALTAQERANLLHRWHQLILEHSDELAHIMTLEQGKPLAEAKGE
                     VLYAASFIEWFAEEARRAYGTLVPSHKANAKILVTKEPIGVVAAITPWNFPAAMITRK
                     CGPAFAAGCPVILKPAPDTPFTALALAVLAEKAGFPAGVFNVITGDAVAIGGELTSNK
                     RVRKLSFTGSTPVGKLLMRQSADNIKKLSLELGGNAPFIVFEDADLDAAVEGAMIAKF
                     RNAGQTCVCANRLYVQRSVYSEFCQKLVAKVSALKVGNGFDQGVHIGPLINDAAVAKV
                     VQHVEDAQSKGAQIECGQLPTAGSRLVQPLVLSGVTDEMLVAQEETFGPMAPLFVFDS
                     EEEVLERANNTDFGLAAYFYTQSLSRAWRVSEALEAGIVGINEGLISTTVAPFGGVKE
                     SGLGREGSFLGMDDYMESKYILMGL"
     gene            349347..349892
                     /locus_tag="AOT11_01375"
     CDS             349347..349892
                     /locus_tag="AOT11_01375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98119.1"
                     /translation="MADIQIPKSLHEVFGEKQSALEIACVFAFAFVGTAIVYWHLYLP
                     MNAELNWKVALGFVLIADVLAGCVANFTKGTNQYYAARPSSRFTFIAIHFHIIAIAWL
                     LGGSLLSAWIIWGNTIAAAMVINSLKGHKFQLFIAANLLCYGLLLLLILPLEPWLLAC
                     SLFFMTKVMFSFAVDHYANAE"
     gene            complement(350011..351633)
                     /locus_tag="AOT11_01380"
     CDS             complement(350011..351633)
                     /locus_tag="AOT11_01380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98120.1"
                     /translation="MKIQHKLTIPVGIILLTFLVVSFINYSLSEKQAKIADDINNGMY
                     PVVMSLEDAYRDLYQSSNAVQGWLLASSQDEKNYHLGEFKENAYKAIPRMKKVQQLID
                     AQLIPRAMQGELNRLVKITQSWIGLYEPIFNQPDLAEHYYANNQQNIHDEFVLMRAQL
                     KTLSNAIDDELMLLNQQYVERQNFVDNVILIGLAAVVISVSFAYWVIQRFVMKPMCQI
                     QVAMRDIAEGEGDLSRRIDISSHDELGELAHSFNQFTSRIHNTIGEVVAATQSVRSDM
                     HLILQSTQQISQFSHGQQQESHTVAAAVNEMQATSQSVSDSAGEAAQSSSLASEQVEQ
                     AQHTVQQTVESIEHLSDEIESATQVIHRLDSQVSNIASVLDVIRGIADQTNLLALNAA
                     IEAARAGEQGRGFAVVADEVRSLASRTSDSTGEIQAMIERLQQGAQEAVVVMSRSANS
                     REETLHRASNATDSLGQIGASIVHMNDMNSQIASAATQQSAVSADINLNVQNIADSSK
                     QMVSMVAQVQQACEGLDEQCEQLDTLLGRFKI"
     gene            351848..352450
                     /locus_tag="AOT11_01385"
     CDS             351848..352450
                     /locus_tag="AOT11_01385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="ASM98121.1"
                     /translation="MHLALFDFDGTITHEDMFSLFLKHSASPKRKWLGRLAIMPFYAL
                     YKLKLLPAHVMRPIASWVAFRGRNAHQLRQLGEHFSAEVIPHYLRVEAMEKLAWHQAK
                     GDRIILVSASLDLYLAPWCKTQGIELLCSEMKIHHGTLTGTYLNGDCSKTRKVARIQA
                     HCDINQYPRIYAYGDTDEDRPMLALADEAYFQWERVAPEG"
     gene            complement(352532..353143)
                     /locus_tag="AOT11_01390"
     CDS             complement(352532..353143)
                     /locus_tag="AOT11_01390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation protein Fic"
                     /protein_id="ASM98122.1"
                     /translation="MRDKYGAEQDHYCYPDSNTLVNLLDIRDSDDLDKAEVAFSELRY
                     IEYSSSVLTLEEMDITHFKHLHWVLFQDVYGWAGEFRDVDISKGSSRFAHCVFIERSL
                     VKELGRIPQLRHCKDRISAVRLIADIFCEINVIHPFREGNGRATRFFFEELVFIAGYD
                     INWPEISKEEWVEANIQGFLGNTSFLESIFDAAISGDKYHSTN"
     gene            complement(353484..354665)
                     /locus_tag="AOT11_01395"
     CDS             complement(353484..354665)
                     /locus_tag="AOT11_01395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Spindolin"
                     /protein_id="ASM98123.1"
                     /translation="MKKALSFSLASASVLAALSTFQVQAHGWVEYPSARQNTCYEDGG
                     FWTNEIPNQACQAAFDASGAYPFVQRSEIAANVPNYRDMAHVKAIVPNGELCSAGDSA
                     KAGLNIPSPYWQRTSITPDANNQIELVFFGKAPHNPSYWEFYLTKPSYDASLPLTWDD
                     LDLIDTAGDIVVDEQKRYRMKVTFPADRSGDAILYTRWQRIDVVGEGFYNCSDITLRS
                     GGTTPPTDPTDPPTEPGNNLSVLGYFVPQGFGPVESGDTVRLRTFDATGAELVDISLA
                     ISANNTGTWAAELAGQFNGQQHKDWYIGIWHQEMNHYMYDSSNLFANQVHAPSANFSY
                     ALSLIKADTTPPTLPTNGWSKDKVYVAGDVVSHNGREWTAQWWTTGEEPGTTGEWGVW
                     R"
     gene            355098..355736
                     /locus_tag="AOT11_01400"
     CDS             355098..355736
                     /locus_tag="AOT11_01400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrrolidone-carboxylate peptidase"
                     /protein_id="ASM98124.1"
                     /translation="MRKILVTGFEPFGGESLNPSLELVKVLTQKERTNIEIIGCQVPV
                     VRHQSISTVIEAIEQHEPELVFMIGQAAGRAAITPERVAINLDDYRIEDNAGHQPVDE
                     PIIATGPAAYFSTLPVKAITHALQQAGIPCQLSHSAGTFVCNHLFYGIQHYLQARPIR
                     SGFIHIPLLPEQASASNQPSMSLETLARGLEMMIMTCLETEQDTKLTGGTIC"
     gene            355821..357008
                     /locus_tag="AOT11_01405"
     CDS             355821..357008
                     /locus_tag="AOT11_01405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98125.1"
                     /translation="MHTRLLVFALPVLASSFTMANEVNYHIRISPTSEDQLRFSANTR
                     NLGKFTVEPPRSLTSAMPPALSCLQDERFTSIQYGTEVECDRIEWQTTAEKVPDQGFE
                     PSNQNDSYSPQQGWYFVSEYDTLPRIPQADITLVCTPDQHCYTLPNPTLPPLFLVWGM
                     DTALIPISGQHVRVHVEDAKVIDAQQRWLPTMQKQLSYLHRVFPQSNMAGWELAFFKR
                     DKNAGSLGGAAGTNMLLVNSLLDQGELTDESLQLLLKISAHESIHYMDKRKNSLWKSE
                     SLAEYYALKSLMNTEITFESPEALWQQFAQKYPFAGTGLYEAEHQVLEHGNRQYYPLF
                     YFKGAAFWYALDQALQTHGSSLDQWQQIELGREAEFNAKIITQLQAIIGEERWQALAE
                     KYL"
     gene            complement(357005..357445)
                     /locus_tag="AOT11_01410"
     CDS             complement(357005..357445)
                     /locus_tag="AOT11_01410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="ASM99237.1"
                     /translation="MDRFDEKILHALKRDGRISNVELSERVGLSPSATLRRVQDLERK
                     GVIKGYRAVLDSNQLGIGFVAYVSIGLASHSKKAQQEFEDHVRFVDEVVECHNITGAN
                     EYLLRVETKDLVAYKKFHADVLGECEQVKSITTMVVMDSPKDER"
     gene            357567..358154
                     /locus_tag="AOT11_01415"
     CDS             357567..358154
                     /locus_tag="AOT11_01415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="ASM98126.1"
                     /translation="MELSQLSALALFAFVSTFTPGPNNIMLMTSGANVGFVRTIPHML
                     GITLGFAVMVMLIGVGLMGLFHSYPLSHQILKYLSLSYLVYLAAKIAFSGKASERKDF
                     KPMSFLQAASFQWVNPKGWTMALTAVSVYSTGSQWWELALIAGVFILANLPSVSFWTS
                     AGTQLQRWLTTHTRVRCFNISMALLLLLSTLPMLN"
     gene            complement(358243..359652)
                     /gene="rimO"
                     /locus_tag="AOT11_01420"
     CDS             complement(358243..359652)
                     /gene="rimO"
                     /locus_tag="AOT11_01420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421740.1"
                     /note="catalyzes the methylthiolation of an aspartic acid
                     residue of the S12 protein of the 30S ribosomal subunit;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S12 methylthiotransferase
                     RimO"
                     /protein_id="ASM98127.1"
                     /translation="MTVQTFTPNQTTTLDTAKKTIEQQSQELTPSGGNKIGFVSLGCP
                     KNLVDSERILTQLRTEGYDIVNSYHDSDVVIVNTCGFIDSAVQESLDTIGEALKENGK
                     VIVTGCLGAREDEIREVHPGVLGITGPHAYENVLEHVHQFAPKPEHNPFTSLVPDHGV
                     KLTPKHYAYLKISEGCNHRCTFCIIPSMRGDLVSRPVGEILSEAERLKNAGVKELLVI
                     SQDTSAYGVDSKHSLGFANGSPVRQNIKALSEELGKMGIWVRLHYVYPYPHVDDLIPL
                     MAEGKILPYLDIPFQHASPNVLKAMKRPGRAERTLDQIKKWREICPELVIRSTFIVGF
                     PGETDEDFEMLLEWLKEAQLDRVGCFKYSPVEGAAANDIDDQISEEVKQERFDRFMLV
                     QQEISAAKLQKRIGSTMKVIIDEVDEEGAIGRSYADAPEIDGLVYLNGETSLKAGELV
                     DVLIEHADEYDLWGALVRA"
     gene            complement(359906..361909)
                     /locus_tag="AOT11_01425"
     CDS             complement(359906..361909)
                     /locus_tag="AOT11_01425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98128.1"
                     /translation="MKRFWWSIVLIGLFAKDALSMTLTIANKIRLGFAICLLFFIVAS
                     YVSYQGMVNTASNFRHYGELAGETTLAGEIQANFLKVRLSADKYLANLENSHLSTYQQ
                     RVQKITKMIQDDIARTDDDKHRAYLDKALAEVKHFDHTFGQLKQNVEQVDKAIYQDMV
                     KVEKQALHDLEAILDNAHRSLKPEVEYYAALLMENFLLANLAVLNYVHKENEESFQQV
                     RVTLSETLPQLEEQFRTVIESEEQKALLQAFVQQRALFIKAFDHTVMLKNQQNGHRKK
                     LAEYGELLSSDLEALKLLSIEEQTQLTAELQEKKKQTIEVILGLAVAAVVIGIACAYT
                     VASSIGKGIRKVKRISTELSKGNLSIEVLVEGKDEIGELLANMRETILSLRDIVDKVN
                     LSCYKVAQMSEELSAITNTTSHSSNALNSEMEQISASVQQLSTSTTEIAQSATDSASF
                     AQRATHNVSQGLDEVHKTLDAIEKAEHEMAGSSKQIGDLYQESMDIGSILEVIHGVAE
                     QTNLLALNAAIEAARAGEQGRGFAVVADEVRSLAKRTQEATAQIETMIGSLQHGAEEA
                     KNSIDQSHYTVTGAAQQAQSTTSNLENIQTLIEELNDTNTQIAAAVEEQSMVTANVSE
                     SVTETYNITRDNNEAVKNIAESAQELAVVAQDLETQMKRFKTA"
     gene            complement(361976..364195)
                     /locus_tag="AOT11_01430"
     CDS             complement(361976..364195)
                     /locus_tag="AOT11_01430"
                     /EC_number="2.4.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791428.1"
                     /note="catalyzes the transfer of a segment of a
                     1,4-alpha-D-glucan chain to a primary hydroxy group in a
                     similar glucan chain; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen branching protein"
                     /protein_id="ASM98129.1"
                     /translation="MFTTLAVWRGKKGLKKLVKSKVNQMFEKLSQAACSEPFAFLGPF
                     IDPTQGALRVWMPGATGVALVLEGQPRIALEREKESAFILKADLNLHLTHYQLAIDWN
                     GVEQLVDDPYQYHGIYAEYDDLHTPKTMYQHMGSQFMTLERDGKSISGIRFLVYAPHA
                     TAVSLVGCFNDWDGRRHPMQRLDYGIWGLFIPALTEGVSYKFEMKGPKGEGLPHKADP
                     WGFYAEQYPSFASVTYDHARYQWQDDQWQTRPVTEKRKEALSFYELHAGSWKRNEQRE
                     FLNYRELAAELVPYLVDMGYTHVELMPVSEHPFYGSWGYQPVGLFAPTSRYGSPDDFK
                     FFVDACHQAGIGVVLDWVPAHFPSDDHGLANFDGTPLFHDPDPRRGWHQDWNSFIYDL
                     GREQVRRFLVSNALYWFEQFHIDGIRVDAVASMLYLDYSRSHGQWIPNMDGGNENYDA
                     IATLKWMNEEVYKYFPNAMTIAEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYI
                     KEEPVHRKYHHNTLTFPLVYAHSENYVLSLSHDEVVYGKGSIHNKMPGDEWQQTANLR
                     AYFGYMYGQPGKKLNFMGAEIGQTAEWNHDDQLQWFLLDFPRHQGVQALTRDLNHLYR
                     NQAALHDQDCIPAGFEWRLQDAAEQSIIAHERISEAGERILVVSNFTPVPRDEFRLGV
                     PNKGRYQLLLNTDDSKYAGSGYEVVVEAKSEAVVSEDLAQSIVLRLPPLSTLFYKLV"
     gene            complement(364391..366571)
                     /locus_tag="AOT11_01435"
     CDS             complement(364391..366571)
                     /locus_tag="AOT11_01435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005374838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="ASM98130.1"
                     /translation="MKEQTALKKVAEMARLADSYVSAWGDEALVSEETLRRLLNSLGY
                     DTSSDEKLLASAEKKHKKDVLAPVLVLRDGDPVEVELNLGTSARESEFNWRLETEQGE
                     VLEGYLQSQIVRDERAEGGPLVFALPKDLAWGYHKLYVSRKRRKAPYEMALIITPRAC
                     FKQDSLELNKKLWGPSIQLYTLRTQHNWGIGDFGDLKLLVSDIASRGGDFIGLNPIHS
                     LFPANPEGASPYSPSSRRWLNILYIDVSSVPEFALSALAQQKVGSAEFQQRLQKARES
                     HWVNYTEVAELKMSVLPLLFAEFKTRHLDKNSDRAREFLEFVEEGGDSLVHQAAFDAL
                     HADLHAQDSNVWGWPVFPEQYRRFDSAATQKFIKDNQEKVHLYMYLQWIADGQIKEAQ
                     ALAEEKGMSVGLYRDLAVGVADSGSETWADNGNLVLDASIGAPPDILGPLGQNWGLPP
                     LNPEVLQATGYDAYIKLLRANMKHCGALRIDHVLGLLRLWWIPKGEKATEGAYLYYPV
                     EDMLAILALESHRHQCSVIGEDLGTVPDEIVDILRDAGVHSYKVFFFETSKEDGGFIS
                     PKHYADQSMAALCTHDMPTLRGFWHCDDLKMGREIGLYPNEEQLNGLFDDRLKCKQGI
                     LDSVRWHGYLPEGIGHDAQYVPMDAHLSEALQLHVAAGSSALLSVQLEDWLQMDNPVN
                     IPGTVDEYPNWRRKLSMNLEEIFSREDVNRIARRLTEVRAQASK"
     gene            complement(366684..369137)
                     /locus_tag="AOT11_01440"
     CDS             complement(366684..369137)
                     /locus_tag="AOT11_01440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltodextrin phosphorylase"
                     /protein_id="ASM98131.1"
                     /translation="MKPTQQKQFDKVSFQESVKKHLSATYAHTLENADSRAWYLAMGR
                     ALAELTTFDLLATETDKKIVEAKSVNYLSLEFLIGRLTGNNLISMGLYEQITEAMAEL
                     GQNLTDLLEEERDPSLGNGGLGRLAACFMDSLAAQEFPTVGYGLHYEYGLFKQSFEAG
                     RQKEAPDAWRGVEGYPWEVARPELAQEIGFYGHVEVINEGGKERRQWVPGMHVKAMPW
                     DLPIVGYESETVYPLRLWECQAIAPFSLESFNNGNYFEAQHALIDAGNITKVLYPNDN
                     HEKGKTLRLMQQYFHSAASVRDILRRHEAAGHTLASLPNFETIQLNDTHPTIAIPELM
                     RILIDEKGLNWDEAWAISSKTFAYTNHTLLPEALETWSESLIQHLLPRHMEIIYEINH
                     RFLQEVRAKWPGDVAKQQKLSIIQEGFHRMVRMANLCVIGSYAVNGVAALHSELVKRD
                     LFPEFDELYPTRLQNVTNGVTPRRWLKFCNPGLSALISEKIGTDWPAHLEQLEGVAKF
                     ADDAKFQKEYMAVKKANKERLANWVKENMNIDLDTNAIFDVQIKRLHEYKRQHLNMLH
                     ILSLYHRLLNDANFDMAPRVVFFAAKAAPGYHLAKEIIFALNKIAEKINNDPRIGNKL
                     KVVFIPDYRVSMAEIIIPAADVSEQISTAGKEASGTGNMKMALNGALTIGTMDGANVE
                     IREEVGDDNIYIFGLEVDGVEALKAKGYNPFDYYNADPLLKASMDLLLGEEFTPGQPG
                     LLRATFDSLLDGGDPYLCLADFASYVKAHEAMDKQYRDQAGWAKKAILNTALVGKFSS
                     DRSIRDYVNNIWKLEAVHR"
     gene            369693..372401
                     /locus_tag="AOT11_01445"
     CDS             369693..372401
                     /locus_tag="AOT11_01445"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87FQ5.1"
                     /note="Positively regulates the transcription of the
                     maltose regulon whose gene products are responsible for
                     uptake and catabolism of malto-oligosaccharides; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator MalT"
                     /protein_id="ASM98132.1"
                     /translation="MWIPSKLTRPGRLHNAIVRPRVLELLQQAPYYKLVLFRSPAGYG
                     KTTMAAQWLADKTNVGWYSIDDSDNDGFRFINYLLQALNKATNGNCNNAQKLAEKRQF
                     SSLRSLFSDVFAEMVDFHQECYVVLDDYHVINNEEVHEAMRFFLKHMPDNLTLVVTSR
                     ANPPLGTANLRVRDLMIEIGNEMLAFDTEETTRFFNQRVADGIDEDTANNLRNYVEGW
                     PSALQLIALQAQHQKRTLAQSAESVSQFNHAHLWDYLVEEVFDLLDADTRKFLMQVSV
                     LDHFNDELVYALTQREDALGMIESLNRYGLFIYPLEGEQNWFRFHNLFGEFLSHERQA
                     RIPQQEQELNRNAAIAWLKQKSPHQAIRHAQKAYDGELVAEILNEFGWKMFNQGELST
                     LESAINLLEKDLLFSNPKLTMLRAWLAQSQHRYNQVGTLLAEAENEHKKRNIDLDIQY
                     QGQANALLAQVAINSNDPEKALELAELALSQLDSTVYRSRIVATSVVGEVNHVIGRLD
                     RALPMMQQTEKLARQYQVYHQALWAILQQSEILIAQGYVQAAFELQDSAFRLIEEQQL
                     QHVPLHEFLLRVRAQVLWCWNRLDEAEECAYKGLQILENHAPSKHLHSYSMLARIAIG
                     RGELDRAGKFIEHIQHLMKQSTYHVDWTANASLSLILYWQAKGKLNAIQEWLDTAVRP
                     ENACNHFCQLQWRNIARAHINLGQYDQARQALDFLQSEAEKANLVTDRNRNLIIEAIF
                     AVHQKDENQAKVLLKEALQLTNQTGMVGNFLIDGATIGNLLEKLTNRHELGDLERHRA
                     LQLMKDISSNQRSRSVHFDEEFVEKLVTHPNVPELVRTSPLTQREWQVLGLIYSGFSN
                     EQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAVTTAENLLQLMGY"
     gene            372722..373759
                     /locus_tag="AOT11_01450"
     CDS             372722..373759
                     /locus_tag="AOT11_01450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98133.1"
                     /translation="MNIRTKPHHKFSLYMGDNRSDYSECEIDSIQFNIHNFDMYTSNS
                     TYIQNYAASDDIFYRIASAILLHWSRPAIQYLIGSASELAKMHWAIHCQPNQTIEVDY
                     FTQRLQVTTVEKQHDYNSYDSLIHWLDGASMAILADNPQAKAQINAVPAHEISRKTDL
                     TDFRPIEQDFFHLFKAFLFGEQNKEQQAALLQAVVPYLTSELIAEKGHPYWMDYYEFL
                     IFPLYSLIAISWGFEATPLDQAVEASIEANYQWYAYFAEQNGGKTGEESLHLNDRSCL
                     FHNILTAFLKVHYQQTGETPSFDSLYTPMWLIKGEGPSFEALKANPPEFTVESVLAES
                     LGCKGNKHSSL"
     gene            373779..374786
                     /locus_tag="AOT11_01455"
     CDS             373779..374786
                     /locus_tag="AOT11_01455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98134.1"
                     /translation="MNTLLKPHHKFTYYMIENRTDYTIWGIEDIHFYRASFEKNSSNS
                     TYIQNHAASATVYHAIARAILLHWSRPAIQYLIGSASELAKMHWAIHCQPNQTIEVDY
                     FTQRLQVTTVEKQHDYNSYDSLVHWLDGASMAILADNPQAKAQLNAVPAHEISRKTDL
                     TDFRPIEQDFFHLFKAFLFGEQNKEQQAALLQTVVPYLTSELIAEAEKGEPYWMNYYE
                     FLIFPLYSLIAISWGFEATPLDQAVEASIEANYQWYAYFAEQNGGKTGEESLHLNDRS
                     CLFHNILTAFLKVHYQQTGETPSFDSLYAPMWLIKGEGLSFEALKANPPEFTVESVLA
                     E"
     gene            complement(374876..376450)
                     /locus_tag="AOT11_01460"
     CDS             complement(374876..376450)
                     /locus_tag="AOT11_01460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclomaltodextrin glucanotransferase"
                     /protein_id="ASM98135.1"
                     /translation="MDEHFGTLDDFKELTAKMHSAEYNMKLVLDYAPNHSNGNDENEY
                     GALYRDGKYITDYNADVAAGTNWYHHNGGVTDWNNWYQVRNHNLFNLSDLNQSDESVY
                     QYLLDGSKCWIDAGVDAIRIDAIKHMDKSFIQQWTTDIYNYSKTLGREGFYFFGEWFG
                     ASANTTTGIDGYAIDYANSSGSALLDFGFRDTMERVLANRPGNSMKTLNNYLETRKSV
                     FTSDDWQVVFMDNHDMARISTALRSDASTFGPGNNESGGNQTEAFAKQRVNLGLVATM
                     TVRGIPAIYYGTEHYTANFTQNAFGQVGSDPYNREKMPSFNQDTDAFKIIQALTALRK
                     KSLAIQRGSYTQRWVNDDVLVYERQEGDDVVTVALNRGPATSITVSNLSLKDGSHISL
                     IGDESINVSGGQATFHLAQNQAVVLHATGSGSIDPTLKSVTFTCYNGYTNLGQSVYAV
                     GSVAQLGNWAASGAVKLDPAQYPTWGATISVPAAQNIEWKCLKRDETNPALNVVWQSG
                     ANNKLSSSSNATQGAF"
     gene            complement(376577..376846)
                     /locus_tag="AOT11_01465"
     CDS             complement(376577..376846)
                     /locus_tag="AOT11_01465"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98136.1"
                     /translation="MKKRTLLCSALLAAIAANGLFSSPTVLANTSTQAEPGSFLDFRQ
                     ETIYFVFLDRFSDGDASNNAGRNPATYDPNNLKKYVGGDLRGLIN"
     gene            complement(376885..378015)
                     /locus_tag="AOT11_01470"
     CDS             complement(376885..378015)
                     /locus_tag="AOT11_01470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ASM98137.1"
                     /translation="MATVSLRKVEKKYENGFKAVHGIDLEIHEGEFMVFVGPSGCAKS
                     TTLRMIAGLESISGGEIRIGNQVVNDLPPKDRGIAMVFQNYALYPHKTVFDNMAFGLK
                     MQKRPKDEIKRRVEEAAEKLEITDLLYRKPKEMSGGQRQRVAVGRAIVRKPDVFLFDE
                     PLSNLDAKLRVSMRVKIAQLHQSLKEEGNPATMIYVTHDQTEALTLGDRICVLNQGKI
                     MQVDTPANLYNFPANKFVASFIGSPAMNLIDTVIREENGQLYIEIGNEIRMFIPVEKQ
                     KLLSEYIDKPVCFGIRPEHIRVAAPGDKINAVEGILTVVENMGNEKYLYFKVGGKELI
                     ARVNDQTITTADIGKPMRFNLNTAFCHIFDFYSEKNLTNIRE"
     gene            complement(378137..378625)
                     /locus_tag="AOT11_01475"
     CDS             complement(378137..378625)
                     /locus_tag="AOT11_01475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosidase"
                     /protein_id="ASM98138.1"
                     /translation="MKRTFLIAAVTATVLAGCASTSPEQAAPELTNVDARFSDCRLPT
                     LESERGPIKPSLFVVGTFPDGQWIHMDNRKMGYKGDGIYQVVSEEKAGNVSLQFATMS
                     WTPQFTVSGMEMAVGQLKELKRGGFAKNTVVYLPKDAKYLWTIQLSPDKKPQWAMVME
                     CQ"
     gene            complement(378713..379723)
                     /locus_tag="AOT11_01480"
     CDS             complement(378713..379723)
                     /locus_tag="AOT11_01480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
                     N-acyltransferase"
                     /protein_id="ASM98139.1"
                     /translation="MLTVLEIAQCLSGRIEGDRSIIVDTIRPIQSQQTGGLAVVFARS
                     DLKWVSKSQADVLVGPEAILQSSAKAHVVIEQLEVDKLNQLLRYYKVHKYQLFDQENT
                     STIEGVYIGKHCHIGQGCHFMPGVRIMNGVTIGNNVAIHANTVIKEGTVIGNNVTIDS
                     NNSIGNYSFEYMSGKDGQYQRVESVGRVVIEDDVEIGCNNTIDRGTLGDTIIGQGSKI
                     DNQVQIGHDCRLGKHCLIVSQCGFAGHTIMGDHVVAHGQVGTAGHIIIGSHSVIKAKS
                     GVSHSFPAGSDLFGYPAKESKAYYRNLAVLNKITQQYEHMKASRPEQKRWFARLFDKK
                     SA"
     gene            complement(379757..380794)
                     /locus_tag="AOT11_01485"
     CDS             complement(379757..380794)
                     /locus_tag="AOT11_01485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="ASM98140.1"
                     /translation="MKRTLISVSVATALALSSSSVVAASGRGLDAENSFFDEALQFGG
                     HIGTSIEYEDKVTDGFNGNKKKEKTTTNEVFGIYYNNARWNLTALYSLKTQDRSQVEP
                     GYHENEDGMKHLVSLNKGFDLSNGWATGVIYDLEFTKSKVYSPYVTGLRKELAEHSLR
                     PYLTYFNNDYNWGFYSNLEYLYSKEDKSAWGERIEEGYSILFKPYKRLGSWELGVEFY
                     YQIKDNEDRQASGGINEISDFTEKYIEPIVQYSFDDAGVLYARVRVGENETNNAANSG
                     GGNANVDYFKDIRKATLGYEQAVGDNWLLKGEYEYANEIEEKSKLAGWEAKNESELKQ
                     HTLYLQALYRF"
     gene            381196..382425
                     /locus_tag="AOT11_01490"
     CDS             381196..382425
                     /locus_tag="AOT11_01490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="ASM98141.1"
                     /translation="MNKTWIKAALITSLFGLPVVSHAQEIAPESGADLLVWTDTTTLD
                     YMKYAAESFNQDFGYNVKFSFRGLAPIDAASRMIQDGGSARVADIAEIEHDLLGRLVV
                     AGGAMENLVSAARIKSTFLPNATSAAEYAGASYGFPVSYATLALFYNKELLPNAPKTF
                     EEIIAFGKAFNNAKENKYALLWDIQNYYESRMFLTLYGAYEFGQNGTDAKDLGINSPL
                     ALQGMEAMKSLKAANNSNPVDMRNPQVRRGLFGEGKVAAIIDGPWAIQSYDSSNVNYG
                     VVPIPTFEGQQPRTFSTVRLAVVSSYSEYPQAAQLFADYLSSDKMLMKRYEMTKSIPP
                     VQALMEKIIVDANEATYAIIAQGFYSDAMPSIPEMGYLWSPMASAITAMWVNDQSPKK
                     VLDHAKAIIEEQIAFQE"
     gene            382428..383711
                     /locus_tag="AOT11_01495"
     CDS             382428..383711
                     /locus_tag="AOT11_01495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000927283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="ASM98142.1"
                     /translation="MLLSQNIKIPTLHSSWLIMGATQLANRHWVKGAILLTIQCTFIV
                     YLPDMASALKGLITLGDVAQTRQGFKVIQGDNSIFMLVEGVIATLFLFLFLVIYFMNV
                     RDAKQCRVSHLSVAQQAKSIYEEKFAFIVLSPAFVASIAFIIMPIAITVLVSFTNYSS
                     PHHIPPRNLVDWVGFKNFLTLFELKIWSSTFVGVATWTVIWAIAATVCTCGFGFVLAL
                     ALENRNIKAKKLWRFIFILPYAIPAFVTLLMFRLLLNGIGPINATLNSWGFESVAFLS
                     DPFLAKLTVIAVSVWVGAPYFMLLIAGALTNIPRDIYEASEVDGASKFQQFREVTLPM
                     VLHQVAPSLVMTFAHNFNNFGAIFLLTEGGPINPEYRFAGHTDILITWIYKLTLDFQQ
                     YQIASVISIVIFLFLSVIAIWQFRRMKSFKDDVGM"
     gene            383714..384547
                     /locus_tag="AOT11_01500"
     CDS             383714..384547
                     /locus_tag="AOT11_01500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter permease"
                     /protein_id="ASM98143.1"
                     /translation="MSRVLEKLGTVIVYLFLTLNALLVLGPVLWTILASFKPGNNLFS
                     SSFGEWAFTLDHYQTLFTDTPYLDWYKNTFMLATANMLISLVIVTMTAFVFSRYRFQG
                     KRNVLMSILVLQMFPAFLSMTAIYILLSKMGLIDTYLGLLFVYVTGSLPFMTWLVKGY
                     FDAIPTSLDEAAKIDGAGHMTIFLEIILPLAKPILVFVALVSFTGPWMDFILPTLILR
                     SEEKMTLAIGIFSWISSNSAENFTLFAAGSLLVAVPITLLFVATQKHITTGLVSGAVK
                     E"
     gene            384562..386340
                     /locus_tag="AOT11_01505"
     CDS             384562..386340
                     /locus_tag="AOT11_01505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclomaltodextrinase"
                     /protein_id="ASM98144.1"
                     /translation="MITRSSLTHLAKSADSYAYNNETLHIRFRSAKNEIDRVTLWIGD
                     PYQWAEGGLDGGNLGGSDAHGWIGGTEVNMVLEGQTEHHDHWFAEFSPPKKRARYGFI
                     LYGKHGEKLLFGEKRCVDIHAPRDAERELSNLSNFFCFPFINPKDVLKTPDWVRNTIW
                     YQIFPERFCNGRPEVSPSDVQPWGSEPKSDNFMGGDLWGVIDKLDYLQELGVNGLYFC
                     PIFTANANHKYDTVDYYNVDPHFGGNEAFRALVKQAHSRGMKVMLDAVFNHIGDQSPL
                     WLDVVKKGQQSAYADWFWIKQFPVYPDKPKSQWDYSNLNYETFGNVAEMPKLNTENPD
                     CRAYLLDVARHWVEEFDIDGWRLDVANEVDHAFWRDFRQVVKEIKPNCYILGEIWHEG
                     MPWLRGDQYDSLMNYPLTQAITDFFALGADDKTTFMNAVTRAYLAYPRNVNEAMFNLL
                     ESHDTTRLLSLCGNDKRKAKLAYLFMFSQVGSPCLYYGGEIGMDGKRGMGLELNRKCM
                     TWDNNEQDLEFKAFIQQLITWRKTNPEWNAPDLCWLNINHPDIISYQRGDSQFFLNNS
                     DCYVEVMFEEQTISLSPYGYLLLTVS"
     gene            386346..387239
                     /locus_tag="AOT11_01510"
     CDS             386346..387239
                     /locus_tag="AOT11_01510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family transcriptional regulator"
                     /protein_id="ASM98145.1"
                     /translation="MIKLGLSLDSHWIRGVLLDNQNVLYRTQVRTPSTPLQAASTLSY
                     MTANMQRMFGSISMAGLNVMEDCWKDEFTLTANNNLPRVLAQSLPVPCSQMSSAIIAL
                     SQVSHLPKGNILSAVLDDSCELCMTTNQNDEQWIGNTLQLSWAHKPLKNYQSLIDGLT
                     PLCCCGSDECHRQYLTQKGIERQYHQLSLRTLGYQDILQNVANQQSWAIRIYRIWIDQ
                     LARALTEPILRFQPSLLLLSGSLIQNDDLALNLKSTLSRHCAIDYSLNIQCLPVDEYR
                     FAHGAASMCDINPRQVSTFTA"
     gene            387295..388101
                     /locus_tag="AOT11_01515"
     CDS             387295..388101
                     /locus_tag="AOT11_01515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TrmB family transcriptional regulator"
                     /protein_id="ASM98146.1"
                     /translation="MTELVTKLMDFGFTKTDALVYINLLKNGRASGYKIAKEIGLSRS
                     SVYSSIDNLYKNGCIFMSDGETKEYEAKSPDLIFNQIEKKTIENIQILKKELSRMMLQ
                     EEKEFIYNVTGFENLLQKAREMLNLAQVEIYLNTDFHLELLSEEISQAIERGVRVIVF
                     SFNRLAIPHPKVELYSRSEQSEKRYPSHRFMLVVDMKQAMMFSHRQETQGLYSNNRLI
                     VKMMAEHIHSDIYLTEYEKLDPEKRCRIATIHELENDMVVDDRQQVHIPS"
     gene            complement(388282..388497)
                     /locus_tag="AOT11_01520"
     CDS             complement(388282..388497)
                     /locus_tag="AOT11_01520"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98147.1"
                     /translation="MDITLLAFEQWSRFLSFIFIVQNLSATVFTMAICIVICKMLLQN
                     AKIILARVNIWDIQPKNSPFKVGMINA"
     gene            388519..389487
                     /locus_tag="AOT11_01525"
     CDS             388519..389487
                     /locus_tag="AOT11_01525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98148.1"
                     /translation="MNLGILAALLFYDFYDMNYLFTFLKGLAMGAADVVPGVSGGTIA
                     FITGIYDTLLESIRRINPGVIKIWRAEGFKAAFNHINGFFLIALFGGVLTSIATLAKL
                     ITWLLANHPIPIWSFFFGLILVSVYHILKQVEKKDLTRFALLFLGIAFAYSITVLKPL
                     HLEPTSINVLIAGAIAICAMILPGISGSFILLLIGMYAPVLGAVKSFQVDILALFLVG
                     CVTGLLTFSHVLSWLLRKFRDFTLMFLTGLMIGTLPKIWPWKETISWRLNSKGEQVPL
                     VQHNLSPFEFEALTSQPSQWVMAIIMALVAIALVLGLEKFAEANAK"
     gene            389623..390066
                     /locus_tag="AOT11_01530"
     CDS             389623..390066
                     /locus_tag="AOT11_01530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98149.1"
                     /translation="MNNILKIIAFILALSGGFFAKDIVQLFSSDTTAVTQSAPKLEDY
                     CMLSTQACTQQAVSMTLSNDTAQPLVASEVRVEWPSSKEPQLVLTLSGLEMDMGKPKF
                     VLKQTSPGHYSGEVILPVCTTDAMTWLGELTDGTTTVYPAIRMQR"
     gene            390063..390662
                     /locus_tag="AOT11_01535"
     CDS             390063..390662
                     /locus_tag="AOT11_01535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="photosynthetic protein synthase I"
                     /protein_id="ASM98150.1"
                     /translation="MSKNWSLFLVVAFVLGFALKSYLDLQGKVENEATPPTHSAAMLY
                     GQDGQAVNIFDTEDTRIRVVYFGFTRCPDVCPTSLAMLSGALNELDDATKAKLRPLFI
                     SLDPERDDAKLSAQYAHYFHPMIEGLSSSLEVTTELAKRYGVIFRKTELKDSELKYTL
                     DHSSYFYFLQPDGTLITKVPHTLTPAPIVEAIKTITQGN"
     gene            390664..391113
                     /locus_tag="AOT11_01540"
     CDS             390664..391113
                     /locus_tag="AOT11_01540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98151.1"
                     /translation="MKLKALALAALLVSPLVSAQMDLMAHHPYARAMAPGAVNSAVFV
                     ELMNRSDNVRTIVAAETPAAGKVELHDVIKEGDVMKMRQVESIEIPAKGKTVLKPGSL
                     HIMLFDLKAPLNEGEQIDVTVTFANGEKMTFQAPVKKVMKGMQHSGH"
     gene            391426..392487
                     /locus_tag="AOT11_01545"
     CDS             391426..392487
                     /locus_tag="AOT11_01545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase RsgA"
                     /protein_id="ASM98152.1"
                     /translation="MNNTMTSSQPYTLTQLGWKPFFQQQLTLEDYENTQICRVIAHHR
                     SGYQLCSEQGRFHLAIHHAQPKMTVGDWVLLDDQQQFKRLLERQSELSRKAAGSKIAE
                     QLIATNVDTLFIVCSLNDDFNLSRIERYLSIAKEAHIEPVVVLTKADLSQQAEQNITQ
                     VKQLSAALWVEAVNALDPASVAALQPWCAKGRTVAFIGSSGVGKSTLTNTLLGVETQQ
                     TGGIREDDSKGRHTTTARSVHMIPDGALIIDTPGMRELQLADCREGVSETFAEIETLA
                     QHCRFKDCQHQQEPGCAVQQAIDCGTLEARRLQNYFKLQREQAYNASTFAEQRSRMKQ
                     FGKMCRHIQSDKQKLKTTY"
     gene            392814..394034
                     /locus_tag="AOT11_01550"
     CDS             392814..394034
                     /locus_tag="AOT11_01550"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MGA3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="ASM98153.1"
                     /translation="MQHNSLIARFARGNLVIQILVGIILGISLALVSPSSAESVGMLG
                     SLFVGALKAIAPILVFILVAASIANQKKNQHTHMRPIIVMYLAGTFFAALTAVVLSFM
                     FPTTLTLVTGAEGANPPQGIMEVIKTLLFKLVDNPVNALMSANYIGILAWGVGLGLAL
                     HHASDTTKAVFEDLSHSVSHIVRFIIRLAPFGIFGLVASTFATTGFDALAGYAHLLVV
                     LLSAMAIIALIVNPAMVYAKTKQNPYPLVFQCLRESGVTAFFTRSSAANIPVNMSLCE
                     KLKLDEDTYSVSIPLGATINMAGAAITITTLTLAAVHTMGIEVDLMTALLLSVVAAVS
                     ACGASGVAGGSLLLIPLACGLFGISNDIAMQVVAVGFIIGVIQDSAETALNSSTDVVF
                     TAAVCESEAQKAKG"
     gene            complement(394088..394960)
                     /locus_tag="AOT11_01555"
     CDS             complement(394088..394960)
                     /locus_tag="AOT11_01555"
                     /EC_number="2.7.1.35"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D4Q2.1"
                     /note="catalyzes the formation of pyridoxal 5'-phosphate
                     from pyridoxal; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine kinase"
                     /protein_id="ASM98154.1"
                     /translation="MQGILSIQSHVAYGHAGNSSAVFPMQRMGFEVWPIHTVQFSNHT
                     QYQEGWTGRAFSADDISELVRGLNNIGALEKCQAVLTGYQGSAEQCLAVEETVTKVKQ
                     ANPEALYVCDPVMGAPDKGCIVAPGIAENLLNRLMPMADVIVPNQFELSQFAEMEIHT
                     LDDAFNACQRALVKGPKVVLVKHLYCLSDDSFNMLLATQEGTYLAKRPHFEFAKAPVG
                     AGDLISAIFTAGLLKGWTPKQAFQHCHDACYGVLNATYQAGEWELQTIAAQQEFVEPS
                     KHFPLEEVTLKTVE"
     gene            complement(395325..396635)
                     /gene="potE"
                     /locus_tag="AOT11_01560"
     CDS             complement(395325..396635)
                     /gene="potE"
                     /locus_tag="AOT11_01560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421711.1"
                     /note="catalyzes the uptake of putrescine via a proton
                     symport mechanism, as well as the efflux of putrescine by
                     a putrescine/ornithine antiport system; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine-ornithine antiporter"
                     /protein_id="ASM98155.1"
                     /translation="MSTETKKMSVVQLTILTFINMAGSGIIMLPSKLAQVGTISILSW
                     LITAAGSLALAYVFAKCGRFSKRDGGMNGYASYAFGKSGAFMAGWTYGLSLLIANIAI
                     AITCVGYGSAFFEVTLSPVETCLYTIAILWICTFANFGGAKITGQIGSFTVWGVILPV
                     CSLGIVGWFWFNPTMYVEAWNPHHLPFGEAVSASIAMTLWAFLGLESACANSDAVDNP
                     EKNVPIAVLGGTLIAAVVYIVSTNICSGIVANADLAASTAPFSTVWTVMLGSTAGKMV
                     AGMAVLACAGSLLGWQFTIASVFKSSSDAGFFPKLFSEVDKRGTPIKGMVAITVIQSV
                     LSLMTISPTLNEQFEALVNLAVVTNVIPYILCMGAIFIMQQVAHVPEREMKTTNIIAL
                     VGSLYSFYALYGSGYEAMMWGSIVTFLGWSAYGLIAAKHEPLAN"
     gene            complement(396701..398881)
                     /locus_tag="AOT11_01565"
     CDS             complement(396701..398881)
                     /locus_tag="AOT11_01565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine decarboxylase"
                     /protein_id="ASM98156.1"
                     /translation="MKRLVIGVSNYMPEDFSLLAESLDEQFNRHLHPLEQVELTDVGA
                     AIITSADIKAGLHKVISETGYGIPVFLVTDATPVSAEDYVWLTGVIDLERQSIEYYSR
                     QINEAVTKYECRLLPPFFKQLTHYVEMGNSAFDCPGHQGGQFFKKHPAGKQFYDFFGE
                     NLFRSDLCNADVDLGDLLIHEGSAHQAQAHAAKVFNSDKTYFVLNGTSASNKVVCNAL
                     VTEGDLVMFDRNNHKSNHHGALIQAGGTPVYLETARNPWGFIGGMDEHCFDEEYIRAQ
                     IAKVSPERARDTRPFRLAIIQLGTYDGTIYNARYVMDKIGHLCDYILFDSAWVGYEQF
                     IPMMKDCSPLLLDLKPEDAGVIVTQSVHKQQAGFSQTSQIHKKDHHIKGQARYCNHKR
                     FNNAFMMHASTSPFYALFSALDVNAKIHDGEAGLRLWRDAVKTGIEARKEILKSCELI
                     RPFIPDQVDGQPWGSYDTDVIATNKKFFMFEPNASWHKFEGYGEGQYFVDPCKLLLTT
                     AGIAEDGSYADFGIPATLLANFLRENGIIPEKCDLNSILFLLTPAEDMGKIRHLVAQI
                     NRFEKFIRDDAPLNIVLPRVYEANKERYRGYTIRQLCQEMHDMYKELNVKQLQKAMFR
                     SEYFPTMVHKPDVATRKYFRGECDYLPLKEAVGRVAAEGALPYPPGIICVITGEIWTQ
                     QVVDYFLSLEEGINRFPGFAPEIQGVYLEDVNGRTTAHCYALKD"
     gene            complement(399294..399803)
                     /locus_tag="AOT11_01570"
     CDS             complement(399294..399803)
                     /locus_tag="AOT11_01570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98157.1"
                     /translation="MHVSTMNRVQRTRFIIIRDLCMLRIISADKFISSRFILEYSKVE
                     FASLLGVSVAKITNIESGKSSIPPVYDYAINYLLSEHPFKESAMEALCSHETLNFARR
                     IDTNNKVQRLSCKRCDSRRLHVMAGMSGLYFVECMDCKHTMYSSGIAVKRYLQWSNNG
                     VKLDSHLFN"
     gene            complement(399930..400193)
                     /locus_tag="AOT11_01575"
     CDS             complement(399930..400193)
                     /locus_tag="AOT11_01575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98158.1"
                     /translation="MVHDGCMGAIQMAMVAECWQTIARHFLTSLLVIYSHRQQHWLRV
                     IDDGENYVKRGGFPLYKMQCLMLNKWKYLTILWFFFICISENI"
     gene            400583..404194
                     /locus_tag="AOT11_01580"
     CDS             400583..404194
                     /locus_tag="AOT11_01580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017789925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion protein"
                     /protein_id="ASM98159.1"
                     /translation="MNKQPFNLSLLAKAIMPIMATSLLIGCNSSNDGETANPQPDTGK
                     VARVYFKASETATRAAADSSAYDKATLYVWNNDTCGGYAETDEGHDDWGTGIKPTGVD
                     DKFGAYWDLQVRSEATQCINFIPRVGNDKPLGEFDAKLDLTQTGKNNAVYTQQGVAAV
                     YPELISTSDIPANTARVYMNTPDGDEGHFTLHVWNNDTCGAFDGNDTSWPGMEPTGFS
                     DVYGPYWDLPVKGAEGCINIIPNNKSNGDYQTSDLKFEFDKTTAIGNVAFVFKGTNKV
                     YYTALAQKPVAQVELAGASAIFADDSVILVNAKDATSVTLYYSESGELAFDSASKKVT
                     GATKQITSSKAASADWNKTKPHLSNDFIGFEMDFSGEGNTLKDLLKGQLILVASDATG
                     VIKATEVQPASALDALYAAAATKLSYGAVINPDSTTTFRLWAPTAQSVKLIPYNAEKQ
                     AQTAITMTFDATSGAWVAENTALKHGDFYRYEVTVYHPATDKVETYQVTDPYSLSLSM
                     NSEYSQVVDLANAELKPSGWDALSAPHNQANPAEFVLYEAHIRDFSALDDSTAEANRG
                     KYKAFTQAGAAPVEHLKKLAQSGVTHLHLLPTFDIATINEDPTKVANINQPFAKLCEL
                     DASVKNDADFGNYCDSNETLSTVFETLAKKDSKESAVVQRLNSHVRNLDSFNWGYDPF
                     HYTVPEGSYSSDAEGMVRIKEFREMVMSVKKEIGMNVVMDVVYNHTNESGVSSKSVLD
                     RIVPWYYQRLNEFSGAVEQSTCCSNTAPENQMFAKLIDDSISTWVKEYKIDAFRWDLM
                     GHHPLAQMKQTLAAAKAVDPNVYFYGEGWNFGEVGNDRMFKQATQLNLAGTGIGSFSD
                     RLRDAVRGGGPFDSQDSLRSNQGFGNGIYVQVNEKNEQNAALKTTALHLADLTRLGMA
                     GNLKAFPFTDSKGKAITGAELDYNGQPAGYAQDAWEIQNYVSKHDNQTLWDNNQYKIA
                     YATTAAERTRMQAVGLSTAMLGQGVPFIHMGSELLRSKSMQRDSYDSGDWYNRVDFTK
                     QDNNWNVGLPREDKDGSNWAIIDAVITGSSDHAMPSATDIDNMDKFFNELAALRASSG
                     LFTLGKGSEIIKRVAFHNTGAEQTPGLIVMSIDNSGDKHDATIDAKRDGMVIVVNASP
                     SMVSDFAKFDAAGYTLHAVQTNAGNDSLAKNQDKVAQVVNGKLTVPAWSVAVFEKLR"
     gene            complement(404258..405439)
                     /locus_tag="AOT11_01585"
     CDS             complement(404258..405439)
                     /locus_tag="AOT11_01585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98160.1"
                     /translation="MSMMAVAIGATGLSLLLVFVWMFSLSLRKQRLEQERKAREIANR
                     KAIEKAREQERQERLFKAEGGHIPTILFLAKEAERTNLKEALYWYNKGARLDNVNSMY
                     GIVRMSDRMREDLILKEQANFWRLAIAGLEGSLDAKFEAGKALVHGRGIEKNLPKGYR
                     LIEEAAVQGNLDAMLFMGEWSQSGENPERSNDNAYQWYHKAASKGSVDGQIHLGLSYL
                     AGVGTKTDHAKGTYWLERAAERGSAEAMFHAGEAWRDYGKTGNALAYVWLFLASHFGY
                     EKARAMRDQVATKIGVDIVVGLQAVAKPLLKKLEAGKVGKHAIIKALNKVYKRPSYFP
                     PLEANLDRSDEPLVFEEIDEGLLADTINQEPQPPSAGADSSAGSELDFTQDLFSSQHK
                     P"
     gene            405633..407453
                     /locus_tag="AOT11_01590"
     CDS             405633..407453
                     /locus_tag="AOT11_01590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="ASM98161.1"
                     /translation="MTLQTWDKCEMKKQKFTVYQVFTRLFGNKVQHSRPWGSKEENGV
                     GKFSDFTDLALKEIRQLGISHIWYTGVPHHALVADYQHHGIGHDHPAVVKGRAGSPYA
                     VKDYYSVNPDLADNPAERLSEFAALIERTHRHGMKVIIDIVPNHVARKYHGLNNPEGV
                     RDFGADDDTSVEYHRDNNFYYIPGQAFQLPDFPTPFTPLGGEAHPQLQWPYEEFPAKW
                     TGNGSRLAKPQFDDWYETVKVNYGVRPDGSKDFAELPADFAQKTAAAHFAFWQQQDVP
                     DSWKKFRDIALYWLEFGVDGFRYDMAEMVPVEFWSYLNSHIKMRNPDAFLMAEVYQPH
                     LYRDYIHLGKMDYLYDKVDLYDGLKAVIQNRASTAIIGEIQAQMMDIEHHMLHFLDNH
                     DEQRLASPQFAGDAEFGRPAMLVSALLSSSPTMIYFGQEVGEAGAELGGFGLPSRTSI
                     FDYVGVPEHQKWMNEGQFDGGQLNEKQRALRAFYIRLLNFTLTHSAMSGEYCDLYSTN
                     QQALSHFCHLFARFDSQQLVLAASNFSAHHSNTCQVVLPEALIAQLGLADGQYTLVDK
                     LSDQSSHHASETLQLNVNHGQGRAWLTLPPFAASAWVLEL"
     gene            407680..408858
                     /gene="malE"
                     /locus_tag="AOT11_01595"
     CDS             407680..408858
                     /gene="malE"
                     /locus_tag="AOT11_01595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082122.1"
                     /note="functions in the MalKFGE ABC transporter complex to
                     transport maltose into the cell by using ATP hydrolysis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="ASM98162.1"
                     /translation="MKPIIKTLSVCTLASLMTAPVMAMQEGEITIWINGDKSYQGLTE
                     IGRQFEQDTGVKVIVQHPESLEAKFQQHAATGGGPDIIFWAHDRFGGYAEAGLLYEVK
                     PSKEFKEKLVDFSWDAVTVNGKIVGYPLAIEAPSLIYNKDLLPEPPKTWEELPQIQKQ
                     MQKQGKQAIMWDIKNAYFTWPVISSGGAFAFEKIDGGYNAKSTGVNNQAGIHGLQYLV
                     DMVNQGVLNPDMDYSVAEAAFTKGEAAMTINGPWSWGNLDKLNVNYGVAVLPTLNGGK
                     GNPFVGILSAGINAASPNTDLAVEFLENYLFQDEALKIMNNDKPLGAVTLKSFQTILE
                     SDERIKSTMINAENGEIMPNIPQMTAYWFAEGAAIDNAMQGKQSVKDALDMAAKQITK
                     "
     gene            408920..411700
                     /locus_tag="AOT11_01600"
     CDS             408920..411700
                     /locus_tag="AOT11_01600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen debranching protein"
                     /protein_id="ASM98163.1"
                     /translation="MHTLPTLYLKGTFNGWGLDTPFVPASPQQLQACVVLSADRHQFK
                     IADKDGTAQWTFSAHPTQAIELNEAITQPLIATQGIGNDLVYIPQKTERFTLTLDCSQ
                     PQPSLTITKGANNAEVEVERAQLHSQLIPTCGPTPNAPHREHALAIDTLFDTLAIEEN
                     RRFPFVFGDNVDGYYEGQTHCFVGAGRYRHHQGWYLGGFAAFVDGQLLNKPEACRARL
                     LPYGIEHHYTCHSRDRLSVHSGQRQVALSVQSVEPTTLAIVPELNIALNDCQIKTYGQ
                     CVLIEINPERVPEGAPRFLALSANQAVEAQEVTFEQCPALDYAVHLDGGNCKLRITTS
                     QPSTLLTLYLCFEHDKDAAIQQAQNAAYQHADLQHQHQLYHFLTDNDFYCDDQEYNRA
                     VMWARLASRTFVSHEFGLGIWAGLPWFKDCWGRDTFIALSGTSLINGLFDEAKAIISN
                     FASMQKSDLDNVNHGRIPNRVTSKTNIIYNTTDGTPWMIREIMEYLHYSGDMAFAQQI
                     YPVVQRFIQGVEKHYLDEDGLMSHRDPDTWMDAKINGQIPWSPRGPKANDIQALWFES
                     LQIAEQLALWQGDEAFAQHCHQLATKAQESFVAKFWQPESRCLADCLRHGDEADLSQR
                     PNQLMALTIPMKRNLLAAEIGQHLVKNCVEQLLFPWGICSLTQSHQDFHPYHDNRSEY
                     HKDAAYHNGTIWGWNAGFTVSALCQFGQQDFAYQLSKNLAKQILTQGHRGAMSENLDA
                     FQQDENALVMTGTYAQAWSVSEFARNAQQDYLGFMPRLAEKRMLLHPQLPSRWHKVKA
                     RLPFGQHNALLFTVTRPGNTGQNNTLIYSVKPERVEPEVQLTLVLELEDTQLHLTFPL
                     NEAHSFIVRDGQLKPLAPEVMLTVVDKPHYALLENLSFAQPDWQRKHHALQQQDYLRQ
                     KRMADNLALAED"
     gene            complement(411816..412679)
                     /locus_tag="AOT11_01605"
     CDS             complement(411816..412679)
                     /locus_tag="AOT11_01605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98164.1"
                     /translation="MRNIMKNKHSLLAVVLGALLAGCASDAQVQTELAPPTNAEVCCT
                     EFSQFPYAQLNDKEDIKFDVDLASPVGTFSQGNSHFAAFRFSDRSGDVTVTVSSLMID
                     DSVFAPEVLLLDNQFKVVETFKLADFQILPSDAFTRTRYIERFTTNAEQTPYFVIYTP
                     ADQLGKQVTVDHPAKVRAKEFGEVMPMVTDPVYTHRLGGRVEVQVETLKLRPFRAIDP
                     VKPADVAPAPVVEKAIKAQPESQKFYLSAIEQAVAKGDIPKALSLLDEAKALNIPGAQ
                     EAFVKAVNSKK"
     gene            complement(412743..414026)
                     /locus_tag="AOT11_01610"
     CDS             complement(412743..414026)
                     /locus_tag="AOT11_01610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltoporin"
                     /protein_id="ASM98165.1"
                     /translation="MELRMKKVSLIAAAVASTLAAGTAFAAGTDVVTDGWEVHGYMSS
                     NVRVVDGTTTDTEFGRPDYKTAGTHGKSTNQVEFVVKKHSEYENGVWADYVVRTEFGN
                     GNSYAYSSDGDEAVRDEDGFAVKEAFVELGGILGEDTSIWGGQRYLNRAAGILSGEFW
                     KQSSGIGAGLQTKLGGNTAGIAYVMADPINTFGDKHKTDPRTTLSSLDLYYYGVDAGI
                     GSLDFDLKIGHQSKPGKDDDGFGASVTLNTSYYGLDGWTQTAIAYGKGVMQNRGVNFG
                     SWSGGDDNAESLFLTSYGVWNISDKVQLGTEATYMTALDQLFGAKGLTRYIVAARPSY
                     KLNENVRLEATASYGHEEGDKGYWGRTGDDVESNILNLEVATAFTANSDYFGRPQIKP
                     YISYIKADDEASAKIIGIENGKDQFVFGVHTEIWF"
     gene            414421..416433
                     /locus_tag="AOT11_01615"
     CDS             414421..416433
                     /locus_tag="AOT11_01615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen debranching protein"
                     /protein_id="ASM98166.1"
                     /translation="METELRKITMTTSLARPYPLGVTLHDKGCNFAVHSPDCASIRLA
                     LFDDNNEFKTFELSEEYAGIRYTFVENVQHGQKYGFIIDTDNGPLLLSDPYAKALDGP
                     LHYQTPYSAEKSFSMPKCVVYQDDFDWQGIESPRIPREEIVLFETHVKGLSKLNPEVA
                     PAAQGRYLGLVSDAMLAFYKQQNINTLQLLPVAACMHEPHLLDMGKVNYWGYNPYLFM
                     VPDPRYADTDAILELKTAIRELHRNGIQVILDVVYNHTAEGGAGPTIFNLKGLDSRCY
                     FKHGSHFANFTGCGNTVDLTYQPALNLVMDTLRYWVSEFKVDGFRFDLAATLGRQGDD
                     YSRDAAFFKAVAQDPVLKETKLIAEPWDIGPNGYQVGNFPFGWNECNDKLRDITRSFW
                     RGDQGYLKEFATRLMGSRDIYSAANWPYKLTVNYITYHDGFTMQDLVSYKHKHNEDNG
                     EQNRDGHGDNRSENYGAEGPTENLMIIATREKQKRNFMASLLFAFGIPHILTADVLSH
                     SQKGNNNAYCQDNETSWLNWEYSERKHDFRHWLAQMVENRQRYMVPFIRAFSGPSRNL
                     NRIYWRRVDGVHMEHDDWNRLSAVSLHIGIGEKGDEMVYLINQTSAPARFTLPDDNQQ
                     QWTYICDTNVRNVSPEVAQGEVLLSPVSMAILHYQPPESAPSTAAV"
     gene            416588..418396
                     /locus_tag="AOT11_01620"
     CDS             416588..418396
                     /locus_tag="AOT11_01620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011151482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM98167.1"
                     /translation="MELPKTLIRLLRPYLIALTCTMIYLAYHQFKQSEEAVYQQSQSH
                     IITASSLIHAQIEAVYSKFYLLEKSLLAAHLDPSNADSQTIAQHILSHSNNYSNILFW
                     RKNSPTLLDMSGKQQAINPYKLYWHPLKTVRDKFEISSLYQNNKNRWVFAVRHINPNI
                     DGQLWIEFDLLFTTQYLKGLKILDKGYVFVVEKSTGKLVFHPDPHRIGTLSISFNSGI
                     AQQIATGHPFGKYEYYYRDNFKLAVFNTDNDLDWVFISGTDRADILSSSDQFSLTAVV
                     IASLLGLAIIINYLSYRLSDQLAQLGQCRSLLDFKQQLKILLNRFYFNSGVQFCLYDP
                     INQMFSTLDYHGNKKPLLQNDDLVAQLSANALSFHHQHDADPLAVKLQINGNHYRMAL
                     YDGERLNGVIYLRKRFPTQKAVISIVQNYAQTTLANLLLHEQLRHQDPMTQLENKASL
                     ANTVQRELGKEALYLAMINIDNFQRINDSFGHPVGDMVIRKTAQMIRDAFPKPNGLCL
                     ARYGSEEFAVLFQSSDAHEAQTQLNELKHAISNTRLLEAGLPVGYSISVGLTKLAPSY
                     HETIENAERALQRAKNLGKNRVVTHFSESSAKTSCA"
     gene            418850..420046
                     /locus_tag="AOT11_01625"
     CDS             418850..420046
                     /locus_tag="AOT11_01625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM98168.1"
                     /translation="MTKLVGQHLEEMADIRSTRKKKIVGLCSVAASVMFFYCAIEQFA
                     QSDLALGALNGLAAMICLGNFLYIKSVENPLYADLVLSCLMLLDALLLFLYGDATADK
                     MLVLFPLLATVILINSFNIGLLLSGSFCFIVAYSLFFAKTVVLTGLLDTTQFFIALIA
                     TCIVCHTSTYYYSKVVHYIQSLYQEGIEDLAYLDQLTGLANRWSFENWAKDKLREIDA
                     TPSTCITALVFLDIDNFKHINDAYGHDVGDRVLQHFANRLKNNVRNKNRRTDKHDYSI
                     ARFAGDEFVLMLYDVKTKQDLDNILQRIVGLFTTGYLAHERINELTLSVGAAIYQQDA
                     FELSELTRCADKAMYSAKHSGKNQYAYYENCTPPLPQKKMTYSEPLPPTGNVSLFIKK
                     ANSSSE"
     gene            420523..421368
                     /locus_tag="AOT11_01630"
     CDS             420523..421368
                     /locus_tag="AOT11_01630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quercetin 2,3-dioxygenase"
                     /protein_id="ASM98169.1"
                     /translation="MAKVRALKQIRESIATKDGDGVNITRLAGFECPDFSPFLMIDEL
                     KSEDSADYIGGFPPHPHRGIETLTYMLNGHFQHKDHMGNVGELRSGGAQWMAAGRGVI
                     HSEMPIMTEGQLHGFQIWINQPAAKKMTPARYHDFQPESITEYRSEQHDLLRVIAGNL
                     EVNGRILSGPLTETGVPLTVADWRSDTPTTLIAKVSKHFQCMVFVYQGTLSIDGQKLT
                     QGHLGLMGEGDVLKLTASPNCGVLIFAGEPIREPIVHYGPFVMNSVDEINQAINDYNS
                     GHFVD"
     gene            421507..422844
                     /locus_tag="AOT11_01635"
     CDS             421507..422844
                     /locus_tag="AOT11_01635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM98170.1"
                     /translation="MSIQNYFADFLEESPVDVAQLTTFSEHIPDEWVAKAATLSDKAT
                     IRRRRLPSDMVLWLIVGMAFFRNESIAEVARRMNVCAEGLADEELLAKSALTQARQRL
                     GKAAPEWLFRQCSHTWGLERYPEDTWQGLQVFAIDGALFRTADTSELREHFGSGNTSS
                     ERQTPHPVLRVVTMMNIRSHVIVDAAISPYRRGEIPLAMPFIDSLPDNSVTLLDKGFY
                     GADLLLSLQNSGSNRHWLLPAKKGVKFRLLDDEESDDMLVEMKVSPQARKKNPNLPEK
                     WQVRAVTYQVQGKHKTVFTSLPREEYDAESVAELYHERWEIELGYRDIKSSMQHNALV
                     LRSKTVELVYQELWGLLLGYNLVRREASQAAVAHGRMANEISFKYACQFIASQLKVMS
                     KAVSPGNTPKRLKSLRGDLSILFIDKRPKPNRPRAVKISKTRYPVNRKAAPLK"
     gene            complement(422906..423187)
                     /locus_tag="AOT11_01640"
     CDS             complement(422906..423187)
                     /locus_tag="AOT11_01640"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MGC2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98171.1"
                     /translation="MIKENSYFAGNVKSLGFNQQGEDSSVGVMLPGNYTFGTDAPERM
                     TVVKGALVIKREGDEEWSTYQAGEAFEVAGKSSFDLQVEVATAYLCEYL"
     gene            423403..423912
                     /locus_tag="AOT11_01645"
     CDS             423403..423912
                     /locus_tag="AOT11_01645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98172.1"
                     /translation="MVKKSTQNSKNNRIEQQAEKRINNKLAMFRGLFVVFFLLLTGYF
                     SFRIYSEYQLYVDPVNVYGEWIEIGAPPYLTERLTLSEQGVFRNNRLVATQYQFDGKR
                     IIVETGNGLTIYQVAGSESSPQLRRLQPATPVQRFVKKGYEDTITESASGGAQNRRAA
                     LSEHFNSSN"
     gene            424232..426769
                     /locus_tag="AOT11_01650"
     CDS             424232..426769
                     /locus_tag="AOT11_01650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="ASM98173.1"
                     /translation="MTKLNLCAASIALALSGAALAAPTAPSIDLYGSNNLQFSKIELA
                     METTAGYNQMVKYHDQATISVKFNQWSGNTGDTYNIYFDGVKVASGPISGSQTAANFQ
                     YGKGGLYQMEIEACDATGCAKSAPAEITIADTDGSHLKPLTMNVDPNNKSYNTDPSLV
                     VGTYFVEWGIYGRNYTVDNIPAQNLTHILYGFIPICGPNESVKSVGGNSFNALQTACQ
                     GVPDYEVVIHDPWAAYQKSFPQAGHQYSTPIKGNYAMMMAMKQRYPDLKIIPSIGGWT
                     LSDPFFDFVDKKNRDTFVASVKRFLTTWKFYDGVDIDWEFPGGDGAAPNLGDPARDGQ
                     AYVDLMRELRTMLNELEAETGRTYELTSAIGVGHDKIEDVNYADAIQYMDYIFAMTYD
                     FYGGWNNVPGHQTALYCGNFMRPGQCDGTGVDENGVPYKGPAYTSDHGIQLLLAQGVP
                     ANKLVLGTAMYGRGWEGVMPSTLRDPNDPMTGTATGKLKGSTAQGVWEDGVIDYKGIK
                     SFMLGPNSTGINGYEYGYDEQAEAPYVWNRTTGELITFDDHRSVLAKGAYAKNLGLAG
                     LFSWEIDADNGDILNAMHEGLAGGVVIPPNKKPTANAGADVVVVGPAAVTLDGSASKD
                     AEGPIASYAWTQVSGPAVTLTGANTASASFDAPEVTAAQQFTFQLTVTDADGASASDT
                     VVVTVNAKDTGPVNTAPVAKVTAPATANAGDVVVVDASASTDADNDTLTYTWQLPAGL
                     VAQTNGAQVTFTAAEYTADTSLTFTVTVSDGQASSVASTTVVVAKKVDNGGTCSNAWD
                     ASAVYTGGQQVTHAGKTWEAKWWTTGEDPSKAGQWGVWKEIGPANCN"
     gene            complement(426876..427727)
                     /locus_tag="AOT11_01655"
     CDS             complement(426876..427727)
                     /locus_tag="AOT11_01655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="ASM98174.1"
                     /translation="MMSEKIYFNTSQKFSLKRSLVNWTTRLHHTLAPSHAKRTARKLL
                     LTPARTQSKNLPPQGLRKGQVDTAHGTLTTYALGEGAVWVLTHGWSGTASQFFPLMAH
                     IASRGFTALAYDHPAHGESSGDVGHIPAFVEGLDAVLDSLDEVAGLIGHSMGTASALE
                     CRHQKLEDKPMLLIAPVLNYVENLFSSIERSGYSMKLFRAVVSEVEEQFNYPIQSVDP
                     YRRLAQRRVQTLIVHDEQDKFTSYAVSASAAQEMENVELISTQGQGHGRVMKCQQVLD
                     SFDRLIA"
     gene            complement(427804..428397)
                     /locus_tag="AOT11_01660"
     CDS             complement(427804..428397)
                     /locus_tag="AOT11_01660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98175.1"
                     /translation="MSKGRITKEHILQHAFQLASENGLESLTIGELAKQCGMSKSGLF
                     AHFNAKLNLQLSVLEYANLIFAERVIAPARLSGDADMEKKIRGLLDNWMTWNHSFQGS
                     CMFLDAWNDAAPKECELQKALQGSIAKWLDYLQIQVEKGMEQGAFSADLNAQQAVFEL
                     YGLYLSAHVFYAIRGEEVSLQHFWQGVDRLLAGWKNG"
     gene            428616..429635
                     /locus_tag="AOT11_01665"
     CDS             428616..429635
                     /locus_tag="AOT11_01665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fucose 4-O-acetylase"
                     /protein_id="ASM98176.1"
                     /translation="MKTKIASLELGRIIAMLAIIGLHCQMALTYWQIDDIPWVGYVLN
                     QMARFAVPLFFLISGYLIQPKLTSAPLVTLRNYAKPLLKIWLVWSVLSLLMPFNFQVV
                     AEHGYLAERQGYWGYLAQTPLNSLLEGGLVHLWFLPALIIAVAVVALFVHFQRQHWLL
                     PIAALLYLYGVLAGSYQPLTDLASPFFTRNGPFFSTLLVAIGFMIREKNVRVSSAIAG
                     GMFLVGLLVHLGQAYGLMGYDIAFNGHDFLFGTELWATGLFLLLLNYPQLGQHPLTFA
                     LSPYVLGVYVCHLLVIILLMNIAGILGFEGLSRDLFIYPMTIGLSMTLVWVLNHTPLQ
                     RYLLR"
     gene            430055..431491
                     /locus_tag="AOT11_01670"
     CDS             430055..431491
                     /locus_tag="AOT11_01670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="ASM98177.1"
                     /translation="MGIYQRIVVLITLLFPTLAFGATTSKLNLTTSAVGILCLFIFVL
                     SYILVMLEEYLKMRKSKPVLLAAGLIWILIGFSYQSHGQSEVAKAALEHNLLEYAELL
                     LFLLVAMTYINAMEERRLFDALQAWMVSKGFDFRRLFWLTGFLSFFISPIADNLTTAL
                     LMCAVVMKVSGDNPKFVNLACINIVIAANAGGAFSPFGDITTLMVWQAGHVSFSQFMP
                     LFLPSAINYLLPALIMSFFIPEERPQTVHVDVELKRGARRIVGLFILTIATAVAFHAV
                     LHFPPVIGMMMGLAYLQFFGYFLRKTLAQSLAKKTAIAIANGDEDALKRIGSVVPFDV
                     FHRVSRAEWDTLLFFYGVVMCVGGLSLLGYLEVVSFTLYTKWDPVWANITVGFLSAIV
                     DNIPVMFAVLSMEPSMSLGNWLLVTLTAGVGGSMLSIGSAAGVALMGAARGQYTFFGH
                     LKWSPVILLGYCASIAVHLVYNTQTFNY"
     gene            complement(431570..431965)
                     /locus_tag="AOT11_01675"
     CDS             complement(431570..431965)
                     /locus_tag="AOT11_01675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde-activating protein"
                     /protein_id="ASM99238.1"
                     /translation="MIKQVGPTVIQAKHKASCHCGGVELELDLPNGIEKPRRCDCSLC
                     RRKGAIVASVKLDGIRIIKGEALLKLYQFNTHTAKHYFCSNCGIYTHHQRRSSPDEYG
                     FNLGCLEGVNPYDIGEVPLMDGVNHPADR"
     gene            432176..432784
                     /locus_tag="AOT11_01680"
     CDS             432176..432784
                     /locus_tag="AOT11_01680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98178.1"
                     /translation="MDKDHSLRENLLALTLGSALVSLGVIFFNQVGLLTGGTAGLAIF
                     LTKVTDFSFGQVFFALNLPFYLLSVMRMGWRFTINTFIAVTIVSFAVDHLHHVIQIAH
                     IDPFYAALLGGGLIGIGMLIIFRHKMSLGGFNILALFLQERFGIRAGKVQMALDCTIV
                     VFSLFIVEPYLIALSVLGAVATNLILAMNHKPGRYQPQIATQ"
     gene            complement(432967..433452)
                     /locus_tag="AOT11_01685"
     CDS             complement(432967..433452)
                     /locus_tag="AOT11_01685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine methyltransferase"
                     /protein_id="ASM98179.1"
                     /translation="MKYYTQFSSPFGLVTVQANDQGLLGIWFEQHTTLPTELGCDAAS
                     HPVISETRQQLEQYFSGLRQQFDLPLAAQGTEFQQKVWQALTQIPYGQTCSYQDLANA
                     IGNPKAVRAVGLANGKNPISIVVPCHRVIGKNGKLTGYAGGLERKQQLLTLESGGEMS
                     R"
     gene            complement(433454..434839)
                     /locus_tag="AOT11_01690"
     CDS             complement(433454..434839)
                     /locus_tag="AOT11_01690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="ASM99239.1"
                     /translation="MAILNYSSLTTEQCQQARMARDSRFDGLFYVAVKSTGIFCRPVC
                     PANLPKEENVEYYHDKAQALSAGYRPCLRCRPDSAPDSWAWKGVETTFQRALTLIEQG
                     ALQTERLSVLAQRLGVSDRYIRQLFRRYLGISPKQYAQSQQLLFAKQLLHGSSLSITE
                     IGFASGFNSTRRFNDAFQKSMGMPPSRIRRSKEGASHEQSHIVLAFRGDLNAKHMLDF
                     YRQRAIEGVEVVTETSYQRQVVINGKTVGFRAEFPTTFPAEKRQLVVYFSMDDLTLLR
                     PMVAGIRRMFDLDCDTRVIEAHLNTVAPGLVKSVGIRIPGVWSVWEAGVRAILGQQVS
                     VKAAIGHLNLLVATLQPDSEVRTFPSPQQVVDADLHFLRMPQSRKETLRRFVAMMLEN
                     EHADPNQWLALKGIGPWTVSYAQLRGLSQPDRLLEKDLVVKKALTQFPTLTQESASPW
                     GSYATFHLWNQ"
     gene            435208..435411
                     /locus_tag="AOT11_01695"
     CDS             435208..435411
                     /locus_tag="AOT11_01695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98180.1"
                     /translation="MDLHSCIIVLRNQEVITSNSVEDSLGIIESQGDNGISTIQINAR
                     DGNAIHTYHCANIEDSLENLMNL"
     gene            complement(435531..436430)
                     /locus_tag="AOT11_01700"
     CDS             complement(435531..436430)
                     /locus_tag="AOT11_01700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM98181.1"
                     /translation="MDVKVFRTFLELANVRHFGRAAENLYITQAAVSARIKQLESYFD
                     VELFIRDRNNIKLTSAGERLVGYAEVMVSTLQQAKLELSMQDGRALQLTLGGTPNVWD
                     AYLQNCLSVVTDSFRGYGFNAEVMGRELLTRGLQERTLDMAFAFDQIKADEFSCKKVA
                     DLVLVMVSTETASKDSVFEGKYVYIDWGTKFASEHAERHQKHLAPYLRTSTARIALDF
                     ILEKGGSAYLPASIAQPYLSSGQLHRVEGVEEWNRPIYLSYRKASTSIDAIRQVEELV
                     KMIDPLASYQVQQAMDSSLTQNG"
     gene            436580..436939
                     /locus_tag="AOT11_01705"
     CDS             436580..436939
                     /locus_tag="AOT11_01705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98182.1"
                     /translation="MSDTTIRHGKKRFFDNAKFPRGFAKSGDFTLAEEEILMIYGDTL
                     VGLETGQLTPENDDEKHFLLTLETPEAAQNKVERTWLKYMRLARGRKRFHTLNGRNKP
                     DASDDYVEEDASLTEDD"
     gene            complement(437526..437777)
                     /locus_tag="AOT11_01710"
     CDS             complement(437526..437777)
                     /locus_tag="AOT11_01710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004396975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98183.1"
                     /translation="MKNELDSTKILHAYETIMERGTPTEFGKIYEGVEAFSDYDGYSV
                     YMRGNGVELKVGFHNTYHLDYEQEHLRDSFLKKVAMLAK"
     gene            438099..438899
                     /gene="nagB"
                     /locus_tag="AOT11_01715"
     CDS             438099..438899
                     /gene="nagB"
                     /locus_tag="AOT11_01715"
                     /EC_number="3.5.99.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001237047.1"
                     /note="catalyzes the reversible formation of fructose
                     6-phosphate from glucosamine 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="ASM98184.1"
                     /translation="MRLIPLKTAAQVGKWAAAHIAKRINDFQPTAERPFVLGLPTGGT
                     PLATYKALIELYQEGKVSFKHVVTFNMDEYVGISADHPESYRSFMYNNFFNHIDIQEE
                     NINLLNGNAEDHEAECQRYEDKIKSYGRINLFMGGVGNDGHIAFNEPASSLSSRTRIK
                     TLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDSQEIMILVTGHNKALALEAAVEG
                     SVNHLWTVSALQLHPKSVIVCDEPSTQELKVKTVKYFTELEAKNIVGF"
     gene            complement(439004..439870)
                     /locus_tag="AOT11_01720"
     CDS             complement(439004..439870)
                     /locus_tag="AOT11_01720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="ASM98185.1"
                     /translation="MTDKISTTALAKMRNIEASQLFTDLSRAGYISRVGDKWILTELG
                     ARFGGEYVDHTKFGQFIVWPVNLHVELTSTQGKLLSATQIGELLGLNAKKMNQLLSEM
                     GWMAKTERGWEVTESGIRAGGKQKGDGEEKPYYLLWHDSITRNKRLKQSVVEFLGQDA
                     EVHATDKSFSSFRQKFEAKHRTLDGHYVRSKGELLIDNWLYLAGVAHAYGRQLPIEEE
                     IISDFYLPAGKVYVQFWGSDNGGTPEANKAKIRAVYQAHHFHLIEVEQDELESLDEVL
                     PQRLRPFGIKAY"
     gene            complement(440026..441252)
                     /locus_tag="AOT11_01725"
     CDS             complement(440026..441252)
                     /locus_tag="AOT11_01725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:glutamate symporter"
                     /protein_id="ASM98186.1"
                     /translation="MNSVVSVGPQESFLIAVGVLFLGHFINGQIPILKRFNIPEPIVG
                     GLVVALVITLAHFNGITFDFDLPLQKTFMLMFFATVGLAANYKQLLKGGVKVLLFLLI
                     ASIYIVVQNGIGVSLASMLGLDPLLGLIAGSITLSGGHGTGAAWSNTFAQNYGLENAL
                     EIAMASATFGLVMGGILGSPVAQRLVDKHQLESEYGRELQAHQRFADLVTYNENEEDK
                     VTAKKVIESLALMFLCVIGARYLSQWVNQLDIAWLMIPDFVYALLLGVFVTNFLELTK
                     VRKLDLETVDMLGTVSLSLFLAMALMSLKLWNIFDLALPFLFILSIQSLVMVLFSYFV
                     TFKVMGRNYDSAVIASGHCGFGLGATPTAVMNMGSIVNRFGPSPQAFLVVPIVGAFFI
                     DLVNMLILQGFIAFLG"
     gene            complement(441714..442940)
                     /locus_tag="AOT11_01730"
     CDS             complement(441714..442940)
                     /locus_tag="AOT11_01730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:glutamate symporter"
                     /protein_id="ASM98187.1"
                     /translation="MNHLITVGALESFLVAISVLFLGHFINAKLPILRKFNIPEPIVG
                     GLIVACIITILHFRGIDLEFNLPLQNTFMLMFFSTVGLAANYTQLLKGGAKVFLFLAV
                     ASVYIVIQNGVGVSLASMLGLDPLMGLIAGSITLSGGHGTGAAWSQTFADNYGMSNTL
                     EIAMASATFGLIIGGLIGSPVAQRLVDKHNVESEYGRGSKTHEKFPELVTYNEYEEDK
                     VTAKKVIEKLFFLIICVTGAKYVEQWVSTYEIKWLMIPDFVYALFIGVIITNFLEVTK
                     IRKLDAETVDMLGTVSLSLFLAMALMSLKLWNIFDLAIPFLVILAVQSVVLALFTYYV
                     TFKVMGSNYDAAVIAGGHCGFGLGATPTAVMNMGSIVNRFGPSPQAFMVVPIVGAFFI
                     DIVNLIVLQGFISFMG"
     gene            443563..444354
                     /locus_tag="AOT11_01735"
     CDS             443563..444354
                     /locus_tag="AOT11_01735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98188.1"
                     /translation="MRHPHPSCQKTRWPLSLLLASCVSTGALAESIQILYPKQITKQE
                     QTIIDTLESYQINTTLLDLSHSLFPFKKTLTVSYGGDQGPLYDPETHTVHIPFSFYTE
                     SLDYFRKNEYQKNGGKSAESGAINTMLHTLLHEAGHAYIADQNIAILGKEEDAVDNFA
                     TLLLIDYVENGDEIAISAADMFAFESEDKPEYYDLDEYIDEHSFDLQRYFATLCLVYG
                     SNPERHSNLLDEIEKEYRQERTEFCQANYQTLSDNWHRYLTSTPE"
     gene            444568..446229
                     /locus_tag="AOT11_01740"
     CDS             444568..446229
                     /locus_tag="AOT11_01740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98189.1"
                     /translation="MNLTIRKRLYIFSIVPVLTIALGMMWFTYLKTTAFNEQQVEITR
                     DNMMRMKQEELKNYIQMAKSAVQPLLNRKATLEEALPVLRELEYGDSGYVFAYDSKGT
                     RIVVGKSDKGIGENFINLQDQKGNYLIKDLLKNARTGDFTTYYFPKPGQTTPLPKLSY
                     SIFISEWDLMIGTGFYTDDIDAIVMEMENTAHDALQTTLSAIAFFAIIIALIVGVFAV
                     FVNRSIMRPLEMFDESIRSFASGDADLTARMEDFSVPEFKQLSRNFNQFVGSLQNIIR
                     SVTEVGNDVVSETDNMSRRATEVDNLAAGQRGETEQVATAMTEMTTTATEISSNASQA
                     AQAARYAEENAHEAQTIVNSAASSVRELAGEVSKANDVISRLEGDVKNISSSLEVIQD
                     IAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLASRTQDSTGEIHQMINQLKAAS
                     DAAVKAMDASQARGESTVEEANAAAAALLKIIDSIGTIMDMNSLIATATEEQSIVGQE
                     ISERIVVISDQSSQSADLANQNRMGSQSLNKKAHQLSDLVGRFTV"
     gene            complement(446418..447185)
                     /locus_tag="AOT11_01745"
     CDS             complement(446418..447185)
                     /locus_tag="AOT11_01745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator"
                     /protein_id="ASM98190.1"
                     /translation="MTSMTALIADDEPLLRHHLNRMLADVWPELEVVALVGDGQQALT
                     SIEQLQPDIVFLDIRMPELDGIAVAKQLNRGEYRPTIVFVTAYDEYAVKAFEQQAIDY
                     LMKPLSEARLIDTCQRIKARQQPTVSPPDVGALLSQLQALSKPAQPQYLQWIRAALGD
                     DIHLISVNDVLYFKAEEKYVTVHTLAKKEFLIRMSLKELLAQLDPERFWQIHRASVVN
                     VAAIEKVQKDFTGRMSVTVGEQKLPVSRGSQHLFKGM"
     gene            complement(447185..448288)
                     /locus_tag="AOT11_01750"
     CDS             complement(447185..448288)
                     /locus_tag="AOT11_01750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ASM98191.1"
                     /translation="MFFSRVAKNRAAQEALSSNHLVNDDAQALESGWLRSFAVTSIFC
                     LFVSVLTLSVWGGAYYIHLIISFGFGYSALFFSWLIEKLFPMMPRNAEILLSLTACLL
                     FGILNARFWVGDYFGITDMVPVGLMGLLFSGMCYFYFHSKEQQMLAAHELEVMKREKA
                     EQERALLMSQLKQLQSQIEPHFLFNTLANISALMSCDVEKAQQMLTRLTDLLRSTLKS
                     SREERTLLASELEILDAYIAIQKIRLGERLEYHIHCPEALKGCVIPPMLIQPLVENAI
                     THGIEPKVQGGKVEVRVMKNELGLELRVVDTGVGFGQDSRSGMGVGLNNIKQRLAALF
                     GELGTLTLLEGRHGGVCAVIQMPPQQENQEAKA"
     gene            complement(448289..449623)
                     /locus_tag="AOT11_01755"
     CDS             complement(448289..449623)
                     /locus_tag="AOT11_01755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="ASM98192.1"
                     /translation="MEVCVHRRPAYLSPAKWAHSLLLSTLPWWAMAGELSSEWDWALS
                     YEAAQSRQSVFTTTQYAHRSELNAMLDLQLAYHTQQGQWTSSFALYSDGLYLNNGERS
                     VWWESRDSQWVVRELAWLGEWQVGDWLLDVSIGKLRLDWGVGYGYRPLDLFRPYRQNP
                     VTLVAEEGTGVASFSHYDLAGEWTLLFTDSSWSQMEQSALDEAAQQRGAGIRRYWLDD
                     DHEWQWIAYYDDVRQGLIGGSVRTVFNEALSLHSSALWQHQSVGYQLPDSLFAPVAVE
                     EQGEAWQALVGVNWASESGHSLLAEYWYDSRAWSKRQWQQAMDRARMLTQQPNTEPLA
                     ASYAQGFEHANLVQHNLMLHWSWDSNAWMMWHGISAPQWLADVTPTLDILFSPEDGGV
                     ILTQWIRYQWIDTGQQSVELEFAARFLTGDSQSAYAQIEDKHMMVLNLKGRF"
     gene            complement(449643..450413)
                     /locus_tag="AOT11_01760"
     CDS             complement(449643..450413)
                     /locus_tag="AOT11_01760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98193.1"
                     /translation="MYNAIKAGLWMALLCASNWASAQPSDEQVVSMIKQADDYRLKET
                     SARVVSLVSLYENDQLDKTREYHVYTRPNRESLVIFKSAVEAGQKMLMLQDNYWLQMP
                     KSRRPIRITPMQKLLGEASVGDISTLTWSEDYQAIWRAEESVSSLSGQATPTQHLQLT
                     AKTSGASYQTIDLWLTVPEHFPLKADLYLRSGKLAKQAWFTRGERNGELSVTEMTLLD
                     HIQPAKKTVIEYQDVQPWQLEDKFYNPSYLSKADSVQF"
     gene            complement(450406..451671)
                     /locus_tag="AOT11_01765"
     CDS             complement(450406..451671)
                     /locus_tag="AOT11_01765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="ASM98194.1"
                     /translation="MGQLVARLFPDSLRLAWLNLKRNGRRSLLSVLIIAIAVFALTSA
                     GGFGLYTYDSLKESTARDTGHITISTPGFFTKEEEMPLSNGLSQPDDLIASVMGLNEV
                     RGVQPRIEFNGLISNGSKSAIFVGIGVNDREFDMKGPFLDVREGKTLSNPRGQRYDPA
                     EPEVMLAMDLARNLNVTVGDWITLLATTTDGALNAYDFKVRGVYATGVPELDKRQLFI
                     HIDSAQSLLATDKVSVISVFLFETEKTAAVQQRLSALLSQFSQELELTPWQERAFFYQ
                     KVKDLYDRIFGIMGAVMGLVVFVALFNTMTMSVTERTREIGTLSALGSYPRDIIIGFL
                     REAGLLALLGSLVGALASGAISLLLMVVDVQMPPPPGRTDGYPLMVYFSFELVAIAAV
                     GVVCICLLAAYLSARKGVNKPITEALTYV"
     gene            complement(451659..452354)
                     /locus_tag="AOT11_01770"
     CDS             complement(451659..452354)
                     /locus_tag="AOT11_01770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="ASM98195.1"
                     /translation="MIQFSNLQRHYQLGLLEVPALQSVSGAIEQGEMVALCGPSGSGK
                     STLLNILGLLDMQYSGQVTLHGDDYPRSANQAATLRREKLGFIFQKFNLVPVMTALEN
                     VAYPLYLNGVDKTKQRQLAAEMLERVGLGESLHALPDQLSGGQQQRVAIARALVHRPT
                     LVIADEPTASLDSVTANLVIDIMKQLGHERATTFVVATHDGRMASRCDRTIELLDGRL
                     RQHHEQEVISWAS"
     gene            complement(452365..453096)
                     /locus_tag="AOT11_01775"
     CDS             complement(452365..453096)
                     /locus_tag="AOT11_01775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98196.1"
                     /translation="MVANPCETGSMLLFCHRQSKHKDIATMLVKKKTITTCLMMTSLL
                     FAPMVMANPDQALINQYNLAVEGETALVDHVYGQLNALIEREGAKPLSLVYLGSTQTL
                     QGRDAFLPWNKMKLTEQGLATISKGLGMLDTLPPSQNEQQRIQGLPEGYLARAMAAAT
                     FTSLPDMFNHFERGYELYLELLAEPDFQAQPFAATSWVYRYAIQAALRAQDVPQAKTW
                     LDMMVNQDRDNLDTRSASAQIDAQG"
     gene            complement(453441..454157)
                     /locus_tag="AOT11_01780"
     CDS             complement(453441..454157)
                     /locus_tag="AOT11_01780"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D4V5.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98197.1"
                     /translation="MGRSFEVRKASMAKTAGAKIKVYSKYGKEIYVCAKNGGIDPDMN
                     LSLRHLITKAKKDQVPSHVIDKALDKASGGGGEDYQPARYEGFGPGGISVIVDCLTDN
                     GNRTFQDVRQCFVKTGAKIGTPGVVAHMFDHQAVFQFKGDDEESFLEALMMADCDVTD
                     IELEDGVITIYAPNTEFFKVKTALNTEFPDLVIDVEEITFVPQNYSPVPEEDAEKFQK
                     FLDMLDDCDDVQQVYHNAEM"
     gene            complement(454288..454497)
                     /locus_tag="AOT11_01785"
     CDS             complement(454288..454497)
                     /locus_tag="AOT11_01785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5-phosphate oxidase"
                     /protein_id="ASM98198.1"
                     /translation="MSFNLSLLPPDEKNRIELDKQASFLVWQLKEAKCGPDAIMTQAE
                     KLSDPSEKAFFEQSIEKYKRVMGVA"
     gene            complement(454656..456596)
                     /locus_tag="AOT11_01790"
     CDS             complement(454656..456596)
                     /locus_tag="AOT11_01790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM98199.1"
                     /translation="MGKSMNGKRQIGIDKQLMIAVILLSLAFTLASTGFNVYWDYKQE
                     LKKRQAELNWVEQSYLQSLTESLWVEDRQHLESQVQGMMTLPFLDAIDIANENEVIVN
                     TGDVGHSKRVLERRWPMEYQLADNHYLLANLTVRSNLDEVYQGLWRKFALLLVGESIK
                     TFLLMVGVIYIALSLIVKPISLLSRAVSDFKDGETPSRLRLPARAFDDEISLLAEKYN
                     SSVERLRSNYAELKSAKEQAEVANVKKSEFLATMSHEIRTPMNGIIGVASLLKEMDLS
                     SEQKQYVEMINHSSESLLDIINDILDFSKIEAGKIAISLEPFCLSDLVEQMCAIYTLK
                     AHAKNLQFVVELAEDVPHTMSGDSKHLKQVLNNLLGNAVKFTERGYVKLVVAKELDAQ
                     HIPRIRFQVFDSGIGIAKEKQELVFERFQQADGSTTRKYGGTGLGLAICRRLVSLMGG
                     ELELKSEVGLGSCFEFSVPCVDGEGVFAKDRKDNVRHLQELGVTEVDSEPSSAHQSSQ
                     IAALPRALLVEDTFINQKVAKLMLEKIGLAVDIAEDGEQALVLCQQQQYGIIFMDCQM
                     PVLDGFETTEILRASDGWTRDVPIIALTANVVVEDKQRCFDVGMTDFLAKPVTQQRMS
                     DMVKRYLPFDGSSTVSHRHHQP"
     gene            456672..457427
                     /locus_tag="AOT11_01795"
     CDS             456672..457427
                     /locus_tag="AOT11_01795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="ASM98200.1"
                     /translation="MKQLNRWICTAMLIFSSFALAQEVNYYVIANQARPFQIEQNGHD
                     QQGIVTDIVRAIFSNSEHTLRFHTYPFNRMISILESGGEPNWITYGSPGWGKVQSENL
                     SEEAIYTVKHTLVSSRKKPIAFNDISDLKNKGVVLLMGFDYPQLSPYIQDGGLKEIRV
                     KDYQAAFRVVSRTPGDTAFVEMASRVNYNIQQLKLDPEQFALQPFEKIIPDYQIYLAF
                     SPNMDATLQRFINQRLKEIKQSGELQRIVNKYI"
     gene            complement(457472..458113)
                     /gene="ribA"
                     /locus_tag="AOT11_01800"
     CDS             complement(457472..458113)
                     /gene="ribA"
                     /locus_tag="AOT11_01800"
                     /EC_number="3.5.4.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009706698.1"
                     /note="catalyzes the conversion of GTP to formate and
                     2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
                     and diphosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase"
                     /protein_id="ASM99240.1"
                     /translation="MVREELQEHAPYNLVQFIDSAKLPTQWGTFQMYGFIEKATGKEH
                     LALVYGDIEQQPAPLIRLHSECLTGDALFSARCDCGFQLAKALQNIVAEGAGVLLYLR
                     QEGRGIGLINKIRAYHLQDDGADTVEANEQLGFGADMRDYAFCRGILSFLGIERVRLM
                     TNNPRKVKALQLANIEVTERVPLQEGNNPHNHQYLKTKADKLGHMFDRDFVKP"
     gene            complement(458721..458918)
                     /locus_tag="AOT11_01805"
     CDS             complement(458721..458918)
                     /locus_tag="AOT11_01805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98201.1"
                     /translation="MSINSINHDEIADMAHKWEVSEEEVVLRPEKQVKSAEARRRIEA
                     LREIRESGLSIEEAKELGLLH"
     gene            459268..460113
                     /locus_tag="AOT11_01810"
     CDS             459268..460113
                     /locus_tag="AOT11_01810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ASM98202.1"
                     /translation="MSVFHADKAFHPDPVLQVRNLCVDYITDNGDFNAVKSVSFDIGR
                     GEIFGLAGESGCGKSTIAFAINRLHKPPAFISGGEILFEGRNLLALSDQALSVLRWSE
                     IAMVFQSAMNSLNPVLTIEEQFADVLRHHSGFSNTQAKDRAEKLLDLVNIPRHRLSEY
                     PHQFSGGMRQRLVIAIALSLNPKLIIMDEPTTALDVVVQREILQQIYQLREEFGFSVL
                     FITHDLALMSQLCDRIAIMRHGEIVEVDLSYQIRNHPKHPYTQKLWSSFPNIHDVHST
                     VEQGA"
     gene            460116..461048
                     /locus_tag="AOT11_01815"
     CDS             460116..461048
                     /locus_tag="AOT11_01815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     ATP-binding protein"
                     /protein_id="ASM98203.1"
                     /translation="MTTPVIELKNVVKEFTVGGGFARQESFRALHGVSFNLYAGKTLA
                     LVGESGCGKSTCARLITKVYPPTEGEILFQGKDISELKSRKEILDYRGKVQMVFQDPF
                     GSLNPTHTIEHHLARPLKIHGQVSSDAEVPAKLTELLALVELSEETLTKFPHQLSGGQ
                     RQRVNLARALAVGSQIILADEPTSMLDVSIRLGVLNLMQRMKKELGIGFLYITHDLAT
                     AHYIAEETAVMYKGQIVEWGDTRAILSNPQHPYTKLLISAVPDPDLPFGDLVKSEPDY
                     SLDADVIRQQSSIVVDECEQVGPNHFVKQWTKAA"
     gene            461048..461515
                     /locus_tag="AOT11_01820"
     CDS             461048..461515
                     /locus_tag="AOT11_01820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015727323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98204.1"
                     /translation="MDLSIWLNNISTWYQDRKHDQGDALKTIIFSAPDSVFGPELSDD
                     QSKAIACWLDGCLRLFQQHRYLNPECAFEFLNYTSSQLERVACDHNTDLAIRDWCMKR
                     LQHMTVLSLEFCNQQEDQQNWLTRAHCLIEGHVKLMEALAWNEPRKHDQVIWH"
     gene            complement(461869..463839)
                     /locus_tag="AOT11_01825"
     CDS             complement(461869..463839)
                     /locus_tag="AOT11_01825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor"
                     /protein_id="ASM98205.1"
                     /translation="MTTEEKILIKAPRSHKDGHLFEVNESSADWVEQYQHFKGVTKSI
                     LELLNLISLRGFSSKDGLVSTTELVEATDGHLTRAAIQQRLRAAVSIGLFTQTPVRFE
                     EGLAGKTMLHHFVNPNKLISVLGATSLVTEKVKQTEKEKRSKALAQTQVNKRLLNEHG
                     LNTPPGMKDEADQFVVSPTNWAGIIDQALAPPRTRKNYQKSMVSISGTRAVIETRSSK
                     NIMTVDDLMTLFALFTLTVQYHDHHKEEYQMDAAHIPNKTPLYITDILSLRGKKDSGP
                     ARDSIRDSIDRIEFTDFQLHELTGRWLSENMPEGFKSDRFRFLARTITASEEAPTEGS
                     DGEIRIKPNLYILVWEPSFYEELLTRDYFFLFPPEILKQHTLVFQLYSYFRTRMARRH
                     TDSMLLSELNQKLARNIEWRRFSMDLIRELRRLSEGKGTEDLFVVNLWGYHLTVETIQ
                     EQDKVIDYQVDIKCDVEEVLRYSRARTTNAGKRNMAPTLPNPLRNEMVSKQKLDELSG
                     IIDGEFEPIQRKERSPKGNLGRRVKLRKHLVEINADEITITLTKYTSPEALERSITAL
                     SAMTGHPYASIKEECQELLEKLDFIRVDESILPYETLSKVVELYNGQTENKHLSIERL
                     IAGLAVRRKVCRQVFEGHLDETVFRALDEVAV"
     gene            465249..466466
                     /locus_tag="AOT11_01830"
     CDS             465249..466466
                     /locus_tag="AOT11_01830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004412853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="ASM98206.1"
                     /translation="MKREKTIENLMQLAESTQQVQADRIEIVLEERSDDYFPPMSKAL
                     METRSGLTRRKLDDAIGKMEAEGHQFTKNNANHYSITLEEAHMLMDAAGVPKFHQRKN
                     GGNGKPWIINVQNQKGGTGKSMTAVHLAACLALNLDKRYRICLIDLDPQGSLRLFLNP
                     QISIAEHDNIYSAVDIMLDNVPENVDVDRSFLHKNVLLPTQYPNLKTISAFPEDAMFN
                     AEAWQYLSQNQSLDIVRLLKEKLIDKIADDFDIIMIDTGPHVDPLVWNAMYASNALLI
                     PCAAKRLDWASTVNFFQHLPTVYEMFPEDWKGLEFVRLMPTMFEDDNKKQVSVLTEMN
                     YLLGDQVMMATIPRSRAFETCADTYSTVFDLTTSDFEGGKKTLATAQDAVQKSALELE
                     RVLHSYWSSLNQG"
     gene            466474..467448
                     /locus_tag="AOT11_01835"
     CDS             466474..467448
                     /locus_tag="AOT11_01835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="ASM98207.1"
                     /translation="MAIKTSDLNAKLFGKANKRRVATPQEAQTAAKEQAQVIELAVAG
                     EETVTFELIRIAADQVATQTSVFAENAREQSFLTEHALSDVLATLRDRGQQYPAVGRR
                     TADGKIEVLDGSRRRMSCILAGQDFLVYVADNISTEHAKFLSDVANAHKPLSLYEKGK
                     EMLAKLEKGDAEDQKALAKMFQCSEALVSGALKAASLPLELLQAYPNVSDLGRPTIVK
                     LHKQYNSLAEPQQKALLNKCRTNEGFVWQRSQAQGVARLTKEVTENIEAWIAELSPVK
                     AKAKAEKVELVKDRASYSRKGSNLSLNLKKVDDKTMQEILQFLESKLA"
     gene            467547..469574
                     /locus_tag="AOT11_01840"
     CDS             467547..469574
                     /locus_tag="AOT11_01840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ASM98208.1"
                     /translation="MNAQIESLIHIQQHAEQTGWRVGVVLKGPDDWQTALLQGLLSEQ
                     SPCSIFVMGEGIASADDVTQCVSVKQGQRLLGQECQLLVVDCRKQFDANSFSAACGAL
                     CGGGMLLLLVSEQAANTPWELWLTGQFEQLIQMGCDGITHQPVLPPLPTSATARFAQQ
                     QQAVEHVHHVVTGHRKRPLLLTADRGRGKSSALGIASGQLMKTRKMRILLTAPTSAAV
                     EPVFHHAQSQLDGVVWQQSKSKLESENAVLEFVAPDDLLQRLPKCDLLLIDEAAAIPL
                     PMLKRMMEHYHRVVLSSTIHGYEGCGRGFTAKFLPWLQSQRPGMKHLHLNTPIRWLPD
                     DPLESWLNDTFLLNAELPMPENVVLKNLALRLVDKSELLAQPARLRACFALLVNAHYQ
                     TSPNDLMQLLSDPNSQLWLAECNSEVLGCLLTVEEGGLESALITQVQLGQRRPSGHLI
                     AISLANHLGLKAVAEQRSLRVMRIAVHPQYQSLGIGQAMLSQLEQQSGQQVDFLSTSF
                     GATESLVRFWLHSQYRPVRVGFSRDAASGCHAVMMVKPLTSRAEHWVEKAERMFEQTL
                     PEWLSSALNDLEPEVVRALLPALGANALPPEALSLIRHYALGGNSFESVLPWLKRWVL
                     MLEASQVEQLLIRKVLQNHTWSECAQMAGLPGRKQVELLLRQHIAALCHEH"
     gene            469908..470162
                     /locus_tag="AOT11_01845"
     CDS             469908..470162
                     /locus_tag="AOT11_01845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011152873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-anti-sigma factor"
                     /protein_id="ASM98209.1"
                     /translation="MECWLAECLDISSVQECRSQYLQWLESDQPLQLIGSEVRKVDAS
                     GIQALVSFIRSVKQTGSTLELTAFSDVLAEGIELLGYELN"
     gene            470194..470553
                     /locus_tag="AOT11_01850"
     CDS             470194..470553
                     /locus_tag="AOT11_01850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM98210.1"
                     /translation="MVKILAVDDSVSIRQMVSHTLKDAGYDVETANDGSDALQKSKTT
                     KFDVVISDVNMPNMGGFELVRAMRAIPQYKFIPILMLTTETSPEKKMEGKSAGATGWL
                     VKPFNPDTLLKTLKRVL"
     gene            470588..472702
                     /locus_tag="AOT11_01855"
     CDS             470588..472702
                     /locus_tag="AOT11_01855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="ASM98211.1"
                     /translation="MALDMEQLRRMFYEECRENLEVLEDILLNLDPTQVEKDLIDTIF
                     RAAHSIKGGAATFNLLDISEFTHTVEAYLDKVRIGELVMSRDCVDVLLRSCDGIRLLL
                     EGHEAGEPVETGRLQHVSDELAQLLDCDDGESVASSFNEPSDSVSTTEPTEPELSEEG
                     SAPADDAGLWQVLFRPHSTIFYSGNDPLRILRELKELDDQAQLRCDASQLPDIQALDP
                     ELCYTHWTITLSSSVDKALIEEIFEWVEDECDLDITLLAPPVQNAEAAGTAENPAVIA
                     PVEVVSESAQATPAAKPATRSNKNDSAVTSIRVDIDKVDNLINLVGELVITQSMLAEI
                     GNDFSIDKLEKLKAGLDQLLQNSKDLQEHVLNIRMLPMSFAFSRFPRLVRDLCGRLGK
                     EVDLQIHGEHTELDKTVLERIVDPLVHLVRNGIDHGIEMPDVRQQQGKASFGTLTLNA
                     FHQGGSIIIEVKDDGAGIHCDRIWQKAIEKKVLPADSRREEMSDKQIVNLIFAPGFST
                     ADQVSDISGRGVGMDVVKRNIEELGGHIEVDSQQGQGSTFTISLPLTLAILDGQLVKV
                     AGEVYVIPLLTIIESIQIDPRHIKHAAGGVELYRLREENIPILRLQQEFAMGHSREFR
                     SKILCVVEAAGTRVGLLIDELLDQQQVVIKSLESNYQKVSGISGATILGDGSVSLILD
                     VQGLITNFLKRRTESGNSGIAA"
     gene            472712..473218
                     /locus_tag="AOT11_01860"
     CDS             472712..473218
                     /locus_tag="AOT11_01860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="ASM98212.1"
                     /translation="MESEQTVVIESQTMDEQSSADKVEYLSFTLANELYGIAIGDVEE
                     IRVWERPTPIPRSPAFVKGVINLRGMIVPVMDLRQRFCVGECHYLPTTVVIVLRHQAT
                     DHERLMGIVVDAVSDVVSLKSHDFYTSIGDTPVSAFMLGLVNVGDEVMTLLDTAELMD
                     IESFQEAC"
     gene            473218..473679
                     /locus_tag="AOT11_01865"
     CDS             473218..473679
                     /locus_tag="AOT11_01865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="ASM98213.1"
                     /translation="MELQEYLSFVVDDDEYGVPILDVREVRGWSDVRKVPNAPAYLVG
                     VLEIRGEYVPVADLRVRFHLPPSHISNTTVVVVLNDVQHNPLGIIVDAVAEVYALEEG
                     EIKPPPQTMKMEQRYIKGLAATSNGHLIIINLEALFDVAELTRTTVEEALM"
     gene            473688..476111
                     /locus_tag="AOT11_01870"
     CDS             473688..476111
                     /locus_tag="AOT11_01870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98214.1"
                     /translation="MAFWNRNKETHNSFRPQTSHPRDTLLNEVEEQEELSKEQLLSAL
                     NTAKTALMMVDRDFKITYINEQSMTLFKQHEGLFRKFWPSFSANKEFLMGACIDMFHR
                     NPAHQRQLLSTPANLPYSTVIAIDDVRLELNVGAMLDSAGNYVGNTLEWQDVTEERRK
                     EDSIARLQAAIDQAQTAMVMIDRDFLITYLNEETLTLFRRHEAAFRGVWSGFTASKEW
                     LMGRCIDEFHRNPAHQRKLLSDPNNLPYRTDIAVGDIRIELNVAAVKNAKGEYIGNSL
                     EWRDVTEQRINEEQVGRLASAVAGMTTNLMMADKNGIIRYLNPALENLLRSRESELQK
                     SLPGFDSRNLIGKSIDVFHKNPAHQQAIISNPDRLPFSSDIKVGSLEFNLTCIAMRDG
                     SGNYMGPALQWIDITEQRDGQRQVESLIQKAIAGQLKERIDTSVYSGFMKELGDGINS
                     LLDTLVEPLDQCIQVMSKVANGDLKTKMSDTHQGEFGRLAEAVNTSILNIRNMVDKIT
                     VSSARVATASTEIADGNNDLSQRVEAQASNLEETAASMEQMTATVRQNADNAKGANEL
                     SEDAAKKARKGGDVVGQAVAAMAEINTASKKISDIIGVIDEIAFQTNLLALNAAVEAA
                     RAGEQGRGFAVVAGEVRNLAQRSAAAAKEIKGLIKDSVEKVDEGSRLVDESGATLNDI
                     VAAVEKVTGLISQIAQSSIEQSTGIDEINRAVATMDEMTQQNASLVEETSAASQSLKA
                     EGKELLNLMSFFSTDSSVTTLETSPSAAPSAAKVTAMPTRGNISEMKKPKVANSGFRA
                     EESDEWEEF"
     gene            476096..476956
                     /locus_tag="AOT11_01875"
     CDS             476096..476956
                     /locus_tag="AOT11_01875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="ASM98215.1"
                     /translation="MGRVLSSEVTLEPAQEFELTDKDFKYVQWFIHKHVGIFLSDHKR
                     AMVYGRLSRKLREKGLKRFADYRECIENNPDDRMAFINALTTNKTHFFREIHHIEFLE
                     SQLFPYWRDQRKKKVRIWSAGCSTGEEPEPYSYLASIQQSGLWQAGVDCQLLATDLDT
                     NVLQRAQQGIYEESALECIPTCYLRGNFLRGKGAQAGNIKVKECLKQHVAFRQLNLLD
                     AWPMQQKFDLISCRNVMIYFDKPTQQRLIERFYHQLQDDGVLFLGHSESVGSDCQLFK
                     HLGKTIYIKA"
     gene            476972..477616
                     /locus_tag="AOT11_01880"
     CDS             476972..477616
                     /locus_tag="AOT11_01880"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MBQ4.1"
                     /note="catalyzes the conversion of glutamine residues to
                     glutamate on methyl-accepting chemotaxis receptors;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheD"
                     /protein_id="ASM98216.1"
                     /translation="MMLDSINHHFQAHEDAYYSRFFNEQRGLHMIKVLPGGVYVSGQE
                     ELICTGLGSCVSACIWDPVKRVGGMNHFLLPFHNHFEEKHWHADELLSGASRYGSYAM
                     EMLLNQLLSLGARRERLRMKLFGGAQMMGFHSMIGEKNVEFVLHYAEQEGLEVVAYDL
                     GGLEPRKIMFDPLTGKAWLKRIPFAEINHLRREEERYAHTLEKQTDKGSEVELF"
     gene            477616..478650
                     /locus_tag="AOT11_01885"
     CDS             477616..478650
                     /locus_tag="AOT11_01885"
                     /EC_number="3.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419912.1"
                     /note="regulates chemotaxis by demethylation of
                     methyl-accepting chemotaxis proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98217.1"
                     /translation="MSKKIKVLVVDDSPVFRALLSEIINSDPQLEVIGAAEDPYQARE
                     MIKALKPDVLTLDIEMPKMNGVQFLKNLMRLHPLPVVMISTLTQHGADATLMALELGA
                     VDYFPKPSVANTADMLGYRSLVNEKIRMAAQAQVGANQSMSPAVASSSAVSTSQYQLI
                     AIGASTGGTEAVKHLLSALPASMPPIVITQHISAMFSGPFASRLDASCALSVSELTQG
                     EVALKANHAYVAPGDKHLMVFRRGGQLYAHLDDSPAVNRHKPSVDVMFGSVAESLKGK
                     AIGVILTGMGKDGAQGMLQMKQQGAITVAQDEQSCVVYGMPRAAVECGAAMHIKPLNK
                     LPQFLCDLLS"
     gene            478702..479874
                     /locus_tag="AOT11_01890"
     CDS             478702..479874
                     /locus_tag="AOT11_01890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011152865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98218.1"
                     /translation="MEKSAQINYRTRYLIAVFCQIVALTFGAMIANSMGNIALMIIAA
                     AIPWFVLPSIFSLGRDENSESARVEREKKADPAWGPVGHFLQTAIPRVEQPLAKQKSV
                     IEASVETLNDSFFGLQRTCEEQSQVSERLVDDLLANQNSENSIANVMPRTEKIINRYI
                     DILINVSEKSISAVHSIHDMSDKLDAVFKLLNQVRGLSEQTNLLALNAAIEAARAGEQ
                     GRGFAVVAQEVRDLSVKAESLNNQIEREINIALSTVKQANHTVGEMASIDMTVAIESK
                     EEVDEMLRGVQKVNEMVEAQVQQIHELGAQLAQKVSSGIRALQFADIVVQQGDFASHT
                     MQNVEALQQLIKQHAASQISSDDLIQQVESLERQEQGRGEGAANQVSIDEGEVELF"
     gene            479915..480214
                     /locus_tag="AOT11_01895"
     CDS             479915..480214
                     /locus_tag="AOT11_01895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-anti-sigma factor"
                     /protein_id="ASM98219.1"
                     /translation="MSVMKEVDKTSNTVTLAIEGAFGFNLVQEFRNAYTEHLNSQFII
                     DLRKVDYIDSAGLGMLLNMQKHLNSADGRIKIINTLPQVRKILLISRFDKKFHIE"
     gene            480229..481905
                     /locus_tag="AOT11_01900"
     CDS             480229..481905
                     /locus_tag="AOT11_01900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system sensor histidine
                     kinase/response regulator"
                     /protein_id="ASM98220.1"
                     /translation="MKIYIVDDHPSNIEVCKMMLSDLDARISTFNSGLNVISALQEVN
                     ELPDVIVLDVMMPELDGFQTAQIIREAFPNRHIAIIFLTALDDQESFGKCLTFGDDFI
                     PKPVQRNVLLAKVQAHVRIAKMYNEVAKQRSELSHFHEQVRYDYTIAESIFANLKQEM
                     DGCLDVVSGVDYFSSPSTVFNGDLIILARRPHGGIYAMIADATGHGLPAAISAIPATR
                     AFNSMAAKGMALGEIVSEINSALVRFLPMGMMLAASLFEISGNGRHIRWWGGGLPDAF
                     LLNHDGSVAERLTSTHMPLGVLEEREFDASVISFELLEGQSIITYTDGVTESPNEEGE
                     QFGETRLLRVIEQHPYDIIKALQKAVAAFSCRQRHDDLSILTLKCPIISASPESEQTR
                     CDPQLLSQLPLKSCLTLNKPQIASHHLLPDLRAILKGVVSGGPHLDLICSVLSELLAN
                     AIDHGLLELDSKLKEDADGFFVYYQAREEKLEQLSQDAYLSIQFDYQPERTLLAIIIE
                     HNGVGFDYSNPVQQVQESQLHGRGRILLNELCESVVYSNGGKCVTATYQL"
     gene            482127..483800
                     /locus_tag="AOT11_01905"
     CDS             482127..483800
                     /locus_tag="AOT11_01905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polymerase"
                     /protein_id="ASM98221.1"
                     /translation="MWKLCLSWNEKKTEITAKLPEADLGSELVRKELDAVIAEMEGAE
                     LYLDDAEVVRFLNCARERKAEAYDGIVIAKRLNAQLDIEMTDNDMLASMKVTGAYGGR
                     GLRGSEIVHALAQARVTKGINKLALKKVLVVSNQLKAGEEFVQPVAQGKQPIKGKDAQ
                     FVPLVEDITKRVLKPEKGKSANAKIDMRNLGATITVDKGDEVMRREPATKGTPGFTVQ
                     GKIIPPQAGKDALLKPGKGTEIASYDPNLLIASQSGMPLIKEKTIEVDSALCLNNVGV
                     GTGHVKFKGNVVISGDIEAGMMVRATGSITVGGFIESADVQAQGDIEVGKGIIGHTVS
                     DGEPRSCSVKTKGKIVANYAQYSELQAGGNIELAVHSFNNEIRCGHDLLVIDANDRNG
                     TLSGGVAKVGGKVRCVQLGVEGDTATKVEAFARFSAYKDKIASLKEQYKLAQEETMDV
                     IRRELEFKKTPKSQREEGMEEAIAQMKAENNAQLEAVKGQLETLDAEFNALLELNTVE
                     ATEKVFTRVTVQFGDEQVITKRTHGGSIFSFNQYEIKVSSTLEEEDVAV"
     gene            484192..484809
                     /locus_tag="AOT11_01910"
     CDS             484192..484809
                     /locus_tag="AOT11_01910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001897898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98222.1"
                     /translation="MNTLQKIKLYILSLALLFVIIAIITAKLPKESFEWCKPEEACNT
                     KAILSNLFNYFFLLLKANAIPLVMLFLLAISWYFKYEFDHLLQGGGQKIIRIQSIENE
                     DYEHLTFLATYIIPFFGFKFNDPNQFTAIIVLLVIIGAIFVRTNKYYANPTLAVLGYR
                     LYKATLNDKNGVYESIVVISKDQLKENEIVHWEKISDNVFYIKRK"
     gene            484821..485777
                     /locus_tag="AOT11_01915"
     CDS             484821..485777
                     /locus_tag="AOT11_01915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98223.1"
                     /translation="MSKFKTWLEDFINGCDGIAVYFVDDANQIHDSDIDSKVLAKFRT
                     AFCQDLRKKYTDSDDFEVEKLSTFEERPHTLYAYDFSQREMPLEFKLTKNVLDIKPTD
                     TIPKYQVKANKLSGIRGAIVLLTKGISESIAFYQHIFPVSLLGPDKGVLNLTTHATRL
                     IELESDVLKLNTKFVFMQCTHGYFVENVGVLETNLHFKKAINTRAKKYAGEILSMGLV
                     EDTTVILDRIEKEPTYAKKLISAYKNSMVISQKIPISDMITFAQKKEYYSKYLKPSKN
                     GKSLVVDGVTKSKRFLELLNDNFLKSELTNTEYLARSKKAFK"
     gene            486275..486613
                     /locus_tag="AOT11_01920"
     CDS             486275..486613
                     /locus_tag="AOT11_01920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM98224.1"
                     /translation="MEASDIKRLKELEDENRRLKAMFAELSLEHRILKDIVEKSCKVK
                     PAIRRETNRVRSCLLTIITFCMSKLTENLCSYFGLQHVLGQFRVTNGVSRDSARMTKS
                     MEKLYIRGQF"
     gene            complement(486772..487251)
                     /locus_tag="AOT11_01925"
     CDS             complement(486772..487251)
                     /locus_tag="AOT11_01925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006069508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98225.1"
                     /translation="MTNNEILRRIQHALNLKNAQIMKAFGQAEVTVAHDKVENWLKDE
                     SEKSCVKMKDQELAVFLNGFINLKRGKKDGEQPKPEVTLTNNMILMKLRIALDMKAED
                     VLNVLEVVGISLSKYEIGAYFRKPDNKNYKQCEDQLLCDFLNGVQFTNRPDSEEFTG"
     gene            488429..489091
                     /locus_tag="AOT11_01930"
     CDS             488429..489091
                     /locus_tag="AOT11_01930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98226.1"
                     /translation="MRHGLLVLATMGMLYGCGSGDSSSADGRSSNGSCAADTKVVQVT
                     DNSGNRNSYHFFQNTCNDLVYTGTLDLAEIWGYKTNLPYTGFWEHNIQRYRLVRTSDN
                     FELFASLPRTPDNDEKSQGAIVCTTDISVDGKYTNTNITIYGATINEFCYQKGVESPI
                     IANYNVDYETLTQSKITELTTIVLKGNPTGSHFTQAMNSEKLMLCKVSSDEDMGKTQC
                     AK"
     gene            complement(489296..491728)
                     /locus_tag="AOT11_01935"
     CDS             complement(489296..491728)
                     /locus_tag="AOT11_01935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M9"
                     /protein_id="ASM98227.1"
                     /translation="MSVVMSLLPFPRRRLALACLLATVSGASFAQTQCDVAQLQQSPD
                     LAAAISSADYTCYSGWFSASADTLNNIYSEASLSRIQVALHQAVQTYQGEAEQARAIE
                     NLGEYVRAAYYVRYNAGNVAAFSDLLGQQFAHTINAFLANPHALDQGREQVGAMKSLT
                     LMVDNIKQLPLTMDAMMLALQQFNPETAKNTQWVDGLNNLFRSMAGHIANDAFYRYLA
                     SNTQHIDTLEKFANDNAWALDTDADFLVFNALRETGRLIASPDKATKQKAVQVMQRVM
                     ARYPLGSEHDKLWLAAVEMLSYFAPEALNGLDLPQAKRDLAARVLPNRHECQGPAIIR
                     SQDLTPAQAAKACDVLAAKEADFHQVANTGMQPVADDHNQRVEVAVFANNDSYVDYSA
                     FLFGNTTDNGGQYLEGNPADENNTARFVAYRYANGEELSILNLEHEYTHYLDARFNQY
                     GSFSDNLAHGYVVWWLEGFAEYMHYKHGYQAAIELIAQGKMSLSQVFATSYSHDTNRI
                     YRWGYLAVRFMLENHPQEVEGLLALSRSGQFEQWAQQVQTLGQQYDGEFARWLDGLEV
                     TPENPDTDPDTPTEPSDDVAQLQANQSITLSGEAYSEKLFYVDVPANTTHFSVAIEGD
                     GDADLYMSYNQVAHYYDFEVSEFVDGSNEEIQFAADASGYVKPGRYYLSITGRGSYQA
                     VNLTATVNTAAPTPPIQEQDDLAPVMLQSGQAQHLTVHQQRYAAVYVPEGVSEVRIWL
                     SDLTPSDSQGNVNLYASREHWPTPEQHQFASRYAGSNQYLAIPVEQAGYLHFSLNAPQ
                     QGDDVEMVVYFH"
     gene            492007..492621
                     /locus_tag="AOT11_01940"
     CDS             492007..492621
                     /locus_tag="AOT11_01940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="ASM98228.1"
                     /translation="MRQFFILRHGQTLFNAEQKLQGHCNSPLTEKGQRQALSVGRVLQ
                     GYLESGSYHVYSSSLGRALQTAEIVCQQLGYAAEEIIADDRLKEFSLGDWEQKTLPEL
                     QATRPNLLDEADWYLQAPNGERYEQVQQRLSQWLETLPETGRFVVVSHGLTGIVLRGM
                     LLDLDYEQVWQQDLPQDAFFKIVNGQVERVDCPMSEGRAQAVSA"
     gene            492970..493605
                     /locus_tag="AOT11_01945"
     CDS             492970..493605
                     /locus_tag="AOT11_01945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98229.1"
                     /translation="MAIYGVECLVRIFDAQGHSINPGLFFSELSDQLERFSFAILAAS
                     TLHVRNFVKSNYRNKHLFINTSPLLFEELANNQSAIDHLVGALNYYGLEPNQLIYEIM
                     ETAGGSERLAVSGVQNLLNNQIRTAIDDFGCHYSTKERVRLLHPAFVKVDKSIIQAGA
                     SQMQSAIACAHSVNALTIAEGIEDQQTLNQCIEVGFDYFQGYYLARPTKPM"
     gene            complement(493661..494719)
                     /locus_tag="AOT11_01950"
     CDS             complement(493661..494719)
                     /locus_tag="AOT11_01950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98230.1"
                     /translation="MKKTLLSVLLPAAFISNTVLAAEIYQAEDGSTVDLYSRLGFNIT
                     NKNNTHGDGKGEFDGRIGLSGSQTINEHVSVIGMAQYQVGAAEYANQVNDKPALTARY
                     VWAGIDAKEYGRITGGRVSSGLIMFTDIGDVFASSDVSMARQANKVDKTATQVFRQDG
                     TLQYQNQFGNLDLSAAYILGNNTSELDYGYNAALRYTIDMGDFGRLAPVVAIQKNKGD
                     AREGNDTDYTFWGVGTRYYLGDVMLGALYSEDELQGFYAQTSTDKVTELTAVYNLSDK
                     WALRAGYRSLQNSGGDELELNDTTLEVQYKLTARSSIYTSYVDRNGERGYSSGQETSF
                     GGAHADESYYHFGLRYEL"
     gene            complement(494884..496344)
                     /gene="murP"
                     /locus_tag="AOT11_01955"
                     /gene_synonym="yfeV"
     CDS             complement(494884..496344)
                     /gene="murP"
                     /locus_tag="AOT11_01955"
                     /gene_synonym="yfeV"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419924.1"
                     /note="belongs to PEP-dependent PTS system; catalyzes the
                     phosphorylation of incoming sugar substrates concomitant
                     with their translocation across the cell membrane; IIB is
                     phosphorylated by IIA and then transfers the phosphoryl
                     group to the sugar; IIC forms the translocation channel;
                     requires crr-encoded enzyme IIA-glucose component; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS N-acetylmuramic acid transporter subunit
                     IIBC"
                     /protein_id="ASM98231.1"
                     /translation="MAKITQTMISQLLAAVGGSSNVSKCGNCMTRLRLTLANNGVADQ
                     AVIKQIPGVMGVVESDEQFQIILGPGKAQQAAELMNKLIESVINGDVQEQAIASDTND
                     LSSVAAEQKKQMKSKQTSAVQRFLSKFATIFTPLIPGFIAAGLLLGFATLLEQMFVLE
                     QTPSQFMLDLIAYMKVFGKGLFAFLSILIGYNAQQAFGGSGVNGAILASLFVLGYNPD
                     ATSGIYSGMSEFFGYTIDPRGNIIGVLLAAIIGAQVERKVREYMPDDLDMILTSVVTL
                     LIMGVVTFVVIMPIGGELFKGMSWLFLNLNDNPLGAAILAGLFLISVVFGIHQGFVPV
                     YFALMEAQGFNSLFPILAMAGGGQVGASLALYFKAKKDAVLRTQVKGAIIPGILGIGE
                     PLIYGVTLPRVKPFVTACIGGAAGGFFIGLVSYLGLPVGLNTVFGPSGIVAIPLMTSH
                     SGIFAGMAVFVVGLLISYVVGFLATYFFGSKDIDLS"
     gene            complement(496370..497272)
                     /gene="murQ"
                     /locus_tag="AOT11_01960"
                     /gene_synonym="yfeU"
     CDS             complement(496370..497272)
                     /gene="murQ"
                     /locus_tag="AOT11_01960"
                     /gene_synonym="yfeU"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D4Z4.2"
                     /note="catalyzes the cleavage of the lactyl ether moiety
                     of N-acetylmuramic acid-6-phosphate (MurNAc-6-P) to form
                     N-acetylglucosamine-6-phosphate (GlcNAc-6-P) and lactate;
                     involved in MurNAc dissimilation pathway; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramic acid 6-phosphate etherase"
                     /protein_id="ASM99241.1"
                     /translation="MKIDLSRLVTESRNPASAEIDTLSTVEMLRVINQEDQKVALAVE
                     AVLPHIAQAVDAITHAFAHGGRLIYMGAGTSGRLGILDASECPPTYGTPAELVVGLIA
                     GGHTAILKAVENAEDNRELAQNDLKSLNLTANDVVVGIAASGRTPYVLGGLEYATLIG
                     ATTVSIACNPVCPMADAAQIAILPVVGPEVVTGSSRMKAGTAQKLVLNMLTSGAMIRS
                     GKVFGNLMVDVEATNAKLIQRQTNIVVEATGVCAEEAEEALKACDRHCKTAILMILSG
                     LDAEQAKNKLQQHNGFIRAALNDK"
     gene            497519..498367
                     /locus_tag="AOT11_01965"
     CDS             497519..498367
                     /locus_tag="AOT11_01965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020430958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="ASM98232.1"
                     /translation="MSVINKIVARRTQLSQSGRVIGDWIVENAEKAAQLTSQELAEQA
                     QVSQSSIVKFTQRLGFKGYSAFKLALTEEIGRKQAMQATPLHSDILADDPLAVIAQKL
                     IKAKTDAMFQTTNALSYEACHQAVQWLSEARRVQIVGIGGSALTAKDLSYKLLKLGIT
                     TLAEQDSHVQIAVARTLSEQDVQIAISFSGERKEILVAAEAAKEQGAKVIALSSPKKS
                     RLRQIADMTFDTIADETEHRSSAIASRSAQNVITDLLFIILVQLRDESARQMISDISS
                     DIRQIL"
     gene            498540..499754
                     /locus_tag="AOT11_01970"
     CDS             498540..499754
                     /locus_tag="AOT11_01970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="ASM98233.1"
                     /translation="MLKSSLSPSSSNLVLSILDLVLNEGSPLDRAYSRHFSELNLISA
                     EQARITMVTGDVLRRLNLYCFLADIDASNISRESMRLIHIWHKFHGLALPKTNYAEAI
                     EDDLFQAKMEEAKAQPALWDGCPEWLDVLGERELGELWAAERSALAKPAKRYLRVNLL
                     KCDRDDLAKRLNKEGVSTVPVDGVESALEVTSNSALFKTQSFADGWFEQQDAGSQKVA
                     AALEVKPGMRVIDACAGAGGKTLHLAAMMAGKGRLLAMDVEEWKLNNLKERARRAGAH
                     NVETRLITSSKTIKRLKLSADRVLLDVPCSGLGVLKRNPDAKWRDTEERLPVLMELQA
                     HILASYSRMVKVGGMLVYATCSIMPCENRGQVDAFLAANPHFRLIDDENITPANSGFD
                     GFYLARLERIAE"
     gene            complement(499824..500909)
                     /locus_tag="AOT11_01975"
     CDS             complement(499824..500909)
                     /locus_tag="AOT11_01975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="ASM98234.1"
                     /translation="MKKNLLAIALCSVIAVPMSTWAAQTTVKPSVEYAQLVTQRQVVD
                     QLLHDAVVAFKSPARVSHAGFTAKMPSNMEIVTDRLLEAYQLEPYRTDLLISAANAQI
                     YNKNVDKAIELFQQALSVAPDDVDLHTYLAVWQKFKGNEQAYQQHVTALNTLNPGRAA
                     DLQRLLSTVDRILQTPLKEKATRQLGSNDAIVTLGYALNPDGSMHDILIERLETTLAM
                     AKANPEALIILTGGVPQNHKTEGKLMADWLIERGISANRIIEENYATSTVDNALFSAY
                     ALARHGVKHATIISSASHVRRGQTLFEIATWQTGPRNITFDTVAYPDKPLNELKQASS
                     GELLGIYRDALRTFGMWSYRSSPLEFR"
     gene            501410..501700
                     /gene="groES"
                     /locus_tag="AOT11_01980"
     CDS             501410..501700
                     /gene="groES"
                     /locus_tag="AOT11_01980"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8CWI9.1"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="ASM98235.1"
                     /translation="MNIRPLNDKLIVERQEVENKSEGGIVLTSQSVKKSNRGKVIAAG
                     LGKRLENGERASMEVKVGDVVIFNDGYGVKTEKMDGKEYLILSESDVLAIVE"
     gene            501735..503333
                     /gene="groEL"
                     /locus_tag="AOT11_01985"
     CDS             501735..503333
                     /gene="groEL"
                     /locus_tag="AOT11_01985"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8CWJ0.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="ASM98236.1"
                     /translation="MAAKDVLFANDARQKMLKGVNLLADAVKVTLGPKGRNVVLDKSY
                     GAPTITKDGVSVAKAIELKDKFENMGAQMVKQVASKANDEAGDGTTTATVLAQALINE
                     GLKAVAAGMNPMDLKRGIDKAVDSAVEKLRAMAQPCSDKESITQVGSISANSDRAIGE
                     IIAEAMEKVGRNGVITVEEGQGLSNELSVVEGMQFDRGYLSPYFITNQDSGAVELDNP
                     YILLVDKKVSSIRELLPVLESVAKASRSLLIIAEDIDGEALATLVVNNLRGIVRAAAV
                     KAPGFGDNRKAMLEDIAVLTAGTVISEEIGLELEKATIEQLGSAKKVTITKDTTTIVG
                     GAAQESAIHDRVATIEKQIENTTSSYDKEKLQQRIAKLSGGVAVIKIGAATEVEMKEK
                     KDRVDDALHATRAAVEEGIVAGGGVALTKIASELADLKGDNDDQNVGIRVALRAMEEP
                     LRQIAINSGDEGSVVANAVKAGDAHYGYNAATGEYGNMIEMGILDPAKVTRSALQYAA
                     SVAGLMITTEAMITDHVADTSSEI"
     gene            503382..503594
                     /locus_tag="AOT11_01990"
     CDS             503382..503594
                     /locus_tag="AOT11_01990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98237.1"
                     /translation="MTRLPALSFSVRETGKACSNTDWPSVICFPSVTKGYPEFSIKKG
                     LAKPARVVVFTIDVSQLMRAGERVIH"
     gene            complement(503663..504781)
                     /locus_tag="AOT11_01995"
     CDS             complement(503663..504781)
                     /locus_tag="AOT11_01995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM99242.1"
                     /translation="MKLTLEPNSIAKCPCGLKAQAVHEYQWRNVKEATLLGMPVELSV
                     QTRRIKCSHCGIKTERLSWLEPYARITNRLRNYIEQLLPLLPIKHIAQLTGVHWHTIK
                     EIDKRRLQQVVPQVKWGELRQLVMDEFAIFKGHRYATVIADAKSHQVIWIGLGRSRKD
                     IRPFFEQLGEHGKNIEAVAMDMNTAFDLEVQEHCPNARIIYDLFHVVAKFGREVMDRV
                     RVDQANKLKQDKKARQWVKRSRWVLLKNRDNLNTQQESYLTEILNMNQDLMTTYLLGA
                     QLKELWRCGSELQAKNLWQVWWEQVNESGIKPLKEFARKLRPYLDGITASASYPLNTC
                     TLEGINNKIKLIKRMGYGYRDTDYFFLKIKAAFPGKPR"
     gene            complement(505005..505907)
                     /locus_tag="AOT11_02000"
     CDS             complement(505005..505907)
                     /locus_tag="AOT11_02000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98238.1"
                     /translation="MNNPLEFKWLEDFLSLMELGNFSAAAKARFVTQSAFSRRIQALE
                     VWIGVPLFDRTSYPITLTEHGQKFVPYAENLLNQVKVTKEDFAQASLKTDHTVRIVCL
                     HTLAVNLLPKLFLQSAEALSHLNLSVTPSVLGIDAHFQMLEDHSTDLLFTYNISAMRP
                     SLSLEEKLEKCVIHSEKVVPVVAPHLLESLKADQAIPYLSYSEHTFLSKVVEPVLKTL
                     PLTLKPVFETTLSESLVKMAIGGAGVAWVPMHVIEEELAQDRLVIAFEEQKEWQIPID
                     ILCYRSTTNHRAAVDQFWQEIDKS"
     gene            506087..507223
                     /locus_tag="AOT11_02005"
     CDS             506087..507223
                     /locus_tag="AOT11_02005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoaspartyl dipeptidase"
                     /protein_id="ASM98239.1"
                     /translation="MFTLLKNADLYAPNHVGNVDILVGQGKILAIEPQLNLRGLEAVT
                     QIDCHNKMVTPGLIDQHLHLTGGGGEAGFASRTPQVTLSHLIQAGSTTVVGVLGTDGI
                     SRSPRDLYAKAAALTEEGITAFMHTGSYEVPTQTITSSIRDDITFLPSVLGVKIAIAD
                     HRCSFPSLHELARIASDIRIAALLAKKRGLLHMHMGALKDAFAPIFELIQMGIPIYHF
                     SPTHVARTAPLFEQAIEFAKMGGYIDVTSGGTLYTSPQEAILHALEQGVAPSHITISS
                     DGNGSLPKFDAQGNIIGLTAASVDGNLKLLPMLIDCGVSPEVAFSMLSANVADSLGIR
                     KGRIQVGMDADLCIFNQDFSLNSVLAKGQTMLLNHELLVTGNFE"
     gene            507233..508699
                     /locus_tag="AOT11_02010"
     CDS             507233..508699
                     /locus_tag="AOT11_02010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="ASM98240.1"
                     /translation="MSLIIALLGLVFAGRLILKNYNPQAVLFFTGIVLMAISIFTNNA
                     SFVAKSTGWVGFDIFEYISQVFSKQSGGLGLNIMLIGGFALFMSAIGASQVMVKVAAK
                     PLMKLNSPYLMLALAFILGQALSLFISSATGLALLLMATLYPVLIRLGCSKAGVAAVL
                     ASTCAIEFGPASGNSILAAQTAGMDITAFFVGEQLPIVTVLIIAVALIHALTQRYFDK
                     LDAKSNAEQDSLANVDDAQSDAPMFYLLLPMLPLFFMLTFSKLGIESIKVSLSNAILL
                     SIFIGLVCEFVRVKQAKPVFDKLQGIFNDMGKVFAAVVTLIVAGQTFSMGLKSIGAID
                     AMLEMASGAGLSAAIIILFMAILTFTISALMGSGNAAFFSFAPMVPQIAQKIGANAAD
                     MILPIQLSAGMGRTISPIAGVIIAVAGISGLSPFDIVRRTFIPMFIGWLLMLAMTFAR
                     GGQLMQLLPFLVLMLAAVGVGAWLLRKRKAAQPEQASA"
     gene            complement(508738..509292)
                     /locus_tag="AOT11_02015"
     CDS             complement(508738..509292)
                     /locus_tag="AOT11_02015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011152841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="ASM98241.1"
                     /translation="MKKIAVVYFSKTDITHQLAQAIIDGIQAQDVQVIEHRIEGASII
                     EGRFEHPELFEVLLSCDAIIFGSPTYMGGVSAQFKAFADASSEFWADQRWANKLAAGF
                     TSGGGYNGDQSSTLQYLTTLAGQHGMLWVNLDVAGGFGPQGLNRLGQQSGVVAQGMEG
                     QAHPSDLATAQYLGKRVAQWVTRL"
     gene            complement(509458..511572)
                     /locus_tag="AOT11_02020"
     CDS             complement(509458..511572)
                     /locus_tag="AOT11_02020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010453721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="ASM98242.1"
                     /translation="MKDPLLNSLIYVSRYYGLANSPDALINGLPLSDGKLTPFLLPRS
                     AERAGLVAKENRAELSEISSLVLPAILLLKGGDSCVLISVNKEAGEAEITTLESGMVP
                     VLIPLEELQQQYTGRYFLVKKQFRYDERSPEILKTREGHWFWSTLWQSKHIYRDVLIA
                     SILINLFAIAAPMFTRIVYDKVVPNLAFETLWVLASGIFVVFLFDFILKMLRNYFIDV
                     AGKKSDILISSKLFSKVMGIRMESKPPSVGAFARHLQEFESIREFFTSATVSALIDLP
                     FALLFLLLIWLMAGDLVYVPIAGVVILMIHSALIQGPLRRSIEEGSRLASQKYANLIE
                     SLAGLETVKLFSAQGQFQYRWEEAVAHMANWNIKTRRLTDSIQNAAGFVQQSANVAMI
                     ILGVYLISNGDLTMGGLIAATMLSGKAIGPLVQLSLLSTRYNQAKSSMTIINQVMEMP
                     DEQEEGKRYIHRPMVQGKVELDRVTFHYPDAPVASIRDLSITINPGEKVAIIGRIGSG
                     KTTLERLIMGLYQPTAGHVRIDDTDIQQLHHVDIRRNIGCVPQDSNLFFGTIRENITL
                     GRPLVDDRDVLDAANRAGVTTFTQADPAGLERQVGEGGAMLSGGQRQAVSIARAFLGR
                     PPVLLMDEPTSAMDNRSEMQIKYQLSQLKPSETLILITHKTSMLDVVDRVIVMEKGSV
                     IADGPKAQVLSDLKQGKVRAVS"
     gene            complement(511585..513498)
                     /locus_tag="AOT11_02025"
     CDS             complement(511585..513498)
                     /locus_tag="AOT11_02025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM99243.1"
                     /translation="MTLYKQLVVGMITVFVLLMASVFVIEFNTTRNSLEQQQRSEMNN
                     TINTVGLALAPYLKDKDKVAVESVINALFDGSSYSVVRLIFLDSGEEIIRTYPIQPSS
                     VPTWFSQLNLFQRIHDQRIVTSGWLQLAEVEIVSHPGAAYEQLWKALMRLLTAFAGVF
                     FIGLLSISYILKRSLKPLTAIINKMNDIANNKFGDPLTRPHTKDLIAVVDGINRMSAQ
                     IEVSFKEQAKEAQRLREQAYIDPISKLGNRSYYISQLDQWLAENAPGGVAVLNAEYIG
                     EVYDNKDYQSADRMVAELAKQLDSTISIPGATLARISSDEFGLIFPHMDESELKIVAD
                     SIVNCVNMLNTDPTGTADAKVALGIAYIKESKTRSEMLSMVDNALSKAKATPEKKYGF
                     VGSDSQGGMMGKQQWKALVEEAIHNQWVHFRFQAANTINGQTFHREVFSSIEKDGQVY
                     RANQYLYALEQLEATHIFDQYVITSMIEKLQTGLVAEPLAINIAQSSLSQPSFIRWIT
                     NTLEKNRDVASLLHFEIPEECFIHQPHHAALLCHAIRTSGAEFGVDNYGRNFQSLDYI
                     NEYRPNYVKLDYLFTHNLDDEKQKFTLTSISRAAHNLGITTIASRVETQTQLDFLSEH
                     FVEVFQGFIVDKE"
     gene            complement(513504..514241)
                     /locus_tag="AOT11_02030"
     CDS             complement(513504..514241)
                     /locus_tag="AOT11_02030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase"
                     /protein_id="ASM98243.1"
                     /translation="MPLKSKPHMAREHWTRFTRATFHTGRWVLLAGLSMAGFYSQALN
                     TTEQKWIAAVTATYGERAGQRVNTWRENIDFFKLLEENEKLEGINDFFNQLYFVDDID
                     LWGQKDYWATPLEFLGSNAGDCEDFTIAKYFSLIELGVSDSKLRLVYVKAIELNQFHM
                     VLAYYKTPSSEPLILDNINPKIMKASKRPDLLPIYSFNGKNLWLMKSANANGQLAGDS
                     SRLSLWNDLRSREKTLKLNKPIINYDE"
     gene            complement(514225..515616)
                     /locus_tag="AOT11_02035"
     CDS             complement(514225..515616)
                     /locus_tag="AOT11_02035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="ASM98244.1"
                     /translation="MSSENYNKLSREELDFVDDKTAALLLNTPTNARLMLWVIVLFFA
                     VAIGWAAWAEIDKVTVGQGKVIPSSQIQIVQNLEGGLVKEILVKEGQLVQKGQQLLLI
                     DDTRFRSDYREREQQVANLTAAVLQLTSSIDSVEIDEEFTNAEWEKSVVIKYGQLAFP
                     AELEQQQPELIARQRAEYRQDLNNLRNQISVLTQQVKQKQQDLVEIQARVKNLRQGHV
                     FAKKELEITQPLADEGVVPKIELLKLQRQVNDTRRELTSTELKIPVLQSTIREAMLSR
                     IDAALKFRSEQQEKLNKTQDQLSALVESAVGLRDRVKRTVVISPVTGKIKTLNINTVG
                     GVIQPGMDIVEIVPTEDSLLVEAKIAPQDIAFLRPNLPAVVKFSAYDFTKYGGLDGEL
                     EHISADTTQDEEGNSFYIVRVRTEKTNFGQDAELPIIPGMTASVDIITGKRTVLEYLL
                     KPILSAQNNALKE"
     gene            complement(515719..516948)
                     /locus_tag="AOT11_02040"
     CDS             complement(515719..516948)
                     /locus_tag="AOT11_02040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011152838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator"
                     /protein_id="ASM98245.1"
                     /translation="MNSQIYFIDDEPHIRDSVSQALMIEGVEVTSFPNAVEALKHIDT
                     QQAGVVVTDIHMPVMNGLALLKELRSRNPHFQVIVLTGYGDVKTAVEAMKGGAYDFLE
                     KPFSTDSLLKAIRNAEDKLALLQENIWLKKELDMQTHAGSKLIGHSQAMVQIRRALIS
                     AQTDLPLILYGDKGTGKRLCAQFFYDIHNRNEGELVPISGFYFSDLSSEEMPQKLRQL
                     LAQHPNDTLFIHDAEVLKAKQWQILTETPLGTTKLVCAALSLPSTITGKIQSIALPTL
                     DQRKNDIPALYKHFVRNACSRYQVQPPRITAEELETVQQQTWPENIRQLRQFAELRAL
                     KSPQFLSADVDELQQAQAQTMAQRLDYFEYTLLFDALKRHGGRLKEVQQELQVSRKTL
                     YDKLKKHQLDKSQFKDQ"
     gene            complement(516945..518756)
                     /locus_tag="AOT11_02045"
     CDS             complement(516945..518756)
                     /locus_tag="AOT11_02045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011152837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM98246.1"
                     /translation="MSLVSRWSGYRFFLFMLLLGGIGLTVTHFAASHYQQNKWASILK
                     NYADRANQQLSSELAKFEQIPNLLSHDPRLLTYLTQPESNGLNQLLAEWSKQTLADTI
                     YLHNQQGVVIGSSNYQQDDTFVGEDFSFRPYFIEAMQGHIARYVALGIRSNKRGYFYS
                     APIWLENRIAGVITVKVSLEELENSLAPERADIMVLDQNNVVFLSNQATWRYTALAPI
                     APERIEAMVQNQQYGSQAPKAHPSVQLGDPANPQAQQRMMPQHQLYLSATNDNGFRVV
                     TLAAHQQRLITVLQADVIFVLIFSLLSLIAFAWQQTLNNKRQLALLNKQLESKVKQRT
                     EVLSESNQRLQQTIIQYEKTQQELKQTQQELTQAAKLALLGELSASINHEINQPLAAL
                     RTYTENSLKLMSMEKHQLVEHNLQQMLQLNETISEVIARLKIFTRKSTPDERHYYANL
                     HDSVHNATRILSNKLIKSGVTLKVATIPASLAANIHHIELEQVLINLIHNAIQALEGQ
                     ADGQIMIECAIEQDACQLIVSDNGPGIEATKLAHLFDPFFTTKPEGLGLGLTISKRII
                     ESYQGSLEAELHSPHGMRFTLSLPRLLSSDASTQEFV"
     gene            518969..519604
                     /locus_tag="AOT11_02050"
     CDS             518969..519604
                     /locus_tag="AOT11_02050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005449881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine 5'-phosphate oxidase"
                     /protein_id="ASM98247.1"
                     /translation="MELADIRREYTKGGLRRKDLKNDPIDQFNFWLEQAIKANLSDPT
                     AMTVATVDKDGMPFQRIVLLKNVDKDGFVFYTNLGSRKAQHLEHNSKISLHFPWHPLE
                     RQVHITGVAEKLTAMENMKYFTSRPKESQLAAMASRQSSRISARGVLEGKFLELKQKF
                     ANGEIPVPSFWGGFRVRPQSIEFWQGGEHRLHDRFLYSQEQGEWHIDRLAP"
     gene            complement(519654..520394)
                     /locus_tag="AOT11_02055"
     CDS             complement(519654..520394)
                     /locus_tag="AOT11_02055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="ASM98248.1"
                     /translation="MSCTVSNCLSNIEFSLFNQLPGCWGCKDRHSVFRYANQDYAWLV
                     GHRRPEDCIGLTDFDMPSPTVECAAEFQRQDQYVMESERTLKILDIHPYPDGRWHAHI
                     FTKSPWYNDSGEVQGTIFYGQELTDTAVLEVGYWICRATGITDGNLPRFRFNDASLSI
                     SDLTAREQETLFLLLYGRKPQYIANIMGISIKTVEGHVARLRTKFAANSKNELIDKAL
                     EAGFGSLIPESLLNTQLSVVLNGDHLSQ"
     gene            520938..521756
                     /locus_tag="AOT11_02060"
     CDS             520938..521756
                     /locus_tag="AOT11_02060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ASM98249.1"
                     /translation="MNESTKPQPEIIANIKLPKPAELVTLPSYMDCHDHLYTQIVIGL
                     KGQAEFEVRGQGNLVGPGQGCIVTACSDHAFGGVIGQSDILVLNMPVPNDDDPLLLQK
                     INQIEKSHLYFQLDAQIQKLIQMLVHEMQSNPEDLLLSRACNDTVMALMQRHMSAFET
                     PRKESRFDLDAIDRYIETHLSHKISVAQLAGSVFLGESQFHSLFKEQMGITPHQYLLG
                     KRIDMAKDLIEKGTLSLGQIAELTGFSGQSTFTHSFTRLQGVSPSQYKKQFGVK"
     gene            521940..525071
                     /locus_tag="AOT11_02065"
     CDS             521940..525071
                     /locus_tag="AOT11_02065"
                     /EC_number="1.2.1.88"
                     /EC_number="1.5.5.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082015.1"
                     /note="proline utilization protein A; multifunctional
                     protein that functions in proline catabolism in the first
                     two enzymatic steps resulting in the conversion of proline
                     to glutamate; in Escherichia coli this protein self
                     regulates transcription via a DNA-binding domain at the
                     N-terminus but the proteins from this group do not and in
                     addition appear to have a truncated C-terminal domain;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="ASM98250.1"
                     /translation="MFTATDVLKPEFVAQPLDKLWALISPLYMVDESQWLEQLLPLAT
                     PSAEEKQAIASRTTQLIEAIRADKKSIQLIDALLLEYSLDTHEGILLMCLAEALMRIP
                     DAATADALIKDKMSVADWKSHLKNSESVFVNASTWGLMLTGKVIGLADEETQSANQAL
                     NRLVNKLSEPVIRKAMYQAMKIMGHQFVRGRTIEEAQKNGRPMRDKGFTYSFDMLGEA
                     ALTTADANKYFKDYLMAIEAVGRETYGNDTSPAPSVSIKLSALHPRYEVANEHRVMSE
                     LFDTLAQLLKRAVELDVAITIDAEEADRLELSLKLFEKLYRSETVKGWGKFGLVVQAY
                     SKRALPVLVWLNALAKEQGDLIPLRLVKGAYWDSEVKWSQQRGYDNYPVYTRKEATDV
                     AYLACARFLLSDEVRGNIFPQFASHNAQTVSSIATMATHSDYEFQRLHGMGDSLYNHV
                     MEQYRQPVRIYAPVGSHKDLLPYLVRRLLENGANSSFVHRLVDARCPVAELTKHPVEA
                     LTSFETLNNTKIPLPAAIFPERKNSYGVNVDIESEAKPFEAQVESFLGKQWLAGPIIN
                     GASLAESMIKDDQAESVTAPYDRRIQVGQIAFSNLDHVSQAIDIAQAAFADWNRTPLV
                     EKARCLDNLADLMEANLAELVALCHQEAGKTLHDSIDEVREAVDFCRYYAKQAQNLQP
                     FELEGFDGVKRIASREGLGVFVCISPWNFPLAIFLGQVTAALVAGNTVVAKPAEQTSL
                     IAVRAVELMLQAGFPAGVVQLIPGRGADIGSALTSHPAIAGVAFTGSTATAQRINVTL
                     AQREAKPVPFIAETGGQNAMIVDSTALPEQVVRDVIRSAFASAGQRCSALRVLFVQQD
                     IADRVIGLIQGAMNELSVGVPHLHKTDVGPVIDARAKEKLLQHIEQMNQTQKPIAQLT
                     LADDCQHGDFVAPTAFEISGIDVLKEEQFGPILHIVRFKASELTRVVEQINRTGFGLT
                     MGIHSRNETTYRWIEKHARVGNCYINRDQVGAVVGVQPFGGQGLSGTGPKAGGPHYLY
                     RFTQVQFNQTENA"
     gene            525083..525790
                     /locus_tag="AOT11_02070"
     CDS             525083..525790
                     /locus_tag="AOT11_02070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="ASM98251.1"
                     /translation="MVHQVTSFSDAFSAWEQWNLTNFDYKCEHLLAFKAALDGKHALV
                     AKVVSYHLQQASSLLADAHLLVGPTGETNELYTAGRGVALVIVENEQSDSEQALYNAF
                     ALVTCALIAGNSVIVCSDNSEFNGLLSSALEQTHFPSNLVQMVAYDALLQLIDRDVRS
                     VGYVGNAQVEHELNLQLAKRDGAIVGLVSATDQAGALLAHDPHLSLRFITERTRTINI
                     TAVGGNATLLELGNDTH"
     gene            525860..527181
                     /locus_tag="AOT11_02075"
                     /note="proline:sodium symporter PutP; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            528302..528796
                     /locus_tag="AOT11_02080"
     CDS             528302..528796
                     /locus_tag="AOT11_02080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="ASM98252.1"
                     /translation="MSGYPLDRIDLQILRILHLKGRLPVVELAKQVNLTTSPCSERVK
                     RLEKEGYIKGYHAELNAEKLGLDVQVFIHIRLDQTSFSIFEKFAKAVADMPEIEECYS
                     LSGDFDTMIKVRVKSMKAYQEFMSSKLGTLPGVIQTRSEVVIEEHKTGFGVNPELLST
                     LYQK"
     gene            complement(528906..529610)
                     /locus_tag="AOT11_02085"
     CDS             complement(528906..529610)
                     /locus_tag="AOT11_02085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011082010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98253.1"
                     /translation="MNKSLLTNVIALAALAAGFALKNDYLLYAGLFAFSGAITNWLAI
                     HMLFEKVPGLYGSGVIPARFEEFKAAIKNLMMEQFFTSENIDKFLSKEMAGGKSFNLE
                     PIIAKVDFNPTFDSLVDVIAQSQFGGMLAMFGGTEALIPLKQPFVEKMQQAMVDLSHS
                     DTIKQALKEELEAPAMMEEIQQNIENIIDQRLNELTPKLVKEMVQKMIKQHLGWLVVW
                     GGVFGGLIGVITSVVA"
     gene            complement(529763..531622)
                     /locus_tag="AOT11_02090"
     CDS             complement(529763..531622)
                     /locus_tag="AOT11_02090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="ASM98254.1"
                     /translation="MFKRFESFTNPFPAGTPEQPPEGLLAFCRHYTRGFEKPLILMSL
                     LSTIVAIVEVSLFGAMGQLVDWLSNSDPQTFLEQNQSELIYYGVILLVVMPTLIVGYS
                     LLVHQSLLGNYPMSIRWLAHRYLLNQSLNFYQDDFAGRVATKVMQTSLAVRESVMKTM
                     DVFVYVSVYFTSIIVMLAAADWRLMVPMVIWLLIYIGIQVYFVPKLKDVASAQADARS
                     TMTGRIVDSYTNIQTVKLFSHSKRETEYAESGMREFLDTVHRQMRLVTGFNIAVQVTN
                     YVLVFSIGALSIHLWLGGAISVGAIAIAVSLALRINGMSMWIMWEVGSLFENMGTVVD
                     GMKTLSKPIDIQDKPQATELVVKQGGIEFDDVSFHYGENKGVINHLNLHIKPGEKIGL
                     VGRSGAGKSTLVNLLLRFHDVESGKIKIDGQTISEVTQDSLRAQIGMVTQDTSLLHRS
                     IRENILYGNPDASEEELLRATKQAHAHEFIETLTDPFGNVGYDAQVGERGVKLSGGQR
                     QRIAISRVLLKDAPLLVLDEATSALDSEVEAAIQESLNELMQGKTVIAIAHRLSTIAQ
                     MDRLIVLDKGNIVEQGTHQELLQKNGIYAQLWAHQTGGFLADDCPEMEENQIA"
     gene            531956..532933
                     /locus_tag="AOT11_02095"
     CDS             531956..532933
                     /locus_tag="AOT11_02095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011081987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="ASM98255.1"
                     /translation="MLLPNETIRPQLDATQNADCVVMVPPKEFRFNEETARDNEFQNQ
                     IALSQEEVRSKTLAEFRAMVSKLRQEGVQVVEFDYPESDIATPDAVFPNNWFSTTAEG
                     GFYTFPMACENRREEVRPQALIEALTAAGREVHRQDSLTYYVTEEAFLESTGVMVIDH
                     LNRTIYAALSQRCDRLVLEEYAKRIGYERVISFQTLLPSGKPIYHTNVMMAIGEQFCV
                     ICDEVIPEFERRFVLKSLAKDKQVISISIEQMNRFCGNILQLETVNGSKVIAMSQSAY
                     DAFSEAQRNQLATHGKLLPFDVTTIEDIGGGSVRCMLGEVFLPKRKAVL"
     gene            complement(533025..533453)
                     /locus_tag="AOT11_02100"
     CDS             complement(533025..533453)
                     /locus_tag="AOT11_02100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM99244.1"
                     /translation="MKLLHLQLFWYEKHHTLLEMEDLPILTPAQEKELREWAKTRRKI
                     LSYEVHQHAWLKVNVDGFSSTLHLKPNGTLVEKDLFSEKALQGLWKVIDGFLFIKVIS
                     GEFIVEYQIVGNKEQNIHCGIEYINGKVSTYSKFAQIMSA"
     gene            complement(533676..534557)
                     /locus_tag="AOT11_02105"
     CDS             complement(533676..534557)
                     /locus_tag="AOT11_02105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017818332.1"
                     /note="L-xylulose 5-phosphate 3-epimerase activity not yet
                     demonstrated; may be involved in the utilization of
                     2,3-diketo-L-gulonate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylulose 5-phosphate 3-epimerase"
                     /protein_id="ASM98256.1"
                     /translation="MYQNLQRHRVGLYEKALPNSLSWEEKLRVTKELGFDFLEISVDE
                     SDERRSRLDWDDETIYALRHQCERYGLPLHSMCLSAHRKFPFGSADAKIREQALLHME
                     KAIALAYKLGVRTIQLAGYDVYYEPANRATHLRFIEGMKLAAKLAERAGVMLAVEIMD
                     TDYLNSLSKFEVLNREVNSPYFTAYPDVGNISGWNYDVCTELKLSKPHITQIHLKDTH
                     RVTPDSQGQFRDLVIGDGEVNFDAIFKTLKETDCVVPLVIEMWAQDEDWRAHIHTAQQ
                     RLNRACDHADLPRLFAA"
     gene            complement(534566..535213)
                     /gene="ulaD"
                     /locus_tag="AOT11_02110"
     CDS             complement(534566..535213)
                     /gene="ulaD"
                     /locus_tag="AOT11_02110"
                     /EC_number="4.1.1.85"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020195066.1"
                     /note="catalyzes the formation of L-xylulose-5-phosphate
                     from 3-keto-L-gulonate-6-phosphate in anaerobic
                     L-ascorbate utilization; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-keto-L-gulonate-6-phosphate decarboxylase"
                     /protein_id="ASM98257.1"
                     /translation="MTKPMIQIALDQTNLTDAIAVASNVHSYVDVIEVGTILAFAEGM
                     NAVSTLRENHPDHILVCDMKTTDGGAILARMAFEAGADWITVSAAAHIATIKACKKVA
                     DEFNGEIQIEIYGNWTMQDAQAWVDLGITQAIYHRSRDAELAGVGWTEADLNKMRELS
                     QLGLELSITGGIVPEDIYLFEGIKAKTFIAGRALAGEQGQQTAEALKAQINRYWN"
     gene            complement(535219..536040)
                     /locus_tag="AOT11_02115"
     CDS             complement(535219..536040)
                     /locus_tag="AOT11_02115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005434688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="ASM98258.1"
                     /translation="MYKVLALDLDGTVLTDDHSIHPEVKSAIMEAKHKCHVVIVTGRH
                     HTAARPYYDELGLTTPIICCNGTYVYDYHNDQVLKHNSIDKEDALTFIALAKEFQVKM
                     VMYVTDAMTYSNYNPIHYMEALEKWAKTAPKHHQPKIYKIDSFSDQVRDTEYVWKFVV
                     EGLPSSVERLLENPWVSAKFNGERSWSNRIDFAAKGNSKGLRLAEYVSELGYHPNHVI
                     AVGDNHNDISMLRYAGLGVAMNHADETVRANARLVCETDNNHDGLARLIREKIQG"
     gene            complement(536045..536737)
                     /gene="araD"
                     /locus_tag="AOT11_02120"
     CDS             complement(536045..536737)
                     /gene="araD"
                     /locus_tag="AOT11_02120"
                     /EC_number="5.1.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000286771.1"
                     /note="catalyzes the isomerization of L-ribulose
                     5-phosphate to D-xylulose 5-phosphate in the anaerobic
                     catabolism of L-ascorbate; links the arabinose metabolic
                     pathway to the pentose phosphate pathway and allows the
                     bacteria to use arabinose as an energy source; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose phosphate epimerase"
                     /protein_id="ASM98259.1"
                     /translation="MYSELKQRVLEANLKLPKYGLVTFTWGNVSEIDRERGVIAIKPS
                     GVEYEGMRVEHIVVVDLDGNIIEGKLNPSSDTATHLEIYKAFPDVGGVVHTHSRSATI
                     WAQAGIDIPALGTTHADYFYGDIPCTRKLSQSEIAQEYEKNTGLVIVEEFRHRRIDPM
                     AVPSVIVAGHAPFSWGTNADDAVHNAVVLEEISAMALATRSLNSGIKIQPELSDKHYL
                     RKHGENAYYGQR"
     gene            complement(536747..537223)
                     /locus_tag="AOT11_02125"
     CDS             complement(536747..537223)
                     /locus_tag="AOT11_02125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791327.1"
                     /note="involved in the phosphorylation and transport of
                     sugars across the cell membrane; protein IIA transfers a
                     phosphoryl group to IIB which then transfers the
                     phosphoryl group to the sugar; IIC forms the translocation
                     channel for the sugar uptake; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate-specific transporter subunit IIA"
                     /protein_id="ASM98260.1"
                     /translation="MGLKQSLIENNSIKLQAQASNWRDAIKIGTDMLIASGAIEPCYH
                     DAIISSVEELGPYICIAPNLALPHARPENGVNRTAFALVTLETPIYFDGEDEPVDVLI
                     TLAGSSSDEHMEGLMEVTQVLDDEESDTGVDLDKLRRCRSLTDVFNVIDDALAMTA"
     gene            complement(537293..539053)
                     /locus_tag="AOT11_02130"
     CDS             complement(537293..539053)
                     /locus_tag="AOT11_02130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728426.1"
                     /note="functions with enzymes IIB and IIC, enzyme I and
                     HPr for anaerobic utilization and uptake of L-ascorbate;
                     sgaTBA are regulated by yifQ as well as Crp and Fnr;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate-specific subunit IIBC"
                     /protein_id="ASM98261.1"
                     /translation="MEFLYDIFYIFYSQVMTKAPLLLGLVTLIGYWLLRRDTTTIIKG
                     SIKTIVGFMLVQVGAGTLVAGFKPVISKLSEFHGLTGSVIDPYTSMMSTMEAMGDNYS
                     WVGYTVLLALGINILLVLFRRYTGIRTIMLTGHIMFQQAGLIAVFYFVLGASMWETII
                     YSAVLMALYWGISSNIMFKPTEEVTGGAGFSIGHQQQVASWIATKVAPKLGDKNDSVD
                     HLELPKWLHIFHDSIAATAIVMTVFFGIILLSFGLDNLQAMAGSTHWSIYILETGLKF
                     AVAIQVIVAGVRMFVAELSEAFKGISERVIPNAVLAIDCAAIYAFSPNAMVFGFMWGA
                     VGQFTAVLAMLAFDAPIMIIPGFIPMFFSNATIGVFANHFGGWKAVMKICFVMGIIEV
                     VGSAWAIHLFNQQGTEFNGWMGMADWALVFPPIMQGLSASKMFFFVLVGLSLVYMFFA
                     SRKLRAEEDAQGTLMVSEEPDVIEAVEQAIKASDGVRPVSILAVCGNGQGSSMMMKMK
                     IGKYLEKKGIPHVMDSCAVSDYKSKLASTDIIVSSKHLSAEMEPGEGKFVLGVQNMLN
                     PNSFGDELLDIINKNFVSAK"
     gene            539440..540195
                     /locus_tag="AOT11_02135"
     CDS             539440..540195
                     /locus_tag="AOT11_02135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011152802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98262.1"
                     /translation="MNEVQRHNGILSLLEENQTINVAHIIERFNVSPATARRDISKLD
                     ELGKLRKVRNGAERVEAKKRKWSPLNINSTEHYEEKSLIAMQAAELCQPGDSVVINCG
                     STAFLLGQRLCGQDVQIVTNYFPLASYLINEDHDDVIIIGGQYNRSQNIFLNPAPNSL
                     GGYAGNWMFTSGKGLTEAGLYKADMLTAVAEQQMLEQIDKLVVVVDSSKVGQRTGMLF
                     CPAEKIDILITGKSANPDVIKAIEAKGTKVILV"
     gene            540319..541386
                     /locus_tag="AOT11_02140"
     CDS             540319..541386
                     /locus_tag="AOT11_02140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006069731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ascorbate 6-phosphate lactonase"
                     /protein_id="ASM98263.1"
                     /translation="MSKVNEITRESWILSTFPEWGTWLNEEIENTVVEPNTFSMWWLG
                     CTGIWLKSEGNTNISIDFWCGTGKKTQKNAFMKNQHQMMRMGGVEALQPNLRTAIFPL
                     DPFAIKEIDAVLASHDHGDHIDVNVAAAVLQNCGEHVKFIGPQACVDLWMGWGVPEER
                     CIVAKVGDVLEVGDMKIRILDSFDRTALVTLPEGVSSYDKEILDGMDKRAVNYLIETS
                     GGSVYHSGDSHYSNYYAAHGNEYQIDVALLSFGENPRGVTDKMTSSDILRAAESLDCE
                     VVVPFHHDIWANFQNDPREIEVLWNMKKDRLQYKFAPFFWQVGGKYTFPTDKGRMHYQ
                     HFRGFSDIFKNEPELPYKAFL"
     gene            complement(541432..542526)
                     /locus_tag="AOT11_02145"
     CDS             complement(541432..542526)
                     /locus_tag="AOT11_02145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-ethylmaleimide reductase"
                     /protein_id="ASM98264.1"
                     /translation="MSKLFEPTQLKQLDLLNRVVMAPMTRARTSQPGNIPNQMMATYY
                     KQRATAGLIISEATQISDDSQGYSFTPGVYTDEQVAGWKLVTQAVKSQGAAMFCQLWH
                     VGRVSHPVFQKGEQPIAPSALAPVETKVWIADEQGNGNMVDCVEPRAMTQADIDRVVS
                     DFAYAAKRAIEAGFDGIEIHGGNGYLIDQFLRTNSNHRTDNYGGTRENRLRFLLEVVD
                     AVSKAIGANKVGVRLAPFITFKDMNCPDIVPTILDASKQLQARDIAYLHLSEADWDDA
                     PVIPESFRIELREYFTNTIIVAGSYTQARADEVLEKGYADLVAFGRPFVSNPDLVARL
                     KHQQPLAELDGATLFGGNERGYTDYTALHV"
     gene            complement(542537..543166)
                     /locus_tag="AOT11_02150"
     CDS             complement(542537..543166)
                     /locus_tag="AOT11_02150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="ASM98265.1"
                     /translation="MKLYIYEHCPFSARVRYVAGMLNIPLEIINLAYDDDTTTNDLIG
                     AKQVPLLLKNDGQALAESLDIIAYFIELAQSSESHQPSESVLDWQRSAFLPLQKIGYP
                     RWSNMDLPEFATQSAQQAWRTKKETDALNFDALLQDTPNIAKEVEALIERAKNVLNLD
                     SYQHVTLVDEAILFSILRGFFSATEIQWDNTVKDWMESVSNKTQVPLLK"
     gene            complement(543245..544432)
                     /locus_tag="AOT11_02155"
     CDS             complement(543245..544432)
                     /locus_tag="AOT11_02155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010452926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="ASM98266.1"
                     /translation="MNKEKMPLQVWILTLAAFAIGTAEFVIAGILPQVANSLSITEGQ
                     AGYLISAYALAIVFGGPLLTIYLARFNKKAVLAGLMVLFILGNVLSAFAPNYFVLMVS
                     RVITGLVQGPFYGIGAVVATNLVSEKMAGRAVGQMFAGLTLANVLGVPGGTWIGLQFG
                     WHTTFLIVAAFGLVALFFITSVIKSTGHGEAKDVKAQLAAFKNPMLLISLAITVFAWS
                     GFMTLYGYIAPIAMHITGFSESAVTWILVIVGVGLIIGNTMGGRSSDKNLQKASMFWA
                     IAMIVSLVLVGITVDSKVLFIATAFVFGIASFANVPAMQLRVMNHGGEGQELAATANI
                     SAFNLANAFGGFLGGMVLDSQMGAGMIPYAAVIVPLIGLLFIAKANRKENKQIDLAPS
                     FNN"
     gene            complement(544533..545201)
                     /locus_tag="AOT11_02160"
     CDS             complement(544533..545201)
                     /locus_tag="AOT11_02160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017789031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="ASM98267.1"
                     /translation="MKTEKTVYVVLGGTSGIGAELSQQLASDNAVVHVASRKTGLDIS
                     DEKSVYHYFETIGAFDHLIVTAGSYAPAGQVTDVEVSQAKYAFDTKFWGAINAAKHGA
                     RYIKKGGSITLTSGMLSRKVVANTYVKTAINAAIEATTKVLAKELAPIRVNAVSPGLT
                     KTEAYRGMSEDDRNAMYQRTQNSLPVGKVGGASDIAKAYLLLIENSYMTGAVIDVDGG
                     ALLG"
     gene            545323..546249
                     /locus_tag="AOT11_02165"
     CDS             545323..546249
                     /locus_tag="AOT11_02165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM98268.1"
                     /translation="MDKFSDMTLFVSIVKNQGLAAAGRELGLSPATVTARLQSLEDRY
                     GVKLLNRSTRHISLTDSGAMYHQACLEIIDSVKETENLLQTGTKEVRGALKISAPRDI
                     GKQYISPILSEFSQLYPDVIPYLYLNDNLSNLAESGLDIVIRYGELADSNLISRKLAS
                     SRRVLCASPQYLAKKGTPITPQDLAQHDCLAMVRSNEELKTWHFQDEELHNVVTVVPK
                     RFSDDGEVIRQWALDGAGIALKSILDVQEDIKQQRLVTVLNGYMKNFNASTSSAGADL
                     NVIYLSRQYQPKRLRLFIDFLLAQFQARFPAS"
     gene            complement(546225..546746)
                     /locus_tag="AOT11_02170"
     CDS             complement(546225..546746)
                     /locus_tag="AOT11_02170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011081973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98269.1"
                     /translation="MENGLAQGIGGIAFLVGVMAFWQKDDLRFRYQMMAFCFIMGIHF
                     ALLGATVAAIGVVINGIRSFASIKTQSRKVMWFFIALMWLMTLPNMSHFFEFITVFGS
                     SVATWALFSKQGIALRSLILFNSFCWVSHNLWLGSIGGSLVESTFIVTNLFTIYRLYQ
                     QRSAQRHEAGNRA"
     gene            complement(546841..547470)
                     /locus_tag="AOT11_02175"
     CDS             complement(546841..547470)
                     /locus_tag="AOT11_02175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017189832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphogluconate aldolase"
                     /protein_id="ASM98270.1"
                     /translation="MSSIKEQLKALKVIPVIAIDKAEDIIPLGKVLAENGLPAAEITF
                     RSAAAAEAIRLLRETQPDMLIGAGTVLNREQAIAAKEAGATFIVSPGFNPNTVKACQE
                     IGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGINMVKSLLAPYTDIELMPTGGI
                     NPANIKDYLAIPRVLACGGTWMVDKKLIEAGNWEELARLTREAVALVNE"
     gene            complement(547480..548457)
                     /locus_tag="AOT11_02180"
     CDS             complement(547480..548457)
                     /locus_tag="AOT11_02180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020194165.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate-6-phosphate from
                     2-dehydro-3-deoxy-D-gluconate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketodeoxygluconokinase"
                     /protein_id="ASM98271.1"
                     /translation="MKHIAIIGECMIELNGKPFGSMHQTFGGDTLNAAVYLSRGCEAN
                     SKPDEVKVSYVTALGNDPISTGMLTRWEEEGISTNLVLRDETRTPGLYLIQLDDQGER
                     TFLYWRNQSAARYLLQHPHFGMVKQALTQVDAVFLSGISLAILPDEDRISLLNLLVEL
                     KAQGVEIAFDSNFRPALWPNDDNQTVKNVYQAMYQLTDVALVTFDDEQLIWGDETPEQ
                     TIERLTSLGVGKCIVKLGADGCLVQDSTNQGSSAALAPQAVPTQPVAQVVDTTSAGDS
                     FNGGFLSAYLAGADLATSCQRGNALAGAVIQHRGAIIPKAFTQPALGVV"
     gene            complement(548461..549873)
                     /locus_tag="AOT11_02185"
     CDS             complement(548461..549873)
                     /locus_tag="AOT11_02185"
                     /EC_number="5.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791321.1"
                     /note="catalyzes the interconversion of D-glucuronate to
                     D-fructuronate or D-galacturonate to D-tagaturonate;
                     functions in glucuronic and galacturonic metabolism;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucuronate isomerase"
                     /protein_id="ASM98272.1"
                     /translation="MKNFLCEDFLLSNETARRLYHEHAFHQPIYDYHCHLNPAEVAQN
                     RQFDNLGQIWLEGDHYKWRGMRSAGIEERLITGDASDYDKYMAWAKTVPQTLGNPLYH
                     WTHLELRRPFGITNTLFSPDTADQIWHQCNELLATPEFTARGIMQQMNVVMAGTTDDP
                     IDSLEHHKAIAEDDTFNVKVLPSWRPDKAFKIELDVFADYMHKLGEVADIEIRRFDDL
                     LSALDKRLAHFDAHGCRAADHGIEIVRYAPIPSEADLDALLTRRLNGEVLSELECAQF
                     STAVQVWLGKRYAKLGWVMQLHIGAQRNNSTRMFQLLGADAGFDSIGDRPFAFELAHL
                     LDEMDQTNELPRTILYCLNPRDNEMMATMMGNFQGGGIAGKVQFGSGWWFNDQKDGMQ
                     RQMEQLSQLGLLSQFVGMLTDSRSFLSYTRHEYFRRILCDMVGRWAENGEVPNDLSLL
                     GPMVEGICFGNAKRYFEERA"
     gene            complement(549886..551349)
                     /locus_tag="AOT11_02190"
     CDS             complement(549886..551349)
                     /locus_tag="AOT11_02190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005477431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-mannonate oxidoreductase"
                     /protein_id="ASM98273.1"
                     /translation="MKTIANSTLNAAVSLPDYDRSTLTSRIVHLGFGAFHRAHQALFT
                     HEMLSKTGSDWGICEINLFGGEELIQSLRAQDHLYTVAEKGAKSTEIKVIGSVTESLH
                     PSLDSIQAVLEKMAEPQVAIVSMTITEKGYCADPATGTLDKNNPLVIADLANPTEPKS
                     ALGYIVQALKMRRERGLTPFTVMSCDNVQENGHVAKAAVLEFAQLLDPELRDWIATNV
                     TFPCTMVDRIVPAATEETLSEIADLLGCEDPCGIACEPFRQWVIEDNFVAGRPDWNVA
                     GAEFVADVVPYEEMKLRMLNGSHSFLAYLGYLGGYAHISDTMTDEGYRKAAFDMMMQA
                     QAPSLTMPEGTVLEGYAKLLIERFTNPSLKHKTWQIAMDGSQKIPQRMGGSLRFHLAQ
                     GSNFSWLATAIAGWMRYVSGVDEQGNDIDVRDPMAETLRQICDQHGLNVSVVPALLAV
                     EAIFPAELGQHPQVIDAVSSAYQSLIDNGARATVAAL"
     gene            complement(551401..552702)
                     /locus_tag="AOT11_02195"
     CDS             complement(551401..552702)
                     /locus_tag="AOT11_02195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004404200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98274.1"
                     /translation="MEWQLILTLFGSFAVLLAIGVPVSFAIGLSSLATILMGLPLEPA
                     IAVVAQRMAAGLDNFALLAIPFFILAGNIMNQGGIALRLINFAKVLGGRLPGSLAHVN
                     VMANMMFGSISGSAVASAAAVGGTMSPLQKKDGYDENFSAAVNITSCPSGLLIPPSNT
                     LIVFSLVSGGTSIAALFLAGYIPGILMGLSIMVVAGIIAKRRGYPIAARPTLAMVWDT
                     FLKAAPSLALIMVIMGGIIGGIFTATEASAIAVVYTFVLAVLVYREVKWRDLPKIILE
                     SAVTTSIVLLLVGASMGMSWAMANADIPYMIADALLAISDNPMMILLIINIILLIVGI
                     FMDMTPAVLIFTPIFLPIALDMGIDPVHFGIMMTFNLAIGICTPPVGSALFIGCSVAN
                     VAIDKVIKPLLPFYVALIAALMAVTFIPELSLFLPKLVLGY"
     gene            complement(552714..553235)
                     /locus_tag="AOT11_02200"
     CDS             complement(552714..553235)
                     /locus_tag="AOT11_02200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011081969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter permease"
                     /protein_id="ASM98275.1"
                     /translation="MKMNKLVTYINRGLAAFTVSLSTFLVFCVVWQVLSRYVLGKPST
                     VTDELARYLFMWVALIGAAYTTGLKRHLAIDLLTMKLKGKKKLVNEIVIQVAIALFSY
                     VVLVHGGTQLALKTLATGQLTPALGLEMGYIYFCLPISGALMIFYSVIFAYERVKQLM
                     SGETLVTDSQLDS"
     gene            553552..554535
                     /locus_tag="AOT11_02205"
     CDS             553552..554535
                     /locus_tag="AOT11_02205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000989019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98276.1"
                     /translation="MMTRKTLISALVGAAMTFGATASAYAATTLKLSHNHPRDHAVHK
                     AMDYMAKEVRELTGGEVRIRIYPDAQLGTQRESMELMQNGALDMVKSNAAELEAFSPA
                     YSAFNLPYLFRDKEHYYKVTDGEVGREILNSSAQSGFIGVTYYDAGARSFYTSKPINT
                     PADLKGLKVRVQPSPSAIAMVKALGGNPTPLAYGELYTALQQGVVDAAENNIPSFSLS
                     RHSEVSKFFSLDEHTMVPDVLVISTKTYDKLTPEQQQALMKAAADSSEYMKKLWAESE
                     AKERAKAEKMGVTFVEPNKAAFVEAVQPMYQEIEKSNPQLNQLIERIKAVQ"
     gene            554643..555434
                     /locus_tag="AOT11_02210"
     CDS             554643..555434
                     /locus_tag="AOT11_02210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017791317.1"
                     /note="regulates the expression of uxuBA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM98277.1"
                     /translation="MEYSDNIIMMPFEPKRPYQEIGLVLRKELINGHYKVGDRLPPER
                     DIAERLDVSRTVVREAIIMLELENLVEVKKGSGVYVINIPSKNNARENVISDDAGPFE
                     MLQARQLLESNIAEFAATQVTPGDIVKMRAALKLERDELASGTEDCNGDEKFHMCIAE
                     ATQNSVLVDMLRQSWERREKSPMWKKLHSHISSQDYREEWLDDHAKILAALQRKDPIA
                     AKNAMWQHLENVKQRLLELSDVDDPNFDGYLFSSNPVVLLSAEKV"
     gene            555564..556751
                     /locus_tag="AOT11_02215"
     CDS             555564..556751
                     /locus_tag="AOT11_02215"
                     /EC_number="4.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421379.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate from mannonate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannonate dehydratase"
                     /protein_id="ASM98278.1"
                     /translation="MEQTWRWYGPNDPVSLDDIRQAGATGIVNALHHIPNGEVWSKEE
                     ILKRKAIIEAKGLTWSVVESVPVHEEIKTQTGNFQQWIDNYKQTLRNLAECGIDTVCY
                     NFMPVLDWTRTDLEFEMPDGSKALRFDQIAFAAFELHILKRPGAEADYTEAEQAQALA
                     YFNNMSEAQIQQLTSNIIAGLPGAEEGYTLEEFQAQLDRYAGISKDKLREHMAHFLAE
                     LMPVCEAHGLKLAVHPDDPPRPILGLPRIVSTIEDIDWLTEKVPSKMNGLTMCTGSYG
                     VRGDNDLVKMIKKHGERIYFTHLRSTKREESNPMTFHEAAHLDGDVDMYNVVMAILDE
                     EQRRAEVGNHRLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGLEMALKRAF
                     YTK"
     gene            556961..558199
                     /locus_tag="AOT11_02220"
     CDS             556961..558199
                     /locus_tag="AOT11_02220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005461365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="ASM98279.1"
                     /translation="MPFSTLSLSSELIQALPKDFKKPTDIQALAIPELLAGQDLLALA
                     NTGSGKTLAYGLPLLEKLRVHPEQKALILVPTRELATQVSEAINQVGQALGLNAVCLC
                     GGVDKEQQLQALATNPHLLVATTGRLVDLANNGLDLNNIHYLVLDEADRLLDMGFWPD
                     VQNISALISNQRQTAMFSATFSDELKGKAKLLMQAPKQVAAHQENSTNQDIAETLYLV
                     NKGSKTKALIELIQKNAWTQALVFIGAKENADGLAKKLNKAGISTNALHGDKSQAERE
                     EALAQFKSGQTQVLIATDLLARGIHIEQLPVVINFELPMHAETYVHRVGRTARAGEQG
                     VALSLVCHGEMDALIAIRHLTQRELPVQDLEGFPVTDKPSTGESKRAPRDKKANRRTQ
                     NKKSVKQFQGKAKRPAPKSK"
     gene            complement(558818..559507)
                     /locus_tag="AOT11_02225"
     CDS             complement(558818..559507)
                     /locus_tag="AOT11_02225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98280.1"
                     /translation="MNKTSLAKNSFHQIEWSDDSLYAKWGGSKDLFDHFLRKSGKNKK
                     KYLCDLYMENGGDVRNLPFSWMSPFVSEELAVELIKLKKKHDAIGSDQDEPELQPHAF
                     KWPTTFANHGTGDLPESQWPKVGMLKAVGYRVGSYGIQKNERIEILKNVYTQYLPLVE
                     SEEYIAQWAKPSSSGRLKKMAETLAALTRNAKRKNQSMGAAIRDWEDDLQWLKDRYYE
                     QYQDHWKWPKI"
     gene            complement(559638..560102)
                     /locus_tag="AOT11_02230"
     CDS             complement(559638..560102)
                     /locus_tag="AOT11_02230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecB"
                     /protein_id="ASM98281.1"
                     /translation="MATKNSNQLQKAIENLVIEDVYQKSSRSFCADDFDPKSYSEMEH
                     LHIQQMHVVHKSETIQVEDDGELLRVFVRLGTRWVVPSDDESEPDIKAAIESDFIAEY
                     RINAHLEQECIDAFSLKNASYHVWPYWREYLSSQCERMRLPRVVLPTVQFTK"
     gene            complement(560092..560628)
                     /locus_tag="AOT11_02235"
     CDS             complement(560092..560628)
                     /locus_tag="AOT11_02235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98282.1"
                     /translation="MTTKICPICEQGHLSDQEEVIHVEHMGQQGSITSQFSTCDVCGS
                     EQATPANARFNKRAMIAFKKQVQGLLTGVEVRELRKGWNFSQEDAAKVFGGGPVAFSK
                     YESDDVMQSEAMDRLIRIARDVPASLDKLMADAGVKRKIDADWTTVAVVNFHEKSNIK
                     RTHVVYQHEFGLEANYGY"
     gene            complement(560639..561067)
                     /locus_tag="AOT11_02240"
     CDS             complement(560639..561067)
                     /locus_tag="AOT11_02240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98283.1"
                     /translation="MVNNQFNVSAFEQEPPTATTTKRIHIDGPLYAVGDVLKILESEG
                     NTTIPWTRKCIHDIESLALDTDDIRDLLRQAITQGQYVNSEWCVQKPTGPWAACDSYR
                     LQREEWREHAYKYMSCNYYVKFAIGKTGKILLLVSCHVSQ"
     gene            complement(561213..561809)
                     /locus_tag="AOT11_02245"
     CDS             complement(561213..561809)
                     /locus_tag="AOT11_02245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="ASM98284.1"
                     /translation="MVAWNKGKRVGQKKAFKLEDIWRIRIRLELEERLFELTLFNLAI
                     DSKLRSCDLRNLKVQDVSRSGCVMSRAIVKQQKTQQEVHFEITPKTQQTLSQWIIQNA
                     LAPTDFLFPSPRREGQPISYHYYTTLVNRWVTDIGLHKTQYGTHSLRRTKASLIYAKT
                     KNLRAIQLLLGHAKLESTIEYLGVEIEDALRISESCET"
     gene            561920..563623
                     /locus_tag="AOT11_02250"
     CDS             561920..563623
                     /locus_tag="AOT11_02250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit M"
                     /protein_id="ASM98285.1"
                     /translation="MNQQEQLFLKELESKLWTAADKLRSTLDAAQYKHAVLGLIFVKY
                     VSDAFKLRQEEIKADLANPDHEYYLDPADFSEEELAAEIAVELEQRDFYTEKNVFWLP
                     TESRWQFLQDNGPRVIGGADLEIDGKVKKITSVGHLIDNALEGIERDNPKLKGVLNKS
                     YSALKIDQAKLNELINLIATIPFDHNSLNSKDILGHVYEYMLGQFALAEGKKGGQFYT
                     PASIVSLIVEMIEPFEGRVYDPAMGSGGFFVQSEKFIERRANQKEIDPLTQKRKISIY
                     GQEYNHTTWQLAAMNMAIRGLDYDFGKEPASTYTNVQHPDLRADFIMANPPFNMKEWN
                     TGVDDNDPRFKYGKPPAGNANFAWMQHMLHHLAPDGSQALLLANGSMSSTTNNEGEIR
                     KALIENDLIECMVALPGQLFTNTQIPACIWFLTKNKTARTDKAGRKLRDRKGEVLFID
                     ARNLGYMKDRVLRDFTRDDIQKVADLYHAWKTGAEVNGITYQEQAGFCKSATLADIIK
                     HDFVLTPGRYVGATEELDDGIPFGEKMAALTAKLSEQFAESATLEAEIKKNLAGLGYA
                     I"
     gene            563613..564908
                     /locus_tag="AOT11_02255"
     CDS             563613..564908
                     /locus_tag="AOT11_02255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98286.1"
                     /translation="MQSNWSIVALSDVLETIIDYRGKTPPKSKDGIAVLTAASVKDGR
                     VLKDKVSYISQETYEKVTTRGFPKKGDVLITTEAPVGEVAPFPVDKTYHITRRIMALR
                     GQSDVIDSDFLLYALLGPNNQSQLKACIRGSTVPRVLKTDITGLKFPLPPLLIQKQIG
                     RFLASVDEKIHLNNQTNQTLEQMAQAIFKSWFVDFDPVKAKMNGEQPEGMDAATASLF
                     PEKLDSETGIPVGWSQGVIADIAKVNAKSWTKKNQPEQVHYVDLANTKNGVIETVTSY
                     DFSEAPSRARRILNSGDTIVGTVRPGNRSFAFIGDTEQPLTGSTGFAVLSPKEECWTS
                     FVYLATTNDDSIDEYARLADGGAYPAIKPVVVADTPCVIPTTDIAQKFWQLTGAMLKK
                     AHQNRLENEELAKLRDTLLPKLLSGEIELGLNEAVELEA"
     gene            564905..567673
                     /locus_tag="AOT11_02260"
     CDS             564905..567673
                     /locus_tag="AOT11_02260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98287.1"
                     /translation="MSFFAYRAAPFEFTHENKVFNRLYDLLYQAWGNRDESLHLIGNV
                     YVAGRPVDALVIKHNAIVVIDFKDYGGEIAFSENGRWMAGDVTVKGGGSVNPYQQIRN
                     NKFSLLNYLQEQVTFQSEPNLGHIAGLCLFHQDIHFDEKQLPSGISRWFHVADVAHSV
                     RTLESLASPAINLAPWEIEHIIEKLAVSRFYPDGEAVKVKTGESLRERTEPVEINDCF
                     QGVDLTEGQKNAIAGIGAFLSSNGFGGYILHGYAGTGKTFIAKGIVDFVTRQGKSCVL
                     MAPTGKAAKVIAEKTNHHASTIHKAIYDYSDAFDDDSEAHVPVATIKPNNDGTDTVYI
                     VDESSMLSDVFSGTDNIQFGSGYLLRDLLMYVRDGGQQAQRKIIFIGDDAQLPPVGMR
                     SSPALDANYLREKYALPLAESTLEEVVRQKAGSGVMDNALVLRHALDTDTFNELDFNT
                     TKADIESLSSDVFIERYMALCEKQISKTKEVVIVAHSNAQVDSYNRRCREIFFPNHST
                     LCAGDKVIAVANHYRNDITVTNGEFGLVRQLLSEPESRVVTFNKKLEDKSTEKVTVNL
                     TFRDVEILFRDESGSPISVTGKVVEHLLYNDKASLTSDESKALYVDFLNRNPHLQRKG
                     MSDERKQALKDDPYFNAFKVKFGYAITCHKAQGSEWQHVLVNCYSPYQKTLSRDYFRW
                     LYTAITRTAQKLYVLNEPTVRIGEKPDIVGDTSWMNESDSIRPIDVPTNSVELVLEGF
                     DIDLDSSLGHLYKKVQLSIGDSGIKLTDIQHFPYRERYMFTADNQFADVEFIYNGKNV
                     VSKVNVRGTGLLATMLQTLLVPLEGMVMSTYKQNQHDKAFDFLDDHLEVFHKRVVEVF
                     SAHEIAVAELSQNQWVQRYTFANNGETAVIDFHYNGKKQFKKVTPLVNLSSSKSLLSQ
                     AVRIWSEA"
     gene            567703..569157
                     /locus_tag="AOT11_02265"
     CDS             567703..569157
                     /locus_tag="AOT11_02265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98288.1"
                     /translation="MSEQPFRTVTNLRKAGNLQEAWNVGFAALEHSPQDAYLKGALFW
                     VCYEFIKQQQERISKRAASSNNFRPSDFEFERIENLLQTIVSFDIPTGGLEYKMLLVQ
                     FKKNLEWFPSLVNLVLHHQSALFDDESKKPFQAEKGEVPSLMLSTARQVASAWLRARE
                     FWQLDLNQVLGFINQTRQQVADTKHLIWLDYDQSKCLIVSGQYEQARELLLPILRKKQ
                     KEAWAWGALAATYQKQDRSLALKFFAKGIVSAHDVTFSLKLLQGAIPLLLANQQPTEA
                     SMCLKTALQAYQSNGWKVKPELEQLMNQPWYDASVDENELKAFLKSLCRDAIEYLHGP
                     TEKVIGVIENIHKSEKGFQVFVNKSTTWSVRMGIHKSSLKPQAGDYVELSLSMNGTEK
                     EVIASVPCQSVELADVGTIEGELRIAPKGFGFVEDTFVPPFVIGDIANGSRVTVLRIM
                     AWDKTKARHNWKAIKLEQVEVVSTLMPDFDDIPF"
     gene            569172..572429
                     /locus_tag="AOT11_02270"
     CDS             569172..572429
                     /locus_tag="AOT11_02270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="ASM98289.1"
                     /translation="MKITEDQLEQLCLDWFTDQGYLYKNGYDIAPDGDSPERDDYHQV
                     VLKQRLLERLEVLNPELPQESLDVVLNTVSTPDTPVLIKSNRAFHKYLIEGVPVEYTV
                     YEDGETKTKHTHARLMDFTNPDNNEFLVVNQFTITGKKGNRRPDVVVFINGLPIAVIE
                     LKNPADEHADIWHAYNQLQTYKDEIPDLFVFNESLVVSDGWTARVGSLTANKERFLPW
                     KTVSGEDDKPLWDYQLETMVKGFFKPDLLLDYIRYFVLFETDNDTVIKKIAGYHQFHA
                     VRAAVEATVRAKQADGELPLVAESMGQYQVQATKGLDKIKPGSGKAGVVWHTQGSGKS
                     ISMVCYASKLLQQPAMNNPTIVVVTDRNDLDGQLFNTFGMAHETLKQVPSQADGRDKL
                     RELLLSRQSGGIIFTTIQKFALLAEETEHPVLSTRANIVVVSDEAHRSQYGNKSKLVD
                     VKDANGNVISQKFVYGYSKYMRDALPNASFIGFTGTPIAMDDKDTRGVFGEYVSIYDI
                     QDAVDDGATVPIYYESRLAKLDINQAEIEQLNDQIEDEIGEDEETASREKIKSQWATL
                     EKLVGAEPRIQQVAQDLVNHFTTRTETFPGKAMIVAMSREICVDLYNAIVAIKPEWHN
                     DDPAKGAIKIVMTGSASDKAKMQPHIHDKKTKKLFEARYKDTSDELKLVIVRDMWLTG
                     FDAPCCHTMYVDKPMKGHNLMQAIARVNRVFKDKPGGLVVDYIGIANELKNALKTYTN
                     SQGKGQPTVDTAEAFSVLMEKVDIVRGMFATPVDGKVFNYRPDFETEALRLLPGAVNH
                     LSGLSHTDSKGKEVRDGKRRFLDVMAALGKAYSLCNTMDETRGYKNEIAFYSAIKAAF
                     MKHSTVDKKRTDEERNTALKQILDNAVIADGVDDIFSMVGLDKPNIGLLSEEFLEDVK
                     NMKEKNLAVELLEKLLRDEVKARMKNDVVQEKKYSDRILTTLNKYHNRSIETAQVIEE
                     LIQWAKEMQEDAELLDKLNLSVDEMAFYRALVENESSVRELGDDALRNLAIELTGQLR
                     KSATVDWQKRESVRARMRNLVRRLLRRWKYPPDAAEEAIKLVLEQAEVLADGWYK"
     gene            complement(572654..573343)
                     /locus_tag="AOT11_02275"
     CDS             complement(572654..573343)
                     /locus_tag="AOT11_02275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017789086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor sulfurase"
                     /protein_id="ASM98290.1"
                     /translation="MKKLGVVNSVLAGKTVAFAHGTKSAINKQVMSQRLHATELGFTN
                     DEQGDPRFHGGIQKALHIYPSEHYPVWQQELGNKAIFQSAGAFGENLSSSGVTEALIC
                     LKDKIRIGTTLLEVSQGRMPCWKLNVRFEQNDMARRLQDTLRTGWYFRVLEEGDIGAG
                     DEIILCERPYPDWSLARIMGAVFTGCLDKNELSQLAELPLVESWGKLVERRLETGKVE
                     DWEMRLVGPTA"
     gene            complement(573389..573631)
                     /locus_tag="AOT11_02280"
     CDS             complement(573389..573631)
                     /locus_tag="AOT11_02280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98291.1"
                     /translation="MRYQVEISKENQLLFKVEIDNINPAKCEKLLETVLAKFPKAEGY
                     QRHVLVSDSETRYLKSTEKRIEVLAAIPVFASLGER"
     gene            573716..574534
                     /locus_tag="AOT11_02285"
     CDS             573716..574534
                     /locus_tag="AOT11_02285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017789084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ASM98292.1"
                     /translation="MMPTRQIDSHTGVMTSNEMMSANPHSPALVKTIDMPKGYIDALH
                     QHTWHQVIFPLKGLLQTQTDHYQHLVPHTSALFVPAGIQHESIALSHTTFVGIYLNPA
                     FGTEYQHQVRTITLTPFLNELLQEIRRQCEGFVNDGEVSRLLAVLHDQIMKDNVQTFQ
                     LLLPEDRRLKLIFEALTDTPALDWSLKEWGEKVGASERTLSRLFAKEFNTSFQLWRQQ
                     IRLIYSLSLLDEELSIQSIADQVGYQNDSSYIKAFKAYFDVTPQQFRVTGRRGR"
     gene            complement(574596..575291)
                     /locus_tag="AOT11_02290"
     CDS             complement(574596..575291)
                     /locus_tag="AOT11_02290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005460401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="ASM98293.1"
                     /translation="MSNTTAKKSNPLVEILFNVFVPSFILMKFSGEEHLGTALALVVA
                     LLFPIVYGGMDLIRNKKFNFISALGFVSVLLTGGIGLLELDTKWLALKEALIPGLIGL
                     AVFGSTFTRYPLMQKMVLNDTVLNLDLITQRLKERGKTDAFERCLMSSNYLFASTFAF
                     SSVMNYFLATWIVTSPAGTVEFNEELGKLTLYSYPVIAIPSMLMMFGIFYYVWRQIRS
                     MTSLETEQIFHTK"
     gene            575672..577471
                     /locus_tag="AOT11_02295"
     CDS             575672..577471
                     /locus_tag="AOT11_02295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017789082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PKD domain-containing protein"
                     /protein_id="ASM98294.1"
                     /translation="MYRTTLASLIALTLVGCGGGGGGSDAGNSLRVFTTTPSVHVEGN
                     SMKYTYATVDIDSRGVVTDGSQIFFGVMEDTGGLLRNAELQFVTEQAGYYMLEFYPGY
                     LFKEGDNTSQVSLAFCYDYYCNQHVAGSPIKVNVNYANPLDEQISLSSVSPQNFDKSA
                     RLNETVLDNTPVTFFTQLTGQNADLITLRNQNDYKVASHVAMEDLGSNVYRLTADVRL
                     PTSLGVGSHSGSLTVDACYDADCQYPIKGSPLTIPMNYQVTPPVFAADSPAAVNESQE
                     LPFKVREAKHVPGLDIIVMVSDSPTNAVYVYDIASNTTFKYPLTSEPKDLSVDLVSTQ
                     GRIIVAHDYQVTQIDYNPDYAATPLITVHNTSVANPIAVVKNDHVYLVDRHDGFSKYS
                     RFNLESSHETFLQDSMLRRMSVFELHPSGHGIYFTSTAFSPQDISRTNINEERGLDYP
                     SDSPYHGDYDIGGNFWFSYDGTKLYTSTGSIFTLSNNPEEDMRYAGRLPLMATPGNYG
                     TEYSYVSSTAQNETVTILADSYPSYTVRKFDTGSMTVEKTFPKTARTIDSRIDKVIDE
                     EPIYAFISDRGYVYTIKETNDFPDMYYRLERLE"
     gene            complement(577529..578377)
                     /locus_tag="AOT11_02300"
     CDS             complement(577529..578377)
                     /locus_tag="AOT11_02300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011081950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ASM98295.1"
                     /translation="MEVMSDILRAIRVVGSVYFCSQVEAPWTKTFNDLDHASFHMIRR
                     GACWANVDGRIEQLNAGDLIFLGPGQNHLLSSQSPEKGKSDLTESTLLLCGSFSFTRT
                     ATTPLLDVFPRVTIVRDQDLAKYPWLRSTFDQLSSEYLSQGPGSELIVNKLTEIILVE
                     LIRINFGREQTSPFLEALNDKRISRALQLLHDHPETGWTLETVANQIGMSRAAFANRF
                     SSLVGKPMFEYLTNLRMQKAQELLVESLLPIDEIAEQVGYESERAFTLTFKKHTGTTP
                     KRFRAQ"
     gene            578492..578761
                     /locus_tag="AOT11_02305"
     CDS             578492..578761
                     /locus_tag="AOT11_02305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="ASM98296.1"
                     /translation="MPKIEIYTKSYCPHCKAAKQTLASMGLVYREIEVSDDQALFNEM
                     LNRSQRRTVPQIFVGDVHVGGNQDLITAIRKGRFEKILRSQAIRH"
     gene            578806..579291
                     /locus_tag="AOT11_02310"
     CDS             578806..579291
                     /locus_tag="AOT11_02310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98297.1"
                     /translation="MSTLINTHQNRSEFAHSLNQFADHAVRFSIVIVLAWIGAMKFTS
                     YEAGAIEGLVASSPLTSWLYSVFSLQGASNLIGFVEVATAVALLLAPVHRGFAILGAA
                     SATLTFAVTTSFLFTAPIAEASLGGFPAISVVPGQFLLKDIVLLSAALSLLAKALLRD
                     E"
     gene            complement(579358..580086)
                     /locus_tag="AOT11_02315"
     CDS             complement(579358..580086)
                     /locus_tag="AOT11_02315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015728398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98298.1"
                     /translation="MKKYLSLLMAITLSIALSGCNGSSDSSSELAESYDGVYKDKNGE
                     SLFYSSNEDAIYLYRPPQRYKDGYISSSNRSIVVDNSLIGPYIDTNHFVKSELGDYYH
                     YQNSTVQFHFSKGNVSALVKDEGDRTLVDTTYTKLPTLADFDLMYQSYADWERMTLIF
                     SNDDRMFAQLDFMLTCQLNADVKRMSNFYRVSNGAITCNDPNDPRIDSNMHGVIYKVA
                     EDSRAVVIVQGKRWTYRTTFQTVY"
     gene            580607..582586
                     /locus_tag="AOT11_02320"
     CDS             580607..582586
                     /locus_tag="AOT11_02320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM98299.1"
                     /translation="MSLSIVQRITAGFVLMLLLLILLGVISTLKIQGINDGLSEVSDR
                     ATPLVVAVAGLKEALQESNRWVLEYRASEEAAELPQFSSRFKAQQARFRELSQEMNQF
                     TSASESQAQFQQVLQATNQFYADSDKVLAKHGEWVDTLVKRRELEIAFIRLEDTYQWA
                     ADLLLQQSSSQRSMRNKAELITSGIARDLKNIRRADAKTDLNELEKVLSKDIEMARKR
                     LERVLVPEDVKARYVANLNRLQELALGKQGLLETMRRAQQLENDLVIQNQQVDNSLSN
                     SLAKLDEMARAAGTIAERSRMVADEAVSSANFWIMAVSAISAAVALIIGYTTAMSIKN
                     PLQKINKELAYMAKGDMTRRINYQTGCEFGELSRSIDMLADKTGELLSQITAGSRHLV
                     DEASRSAEISERAMARVQEQKSQTDQVAAAITELEVSATEVARSTDGAKDEVDRADAE
                     AKSGRQKVANTRKITEQLAHDMESAVGITHKLGEFSNNIGSILDVIRGIAEQTNLLAL
                     NAAIEAARAGDAGRGFAVVADEVRALATRTQTSTEEIQKMIENLQQSSKEVVEVMGRS
                     QDQTRTCVEQTREMDTALQSIAERMSAIKEMADQVAHAAQEQIIVSQSVAHHVTGISE
                     VAHETEREARESASSSEVLADLAAKQQQLIAHFKV"
     gene            582595..583947
                     /locus_tag="AOT11_02325"
     CDS             582595..583947
                     /locus_tag="AOT11_02325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="ASM98300.1"
                     /translation="MINKWIGALGLLVCSQVMASELVIESWRADDKALWEQKIIPAFE
                     ASHPGIKVIFRPVKNVNYMPTLWENLKAGKAGDLITCRPFDDSLALFKAGHLAEITEM
                     AGMENFPSFAQAPWQTDSGAQTFCVPMASVIHGFFYNKQIFNQLGLSVPKTRDQFFSV
                     LDTVKADGRYVPLAMSGSESWVSSELGFQNIGPNYWKGEDGRLALINGQERLDDGQYV
                     QVFEELARWRRYLGTGGEKRDYGATNDLFTSGKAAFYVAGSWEIAPFTDKLDFGVMPP
                     PVANQGDGCFFTDHTDIGMGMNPASKNPQAAMAFLQWLTTSQFAELYTNSLPGFFSLS
                     NHFFEVSNPAAREMMEWRDQCDSTIRVATQILSRGQPKLGDELAEVSQAVLLGKMAPK
                     AAATRLENGLKDWYAPHKNSKAKGQECQCSAATPLATSSVSVTESAVVTVEGEESLSE
                     "
     gene            complement(584038..584295)
                     /locus_tag="AOT11_02330"
     CDS             complement(584038..584295)
                     /locus_tag="AOT11_02330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017421397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM98301.1"
                     /translation="MNPILAMLKENNISDEQINELFQILTQNPLAAMATIAQLGLPQE
                     QLQMLMAQVMQNPALIKEAVEELGLDFSKVEEAKAKLQQPQ"
     gene            complement(584500..584748)
                     /locus_tag="AOT11_02335"
     CDS             complement(584500..584748)
                     /locus_tag="AOT11_02335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011081943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="ASM98302.1"
                     /translation="MNDTTAKPALPDRLSGNARSPFFVKECFDHQIGIRFNGKERNDV
                     EEYCVSEGWIKIASPKAKDRYGNPMLIQLKGTVEAYYV"
     gene            complement(584901..585428)
                     /locus_tag="AOT11_02340"
     CDS             complement(584901..585428)
                     /locus_tag="AOT11_02340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011081942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase"
                     /protein_id="ASM98303.1"
                     /translation="MTTQLATFGGGCFWCTEAMFSQLKGVLDVKSGYSGGHVKHPCYR
                     EVCSGKTGHAEVIQVSFDPEIIRYEALLLVHLTTHNPTTLNRQGADRGTQYRSIILAH
                     DEEQKRIAQQVIAEVAPYFDQPIVTEVVDFEQFYQAETHHQNYYSDNPEKQYCAVVIE
                     PKLRRLRERYADLLG"
     gene            complement(585425..585880)
                     /locus_tag="AOT11_02345"
     CDS             complement(585425..585880)
                     /locus_tag="AOT11_02345"
                     /inference="EXISTENCE: