LOCUS       CP012881             3266118 bp    DNA     circular BCT 14-AUG-2017
DEFINITION  Vibrio vulnificus NBRC 15645 = ATCC 27562 chromosome 1, complete
            sequence.
ACCESSION   CP012881
VERSION     CP012881.1
DBLINK      BioProject: PRJNA295776
            BioSample: SAMN04097182
KEYWORDS    .
SOURCE      Vibrio vulnificus NBRC 15645 = ATCC 27562
  ORGANISM  Vibrio vulnificus NBRC 15645 = ATCC 27562
            Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales;
            Vibrionaceae; Vibrio.
REFERENCE   1  (bases 1 to 3266118)
  AUTHORS   Rowe-Magnus,D. and Rusch,D.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2015) Biology, Indiana University, 1001 E. Third
            Street, Bloomington, IN 47405, USA
COMMENT     Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Celera Assembler v. 8.1
            Genome Coverage       :: 10x; 100x
            Sequencing Technology :: PacBio; Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 10/06/2015 12:48:27
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 3.0
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,415
            CDS                          :: 4,220
            Pseudo Genes                 :: 45
            rRNAs                        :: 12, 11, 11 (5S, 16S, 23S)
            complete rRNAs               :: 12, 11, 11 (5S, 16S, 23S)
            tRNAs                        :: 115
            ncRNA                        :: 1
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3266118
                     /organism="Vibrio vulnificus NBRC 15645 = ATCC 27562"
                     /mol_type="genomic DNA"
                     /strain="ATCC 27562"
                     /type_material="type strain of Vibrio vulnificus"
                     /db_xref="taxon:1219061"
                     /chromosome="1"
                     /country="USA"
                     /collection_date="1979"
     gene            complement(join(3265957..3266118,1..309))
                     /locus_tag="AOT11_07200"
     CDS             complement(join(3265957..3266118,1..309))
                     /locus_tag="AOT11_07200"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97785.1"
                     /translation="MKEGAAVPTRLHNIDLLQLDDGIYRLDPVAGIVLPATPTFTTYS
                     LDIDVALVDTDGSESITGVELSGLIEGTEIYSGNGDLLGTANGNGVIYVQGAWDNGDT
                     YWRQQSRKLHGESVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGT"
     gene            complement(479..742)
                     /locus_tag="AOT11_07205"
     CDS             complement(479..742)
                     /locus_tag="AOT11_07205"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95055.1"
                     /translation="MALVTKTFLAGNFDKTKFGIQNSITDSSSALEVVYGSDKNDYIV
                     SSHGGGDSIYGAHYTNLQSDDSDILVGANLTKMILEAVWVMMF"
     gene            complement(938..1585)
                     /locus_tag="AOT11_07210"
     CDS             complement(938..1585)
                     /locus_tag="AOT11_07210"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95056.1"
                     /translation="MYQLTVQHQVNLDNQNFGIVSDISKLDSTGLRTSELQDVNGSHV
                     YKVFETNEGLQDTWIPLTSVTVAQQDTDGSETLVVNISGLPAGAKFTDGKSVLVSDGE
                     SSEYSVTGWDLDNIFVLAPSGTSDDFTIHIDAISSEKDSNSSAHNSIQIDVNVHENAP
                     THCHKDRAVTQEDIKVSGNVLDNDSDDDNVLSVVTVEVNNQVYGAGEVVNLLKAS"
     gene            complement(1554..1868)
                     /locus_tag="AOT11_07215"
     CDS             complement(1554..1868)
                     /locus_tag="AOT11_07215"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95057.1"
                     /translation="MSNVEDTASNATPKDNAVLVTGLIYLEAGKSYDFVGTGDDSLAI
                     KVGGDLVDQARWGVNYGHIPSGNPFVPAVSGFYPIEIYHHNQSGAGNFDVNVSVDGAT
                     PS"
     gene            complement(2051..2290)
                     /locus_tag="AOT11_07220"
     CDS             complement(2051..2290)
                     /locus_tag="AOT11_07220"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95058.1"
                     /translation="MGCLSIWSDGSWYSVSVGQTIEKSQFDSNGVRFTPDENESGYDG
                     HSTDGVGDQKQDYAEIGFKPSDGLNTGEEATIALT"
     gene            complement(2527..2727)
                     /locus_tag="AOT11_07225"
     CDS             complement(2527..2727)
                     /locus_tag="AOT11_07225"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95059.1"
                     /translation="MARTMRATIAGDTPDAALTLSGTLTSEDVDNTDNSFTAKTIEGT
                     QRQFSIDAMARGRSWRTVRSMR"
     gene            2730..2927
                     /locus_tag="AOT11_07230"
     CDS             2730..2927
                     /locus_tag="AOT11_07230"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95060.1"
                     /translation="MVTFTIAVCVYRRHREAFYFAVANIHLIERTCSHERPRAIGVDA
                     ERALVPSMSRGEAVVGVVHIF"
     gene            complement(3106..22314)
                     /locus_tag="AOT11_07235"
     CDS             complement(3106..22314)
                     /locus_tag="AOT11_07235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016361080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95061.1"
                     /translation="MDFTAFLAGASLTAGRIVVLDLNGNIKILAPGQAIAPGELVIET
                     LEETDVPQFRIATDAGETNITDDIQQIFAALEEGQDPTQLGDDFATAAGETGGSSLVA
                     GGTISRTGAESLASTDFSTQGLQALGLNEAQSLSLFDLLNDSNTTLQDIDSIAPSAPT
                     VTLDTDSGSKADDFLTNDGSYTVTDIEDGATVEYFVDGEWTTTEPVAVEGENTIIIRQ
                     TDEAGNSSESSTLTFTLDTTAPDAPQISLDTDSGSLVDDFLTNKGDFTVAGTEEGATV
                     EYFVNGEWTTTAPTPVEGDNTIVVRQTDAAGNTSGSSTLTFTLDTTAPDAPQISLDID
                     SGSLADDFLTNKGDFTVAGTEEGATVEYFVNGEWTTTAPTPVEGDNTIIVRQTDAAGN
                     TSGSSTLTFTLDTTAPDAPQISLDIDSGSLADDFLTNKGDFTVAGTEEGATVEYFVNG
                     EWTTTAPTPVEGENTIIIRQTDAAGNTSGSSTLTFTLDTTAQAGTVSVDPITSDDVIT
                     ETEKNQTITVTGSATGGDIKTGDIVTAIINGNEYKGSVSEDGSWELSVSGSDLAVDTA
                     FEVTVNSTDAAGNEVTSKGESVHRLNDAPTIDTATGSTQVENVAKAGDTVATFTASDL
                     DGDDVTYSITSGNDNGYFAIDSATGVVTLTAAGETALANDALTDTDYRLGVTANDGTV
                     DSEEAFATIKFDGVNDAPVAEAATGAVQEDATITGSISASDVDLGDDASLVFSTDSTV
                     EGLTLNADGSYSFDASSYDSLEAGEKLVLEIPVTVTDDQNATDTTTLTITVTGTNDAP
                     VAEAATGAVQEDATITGSISASDVDLGDDASLVFSTDSTVEGLTLNADGSYSFDASSY
                     DSLEAGEKLVLEIPVTVTDDQNATDTTTLTITVTGTNDAPVAEAATGAVQEDATITGS
                     ISASDVDLGDDASLVFSTDSTVEGLTLNADGSYSFDASSYDSLEAGEKLVLEIPVTVT
                     DDQNATDTTTLTITVTGTNDAPVAEAATGAVQEDATITGSISASDVDLGDDASLVFST
                     DSTVEGLTLNADGSYSFDASSYDSLEAGEKLVLEIPVTVTDDQNATDTTTLTITVTGT
                     NDAPVAEAATGAVQEDATITGSISASDVDLGDDASLVFSTDSTVEGLTLNANGTYTFD
                     ASSYDSLSEGQTQVLTIPVVVTDEQGATAETTLTITVTGTNDAATIAGDTAVVADETD
                     AALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSK
                     VESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNT
                     DNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVK
                     VTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFS
                     IDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTA
                     VVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNE
                     MNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLT
                     SEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVD
                     GTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIE
                     GTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAA
                     TIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFV
                     ANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAAL
                     TLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVES
                     FTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNS
                     FTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTI
                     NGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDA
                     NGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVA
                     DETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNV
                     GDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSED
                     VDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTP
                     QVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTN
                     GTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIA
                     GDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANS
                     AFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLS
                     GTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTV
                     TSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTA
                     KTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGT
                     NDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGA
                     WTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADET
                     DAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDS
                     KVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDN
                     TDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVV
                     KVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTF
                     SIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDT
                     AVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFN
                     EMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTL
                     TSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSV
                     DGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTI
                     EGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDA
                     ATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTF
                     VANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAA
                     LTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVE
                     SFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDN
                     SFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVT
                     INGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSID
                     ANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVV
                     ADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMN
                     VGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSE
                     DVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGT
                     PQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGT
                     NGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATI
                     AGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVAN
                     SAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTL
                     SGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFT
                     VTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFT
                     AKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTING
                     TNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANG
                     AWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADE
                     TDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGD
                     SKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVD
                     NTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQV
                     VKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGT
                     FSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGD
                     TAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAF
                     NEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGT
                     LTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTS
                     VDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKT
                     IEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTND
                     AATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWT
                     FVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDA
                     ALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKV
                     ESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTD
                     NSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKV
                     TINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSI
                     DANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAV
                     VADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEM
                     NVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTS
                     EDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDG
                     TPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEG
                     TNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAAT
                     IAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVA
                     NSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALT
                     LSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESF
                     TVTSVDGTPQVVKVTINGTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSF
                     TAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTIN
                     GTNDAATIAGDTAVVADETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDAN
                     GAWTFVANSAFNEMNVGDSKVESFTVTSVDGTPQVVKVTINGTNDAATIAGDTAVVAD
                     ETDAALTLSGTLTSEDVDNTDNSFTAKTIEGTNGTFSIDANGAWTFVANSAFNEMNVG
                     DSKVESFTVTSVDGTPQVVKVTINGRTMRRTIAGDTAVVADETDAALTLSGHLDLRRC
                     GQHRQQLHREDHRRHQRHVQHRRQWRVDVRGEQCVQ"
     gene            22731..24035
                     /locus_tag="AOT11_07240"
     CDS             22731..24035
                     /locus_tag="AOT11_07240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agglutination protein"
                     /protein_id="ASM95062.1"
                     /translation="MKWTQINAFALGAMLTLPATGQTLEQAISITLATNPELKSAFNE
                     FVSKRYANDASSGAYLPRIDLDAGIGYESINPAEGESTDLTRKEASLTFTQLIWDGSS
                     TLNDMDRTAAEAESLRYQLLADAQNKALEVTKVYLDSVKAYEILSLSESNLATHKRIY
                     SDIKKRVNSGIGSTADLSQVEARLAKAHGNLAAAQNNLFDSHTMFTRLVGQTPQSLIF
                     PRADQTQIPFTLDEAVSQAFNQHPVIKVSQVDVDSARYQYKQTKGRNYPTFSFEASQT
                     WRDDAGGVEGNSDELTAMLRMRYNLYNGGTDSANSESAAYQLNKAKDLRERTFRSVEE
                     GLRLAWSALDLTLQQKEFLSDHVDSASDTVIAYEKQYRIGKRTLLDLLNTENELFEAR
                     KGYLDAKYAEQYAKFRVMNATGQLLNALRVDIPKEWVEGVEY"
     gene            24037..24663
                     /locus_tag="AOT11_07245"
     CDS             24037..24663
                     /locus_tag="AOT11_07245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95063.1"
                     /translation="MKAFILPLVCLTFSATSVIASDKADEYDYLATPRADQVADLQDQ
                     DRDGVINARDLCPDTPSTAEIDNDGCGTYVKTSQQMQIRVLFANDSDKINPVFRKQIK
                     EMSEFLKLYPSTSIELQGYASRTGNAEHNLDLSKRRADNVREMLIGYGIAQSRVRIVG
                     FGDSALANEGTDEVSHALNRRVVASVVGYKGDVKEEWTIFTSIPKAKK"
     gene            24780..25130
                     /locus_tag="AOT11_07250"
     CDS             24780..25130
                     /locus_tag="AOT11_07250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95064.1"
                     /translation="MSKLTADTQANLELFIEETQSTKLVWGLRNEEGWLACDSTEFEQ
                     SEVMPFWSTKEDAMAHNVEEWADFEVLEIPLDIFVEDWLITLDEDGVLVGVNWNAQLE
                     GKEIEPSELAKMYL"
     gene            25329..27263
                     /locus_tag="AOT11_07255"
     CDS             25329..27263
                     /locus_tag="AOT11_07255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95065.1"
                     /translation="MFIRKLLLWFVLLFCSVPAFAESSSFHHWYEFYQQKLKADDGAA
                     FDLLQERYSALLPSAEKLYVSGLLFDYLSNRDQPYYGASQHSDSHFARQEALYVDAMY
                     LRKEGQYDSAVEKFRAVLNHAAQLDEKNTKELIYYQLCYTLNEQGELHKAKHFCSKLQ
                     QQIDSNDSTLLPKYLSYRIIANNFSYRGEPHLALANYQKMLHALPANADRSGAFNDIG
                     NQLREVSQFQQSENYLLDALAIRQNANSPTELAQVLHSLAQLYADWHKHEQAESYYQQ
                     ALALLRKDQHTFGLAMTYSGLGSLYIEQGEFAKGKELLNQALNEANLGQNHRLSAEIH
                     YRFSLAYLQAGELQASLSHADQAYQSAVSMDFLSLQAKASLQLSETYKALADFPRAYE
                     CYHRYAEIEFRLRDKDTTSALEALDLAQQQFEYQLRIAQLQSDNEKKLIELQNYQQKK
                     SLYSLLVAATLIVVGLFFLTSQQKRKQSQLDMMTGALNRGSAIKAIKQASSAKHPHSK
                     NVLILFDLDNFKWVNDQFGHPTGDKLLITICKTLLGELQRGDILGRLGGEEFILLLRE
                     VEDIDVQFRVEKLHDLISECRIASPSNTAVSVSASFSFLATPRALADFDELYSILDQA
                     LYQAKKNGRNTIIDAYNAAI"
     gene            complement(27373..28068)
                     /locus_tag="AOT11_07260"
     CDS             complement(27373..28068)
                     /locus_tag="AOT11_07260"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7ML86.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine synthase"
                     /protein_id="ASM95066.1"
                     /translation="MNKAVVVFSGGQDSTTCLVKALNEFDEVHAITFDYGQRHRLEIE
                     VAQNLAKELGVAAHKVMDVTLLNELAISSLTRDDIPVSHELQENGLPNSFVPGRNILF
                     LTLAGIYAYQIGAETIITGVCETDFSGYPDCRDDFVKAMNSALVKGMDKPLVIQTPLM
                     WLNKAETWALADQNNALQLVREKTLTCYNGIIGDGCGDCPSCHLRKVGLNDYLDNREA
                     IMASLVEKQHAES"
     gene            complement(28081..28731)
                     /locus_tag="AOT11_07265"
     CDS             complement(28081..28731)
                     /locus_tag="AOT11_07265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein"
                     /protein_id="ASM95067.1"
                     /translation="MFETIQGEGVFTGVPAVFVRLQICPVGCSWCDTKQTWEAAEQDE
                     QSFAEIIVKTGDSPTWCQADAESIVEQYQRQGYSAKHIVITGGEPCLYDLTELTQAFE
                     AIGCQCQIETSGTYEVKASANTWVTVSPKVAMKGKLPILDSALQRANEIKHPVGTRKD
                     IDQLDALLLRAQVPATTTIALQPISQKERATQLCIDTCIKRNWRLSIQTHKYLSIA"
     gene            28924..29733
                     /locus_tag="AOT11_07270"
     CDS             28924..29733
                     /locus_tag="AOT11_07270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="ASM95068.1"
                     /translation="MYKLIALDMDGTLLNSDKQISEPNKEAIRQARAAGVTVVLASGR
                     PLEGMQSKLEELQIDSDKDFVLFYNGSMVKNVATGELIHEQIIDGKAAKKIARLADKL
                     GVYVHAFSKEFGLITPQNNPYTGIEANINGLSITEMNFDALADDHPIIKTMIVAEPSE
                     LTKAIAALPAVLHDEFTIVQSAPFFLEFLNPASNKGIGVAAIAEYLGIRAEEVICMGD
                     AENDHHMLKYAGLGIAMANAMEETKQIADYITDSNNDHGVATAIEKFVLNA"
     gene            29887..31524
                     /locus_tag="AOT11_07275"
     CDS             29887..31524
                     /locus_tag="AOT11_07275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM95069.1"
                     /translation="MFVNLSIKQKIIFPVFLIISLFAVSSVLNILASQKQTELTHTLR
                     DDIMPTLFTIEDAYRDMYQATSAIQGLVLSDTKQEIEREQFEYKDNAHKAIPRMKAAQ
                     KLIDSGLLPSTAQRELDVLVTLANSWLKDYETLLSLPEDQWFTYYDENKGTFDKKFSA
                     TRKQLNVVKKLVEEAQNTLQQQINNAASQAERTLELGTLFVILLATAMCWFLIKAIVT
                     PIEHIRSAMDEIASGDGDLRQRIEMDSNDEIGQLAGAFNVFVSKIQATIEQVVNTTNN
                     VRSEMNQLTEITRSVADSTYRQQQESEVVAAAVHEMQATSQSVSDNATDAATESHNAD
                     QEVQNTSQIVDSTVDAIRRLADDINNASHVIHTLDDDVSNIASILDVIRGIAEQTNLL
                     ALNAAIEAARAGEQGRGFAVVADEVRSLASRTQQSTGEIQTMIERLQGGARQAVSVME
                     SSKRSSDSTIESAQSATHSLQEILRAIANMSEMNTQIATAANQQSSVSEEVNANVQRI
                     ADNSSAIVSVVQNAETAIQRLSQQCGQLDRLVSQFKC"
     gene            complement(31586..33016)
                     /locus_tag="AOT11_07280"
     CDS             complement(31586..33016)
                     /locus_tag="AOT11_07280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="ASM95070.1"
                     /translation="MYKRSFFVVISLIISLVFSTFSFAASSTSLPEGLKGALCIVRAD
                     DKLVLVNEILTHQISLPGGTIIAGEDPAVTAQRETWEETGLVVTVGKVLGYNEQAVFY
                     DCISDSSVVAFNFNNSLDGNELPVWFAPHYGVEIASAMLLSPLALEASQYRYPQQWPM
                     VQQMFGQATDQAVAYVNDLVESAPSYHQVELGWLMQLQSFVASSPVLSALGLLLSYFA
                     IYLTSPEILLVVMPLAMWRFGRDFTYQLFFAVVATSLLCLVAQQGFALPRPHVYWPVL
                     EMTQSYGFGFPSLPIAVWACLSALILHRLAWLRSGRALRLTSLVISVVMLGKFYSGAA
                     FIADMMIGGLLGGLVAWHIIRLDSKPNVNVAQLLGAKSVWIAMAVLAAVLTAMWPLPV
                     FSAWLATLIVISLLVVFFKTSKVSLSQGHTLIIVVALLSFNLIITLAQGVIAYSGLYS
                     FIVETLRYPLIALLFAVLTKRFNQQN"
     gene            complement(33305..34939)
                     /locus_tag="AOT11_07285"
     CDS             complement(33305..34939)
                     /locus_tag="AOT11_07285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trypsin"
                     /protein_id="ASM95071.1"
                     /translation="MWRNKRPIKQEEMTLKSTGKLTLLSLMMLSASVSAEVLSQTQTD
                     VVQSNDIQPRIVGGTPANASEWKFYTQIVSRNSNRSYCGASYIGNGYVLTAAHCVDGD
                     LPSQIAVKIGGVVYNGTDGVRSNVSQIYMHPAYNKSTFENDIALLKLSQIPQGVTAVD
                     IAAGSLSQYAAVGDWLTVAGLGRTTEGGSSPTVLQEVDVPLISDATCRQAGGSYANVG
                     EVAFCAGVPQGGIDSCQGDSGGPIVINRAGSITQLGIVSWGIGCARPGKYGVYSDIAA
                     LRSFVDGIVGNVTPPSETVSVGYTPSQTLTAFNVGELKSHTFTIKNTGTGSFTVDRLS
                     VTGSGVATQPVISRDLCTLSTLSNGQTCRVSIEFGASTAGTAKAALAFEIDKTSTIYR
                     AEVSASAKHTNTPPDGTCANEWQASKVYNAGDVVSWAGQSWKAGWWTQGDNPSDSGPW
                     GVWQVVGSSDCSGSGTTPTEPPTTPEPPTTPEPTPPTDANAYLAGTNYSAGDVVTNVG
                     STYQCKSWPYNLWCGSTPSAYEPGVGTNWQQAWTKL"
     gene            complement(35163..35642)
                     /locus_tag="AOT11_07290"
     CDS             complement(35163..35642)
                     /locus_tag="AOT11_07290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone acetyltransferase"
                     /protein_id="ASM95072.1"
                     /translation="MTAFILSSARPSDLEALNDLMFDLHDEHHLQCPEFFKSAEDIEQ
                     EKSIARYLDDPECLVFVAKVDEEVVGFVSGHFCELISTVSRPLPMGSVDELYVGKPFR
                     QQGIAEALLAKIEQTFRDYGVEQVFVEVWDFNQTAIAVYEKNGFQPHIHWLRKSLKN"
     gene            complement(35749..37626)
                     /gene="prpE"
                     /locus_tag="AOT11_07295"
                     /gene_synonym="yahU"
     CDS             complement(35749..37626)
                     /gene="prpE"
                     /locus_tag="AOT11_07295"
                     /gene_synonym="yahU"
                     /EC_number="6.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422148.1"
                     /note="catalyzes the formation of propionyl-CoA using
                     propionate as a substrate; PrpE from Ralstonia
                     solanacearum can produce acetyl-, propionyl-, butyryl- and
                     acrylyl-coenzyme A, and Salmonella enterica produces
                     propionyl- and butyryl-coenzyme A; not expressed in
                     Escherichia coli when grown on propionate/minimal media;
                     ATP-dependent; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propionate--CoA ligase"
                     /protein_id="ASM95073.1"
                     /translation="MSAYQKEYQWAKQQPESFWQAQAKNIDWFEFPKTILANDANGIE
                     RWYPDGLLNTSWLALDYHCEQGRGDKAALIYDSPVTETKQVYSYFEMRDRVARIAGML
                     AGQGVTKGDRVVIYMPMIPEAAMAMLACARLGAIHSVVFGGFAPNELAVRIEDAEPKV
                     IMTASCGIEINKVIPYKPMVDKAIMESRWKPEKVVVLQRPQCDAQLSSERDLDWHQAV
                     ENALPHACVPVLATDPLYILYTSGTTGKPKGVVRDNGGHAVAMKYSMSAIYNMPQDGV
                     FWAASDVGWVVGHSYIVYAPLIHGCTTILFEGKPVRTPDSGAFWRVCEEYGVNVLFSA
                     PTAFRAIKKEDPQGEHLNKYDLSKLETIFMAGERLDPPTLEWVQSQTAKPVIDHWWQT
                     ETGWAIAGNMVGIELMPVKAGSATMPIPGYQVEILDEMGLRAGPMQQGFVALKRPLPP
                     SCLPTVWRNHDRFESGYLSQFPGYYVSGDGGYLDEEGYLFIMGRIDDVINVAGHRLST
                     GEMEEIVGAHPAVAECAVVGVHDELKGQLPLGFVVLKDGVKIDPTELEQELVGKVRNE
                     IGAVACFKQALVVERLPKTRSGKILRRTIRQIADGEQYAVPSTIDDPSSLNEIEKVLS
                     R"
     gene            complement(37691..38917)
                     /locus_tag="AOT11_07300"
     CDS             complement(37691..38917)
                     /locus_tag="AOT11_07300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methylitaconate isomerase"
                     /protein_id="ASM95074.1"
                     /translation="MKPSTRSSTQSATQREARMSQIRVPATYMRGGTSKGVFFNLAEL
                     PPEAQVAGEKRDQLLLRVIGSPDPYGKQIDGMGGATSSTSKTVIVSKSSRADHDVDYL
                     FGQVSIDKPFVDWSGNCGNLSAAVGPFAIHAGLIDEKRIPQNGVVTVKVWQANIGKTI
                     EVHVPIQNGSVQETGEFSLDGVTFPAAEIQVDFVDPADGEGSMFPTGNLIDDLVVPGI
                     GTFNATLINAGIPTIFLDAEALGYLGTELQEQINNDEQALAKFETIRAYGALKMGLIT
                     SIEEAEGRQHTPKVAFVAKPKSYQASSGKVVEAGEVDLLVRALSMGKLHHAMMGTAAV
                     AIGAAACVPGTLVNLAAGGGEKQAVTFGHPSGTLKVGAQAKATQQGWVVEKAIMSRSA
                     RILMEGFVRVPSDVFE"
     gene            complement(38920..41535)
                     /locus_tag="AOT11_07305"
     CDS             complement(38920..41535)
                     /locus_tag="AOT11_07305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe/S-dependent 2-methylisocitrate dehydratase
                     AcnD"
                     /protein_id="ASM95075.1"
                     /translation="MGSKSMSNKNNTLYRKPLPGSSLDYFDAREAVEAISPGAYARLP
                     YTSRVLAEQLVRRCEPSALTDSLKQLIERRRDLDFPWYPARVVCHDILGQTALVDLAG
                     LRDAIAEQGGNPANVNPVVETQLIVDHSLAVEYGGFDPEAFEKNRAIEERRNEDRFHF
                     IEWCKTAFENVSVIPAGNGIMHQINLEKMSPVVQVKEGIAFPDTCVGTDSHTPHVDAL
                     GVIAIGVGGLEAETVMLGRPSMMRLPDIVGVKLIGERQPGITATDIVLAITEFLRQER
                     VVSAYLEFFGEGAKALTIGDRATISNMTPEYGATAGMFYIDEQTINYLRLTGREPEQV
                     ALVENYAKHTGLWADDLQQVDYERVLEFDLSQVSRNLAGPSNPHRRLPTSELASRGIA
                     GQYQEKEGELPDGAVIIAAITSCTNTSNPRNVVAAGLLAKKANQLGLIRKPWVKSSFA
                     PGSKVAKLYLEEAGLLPELEKLGFGIVAYACTTCNGMSGALDPKIQQEIIDRDLYATA
                     VLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTMRFDIERDVLGMDSNGKPIYLRD
                     VWPSDEEIDSVVGSSVKPEQFRQVYIQMFKLDESERSESPLYDWRPMSTYIRRPPYWE
                     GALADERTLSGMRPLAILGDNITTDHLSPSNAILASSAAGEYLAKMGVPEEDFNSYAT
                     HRGDHLTAQRATFANPKLFNEMVKENGQVVQGSLARVEPEGNVTRMWEAIETYMQRRQ
                     PLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLQFKAGV
                     NRNSLQLDGTELYDVMGEIKPGADLALVITRTNGEKLDVAVTCRLDTEDEVHVYQAGG
                     VLQRFAQDFLSEQGA"
     gene            complement(41590..42732)
                     /locus_tag="AOT11_07310"
     CDS             complement(41590..42732)
                     /locus_tag="AOT11_07310"
                     /EC_number="2.3.3.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080571.1"
                     /note="catalyzes the synthesis of 2-methylcitrate from
                     propionyl-CoA and oxaloacetate; also catalyzes the
                     condensation of oxaloacetate with acetyl-CoA but with a
                     lower specificity; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylcitrate synthase"
                     /protein_id="ASM95076.1"
                     /translation="MPSSLTKKGELGGAGLRGQSAGSTALCTVGKTGTGLTYRGYDIT
                     DLANHAQFEEVAHLLLRGHLPTQQELDAYKTRLIGLRGLPAELKQALELIPASAHPMD
                     VMRTGCSVLGNLEQETDFSQQLDATERMLALFPAIICYWYRFSHDGVRIDTQDQSQDC
                     IGGYFLKMLTGKEPSELHKQVMHCSLILYAEHEFNASTFAARVCASTLSDIHSCVTAA
                     IGTLRGPLHGGANEAAMEMIENWQTPEEAESNILRMLANKEKIMGFGHAIYRESDPRN
                     ALIKRWSQALSEAVGDTHLYAVSERVEAVMKREKDLFCNADFFHASAYHFMDIPTKLF
                     TPIFVMSRLTGWTAHVFEQRANNRIIRPSADYIGPDHQDWVPIEQR"
     gene            complement(42922..43818)
                     /gene="prpB"
                     /locus_tag="AOT11_07315"
     CDS             complement(42922..43818)
                     /gene="prpB"
                     /locus_tag="AOT11_07315"
                     /EC_number="4.1.3.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008076308.1"
                     /note="catalyzes the formation of pyruvate and succinate
                     from 2-methylisocitrate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylisocitrate lyase"
                     /protein_id="ASM95077.1"
                     /translation="MSLTPGAKFRLAVQQNDPLQIVGTINPYCAMMAKSLGHQAIYLS
                     GGGIANASYGLPDLGITTLNDVLVDVERITNACDLPLLVDIDTGFGGAFNIARTIKAM
                     EKAGAAAVHMEDQVAQKRCGHRPNKAIVSQQEMVDRVKAAVDARVDENFVIMARTDAL
                     AVEGIDSAIERAIACVEAGADMIFPEAMNKLEQYQQFSAALAQATGKHVPILANITEF
                     GQTPLYGCEELAKSSVDMVLYPLSAFRAMNKAAEMVYRHLLEVGNQEALIDSMQTRKE
                     LYDYLNYHAYEDKLDQLFSEGK"
     gene            complement(43831..44526)
                     /locus_tag="AOT11_07320"
     CDS             complement(43831..44526)
                     /locus_tag="AOT11_07320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="ASM95078.1"
                     /translation="MNVDTKAIGKLAGSDKENTKSESLTESLVEAIVNGQIAPGSKIS
                     EPELAKHYHVSRGPLREAMMRLEGLGLIERVPHVGARVITLSPEKLVELYAVREALEG
                     MAARLAARHISQEELLSLELLLSTHSKHIDEVEGSSYFHQHGDFDFHYRIIKASRNRE
                     LIALLCDELYHLLRMYRYQSPRAQSRPKEALEEHKFILQAIRNRDEELSEMLMRRHIS
                     GSRKLIEQQILKD"
     gene            44875..45846
                     /locus_tag="AOT11_07325"
     CDS             44875..45846
                     /locus_tag="AOT11_07325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006877674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="ASM95079.1"
                     /translation="MFKALKPTLAASIIAASFSFNAFAAEIEKIHFLIPGGAGGGWDM
                     TARGTGDVLQKTNLVENVSYQNLSGGGGGKAIAHLIETAKRQEDTLMINSTPIVVRSL
                     SGVFPQSFRDLTPVAATVADYGAIVVAGDSKYNTWEEVTKDFAENPLKVKIAGGSARG
                     SMDHLVAAAAFKGQGFDAKQVRYIAYDAGGKAMAALLSGETQLLSTGLGEVLEMSKAG
                     QVKILAITAPKRLEAASNIPTLTEYGNPTVFANWRGFFAAPGASQEKINEWNAALTKM
                     YNTDEWKVVRDRNGWIDNYKADKEFYVFLEEQEKQMGDLMRELGFLK"
     gene            46088..46603
                     /locus_tag="AOT11_07330"
     CDS             46088..46603
                     /locus_tag="AOT11_07330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TctB"
                     /protein_id="ASM95080.1"
                     /translation="MSDLPTSSFKSNKLLSTEFLLCRDRVGALIFLLLCLGYGYQTYQ
                     IPLFPGDEYEPFNARTLPFILTVIGIGLALLLLVTGEPDSKSGAVTKFDWKLLIAFLV
                     LMALYGFGLTYLGFVLATGFFLLAGFYLLGERRKSVLFGASFPFVLAFYLLLTKGLDV
                     YLEPGLIFTLW"
     gene            46625..48166
                     /locus_tag="AOT11_07335"
     CDS             46625..48166
                     /locus_tag="AOT11_07335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter TctA"
                     /protein_id="ASM95081.1"
                     /translation="MLDGILQGLSTAVMPMNLMMVVIGCFVGTFIGMLPGLGPISAIA
                     LMIPITYGLEPSSGMILMAGVYYGAIFGGSTSSILINAPGCSSTVVTAFDGYPMAQKG
                     QAGKALALAAYASFTGGTLSAIMLLVAAPALATVSLSFQSSDYFALMLVGLSAVAAFA
                     GKGQVIKAWMMTILGLMLSTVGIDKGVGVERFTFGLTDLMDGFSFLLLAMATFALGET
                     LMGILKPDQDNSAEEQERMSNIGSMKVTREEIKEAAPVSIRSSILGFFTGVLPGAGAT
                     IAAFLSYGMERNLAPKEKKEEFGKGSIRGLVAPESANNAASSGSFVPLLTLGIPGSGT
                     TAIMLGALIAYGIQPGPRLFVDHPDVFWSVIISMYVGNIVLLILNLPLIPYISRLLAV
                     PRTVLLPMILFFSITGVYLVSFNTMDVFVMLLVAMGAIALRLANFPLAPLLLGFILGG
                     LMEENLRRALMISDGQLSFLWERPLTLAFTVIAILMVSSPLLGAIYQKIKPNTTKSNV
                     SQATK"
     gene            complement(48248..49135)
                     /locus_tag="AOT11_07340"
     CDS             complement(48248..49135)
                     /locus_tag="AOT11_07340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95082.1"
                     /translation="MNSSLTRCSTLMCFGTLMCFVSLSLAAVEPATQVCQGEFVVHLS
                     SHPVDKASSSDNALWFQGYVELEGALLACSPQLVIHAKNGWKEPIIGPQGAVASSLLD
                     GQRKSLHRDQRGSFILPLQGRKRSEFWVHVPQGKVLLSGQYQSDFEFKVKAAGHEFRR
                     AVSLNYQVKPFVRARVESRQGAHVSVSGTNVSIDMGNLTEKNQRQLDVIVVSNGSVKL
                     ELDSLNQGDMVNVKNARYKIPYATSLNGQPLRLNAPFYLRPHQQRETRFRLQFENTPM
                     PSAREGRYEDEMTIMLTAF"
     gene            complement(49154..51556)
                     /locus_tag="AOT11_07345"
     CDS             complement(49154..51556)
                     /locus_tag="AOT11_07345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PapC"
                     /protein_id="ASM95083.1"
                     /translation="MQRWWCVFLFLCLCPVSGFCADYRLSLPVWYSETQLGELPIEIE
                     GMTLKSVSAEALNVLLADRISDTWWRERFAHHSGDFIHVDKWRELGVNFHLNLESLTI
                     DLTLPQEALSERTLNASQQYPPFQASASGNVSWLNSFNFAYNRYWQNESESWYSSIDW
                     LSQMNLGGVSGINLQLVNHLQMDEESHDYVRGEWLAFYDDPDLPLRASVGDVFSGESG
                     HLYGLALGGFTVESRYADLQPERSISPQSSQQLLLQESAEVEVYVNGERVSSGRLEAG
                     RYNLQNLILDNGANEITVVLNYLSGRQEVLSFTQFYNARLLQQGLLDYAFSVGRPIVY
                     QEQGIEYEDAWLATGYLEYGVTDGFTLGGNGLWAKEGGVIGILATVSSGMGNLTSRFS
                     WSHNEDQGWVASLDYENSVIGNGESQSPNLRLAYEYSDQFQSKPWRKGEEGNQYSQIL
                     GSYFWQISDAVDLTLSGRYTLFDEKDDEVQTSVLLNWRHKGLTVGLGTEYEESARYVE
                     GDNRLLLTFEYNWYSEQESHRIGASYNSLTERSRLYFNNEGLNYVDDIGVRIEAEQDQ
                     SIKSQKAMLSYTANRFRVESELVRKQNRLDDQAQYQGSVRLATSLGMVDGEWGWGRAL
                     SGPFMVASMHPTLTEATAYLDVDSEGRATALATPSINGLIPISQPYGINIIEYNVHNA
                     PLGYDWGAGKIDVSPGAATGHRLIMGSDASYTVTGFLTTTEGEAIAYRQASLIVDDKR
                     MVFFTNQQGRFYIQGIAPGEYRLELSGLSSEARWIVIPESDNSLINLGQINVVLMDKS
                     AH"
     gene            complement(51587..52246)
                     /locus_tag="AOT11_07350"
     CDS             complement(51587..52246)
                     /locus_tag="AOT11_07350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PapD"
                     /protein_id="ASM95084.1"
                     /translation="MKRICLLTILLFFFHRQTLAFELFPMVQFLDDAGKGTTVFFKIT
                     NTSLAPLPVELIPIKREVSLNNNETLSETDELMVFPPQVLIEPGKSQSIKVQYIGEPK
                     QSAASYRLIASQLPLKNEASSDSIQMLFRIGALIFVSPQDAHADYSSHLTQGENEAVQ
                     LTIRNDGTSVLELTKLSHEVSWHNQKKSWSWVELEPLLPMQYLVPNQSVVVNVQSLLV
                     K"
     gene            complement(52294..52803)
                     /locus_tag="AOT11_07355"
     CDS             complement(52294..52803)
                     /locus_tag="AOT11_07355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95085.1"
                     /translation="MKRLATCIALTLLYSAGAAANSWVVSDEARADFLVKFSGEVPKR
                     CEMRASEELETLNFDLTQKSDKKTFAFKAWCNSYGTKGTLLVDPYAFKNSNGDEIPME
                     YSFNDKVSVKDAETETMAARIVDTIDVSNSLDKQMSSKHKLTIRSLPHKGARWGKYEG
                     YMWVSLYHM"
     gene            complement(53077..53712)
                     /locus_tag="AOT11_07360"
     CDS             complement(53077..53712)
                     /locus_tag="AOT11_07360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="ASM97786.1"
                     /translation="MKEPYKVWVISNDPEWSGLIVAGLSHTFTGYEFVIQASLESLWQ
                     LSDNELVIYDRQTLGNPSQHLISPTTRGGAWILANATQQDLDGVKGLISLGWFGFLES
                     EKTLENLHKAIRMVASGQLWFSREAMSYALRNIVRSQATTSCSLDVVGSKYELSGKEQ
                     KVFLYLLQGYSNKEISDQMNVSLSTVKSHVSHILCKTGKQSRSQLATLMIE"
     gene            54354..55112
                     /locus_tag="AOT11_07365"
     CDS             54354..55112
                     /locus_tag="AOT11_07365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="ASM95086.1"
                     /translation="MDIILLFFAGVFGGMLNSIAGGGSFITFPALMAVGIPPVVANAT
                     NTFASCAGYISGAWGYRRELYAQKSILLKTIVCSLLGGMLGAFLLLNTSESDFLKAIP
                     WLLLFATLLFVFGGRINQAIGHRAERPKHSIILWLPALFLVLVSAYGGFFNAGLGIVT
                     LSYLTLSGHRDIITMNGLKLLISTSVSLIAVVIFIFNGSIDWWNGFVVMLGSVVGGYV
                     SAVVARNLNKIWVHRFVTMTSFVITGYFFVKVYV"
     gene            55281..57017
                     /locus_tag="AOT11_07370"
     CDS             55281..57017
                     /locus_tag="AOT11_07370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM95087.1"
                     /translation="MTPLSFKNKIIALIIAIISLTIITSYFSANYFISRYIQDTDSKN
                     ITHNVDLIQRKLENELNGKLALANSLNFSMMDISETKESSGFDKIIKIVNGYAFDDTG
                     NMSEEDAQQYINLAESHGDATMVSPVSMLNGEPSITFSLKRIDDSVDFFVLNLGQFSQ
                     VIADYAAEGSYAELIANGNVIFSNKQGSNLTPIARPVEFAGQRWELIGYIDLDNIQSN
                     TDQLNWMITLALLVCAAVIIVSSVILLQVSFKPLSRLNLVVADLSQGNGDLTQRLAIE
                     SKDEIGQISHSINLFIEKLQQMFIEVADSSKEIDHAVVNLSEQSRSNLRTLNQHTQET
                     EQAITAIEEMSASANSIAQSADNAAHLTETTTRYADESKQTVTGAVESVNGLVTQVVA
                     MSDTIARMSDDTKQISTVLQVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVR
                     ALAARTQQSTAQINEMLAKLKSTTENVVNEMGSTRTRCEETAERTNHVMDSLNVVTDS
                     VAEINNLNTLMATSAMEQRQVTQEVSKNMAAIQEIVRLLNENAAQSTSISDELQNTSH
                     ALTDVVGRFRVN"
     gene            57529..58833
                     /locus_tag="AOT11_07375"
     CDS             57529..58833
                     /locus_tag="AOT11_07375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001045552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol 3-phosphate ABC transporter
                     substrate-binding protein"
                     /protein_id="ASM95088.1"
                     /translation="MNKVWVNGLLCAAVSGGFSATAFATTEITWWHAMGGQLGETVNH
                     LATEFNASQDEYKLTPVYKGSYTETLTAGIAAFRAGQAPNILQVFDAGAATIINSKGV
                     AKPVQTLMIESGYPFSAHDYIAGVRNFYADSQGKMIGMPFNSSTPVLYYNKDMLAEVN
                     AKAPQTYEQLEQVAAKLASKGKAGFSQSLTPWIMFENFKSRHNLPLSDKQNGYQALST
                     KIMFSTDDMLMHVKKLKEWSDKGYYKYYGSDWDANQTPFERGEVAMWMGSSGSFGGLR
                     NRVKFNLGTTYLPYWQSITQKPTHTFIGGAALFALNGHSTKQDKGVAAFFDYLTKPET
                     QMYWHKTTGYVPVTQAAYELTKQSGYYQENPDAEVGVKQLSLPDGEWTKGYRLGYYPQ
                     VREVMHREFDNIFSGRSTVENSLNKVENESEKLLNRFARTVQ"
     gene            58901..59782
                     /locus_tag="AOT11_07380"
     CDS             58901..59782
                     /locus_tag="AOT11_07380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter permease"
                     /protein_id="ASM97787.1"
                     /translation="MERRQHFSHTPLPYLLLAPQIVIIGVFFIYPAAQAIYLSFMLED
                     PWGLSSTFVWFENYQLLFTSSDYLESLGFTLLFSLLVSFLSLALALLLAVKADNIIHG
                     QGPYRITLTWVYAVAPAVAGIIGGFLFNPHIGVLTDLFERLGWQFSFQTDPVDATIAL
                     ILVSVWKQVSVNFVYFLAGLQSISYAVREAALLDCQSDNKRFWTITFPLLAPTGFFLL
                     VINLTYAFFETFGVIDTMTNGGPGGSTTSLVYKVYRDGFVGADLGGSSAQSVVLLVLV
                     LLLTWLQFRFVEKRVHY"
     gene            59792..60634
                     /locus_tag="AOT11_07385"
     CDS             59792..60634
                     /locus_tag="AOT11_07385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005508157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter permease"
                     /protein_id="ASM95089.1"
                     /translation="MKSNRLSDHLILIAGALFMLLPLWLIFASSTHNPNTIVSEGLQW
                     TLGDNLQAVYAEAWNKSLGFAGNVTAHTMIVNSLIMGLGFAIGKIIISMMAAYALVYF
                     RLPYATAWFWLIFVTLLLPLEVRIIPSYEVVSRLGMLNSYTGLVLPLIASATATFFFR
                     QFFKTIPDELLEAAQLDNAGPIRFFIDILFPLSKTMMAAIFIIMFIVGWNQYLWPIMM
                     TTDEQYNTIVMGIKQILNNINETSLPRYDYAFAMVILAMLPPVLVVVIFQRWFVKGLV
                     ESEK"
     gene            60624..61805
                     /locus_tag="AOT11_07390"
     CDS             60624..61805
                     /locus_tag="AOT11_07390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ASM95090.1"
                     /translation="MKNNQNSNIHPIRRSISAEPIMLDIQQLVKTYENGHQAVKGVDL
                     AIHQGEFIVLVGPSGCGKSSILRSIAGLEAITSGEIHLAGRRVDNEKPANRDIAMVFQ
                     NYALYPHMSVYDNLAYGLKNRGVSKSTIAEKIAKVAKTLKIEEYLDRKPAKLSGGQRQ
                     RVAMGRAIVRDPQLFLFDEPLSNLDAALRAHMRLEIKKLQRELGVTSVYVTHDQVEAM
                     TLADRIVVLKQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFLTASISNGKLQLAGK
                     QWPVPYDADLNCNTLTLGIRPEHASLHPIDDAIELSLNIQVVEPLGPNQLVHGKIKGE
                     YGEGDFIAVTAEMPLTIGENLPIWVRIEQLHLFDEQEKRIPLSAQSPSVDARQQQRQQ
                     Q"
     gene            61802..62575
                     /locus_tag="AOT11_07395"
     CDS             61802..62575
                     /locus_tag="AOT11_07395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="ASM95091.1"
                     /translation="MRLAVSLSTRQKQILAYLQQTHGVLSSTLLSERFDVSVQTIRKD
                     MNDLSDKGMVRRVHGGISLPSANDNLSFTNRDLLNLSAKQRIAQKVALELPEGSSIFL
                     GIGTTPKQVAQALLDHPGLTVVTNNLNAALTLSRNPNITLHLAGGLVRHSDEDTVGEV
                     TTRFYRRFNIKIGIFGVGGMTHNGQLLDFTPEEANLTRAIIECSEQCWLVADKSKLGR
                     YAPVVSGELSEMQKLFVDEITPEFLQLCQDHQVTLIPSR"
     gene            62601..63308
                     /locus_tag="AOT11_07400"
     CDS             62601..63308
                     /locus_tag="AOT11_07400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="ASM95092.1"
                     /translation="MPPMIVGHRGVAGSYPENTRVSVQAAIDLGLSWVEIDVQPTKDN
                     VLVVCHDHTIDRCSNGKGRVDAYSLKELQAFDFGGWFDEAFAGEQIMTLESLLNLAAE
                     YDLGLNIEVKVDNHDVGKVALNLKNLLDKSPLTADIILLSSFSHDIILQLHQHCPGYK
                     LGVLSERLSQRDRQVLKEVNAFSCNLNYRWITEKHIRDLKTSGYQIWCYTVNQADKFR
                     YLDKVDAIFSDHPERFI"
     gene            63537..65708
                     /locus_tag="AOT11_07405"
     CDS             63537..65708
                     /locus_tag="AOT11_07405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase"
                     /protein_id="ASM95093.1"
                     /translation="MEHKPTHTSGQCPVMHGGATSSNSSNVAWWPKALNLDILHQHDR
                     KSNPMGADFSYREELKKLDVEALKRDLKALMTDSQDWWPADWGHYGGLMIRMAWHSAG
                     SYRVGDGRGGADTGNQRFAPLNSWPDNANLDKARRLLWPIKQKYGNKISWADLMILAG
                     NMAYESMGLKTFGFAFGREDIWHPEKDIYWGAEQEWLAPSGAENSRYSGERDLEDPLA
                     AVMMGLIYVNPEGVDGNPDPLKTAKDMRVTFARMGMNDEETVALTAGGHTVGKAHGNG
                     NAANLGADPESADLEEQGLGWNNHKSRGIGRDTVTSGIEGAWTTNPTQWDNGFFHLLF
                     SYDWWLQKSPAGAWQWEPVNIKEEDKPVDVEDPTIRHNPIMTDADMALKLDPEYRKIS
                     ERFHKDPAYFSETFARAWFKLTHRDMGPRARYFGPDVPAEELIWQDPVPTGRKDYDVD
                     AVKAKIIASGLSTGELVSTAWDSARTFRNSDKRGGANGARIRLAPQKDWLGNEPEKLA
                     KVLHVLEAIASEFNISVADTIVLAGNVGVEQAAKAAGIAITVPFAAGRGDATIEQTDV
                     ESFEVLEPIADGFRNWQKQHYAVNPEELLLDRAQLLGLSAPEMTVLIGGLRVLGTNHG
                     DTKHGVFTDNIGALSNDFFVNLTDMRYTWKPTGRNSYDIVERNSGNVKWTATRVDLVF
                     GSNSILRAYAEVYAQDDNKEKFVKDFVAAWTKVMNADRFDI"
     gene            complement(65772..66122)
                     /locus_tag="AOT11_07410"
     CDS             complement(65772..66122)
                     /locus_tag="AOT11_07410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95094.1"
                     /translation="MNPIVVSVGLLICSNVFMTFAWYAHLKELNNKPWIIAALVSWGI
                     ALFEYLLQVPANRIGYTALNVGQLKILQEVITLMVFVPFSVFYLREPLKLDYLWAGLC
                     LVGAVYFAFRSKFS"
     gene            complement(66245..66457)
                     /locus_tag="AOT11_07415"
     CDS             complement(66245..66457)
                     /locus_tag="AOT11_07415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="ASM95095.1"
                     /translation="MSGKMTGTVKWFNETKGFGFISQDNGGKDVFVHFRAIVSEGFKT
                     LAEGQKVSFNVEEGQKGPQASNVTVI"
     gene            67029..68198
                     /locus_tag="AOT11_07420"
     CDS             67029..68198
                     /locus_tag="AOT11_07420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95096.1"
                     /translation="MTLTLDLRTLCIVTSCICLSYGIGLALFNRAHIKHHNLMTFVLA
                     LMLVGSSTGLIALRGLLPDFVSIVIANVMISAGFSCFLHGYSKFRKIHNRFAQISFSL
                     LIPLALSFVYFTYVAPSLSTRIVVVAAFMSLTLYMTAYNVRKGLASDSPVPVNIIAAS
                     FSIIGTIELIRAIYFSIWPEDQYFNASDASLFVLQMSYLFGTLNIAITTFGLVWLINE
                     RLISSLQEMSFKDNLTGFFNRHGLEQQLPQLVHTSQESQQPLSALMLDIDHFKLINDT
                     YGHLEGDNILKRCAEEIQSLLPTEHLAFRYGGEEFLVILKSCNLSQAQKLAETIRQTI
                     EAKQLAMLSGRSLTLSIGLTDLHPEDHIDNLIKRADQALYLAKSQGRNQVVANAM"
     gene            complement(68319..68395)
                     /locus_tag="AOT11_07425"
     tRNA            complement(68319..68395)
                     /locus_tag="AOT11_07425"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(68359..68361),aa:Val,seq:gac)
     gene            complement(68431..68507)
                     /locus_tag="AOT11_07430"
     tRNA            complement(68431..68507)
                     /locus_tag="AOT11_07430"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(68471..68473),aa:Val,seq:gac)
     gene            complement(68655..69446)
                     /locus_tag="AOT11_07435"
     CDS             complement(68655..69446)
                     /locus_tag="AOT11_07435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95097.1"
                     /translation="MRWFAIALFVFHFSAVAAQPKTLTLVLPTQLDGSHLFYHELLRQ
                     SLDSIGVKLTIKTPFEHIPQKRLVKMVENNQLSLMWLLQTKERDAQYPYVNAPVTNGL
                     IGQRVLLIPKGAQPQYDSINSLDELRQSGLTAGLGYAWYDVDVWLQNDLPFYEQDGEW
                     RMLYHKLSTQGSINYFPRGVNEVMAESRLNPQLEIEQHLLLIYQRDFRFYLSEGAKQH
                     KALLERALLKAEKSGLLQRLIDQYWATEITQLQLNKRKVLKLVTP"
     gene            complement(69512..70177)
                     /locus_tag="AOT11_07440"
     CDS             complement(69512..70177)
                     /locus_tag="AOT11_07440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="queuosine biosynthesis protein QueD"
                     /protein_id="ASM95098.1"
                     /translation="MTNIFIIVALLILFFFVIQKYVVKQDDTKEYAYRSKGSVLKGHE
                     VAFFNALKTAVGEHGVVFAKVNMSNVVAPRDINSKKQLFIASNRISRMYFDYVICDPR
                     TFEPRVIIELDNGKELNKVKVEREKLLMQVCKTANIPLIGTSIKHSYQVGRLRRLLAA
                     HIDLIEPDKEVRFCKKCGSPMIIKIASQGEFKGRRFFTCSRQPNCTYTENYNVVFDVD
                     EDD"
     gene            70416..70595
                     /locus_tag="AOT11_07445"
     CDS             70416..70595
                     /locus_tag="AOT11_07445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95099.1"
                     /translation="MELKQDPRCYTDVCIEGKWYHYDHCGTTAYMLKGGCSEEIQLSR
                     EPSTESELIELLMMR"
     gene            complement(70657..71472)
                     /locus_tag="AOT11_07450"
     CDS             complement(70657..71472)
                     /locus_tag="AOT11_07450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="ASM95100.1"
                     /translation="MCQFKTTFTCKGSKLGGVMFRSVLFLLASLLATVTIAKSDLQSI
                     TYLTEEYPPYNFTENGELHGIAVDLLVAATARATQPVAKEDISVQPWARAYRTVLINK
                     DTVLFSTTRTKLRENLFNWVGPISATRIVVMAKKSAQISIKRPNDLIQYRIGVIRDDV
                     GEQLLLELGVPRNSMQESSYAATLAEQLYKGRIDLWAYEENVAKWWISKGGFNSEDFE
                     PVYVLQEGELYYAFNKDVDGASVRALQQAIDALKHTSDDENQTFYQSIVSKYR"
     gene            complement(71507..72175)
                     /locus_tag="AOT11_07455"
     CDS             complement(71507..72175)
                     /locus_tag="AOT11_07455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maleylacetoacetate isomerase"
                     /protein_id="ASM95101.1"
                     /translation="METSLKLYGYWRSSAAYRVRICLNLKQLCYENHSIHLVKNGGEQ
                     HLAQYHALNPNELVPVLVDGELVLNQSLAIIQYLDDNYSSTQVIPSIGPLKYQALALA
                     QDVAVDVHPLNNLRVLQYLEGTLEVDEEQKRLWVHHWIHMGFKAVEEKLLAHRKHYGE
                     CVFSISSSPSIVDICLVPQVYNALRFGVNMTPYPTINAVVAACNQLPAFDLAKPENQP
                     DAQL"
     gene            complement(72183..73202)
                     /locus_tag="AOT11_07460"
     CDS             complement(72183..73202)
                     /locus_tag="AOT11_07460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-4-pentenoate hydratase"
                     /protein_id="ASM95102.1"
                     /translation="MKLATKKNAHRDGELIVVSRDLSRYVSAADIAPTLQLALDHWSV
                     CEPKLKELYQALNQGEVAGSSPFEETLVHSPLPRAYQWADGSAYVNHVELVRKARGAE
                     MPESFWTDPLMYQGGSDSFIAPRDNIEFASEEWGIDFEGEVAVITGDVPMGASIAQAQ
                     ESIRLVMLVNDVSLRGLIPAELAKGFGFFQSKPSSAFSPVAVTLDELGDAWYENKLHL
                     PLISTYNDKPFGKPNAGVDMTFDFADLIVHAAKTRPLSAGAIIGSGTVSNKQGTDHGT
                     SIEEGGVGYSCIAEIRMIETIRDGQASTSFMRFGDSIRLEMFDAQGQSIFGAIEQQVS
                     RYQHK"
     gene            complement(73243..74379)
                     /locus_tag="AOT11_07465"
     CDS             complement(73243..74379)
                     /locus_tag="AOT11_07465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homogentisate 1,2-dioxygenase"
                     /protein_id="ASM95103.1"
                     /translation="MHKWITFPHREGVCSKQAHADFPEEAIYEREAGRSGFFGPAAHF
                     HHQHAPTGWVDWQGDLRPRAFDFTRVTSANQASPWSVPHLLHNHECKVRVWKTQTKME
                     FLARNADGDELLFIHQGKADLYCDYGHLAVGEGDYVMIPRSTNWRLEPSEAMFILMIE
                     NTDAAYSLPEKGLVGNHAVFDPAVLETPSINDQFKAQYSEQETRVEVKRHDNVSVITY
                     PFNPLDAIGWHGDLSVVKLNWRDIRPLMSHRYHLPPSAHTTFVGNGFVVCTFVPRPIE
                     SDPGALKVPFYHNNDDYDEVLFYHAGDFFSRDNIEAGMVTFHPAGFTHGPHPKAFKAG
                     QEYKKKFTDEVAVMIDTRHALTFAQELDSVENKEYVYSWRENQK"
     gene            complement(74372..75445)
                     /locus_tag="AOT11_07470"
     CDS             complement(74372..75445)
                     /locus_tag="AOT11_07470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylpyruvate dioxygenase"
                     /protein_id="ASM95104.1"
                     /translation="MVDAINPLGTDGFEFVEYTAADNTGIEQLKHLFSSLGFAEVAKH
                     RSKEAWLYRQGDINFVVNAQPHSQAEEFANVHGPSVCGMAFRVQDAASALKHALTNGA
                     EEYKTEIGPMELSIPAVHGIGGSLLYFVDRYGKQSIYDVDFRFYDDSAQRLANSDVGL
                     YEIDHLTHNVKRGNMDTWAGFYERIGNFREIRYFDIEGKLTGLVSRAMTAPCGKIRIP
                     INESSDDKSQIEEFIREYNGEGIQHIALTTDDIYQTVQTLRERGMDFMPTPDTYYDKV
                     DTRVEGHKEDVNRLRDLRILIDGAPLKDGILLQIFTQTVIGPVFFEIIQRKGNEGFGE
                     GNFKALFESIEEDQIRRGVLNDA"
     gene            75856..76962
                     /locus_tag="AOT11_07475"
     CDS             75856..76962
                     /locus_tag="AOT11_07475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="ASM95105.1"
                     /translation="MIPVNQERLIEHFCQLVRIDSESMNEKAIAEALAEQLGDMGFSV
                     HKLPVPEHISNGFNVYARLEGELEGSILLSCHMDTVAPGNGIEPVIEDGIIRSKGNTI
                     LGGDDKSGIAAIMEAVRLLKEQNQQHKTIELAFTVHEEGGLFGSEYFDMSYVTAQQAI
                     VLDTGGPIGSIVTAAPGQQKIVATIKGRPAHAGLAPEEGISAIMVAADAINQMKLLRI
                     DSETTANIGSVHGGQATNIVMPELKIVAEARSLNAEKLDAQVEHMITTFERVAEEHGA
                     KVEIESSRAYNAFVLSDDHPHVVEIKQAFADIGVDAITKGTGGGSDANNFNAKGLTTV
                     NLSTGMSKVHTTEEFIAIADMVKITEFLTHYLAK"
     gene            77195..79099
                     /locus_tag="AOT11_07480"
     CDS             77195..79099
                     /locus_tag="AOT11_07480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2', 3'-cyclic nucleotide 2'-phosphodiesterase"
                     /protein_id="ASM95106.1"
                     /translation="MKKTLLTSAIALSLTFPALAANGDIHNVTILGTSDLHGHFMPWD
                     YAADKLNMSGSLSQIATKVKAIRQEQNNVILVDAGDTIQGNFVETFKEEPIDPMMLGF
                     NEMNYDVWVLGNHEFDFGLNVLNRSLTQFKGTSLAGNIQRPDGNPFLPGYTIIERGGI
                     KIGVIGMDTPMTQVFAEGTNRLEGMTFTNPTLEVKKIVKQIEGKVDAIVLVAHMGLDN
                     ENDIADTGVTDIANGNPELDAIVAGHMHTRIDKAVVNGVIITEPDKYGRALSRIDLQF
                     EEQNGQFTLINKDSYTYKIKGIDSDDKMESLYEPYHKRLREMANREVAQLTGVNLVPE
                     NDIRGIPQVHIQDTGISALFQEASFFYAPQANVIALQIDNDNAKLDVGPIKAKDIAYN
                     YQYAGGEITVYQMTGKELKQYMEWSAGYFNSVQPGDVTYSFNPERRASKYSTNDFFAG
                     VTYTIDLTQPAGQRITDLKFADGKPVLDDSEIRLGMNSYRMGHLTQKGGVLEGQTFPV
                     LFDTEAKYGEEQGTIRNLTIRYLTEQKQGQYVGQPMQRWKLSGLQGFEKEGAIVKQLI
                     NKGKIDVPASEDGRYTNIASINVKALVFTNPQAKNEAITSRLAKIEEAYPAEKQHLKR
                     ELILIEALNP"
     gene            79259..80200
                     /locus_tag="AOT11_07485"
     CDS             79259..80200
                     /locus_tag="AOT11_07485"
                     /EC_number="2.3.1.46"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D937.1"
                     /note="catalyzes the formation of O-succinyl-L-homoserine
                     from succinyl-CoA and L-homoserine in methionine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="ASM95107.1"
                     /translation="MPIRIPDQLPAADVLRTENIFVMSETRAAKQEIRPLRVLILNLM
                     PKKIETETQFLRLLSNSPLQVNVELLRIDDRPSKNTPTEHLDNFYRQFEMVKNRNFDG
                     LIITGAPLGLVQFEDVIYWDHLKTIMEWAKSHVTSTLYVCWAAQAGLKLLYNLPKQTR
                     KEKLSGVYHHRIHKPYHPVLRGFDDSFLAPHSRYADFSPEYLAEHTDLDILATSDDAG
                     VYLATTKDKRNVFVTGHPEYDPHTLHNEYIRDLGEGMEPAIPVNYYPNDNPDNPPIAS
                     WRSHGHLLFSNWLNYCVYQQTPYDLDHFSEDAFTKDE"
     gene            80356..81090
                     /locus_tag="AOT11_07490"
     CDS             80356..81090
                     /locus_tag="AOT11_07490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilW"
                     /protein_id="ASM95108.1"
                     /translation="MKKQTLLLPQLVALTLLTGCVTVTEGQAQKDPDPIGMAESRIAL
                     GLGYLENGAMIKAHDNLQQALTHAPDYYRAQLSMAHYYERVGENGKAEDIYQKSARQH
                     PKNGNVLNNYGTFLCKKGEYDKADRLFNRAIEQPYYYLIPASYENAAFCALKAGENVK
                     AQTYFTRAIDYDPHRPKSILNLAKLEVDAGNYTQARLRLMRFHQSYGLQIPSLKLMID
                     LEDKAGNVALVKKYQSELDKLTARQG"
     gene            complement(81183..81398)
                     /locus_tag="AOT11_07495"
     CDS             complement(81183..81398)
                     /locus_tag="AOT11_07495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95109.1"
                     /translation="MDFEIYLPCQPDWLCESFLSVFTILLIIGLVAFIRIIYREYLTI
                     KRKTKVRKLRNTHRKDRYKIRNSTSRR"
     gene            complement(81455..82549)
                     /locus_tag="AOT11_07500"
     CDS             complement(81455..82549)
                     /locus_tag="AOT11_07500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="ASM95110.1"
                     /translation="MTNKRKSAKPLESAKRAPTPHKKKSCDLNMSESSCDFVKVTRAG
                     LHSRNKHQGRYDFAKLTQALPSLAPFVIKNPKGEASISFSDSTAVKMLNKALLSAYYQ
                     VANWDIPAGYLCPPIPGRADYIHRLAELLEGEVKGKFPHEKVQALDIGVGANAIYPII
                     AICDYRWSYTGSDVDPKSIESAQRIADSNPVLQGQLDLKLQDQSQHIFQGIIGPTDYF
                     HVTTCNPPFHASAQEAAFGTQRKLDNLAANRLKKGVTAKAGSQKISKNKPILNFGGQN
                     SELWCQGGESSFLKRMANESERFAHQVLWFSTLVSKKDNVRPLRKQLEKLGVRSIRVV
                     EMSQGQKVSRFVAWSFMDKQQRGEWIKLRG"
     gene            complement(82549..83061)
                     /locus_tag="AOT11_07505"
     CDS             complement(82549..83061)
                     /locus_tag="AOT11_07505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="ASM97788.1"
                     /translation="MHPSLRYIQGYPQHIVQQVAQLIESQRLIPWFDKRYPARHDIRS
                     EKALFDYAMQIKNQFMKKTGPISKVVYDGKIHLINNALGLHSVVSRNHGGKLKSKNEI
                     RIANVFKEAPEPLLRMLVVHELAHIKEKEHDKAFYSLCCYMEPDYHQLELDARLFMIY
                     LDLKAQEAKK"
     gene            83196..83426
                     /locus_tag="AOT11_07510"
     CDS             83196..83426
                     /locus_tag="AOT11_07510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="ASM95111.1"
                     /translation="MKRVVLYIKDKCPHCKDAQRYLDSKGIQYRLCNAKMHRGRKELD
                     AIGARSVPVLKIGDRLMIGWNPKNFERMYGDK"
     gene            complement(83433..84302)
                     /locus_tag="AOT11_07515"
     CDS             complement(83433..84302)
                     /locus_tag="AOT11_07515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM95112.1"
                     /translation="MESKQLKQFLAVAEEKNFTRAAQSLHIAQPALSVSIKKLEQSLG
                     VTLFKRDDKQIALTTEGQTLYEHAKRVVQQLHDAELAMNELKGLEKGEVRLGAPSMMG
                     SYFFPEILMAFKSHYPNLKLTLIEAGTQSIRKMLLDGDLDIGVITENDVPDDLEIDHL
                     FSSQMMAVVGSEHPLSQRASLTFEEFFQHELVMFKSGYFHRDFLDHFSQQHGIEMQYS
                     FETNLLPLILKIVKREFAITALLQLVTENESGVVGVPFSPPVTLNLALAWRRGGYLSV
                     ADRTFIEFIKQYV"
     gene            84397..85605
                     /locus_tag="AOT11_07520"
     CDS             84397..85605
                     /locus_tag="AOT11_07520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter permease"
                     /protein_id="ASM95113.1"
                     /translation="MYELGSSQYRHITIALALGSFLVFCNLYLFQPMLPKLALEYAVS
                     ETQVNWVFAATTLGLSLSLVPMAVLSEKIGRRTVMLAGLFTIPLCSAALLLNDSFLFV
                     VLCRALLGVALAAFAAVAVAYMAEELHPKAFSHAIGGYIAANSLGGISGRISGGLMSD
                     WFGTTVAIEVMLLFTLLGVIAVSFLLPKQKHFSPSTHSLWQHNQTIVQHLRHTRVWLA
                     MVIGGLNFALFVNLYSVMGFRLVAEPHGLPVGLASLIFLCYLGGTISSKYTGKWNQHF
                     HPVSGMLLGAAISLFGMLITSIEHLAAMFIGLVLISFGAFFTHTLAYGWVGQKATHAK
                     ATATAMYLVHYYVGGSLGGFFLLYCWQHWQWNGVIIAASSMYVLLFAVILQLKKPKYA
                     CIEESLVKHP"
     gene            85678..86238
                     /locus_tag="AOT11_07525"
     CDS             85678..86238
                     /locus_tag="AOT11_07525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95114.1"
                     /translation="MTQSSTQQTIHQEVNQWLNDVVIGLNLCPFAAKPQRNQQIKIHV
                     SEADNEELLLQDILSLLMELDQTEPSELETTLVVIPNMLSDFWDYNLFIDWVEALIKQ
                     QDWEGVFQVATFHPDYCFGGAEPEDDENLTNRSPYPIFHLIREESMEKVLRHYPDPES
                     IPDTNIARVSALNEEERKKLFPYLFR"
     gene            86388..86963
                     /locus_tag="AOT11_07530"
     CDS             86388..86963
                     /locus_tag="AOT11_07530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004726154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="ASM95115.1"
                     /translation="MQLSQLTQDIFDHLYRDITEFRSTFDLPVAAPESLDEKADTLHT
                     SLIIEEMTELAEADSKTEQADAIVDSVYVLMGRLVHLGAANVEDNLAISYLIDLLLNV
                     AKNRGIDFIPCWDEVHSSNMSKVCRNEQEYADTEKFYAEQGVKLMAVQKGDYLIAKCA
                     EDFEGEGKTIRAGKVLKSVYYRPADLVPLTQ"
     gene            87119..88456
                     /locus_tag="AOT11_07535"
     CDS             87119..88456
                     /locus_tag="AOT11_07535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95116.1"
                     /translation="MSIQNYFADFLEESPVDVAQLTTFSEHIPDEWVAKAATLSDKAT
                     IRRRRLPSDMVLWLIVGMAFFRNESIAEVARRMNVCAEGLADEELLAKSALTQARQRL
                     GKAAPEWLFRQCSHTWGLERYPEDTWQGLQVFAIDGALFRTADTSELREHFGSGNTSS
                     ERQTPHPVLRVVTMMNVRSHVIVDAAISPYRRGEIPLAMPFIDSLPDNSVTLLDKGFY
                     GADLLLSLQNSGSNRHWLLPAKKGVKFRLLDDEESDDMLVEMKVSPQARKKNPNLPEK
                     WQVRAVTYQVQGKHKTVFTSLPREEYDAESVAELYHERWEIELGYRDIKSSMQHNALV
                     LRSKTVELVYQELWGLLLGYNLVRREASQAAVAHGRMANEISFKYACQFIASQLKVMS
                     KAVSPGNTPKRLKSLRGDLSILFIDKRPKPNRPRAVKISKTRYPVNRKAAPLK"
     gene            complement(88511..89275)
                     /locus_tag="AOT11_07540"
     CDS             complement(88511..89275)
                     /locus_tag="AOT11_07540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter"
                     /protein_id="ASM95117.1"
                     /translation="MRINHISVGNRLLPLSFQCAAGEKVYVAGPNGSGKSTLLSAIAG
                     TLSSREGAKGEVLINETSLLTLPLAEQAIYRAYLCQQSRPAFNVDVFQMLALSLPTGR
                     HVAEPEVQAAVRRVVELVQLQDKLHRSVQALSGGEWQRVRLAAVCLQVWRSLNPYSQL
                     LILDEPAAPLDVAQAKWLYQLIDEMAAQGLVVLVANHDLNRVYRHADKVLLLNQGVLA
                     AYGSAEEVMSVENLQQVFETPVKKVAVDGQPYLIFT"
     gene            complement(89265..90260)
                     /locus_tag="AOT11_07545"
     CDS             complement(89265..90260)
                     /locus_tag="AOT11_07545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Vitamin B12 import system permease BtuC"
                     /protein_id="ASM97789.1"
                     /translation="MELHQLIAHKEKRWRATLLVMVAVLLILSALYLMVGEVFLSPFS
                     SLSSFEHKLLVDLRLPRLVAAMVIGAALAVSGATLQVLLGNVLAEPGVLGISGGASLA
                     MVIALFLLPVMPTPTVFMLAAIIGALVFTLILVGMTRAMHLSTSRMLLVGVALGILSG
                     AFVTWAFYFSDDLSLRQLMYWLMGSIGGASWHHHLVTLVLLPVLVWLCLQGQTLDKLM
                     LGETHAAQLGVDVYKVRWRLILAVSILIGCAVALGGIISFVGLVVPHLLRMAFGSENR
                     FLLPMSAFAGATLLVFSDIWARTLLDSAELPLGVMTTTIGAPIFIWMLIRSHDAH"
     gene            complement(90380..91408)
                     /locus_tag="AOT11_07550"
     CDS             complement(90380..91408)
                     /locus_tag="AOT11_07550"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MLE8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinylglutamate desuccinylase"
                     /protein_id="ASM95118.1"
                     /translation="MTNSLFRQSFLSDTLNMQQSVAAKATTLSNGVRLQLHQRGVLEV
                     IPANNSAETKNIILSSGIHGDETAPMELIDKIVHDIETGFQDVQARCLFIIAHPEATN
                     AHTRFIEENLNRLFDEKEHQPSKELVIADQLKLLVKAFFDNTPVESRWHLDLHCAIRA
                     SKHYSFAISPKTRHPTRSKALVDFVNHSHVEALLLSNSPSSTFSWFSAEYYSAQALTM
                     ELGRVARIGENELERFTALDLTMRDLIAEVTPEHLPKPAITYRVSRTIVRLHEDFDFR
                     FDDSVENFTSFMHGEVFGHDGDKPLMAKNDNEAIVFPNRKVTIGQRAALMVCKVKTRF
                     EDDQLVYD"
     gene            complement(91651..93450)
                     /locus_tag="AOT11_07555"
     CDS             complement(91651..93450)
                     /locus_tag="AOT11_07555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="ASM95119.1"
                     /translation="MTAPSWDLSIAYADLNDVRIEQDIELIEQCIKLLNTQASQREVV
                     SVMQNAIVTREAAGRLLSTVYTFANCYTSVDVTHPQAKALVGRMAKLSSEMEQAFSPY
                     QLALMHADDDFIADVLESNNPDVAGQVFSIAQLRKLADQSLSVSEEQLLSAMQVDGRD
                     GWGRLYDNLTGTLKISLDTEDGKQETLGFSQAASLLYGAEFSRQEPAWRGIQNAMATH
                     RETFAAILNALSGWRLTEYQKRSHQRKIHFLEPSLYESRIEAQTLETMISVAKESRSV
                     GQKAGKLMARVHGLEAMKPWNHLAAMPAFDGEAKVYGFDEAIEVIRNAFAQVNPEMAS
                     FVDLMVENGWIDAAPSENKRLGAYCTKLAATRTPLVFMTWSGSRSDLLTLAHELGHAF
                     HNWVMKDMPLCQTRYPMTLAETASIFAENIVQDYLIAQAATAEEKLEMLWEELSSAYA
                     LTINIPVRYEFEKAFYERRASGELSADDICQLMSETWQAWYGDSMSESDPYFWASKLH
                     FSISEISFYNYPYLFGYLFSKGIYAQRAAKGESFYRDYVALLRDTGAMMAEDVVAQRL
                     QMDLTQADFWQQSIDRIREKVDEFEQLLAQIGK"
     gene            complement(93475..94113)
                     /locus_tag="AOT11_07560"
     CDS             complement(93475..94113)
                     /locus_tag="AOT11_07560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ribazole phosphatase"
                     /protein_id="ASM95120.1"
                     /translation="MEVILLRHGKTAAEAGLFGRTDAKVPAARQQAIAEALFAQHDDV
                     ELIVSSPLSRCHELAELLGQQHDWPIRLQADLQEMDFGLLDGVPFATQDYPWPLLNAF
                     WQDPANASLPKGETLAEFQKRVVQCWSQIISTEHRKVLIITHGGVIRLILAHLLGVDW
                     QRPHWYQTLAIENASLTHITIFTDSDQTQFPTVKMIGMPLSIREEQTNHPVD"
     gene            complement(94123..94683)
                     /locus_tag="AOT11_07565"
     CDS             complement(94123..94683)
                     /locus_tag="AOT11_07565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylcobinamide kinase"
                     /protein_id="ASM95121.1"
                     /translation="MSCSTNKALVLGGARSGKSRFAEQLARQWSQQHDAKCHYVATAV
                     PFDQEMAERIYHHQQQRGQGWCEYEAPLYLAERLSQFGADDVVLVDCLTVWLNNWLFE
                     FGEHASNEKLEQKVAQLASVVKESPAQIILVSNEVGLGVVPLGQISRLFVDNAGRMNQ
                     SLAQVCDNVTLVAAGLPLVLKSSGHQ"
     gene            complement(94686..95453)
                     /locus_tag="AOT11_07570"
     CDS             complement(94686..95453)
                     /locus_tag="AOT11_07570"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin synthase"
                     /protein_id="ASM95122.1"
                     /translation="MKTWQYQYQLFCLAVSFFSRLPVPKSTPYSDERMNQAGRYFALV
                     GTLLGLLCVLIYAFASLFFPYQVAIVLMMAFSLLLTGAFHEDGLTDMADGIGGGMTLD
                     KRLTIMKDSRIGTYGSATLTMALIGKFVFLTTLARQPDFGLMIVVAYTLSRAVAATLI
                     YDMPYVSDSDTSKSKPLANAQSSTELAILILTGVLAAISLGLGVGLLLILFAILFRWA
                     FKRWLLARLGGFTGDCLGGAQQLMELGIYLVLIAVVQ"
     gene            complement(95455..96483)
                     /locus_tag="AOT11_07575"
     CDS             complement(95455..96483)
                     /locus_tag="AOT11_07575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /protein_id="ASM95123.1"
                     /translation="MLEQQFAAEIQHIIDNKTKPLGALGQLEQVALQLALIQSQGKEQ
                     AATHIEIKQPQMLLFAGDHGVADEGVSIAPSAVTQQMVLNFLEGGAAINCFCALHNID
                     LTVVDCGILLPVDSDAPNLILRRLGSRTANFAIESAMTADQVEQALHNGQQIAAEKIA
                     QGADLLMFGEMGIANTSSAAALLSALSGREVDHCVGRGTGISEEQLSHKIKVVAQGVG
                     RCEGQSVNAILAEVGGFEIVTMAGAFIAAAEHKTPVLVDGFIVSVAAYIATLLKPEVR
                     DYLLFAHRSEEQGHQIVLSLLEAKPLLDLGLRLGEGTGAALAYPLLKAAAQFYNNMAS
                     FESAGVTV"
     gene            97021..97719
                     /locus_tag="AOT11_07580"
     CDS             97021..97719
                     /locus_tag="AOT11_07580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="ASM95124.1"
                     /translation="MTIRGENTAVIVAGGTGLVGSQLIEQILPHEAISTLYALTRRQI
                     TVNIPQAIKLVNLIEPDLLISDWPDERARPTVGFICLGTTKKQAGSREQLRQIDVELV
                     CQVAQTMKLLGVTRVAVVSSLGADAQSRFHYLKCKGQMERALMNMGFEQLVIVRPGPL
                     KGQRHASRSDEKWLQRLMRPFIPFMRGKLRNYTPIDAKEVALAMLYRVFAPHPQKVEI
                     LHKNEMVKLLEQYR"
     gene            97793..99214
                     /locus_tag="AOT11_07585"
     CDS             97793..99214
                     /locus_tag="AOT11_07585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease I"
                     /protein_id="ASM95125.1"
                     /translation="MQQDNQPTFFFFDYETWGTSPAKDRPSQFAGVRTDDNFNIIGEP
                     LVIYCRPPADYLPAPEAALITGITPQKAQKEGLPEPEFIAKIHAELSRPNTTSLGYNS
                     IRFDDEVTRYTCYRNFLDPYSWSWQNGNSRWDLLDVMRACHALRPEGVEWPENEEGFT
                     SFKLEHLSVANGIEHSNAHDAMADVIATIEMAKKVKAAQPKLFDYFFSMRHKRKLNEL
                     IDIVNMTPLMHVSGMLGRECQYTSWIVPLAWHPTNNNAVIVVDLAKDPQPLFDLDADA
                     LHERLYTRHDELGDLLPVPVKLVHLNKCPILAPAKTLTAENATNIGIDREQCLANLAL
                     IRQHPEVREKLVQLFSIEREFEKSHDVDTLLYDGFFSPADKASMDIIRQTDPTHLAAL
                     DITFNDKRIEPLLFRYRARNYPWTLDENEQRRWANHCREYFESRIEEYMLNLENLVHE
                     HESDEKKMAILKSVYRYTESLIS"
     gene            99260..99631
                     /locus_tag="AOT11_07590"
     CDS             99260..99631
                     /locus_tag="AOT11_07590"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MLF6.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95126.1"
                     /translation="MKFSLKDLFGLVVSFGLIFLALTIGSGIQHWTGTSVPGSVIGML
                     VLFLSMAIGIVKVEWVKPGASLLIRYMILLFVPISVGLMEHFDMLIANALPIIAAAIG
                     GSLIVLVSLGWLLQRILGEEA"
     gene            99634..100311
                     /locus_tag="AOT11_07595"
     CDS             99634..100311
                     /locus_tag="AOT11_07595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95127.1"
                     /translation="MWLLVTIIVFLFARWLAIKINNPLANPLLISIAILIPMLTVLKV
                     PFETYYSDNEWISYMLQPAVVALAYPLYEQLPQIKANWRIIAFACTLGSIMSMLTAML
                     IAVAFKADISLIASLLGKSVTTPIAMEISSHLGGEAAVAAILVLLVGLFGAILAYPIY
                     NLLGIKHPIARGLTMGTVSHALGTATCVEKAPGDAAFSSLALVLCGIITSILAPSFFA
                     LAVWLYA"
     gene            100623..101015
                     /locus_tag="AOT11_07600"
     CDS             100623..101015
                     /locus_tag="AOT11_07600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95128.1"
                     /translation="MQIQTQTRLYSRFNVLAQPTVPMNVSDQLLQKLANLSAQNQWIL
                     FTAECPRPDFAQLTASNIRCQNVIQMKASQTMTEMEIVMKAIRSGNAAAVVASDQIDL
                     INQSLLSDLAREYGCEVFFVEGRAHKYH"
     gene            101218..102321
                     /locus_tag="AOT11_07605"
     CDS             101218..102321
                     /locus_tag="AOT11_07605"
                     /EC_number="6.3.2.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017038913.1"
                     /note="catalyzes the formation of
                     (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
                     carboxamido)succinate from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate and
                     L-aspartate in purine biosynthesis; SAICAR synthase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="ASM95129.1"
                     /translation="MSLADQVLAVNDDLPIRTDKPVHSGKVRSVYWLTEEDSARLIKE
                     KGYNVAPDAPLAIMVISDRISAFDCIWHGEYGLNGVPGKGAALNAISNHWFGLFKENG
                     LADSHILDIPHPFVWIVQKAKPVKIEAICRKYITGSMWRAYEKGEREFCGIQLPEGLE
                     KDKALPDLLMTPSTKGILKGIPGVPEADDVNITRQNIADNFAAFNFSSADDIALYEKL
                     LKDGFGVISEALANVDQIFVDTKFEFGYVTDAAGNEKLIYMDEVGTPDSSRIWDAQAY
                     QAGKIVENSKEGFRQFLLNYFPDPDILLNKDRMPEREALARDNELPEEALMAVSRTYI
                     NIAEKITGKEIVLSDNPKQEIIDILGREYGLID"
     gene            complement(102415..102804)
                     /locus_tag="AOT11_07610"
     CDS             complement(102415..102804)
                     /locus_tag="AOT11_07610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="ASM95130.1"
                     /translation="MEKQGKRHVEFDYTSFLGASCSKKWTFLEALTTFAPVFGVMWKN
                     SIAELSEPEDRLWDAALKSMSSRRSDESNLVTLLKLAKLEGIDELTVVMPYALEPTQI
                     DFIQNRSESKIDCREQDVFVIRLKDLS"
     gene            complement(103044..103811)
                     /locus_tag="AOT11_07615"
     CDS             complement(103044..103811)
                     /locus_tag="AOT11_07615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="ASM95131.1"
                     /translation="MKFKALALLLTAPLFAQAKSLNTISSYEDNYAIGTYTSDINDEA
                     YEASGSGMDNLQHFEVKFQLSVSVPLYRFSKATAVVGSYTQKSLWQLANSDISSPFRE
                     TNYKPQLFIAHQSNMLIFNHLEAGYKHESNGRSSALSRSWDRLYLAAERLDGPLEYGV
                     HLWSVVGDTSENRDIEDYYAPYEIWMKLYSAAGIFNARGFYNWDDSRGGVEVGYTFYF
                     NDLIGIYIQAYHGYGETLIDYDHNQTRIGAGFKLVRW"
     gene            complement(104013..106358)
                     /locus_tag="AOT11_07620"
     CDS             complement(104013..106358)
                     /locus_tag="AOT11_07620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="ASM95132.1"
                     /translation="MSALPIDAIKAQFDHHLGQTHLVVEAETGSGKSTRLPLWAAEHG
                     RVLVIEPRRIACTSLAEFLAEQSGQPLGSNVGYAIKLQAAYDAQTNIVFVTPGVALRL
                     LAEDGLSAFDIVIIDEFHERRWDMDLLTAMLKAQNKHRLVLTSATLAGEKLAKYLNAE
                     RLQSQGRCYPVSIEYRAKESHLLPSKKQCEQDVMAAINEVLQTEGQDILVFLPGRKEI
                     SNIASQLQAQPSLVVAKLHASVSDEEKRIALSVQTQRKVVLATNVAETSLTIPNITTV
                     IDSGLERRTIQRNGRTTLILSHISKASAAQRAGRAGRVMAGQCLRLYGEHAPLELATP
                     PELQREELSEPMLAAACCGYRLAELEFLDGLPEKSLVQAHKILNDMQAITAEGKVTEH
                     GQKLYPLPVDTLYADLVTRMPTKALKEAMIDLAAGLSVPAALYQIKGGEEAEKLREQE
                     PQQCDATLMIQLIRGQRFSGVIVDDGALDEARGLSQQMRDLFELPDLEVSSRYTRVEL
                     VTAIARLHPELVFIRRAKRREALGNGKMEMMVGRQSRFSDKHELALVLDSHSLPGKGV
                     KQTLNLASVIMPAPLTLINELELGEWRQGETRPSNDAVEVEMQLVYAGRVVESRLEQP
                     QGEDAIETIVALVKTGQLLPDLYAFVTTQMTHWHLYCALGLNEEQRPIGLLDFDQWLR
                     EQLHAMGVNEVDEMALFESCDFPYRGIPDWQYKDFAEQFPLSLSLPDLQLTVEYFPAG
                     KLVQVVFAGGNRKGDPKRWELPRFSGWRVQYRKASRVIDVR"
     gene            106608..108296
                     /locus_tag="AOT11_07625"
     CDS             106608..108296
                     /locus_tag="AOT11_07625"
                     /EC_number="1.1.1.38"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419938.1"
                     /note="malic enzyme; oxaloacetate-decarboxylating;
                     NAD-dependent; catalyzes the formation of pyruvate form
                     malate; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="ASM97790.1"
                     /translation="MNNDKRPLYIPFAGPALLSTPLLNKGSAFSAEERISFNLEGLLP
                     ETTETIQEQVERAYMQYKAFESDMDKHIYLRNIQDTNETLFYRLVQNHITEMMPIIYT
                     PTVGAACENFSNIYRRGRGLFVSYANRDRIDDILNNASNHNVKVIVVTDGERILGLGD
                     QGIGGMGIPIGKLSLYTACGGISPAYTLPIVLDVGTNNPQRLADPMYMGWRHPRITGA
                     DYDAFVEEFIQAVQRRWPDALIQFEDFAQKNAMPLLERYKNRICCFNDDIQGTAAVTV
                     GSLMAACQAAGSKLSEQRITFLGAGSAGCGIAEAIIAQMVSEGISDKQARSQVFMVDR
                     WGLLQEGMPNLLDFQQRLVQKQTVTAKWETEANGFSLLDVVKNAKPTVLIGVSGAPGL
                     FTQEVIQEMHKHCPRPIVFPLSNPTSRVEAVPADIIRWTNGDALVATGSPFDPVIHEG
                     KTYPIVQCNNSYIFPGIGLGVLAVNAKRVTDEMLMESSRALATCSPLAINGKGALLPP
                     LEEIHTVSKRIAYAVAKKAIEQGVALEIADDALQVAIEQHFWQPVYRRYKRTAF"
     gene            108430..109167
                     /locus_tag="AOT11_07630"
     CDS             108430..109167
                     /locus_tag="AOT11_07630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SanA protein"
                     /protein_id="ASM95133.1"
                     /translation="MFDRLAGLKSWISLKRLIGGSLVAILCAILFVIIVDRWVSLQAS
                     DKIITSYDQVEGFDVAVVLGTSKYIGRTLNTYYTHRIDAAIELYRQNKVQHLLLSGDN
                     AHRSYNEPWTMKRDLLKAGVPETNIHLDYAGFRTLDSIVRAKKIFASDHFLIVTQRFH
                     CERALFIANAYQINARCLAVSGPSNSKQIWSMRSREVLARVKAFIDLYVINTQPRFLG
                     PQEPIALEPLETPLSQPPAEGSDSLSQ"
     gene            109375..110745
                     /locus_tag="AOT11_07635"
     CDS             109375..110745
                     /locus_tag="AOT11_07635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Anion transporter"
                     /protein_id="ASM95134.1"
                     /translation="MTALAVTLKNWLLTRNSMIFIANILLFITLMTTLPFDPKVVVGL
                     SILTFVAVLWLTEAIHVSITALLVPMLAVFMGVFDTQAALNNFSNSIIFLFLGGFALA
                     AALHKQKLDQAIADKVLILAKGKMSTAVFMLFGVSAGLSMWISNTATTAMMLPLVLGV
                     MSKLDREKSHSTYLFVLLGIAYCASIGGIATLVGSPPNAIAAAEVGLDFTGWMKLGLP
                     ITILLLPIALIVLYSMTKPNLKHSFELDHTPVEWTNGKKITLAIFLVTVSLWIFSKPV
                     NAMLGGFKSFDTLVAIGAIVALGVSRAVEWKDIEKTTDWGVLILFGGGLCLSNVLKAT
                     GTSVFLAEGLGAFLEQAGILLTILAVVTFVVFLTEFASNTASAALLVPVFATIAEALG
                     LSPVVLSALIAISASCAFMLPVATPPNAIVFATGHIKQKEMMRIGMVLNIVCIAALTL
                     FATMFW"
     gene            complement(111067..112395)
                     /locus_tag="AOT11_07640"
     CDS             complement(111067..112395)
                     /locus_tag="AOT11_07640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95135.1"
                     /translation="MKWIHKLIFALAICTISLIALYSVLGDTRKLVITPERFAYFATD
                     DRAAGGITTTEMAIDGQTIDLSCNMQTASYPWPYCGISIFTDTLEATKGIDLSNYHTI
                     RLKLSYDKTGESDGRLRFYLRNFNPAYSTADNEYTYKYNGMEFTPSASVETIEIPLAN
                     LQVMTWWLADNKIPIEHSAPEYSNVTRIELATGSGAANGEHHIRIERIEFEGAYLAQE
                     TLLFALLLSWVLLGLAFSLNELRKSKHNLAESRFRQEHLRKMNADLRAQNYEFAELAH
                     RDALTGAMNRHAVRTWLEKKARTVRWGQEQLSALYLDLDKFKRVNDRYGHQMGDDILR
                     EFVLVVASSLEEGERLVRWGGEEFIVFLPETTLQQAVEKAEMIRKNVSNHLWVHGGML
                     TCSIGVAQMQEERVTEFLARADDALYQAKHRGRNRVEVNYGMQKTTSECG"
     gene            112626..113549
                     /locus_tag="AOT11_07645"
     CDS             112626..113549
                     /locus_tag="AOT11_07645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95136.1"
                     /translation="MGDGNRDNANRLATCILLPFGYILPQKQIMSNVMTTNAKGTLDK
                     MRATLEGVVQYRLPVGDTEISLTPFIGQSITLTHTGNIFCCSCGKKTKKSYAQGHCYV
                     CMSKLASCDMCIMKPETCHYEQGTCREPEWADTHCMVDHYVYLSNTSSLKVGITRHTQ
                     IPTRWIDQGATQGLPILKVKTRQISGLIEVELAKHIADKTNWQALLKGDGTPLPLEER
                     AQQLLPLIEEKISEIRAKYGDDSIEILQDATTSIQYPVEQHPSKIKSHNFDKNPVVSG
                     VLQGIKGQYLILDTGVINVRKFTSYEVEFEA"
     gene            113657..115093
                     /locus_tag="AOT11_07650"
     CDS             113657..115093
                     /locus_tag="AOT11_07650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95137.1"
                     /translation="MLQEPTPQQYELEMVTMEQLVPKNHLVRKIDNAIDFEFIRDEVA
                     HLYCKDNGRPPVDPVRLFKIILLGYIFGIKSERQLVKEIEVNVAYRWFLRMSLTEKVI
                     HASTLSQNRIRRFNGTDVFERIFINIVEQAMTKGLVAGQELFTDSTHLKANANKNKHT
                     NKVTAVRASAYLDMLDDDVALDREKAGKKPLKARESESKTKNTKTSTTDPESGFMTRD
                     NKPQGFFYLDHRTVDGQHGIILDTYTTAGNINDSQPYVQRLDYTLATFQLNPIAVGLD
                     AGYFTAPVAESLERRGILGVFGYRRPSRTKNAFKKKHFTYDAQRDCYQCPNGQALLYK
                     TTSRDAYREYHSDPKECAFCPMRDDCTQSKNMKKVITRHIYSDAVERANQMRLSSYGK
                     KTYRRRSETVERSFADAKQHHGHRYARFRGLANVQMQCWLAAAAQNIKKIALVVNYLR
                     KMGLNMAEIRQILASVYPCNEWELLRTI"
     gene            complement(115203..116447)
                     /locus_tag="AOT11_07655"
     CDS             complement(115203..116447)
                     /locus_tag="AOT11_07655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="ASM95138.1"
                     /translation="MNWSPNQVRAQFSALAQYHNQRPVTFFDGPGGSQVPQSVLDAMV
                     GYLGHFNSNLGGHYFSSHKTVEVMKQARQSAQALLNAPSQDNIVFGANMTSLTFQLSR
                     AISRDWQAGDEVIVTALDHYSNVSSWEQAAEDKGVTVHQVRVNPEDCTLDMEHFKQLL
                     NARTKLVAVTFASNTTGTIVDIASVVKLARSVGALVYVDAVHYLPHHLVDVQALGCDF
                     LVCSAYKFFGPHVGIAYVASPWLETLRPYKVEPATNIGPGRFETGTQSFEGLAGVSAA
                     IEYLAQFGEEGASLRQRLEQSYALYAQHEQTLSQHFLQRLSALDGVTLYGINDASSDK
                     RTPTFAMTVEGYSPEFIAKTLGEHNICVWNGHFYALGLIRQLGLEFSGGVIRIGCMHY
                     NTVEEVDLLFNVLESIIDQRNA"
     gene            complement(116431..117090)
                     /locus_tag="AOT11_07660"
     CDS             complement(116431..117090)
                     /locus_tag="AOT11_07660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agglutination protein"
                     /protein_id="ASM95139.1"
                     /translation="MMLHSHESTLHLTQLSRRAIEQLSPSFSKLPHTEHADGKFRLRR
                     YSVVSLHQGRVIELDKHDFVQTSDINRFQGDVVRQFSPIEESTLNSEGFREMCQLFAV
                     KNDLRDGQEIEVHQIRITAIYDETQVAPEGVHQDGFDHIAIVGVGRNNIEGGDIMLYS
                     DFHSEPFFRKVLNNGEIAMLADSKLWHNAKPIRTIEQEREGHMDVFVLTAKGMAHELV
                     A"
     gene            117600..118559
                     /locus_tag="AOT11_07665"
     CDS             117600..118559
                     /locus_tag="AOT11_07665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420173.1"
                     /note="catalyzes the transfer of electrons from NADPH to
                     thioredoxin; FAD/NAD(P) binding; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="ASM95140.1"
                     /translation="MSNIKHSKLLILGSGPAGYTAAVYAARANLNPVLITGMQQGGQL
                     TTTTEVENWPGDPEGLTGPGLMDRMKEHAERFETEIIFDHINEVDFSTRPFVLKGDAA
                     SYSCDALIISTGASAKYLGLESEEAFKGRGVSACATCDGFFYRNQKVAVVGGGNTAVE
                     EALYLSNIASEVHLIHRRDGFRAEKILINRMMDKVASGNIILHTDRVLEEVLGDEMGV
                     TGVRLKDVKSGELEDLNVMGAFIAIGHQPNTQIFQGQLEMKDGYILVKSGLEGNATQT
                     SIEGIFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDSLNDK"
     gene            118667..120454
                     /locus_tag="AOT11_07670"
     CDS             118667..120454
                     /locus_tag="AOT11_07670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine ABC transporter ATP-binding protein"
                     /protein_id="ASM95141.1"
                     /translation="MDKKKQRSLNLWLKQQSKLAKRWLMIAVGLGVLSSVFLLAQAAL
                     LATILHQLIIEKVDKHQLIIHFIALVALIGLRALCSWGREIAGYRCGEQIRVYIRQLI
                     FDKLRELGPAYIKGKPAGAWATLVLEQVENMQDFFARYLPQMSLAVLVPFVILIVVFP
                     VNWAAGLIFLITAPLVPLFMAMVGIKAADANRKNFKALQRLSGHFYDRLQAMTTIRLF
                     DRTHAEVEVMRGASEVFRTRTMDVLKIAFLSSAVLEFFTSISIALTAVYFGFAFIGEL
                     NFGDYGAGVTLFSGLFILILAPEFYQPLRDLGTFYHAKQQAVGAAESIVEFLETDVST
                     VRSGDQQIEQGQPIAIKAEQLEVFSPEGKKLLGPVSFDIAAQQTTALVGPSGAGKTSL
                     INALLGFLPYQGSLTINGIERTELDLAQWRSQISWVGQNPLLLHGTIRDNVSLGKSDI
                     SDTDIQVALDNAFAAEFVSQHGLDYAISDRSGGLSVGQAQRLALARAMVQNGQFWLLD
                     EPTASLDARSERLVMQGLEGQIAGKTALMVTHQLTPLKQVDSILVMRAGEIVQAGSYD
                     ELAHQEGLFQEMLLANQALKQLDKGNLDA"
     gene            120447..122168
                     /locus_tag="AOT11_07675"
     CDS             120447..122168
                     /locus_tag="AOT11_07675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150099.1"
                     /note="in Escherichia coli the CydCD ABC transporter
                     exports cysteine and glutathione into the periplasm in
                     order to maintain redox balance; important for cytochrome
                     bd and c; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="ASM95142.1"
                     /translation="MRDLIPFLKLYKKHWFGLSLGMLLAFLTLFASIGLLTLSGWFLS
                     AAAIAGLTIARETFNYMLPGAFVRGFAMGRTAGRWGERVVSHNATFKLLTDLRIFFFS
                     KLAPLIPGRVSNLRDADLLNRLVADIDAMDHVYLRLISPMVVGTLGILGLTAVLCWFD
                     MTLGLTLGAILTLLLLLWPVLFYKLGKSNGQALTHNKAELRVATLDWLQGYSELTLFG
                     AESRYHNAILHAQEKLLKNQYFNAHFSGLAQALLMLANGWTLVLMLWLAADGVGGNAP
                     DPMIALVAFATMASVELLMPIAGAFQHLGQTLTSARRLNEVILAEPEVHFAMEDVAHS
                     GEYSIDYQAVSFKYPDSQSMALSNVSMTIPAQHKVAIVGQTGSGKSTLLQLLNRYWDV
                     NQGSILLAGKPITEWSESQLRRSISVVSQRVDILNGSLRDNLLMASPSATDEQLSDVL
                     TKVGLEKLLDDNGLSAWLGEGGRQLSGGEKRRIGIARALLHNAPILLLDEPTEGLDKQ
                     TEQQIMQLLEAHFDGKTVLFITHRLVNLDKMDSICLIEQGEIVEYGHHQALLAARGRY
                     FELNQTL"
     gene            complement(122295..123389)
                     /locus_tag="AOT11_07680"
     CDS             complement(122295..123389)
                     /locus_tag="AOT11_07680"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MLH6.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoserine/phosphohydroxythreonine
                     aminotransferase"
                     /protein_id="ASM95143.1"
                     /translation="MEQNTDNVFNFSAGPAALPKPVMQQAQQELLNWQGLGTSVMEIS
                     HRSKEFIAVAEQSEQDLRDLLNIPDNYKVLFCQGGARAQFAAVPLNLLGDATTATYID
                     AGYWAESAVQEAKKYCTPDVFNAKAEKEGKQAVLPASEWQIHPDAAYVHFCPNETIDG
                     IEINDLPITDKPIVADMSSTILSREIDVSKYGVIYAGAQKNIGPSGIAIAIVRDDLLG
                     LAKEVLPTVLNYKTLAEQDSMFNTPPTFAWYLSGLVFKWLKAQGGVKAIEQVNREKAA
                     MLYNYIDQSNFYINNVHSDNRSLMNVPFQMVKPELDAKFLKEAEALGLKSLKGHRVVG
                     GMRASIYNAMPIEGVQALVAFMRKFEQENA"
     gene            complement(123513..124775)
                     /locus_tag="AOT11_07685"
     CDS             complement(123513..124775)
                     /locus_tag="AOT11_07685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95144.1"
                     /translation="MNNLKKIGAVGGAISLALCWPLAVGQIGQNVIEDAVAKLNSAQL
                     QAEIVKYDRGYRTSEVTTRYTIVDPVLVEQFETDGLPLVYEMQSTLKHGLTSLDSVSD
                     LVGEQALPLHIEATTQLNGNTDFVATIDSWNFVSDSEGVAVSTAPMKLSGNATVLGDV
                     DFVLDVPSIQFDFSSGESLHVGNLTGNGKGKHKNGYWLGQQDIRLGEFQVADASAQPL
                     FGLYDAQYLGDTKPDAKGERLASVFSFKSKKLLMSDGSEVKDLNLDFSLTNLDMQSFD
                     KLMDVYQNAASLTPEEVQSLMPHIDALFEKGFDVAVKNLSLKLGEGIFENTWNLSMPQ
                     GTAQVTQDPMKIMTSMTGDLSTYFSDELVAEYPFIQEGVDELMVMEILQQVEGGYTLK
                     AKIAEGKLMFDNGQQFPLLALLMPALMQ"
     gene            124965..126908
                     /locus_tag="AOT11_07690"
     CDS             124965..126908
                     /locus_tag="AOT11_07690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ASM95145.1"
                     /translation="MNRYAILCLDNNPISIEQFRQELATFSHKFDVFTADSVEEAHHA
                     IDYLEQANQTMALVIASHHSELNGVDFLIGLDNNPRTEDARRILISCSTDIAAIITAV
                     NEGRLDHCLTKPLPDHVLFQTVQKELTQFILKFEKEDLLGFSSVLDQNRLLRAHIENQ
                     MRHYQAGFIHDYHTLSDAELTERFTNALQNFFQEKDETRACRTYSPEHLLTVEGEANK
                     FLWFITSGEVALYKRDDMGMQREVVRHKKGNLVGGMSFVTGEKSFSTALTLTKTEVIK
                     LDRNVFAQVMQSDSNLLPLFTNLLLRHFNRRLQRSINTKLQLQKTLESLESAHQQLIE
                     KEKMAMLGQLVAGVAHELNNPIAAILRGIENLNQNLGMVLSTSSAPNQTTKGIAVLES
                     AKASKPMSTAELRERSNQLLSCVDNRNIARKLVALGLEQDDELLTQLKQHPTEGARQL
                     DHLEHYFLIGNSLRSIDVCASRIADMVKSLKGYARADDEKTHIADIHEGIEDTLVIFE
                     NRLKLHKLTTHYCSLPPIYCQPIALQQVWTNMISNALDAMPEHGTLEITTKIESRNDK
                     PYVTVSFRDNGCGIPAEQQATIFELNYTTKKEGNFGLGIGLSICHQIIHSHGGWIEVD
                     SIPAQYTCMTIWLPLVSEGASHE"
     gene            126901..127398
                     /locus_tag="AOT11_07695"
     CDS             126901..127398
                     /locus_tag="AOT11_07695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95146.1"
                     /translation="MNKYLILCVDDEREVLDSVLQDLSPFEDHFVLEGAESVAEAKNV
                     IEEYDDEDVPLALILCDHIMPEQTGISFLIELSRDETTRKARKVLLTGQAGLEDTVEA
                     VNHASLDFYIAKPWYGDELRSAIKNQLTSYVIANDDNLLSWTSILDPERILNAMAEKR
                     SSFGE"
     gene            127606..128154
                     /locus_tag="AOT11_07700"
     CDS             127606..128154
                     /locus_tag="AOT11_07700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95147.1"
                     /translation="MRKTILAAALLIASSQVMAKEDPNRPATMSNFSYDYIEARIGAS
                     PMTFGAAYSKSVHPNAHIIARIDSEFESDFDAAAGFGFHSPINNWADLTGAMLMRVVE
                     PAKASSADIGMELNLGIRQWLGPQLEVGGKVGYVSIDNDDDWIGSVYARFHSTELFSL
                     GVEARINDFYDDQLMFTTRFKF"
     gene            complement(128480..129067)
                     /locus_tag="AOT11_07705"
     CDS             complement(128480..129067)
                     /locus_tag="AOT11_07705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA transformation protein"
                     /protein_id="ASM95148.1"
                     /translation="MDMTEQAFFDYINQFGDFQKRSMFGGIGLFAEDAMFALVSNGCY
                     YLRGGDSLDDTFCQLGCEKYRHVKKQTTATVNYYEVSNLLDNRDGQLDRLVKQSIACS
                     VKQRNFQKSSASRRLRDLPNMQLTLERMVKKAGIDDVETFMELGAIEVFNRVKQAYGN
                     DVDVKLLWKFAGAVEGIHWKLLQEPRRKQLLAACC"
     gene            129427..130347
                     /locus_tag="AOT11_07710"
     CDS             129427..130347
                     /locus_tag="AOT11_07710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM95149.1"
                     /translation="MEHLSFFWLPNNKDLLIQALETEFAQLVEQSLATGKVTLPPIPD
                     VVLKIQQLCTQESTGINDVAECLLEDPGLAAIVIRVANSVIFNRRNITCTDLTTAVSR
                     LGILRVRDIVTAQAIEQLKHSVNLNKECNAVLINSAAVSRQLGAVMVMVVNAFRKHAA
                     AKYDYLEPEKALLVGLLADIGLFCLVNEYHLYLDKGNYLDQQIALQIFQTRCAATSKL
                     VLENWEFDSDFVEVSSNQAYRSQRQEVTYLDIARIANHLLMFRNQDERIDDHEVEFNL
                     VGAEVLFELSNLSEDEFQEMVNQVLNSSGF"
     gene            130694..131599
                     /locus_tag="AOT11_07715"
     CDS             130694..131599
                     /locus_tag="AOT11_07715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95150.1"
                     /translation="MLSGMLFIFAPLVVGYLIPIANPSTLARINKITSHLIYVILSLM
                     GLSLAALDNLSANLQVILTYTGTFFLCLGLCNLAALPLVDRLLPVETDTSQKKPPLSA
                     MAMESLKLIFVVGGGLLVGLMLPFSLDWVDTASEWILFVLLFFIGIQLRNSGLTLRQI
                     LLNKQGMVIALVIISTSMIGGLIAGKILDIPTYQALAMASGFGWYSLAGILMGDAFGP
                     IFGGASFMIELLRELLALVVIPLLIRSRPCTAIGYAGATAMDFTLPVIQTTGGVRCVP
                     IAIVSGFILSLLVPVLMLFFVSLAS"
     gene            131797..132309
                     /locus_tag="AOT11_07720"
     CDS             131797..132309
                     /locus_tag="AOT11_07720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95151.1"
                     /translation="MKRFVVALMLASTSSFALAANDQCLAQKYDAYIDASLNWYSDLA
                     ELTSSKYPDLTEVSNWFLEGRKHHFELNRAAVHYYLKHDPSRVSVDKPIESWLQLEQS
                     DIKQLASRSDELGQIAQRTFNDRQAANHEKNYELRSAFADLLSHPQQIDTALSRYNKA
                     IAKVDEVKCQ"
     gene            132425..134086
                     /locus_tag="AOT11_07725"
     CDS             132425..134086
                     /locus_tag="AOT11_07725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate decarboxylase"
                     /protein_id="ASM95152.1"
                     /translation="MAMEQKTADVSFDSLLKIFTIPEGPDSTLTQIEAKLSQNLNKFL
                     GEHIVAEEKPLREIEKDFSSAQIPERPSFVSDHTEHLLDTLVSHSVHTSSPSFIGHMT
                     SALPYFLMPLSKIMIALNQNLVKIETSKAFTPLERQVLGMLHRLIYSQDEAFYSHWMH
                     SAEHSLGAFCSGGTIANITALWVARNNALRAQGNFKGVEKEGLFRAMKHYGYEGLAVL
                     VSERGHYSLKKAADVLGIGQAGLVAIKTDENNRVCPDALEAKIRELQAQNIKAFAVIG
                     VAGTTETGSVDPLAEMAKICQKYGCHFHVDAAWGGATLMSNKYRYLLDGVELADSVTI
                     DAHKQLYIPMGAGMVLFKDPNAMKSIEHHAQYILRKGSKDLGSHTLEGSRSGMAMLVY
                     ASMHIISRPGYELLINQSIEKAKYFADLIKQQDDFELISEPELCLLTYRYIPARVKQA
                     LAAANAKQQLELNELLNELTKFTQKRQRETGRSFVSRTRLNPAQWSRMNTIVFRVVLA
                     NPLTGFDILESVLEEQRNIIVHQAPNLLAKINRLADGILTSTQLN"
     gene            134397..135251
                     /locus_tag="AOT11_07730"
     CDS             134397..135251
                     /locus_tag="AOT11_07730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080654.1"
                     /note="Represses the expression of the zwf, eda, glp and
                     gap; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM95153.1"
                     /translation="MNTLEKIQKNLENFSKSERKVAEVIMASPQTAIHSSIATLAKMA
                     DVSEPTVNRFCRRLDTKGFPDFKLHLAQSLANGTPYVNRNVEEDDGPDAYTHKIFEST
                     MACLDVAKNSLDPMQVNRAVDLLTQAKRISFFGLGASSAVAKDAQNKFIRFNIPITCF
                     EDVVMQRMSCINCSDNDVFVLISHTGRTKSLVEIANLARENGATVIAVTAKDSPLEKA
                     ASLAISLDVPEDTDVYMPMASRVVQMTVIDVLATGFTLRRGTGFRENLKRVKEALKDS
                     RYDKLTHF"
     gene            complement(135315..136562)
                     /locus_tag="AOT11_07735"
     CDS             complement(135315..136562)
                     /locus_tag="AOT11_07735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="ASM95154.1"
                     /translation="MFQFMTATRIIFGEGALQSSLSILSQFGYSALLVTGKDLARAMP
                     IIGYFKSQNIRYQHVAISGEPNITMVEETAIIGRKFKPDMVVAIGGGSVIDMGKALAA
                     IIPNQGDVYDYVEVVGRNVPLKTQPIHFIAIPTTASTGSEVTRNAVLKSGQDKVKVSL
                     RSPDMLADVAIVDPTLTYGTDAYTSGRGAMDAFTHLMEAYVCGEPNPLTDMICEEGLR
                     RLSHSIIPGCLQDDYKARSDLAFSAMLGGMAITNAKLGAAHGLASALGGKLDAPHSVI
                     TAQLAPHVMNENIMAAREAGRADVLSRYKSLARLVTKSGEASELDGVEWVKGVLDKLQ
                     LPELSQFGVCSTSFDAVAEDALRSVAIKGNPLPLTKARLIYILEQVCQCRLRSEQTQP
                     EATGCAQFIESEDYHLAMGNEIK"
     gene            136837..137100
                     /locus_tag="AOT11_07740"
     CDS             136837..137100
                     /locus_tag="AOT11_07740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004749003.1"
                     /note="functions as an electron carrier in the
                     glutathione-dependent synthesis of deoxyribonucleotides by
                     the enzyme ribonucleotide reductase; also involved in
                     reducing some disulfides in a coupled system with
                     glutathione reductase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="ASM95155.1"
                     /translation="MFVVIFGRPACPYCVRAKEHAETLKAKRDDFNYRYVDIQAEGIS
                     KADLEKTVGKPVETVPQIFIDQQHIGGCDDFEAYAKEHLGLFD"
     gene            137212..138549
                     /locus_tag="AOT11_07745"
     CDS             137212..138549
                     /locus_tag="AOT11_07745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95156.1"
                     /translation="MSIQNYFADFLEESPVDVAQLTTFSEHIPDEWVAKAATLSDKAT
                     IRRRRLPSDMVLWLIVGMAFFRNESIAEVARRMNVCAEGLADEELLAKSALTQARQRL
                     GKAAPEWLFRQCSHTWGLERYPEDTWQGLQVFAIDGALFRTADTSELREHFGSGNTSS
                     ERQTPHPVLRVVTMMNVRSHVIVDAAISPYRRGEIPLAMPFIDSLPDNSVTLLDKGFY
                     GADLLLSLQNSGSNRHWLLPAKKGVKFRLLDDEESDDMLVEMKVSPQARKKNPNLPEK
                     WQVRAVTYQVQGKHKTVFTSLPREEYDAESVAELYHERWEIELGYRDIKSSMQHNALV
                     LRSKTVELVYQELWGLLLGYNLVRREASQAAVAHGRMANEISFKYACQFIASQLKVMS
                     KAVSPGNTPKRLKSLRGDLSILFIDKRPKPNRPRAVKISKTRYPVNRKAAPLK"
     gene            138713..140395
                     /locus_tag="AOT11_07750"
     CDS             138713..140395
                     /locus_tag="AOT11_07750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="ASM95157.1"
                     /translation="MNIDVVLLLQQNPILLIFVVLAIGLAFGKVRIANMQLGNSIGVL
                     ITSLIMGHLGFSFNAEALTIGFMLFIYCVGIEAGPNFFGIFFRDGKHYFTLSMVVLVT
                     AVSISYFASHYMGLDFGLSAGMMAGALTATPVLVGAQDALNSGLATIPRNMEFSMVLE
                     NLSVGYAMAYLVGLISMIMFAKLLPRLQKQNLSDSAQQIAQERGLGGSGQRKVYLPII
                     RAYRVGPELINWTDGKNLRELGIYRQTGCYIERIRRHGILAHPDGDAILQEGDEIALV
                     GFPDSHARLDPSFRNGKEVFDRNLLDLRIVEEQIVVKSDAIAGKRLSELHLSEYGCFL
                     NRVIRAQIEMPMDLDIVLAKGDILQVSGEKSRVHGLAERIGFISIHSQIADLLAFCSF
                     FILGIMFGLVTMTFGQVSFSLGNAVGLLLSGITLGFLRANHPTFGYVPQGALNMVKDL
                     GLMIFMVGIGLSAGGKMAEHLTQVGPQIIGIAFLVSVVPVFFAYLVGAYVLKMNRALL
                     FGAIIGARTCAPAMDIVNEYAKSTIPALGYAGTYAIANILMTLAGTILIILS"
     gene            140516..141952
                     /locus_tag="AOT11_07755"
     CDS             140516..141952
                     /locus_tag="AOT11_07755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95158.1"
                     /translation="MLQEPTPQQYELEMVTMEQLVPKNHLVRKIDNAIDFEFIRDEVA
                     HLYCKDNGRPPVDPVRLFKIILLGYIFGIKSERQLVKEIEVNVAYRWFLRMSLTEKVI
                     HASTLSQNRIRRFNGTDVFERIFINIVEQAMTKGLVAGQELFTDSTHLKANANKNKHT
                     NKVTAVRASAYLDMLDDDVALDREKAGKKPLKARESESKTKNTKTSTTDPESGFMTRD
                     NKPQGFFYLDHRTVDGQHGIILDTYTTAGNINDSQPYVQRLDYTLATFQLNPIAVGLD
                     AGYFTAPVAESLERRGILGVFGYRRPSRTKNAFKKKHFTYDAQRDCYQCPNGQALLYK
                     TTSRDAYREYHSDPKECAFCPMRDDCTQSKNMKKVITRHIYSDAVERANQMRLSSYGK
                     KTYRRRSETVERSFADAKQHHGHRYARFRGLANVQMQCWLAAAAQNIKKIALVVNYLR
                     KMGLNMAEIRQILASVYPCNEWELLRTI"
     gene            complement(142121..143323)
                     /locus_tag="AOT11_07760"
     CDS             complement(142121..143323)
                     /locus_tag="AOT11_07760"
                     /EC_number="1.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009705827.1"
                     /note="enzyme from Treponema denticola exhibits
                     NADH-dependent trans-2-enoyl-CoA reductase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trans-2-enoyl-CoA reductase"
                     /protein_id="ASM95159.1"
                     /translation="MIIKPKIRGFICTTTHPVGCEANVKEQIAYTKAQGPIKNAPKRV
                     LVVGASSGYGLSSRIAAAFGGGAATIGVFFEKEGSEKKPGTAGFYNAAAFEKLAREEG
                     LYAKSLNGDAFSNEAKQKTIDLIKEDLGQVDMVVYSLASPVRKLPETGELIRSALKPI
                     GQTYTSTAVDTNKDIIIEASVEPATEQEIQDTVTVMGGEDWELWINALAEAGVLAEGC
                     KTVAYSYIGTELTWPIYWDGALGKAKMDLDRAASALNEKLSATGGSANVAVLKSVVTQ
                     ASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLYKEDGSAAEVDEKNRLRL
                     DDWELRDDIQEHCRNLWPQITTENLKELTDYVEYKEEFLKLFGFGIDGVDYEADVNPD
                     VATDFIAI"
     gene            complement(143504..145789)
                     /locus_tag="AOT11_07765"
     CDS             complement(143504..145789)
                     /locus_tag="AOT11_07765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422190.1"
                     /note="functions in fatty acid oxidation; converts
                     acyl-CoA and FAD to FADH2 and delta2-enoyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="ASM95160.1"
                     /translation="MCSLRKKWVSDPAFKMFKKVLPPLSETEKEAMEAGSVWWDAELF
                     SGKPDFSKLHHYPKPTLSAEEQAFIDNELETLLEMLDDHKIVKEDRDLPKEVWEYLRK
                     ERFFSLIISKKYGGRQFSALANSTIVTKIATRSISTAVTVMVPNSLGPGELLSHYGTQ
                     AQKDYWLPRLADGTDIPCFALTGPEAGSDAGGIPDQGVVCYGMHEGKEVLGIRLSWNK
                     RYITLAPVATVLGLAFKLQDPDHLLGDKTDVGITCALIPADHEGVVIGERHDPLGLAF
                     MNGPTRGHDVFIPMDWLIGGADYAGKGWRMLVECLSAGRGISLPALGTAIGHLTTRTT
                     GAYAYVRKQFGMSIGKFEGVAEAMGRIGGLTYLLEATRTLTTTSLDLKEKPGIVTAIA
                     KYHMTEMARTILDDSMDIHSGRAIQDGPMNYLATHYLGIPVAITVEGANILTRNLMIF
                     GQGATRCHPYVLKEMEAAANPDAKEGAKQFDELLFKHIKHATFNTLGALGAALTGSRF
                     VKAQMSGPTQRYYKDMTRLSRALAVSADFAMLTLGGELKRKEMISARLGDGLSYLYMA
                     SAALKKYEDEGRQQSDLNFVHYAVQHCLHHAAKSLNEAYANFPVKYVGGVLKGLLFPL
                     GNHFAKPSDELCVDIAEAMMTPGVQRDRLTNLCYIGKEKDDSVGLMEQAFLAMYDIKP
                     LERKLMKAAKDGKVARKGLLAERLQQALDADVLTQREVDKILAADKLRYQAIQVDHFS
                     FDFSKTLTNAPEKKKKLTSAA"
     gene            complement(145852..146478)
                     /locus_tag="AOT11_07770"
     CDS             complement(145852..146478)
                     /locus_tag="AOT11_07770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="ASM95161.1"
                     /translation="MAPRSSTKEKILDVAEGLFAEYGFNDTSLRTITGKAGVNLASVN
                     YHFGDKKTLVRAVLNRYLEALMPAVKQSLTQLNSQECYTMDEVFESLRLPLRELNDVR
                     PNGTSLFMLLIGRGYTDVQGHLRWFITTRYAEVLELFIASILKANPALTEEKLFWRLH
                     FTLGTCVFTMASSQALVEIADSKFNQQTDVKSVVDLLIPYLSAGMSAE"
     gene            complement(146949..148094)
                     /gene="nhaA"
                     /locus_tag="AOT11_07775"
     CDS             complement(146949..148094)
                     /gene="nhaA"
                     /locus_tag="AOT11_07775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422192.1"
                     /note="exports sodium by using the electrochemical proton
                     gradient to allow protons into the cell; functions in
                     adaptation to high salinity and alkaline pH; activity
                     increases at higher pH; downregulated at acidic pH;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="ASM95162.1"
                     /translation="MNDVIRDFFKMESAGGILLVIAAAIAMVLANSPLNESYQAILHT
                     YVFGMSVSHWINDGLMAIFFLLIGLEVKRELLEGALKSRETAIFPAIAAVGGMLAPAL
                     IYVAFNGNDPEAIKGWAIPAATDIAFALGIMALLGKRVPVSLKVFLLALAIIDDLGVV
                     VIIALFYSGDLSTLALTVGFAMTGVLFMLNAKNVTKLIWYIVVGFILWVAVLKSGVHA
                     TLAGVVIGFSIPLQGKKGEHSPLKHMEHALHPYVAFANAGISLEGVSLSGLTSMLPLG
                     IALGLLVGKPLGIFTFSWAAVKFGVAKLPDGVNFKHIFAVSVLCGIGFTMSIFISSLA
                     FGSANPDFDTYSRLGILMGSTTAAVLGYFLLHVSLPKTAAESEKAIS"
     gene            complement(148370..149494)
                     /locus_tag="AOT11_07780"
     CDS             complement(148370..149494)
                     /locus_tag="AOT11_07780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="ASM95163.1"
                     /translation="MKWLAGKSNNLALMLIFLLAAMVTAAMGFYWSQSGTNEAQEYRL
                     NNSLGIQDKTIFEPVLPNKKVSLPEDFKFHEQYQHEWWHYFATLQDEFGQFYTVQFSL
                     IRIATDEREVSGWQNPQLYLANVVLTGKEKIWREQRVARGGIGQAGATNKPFRMWIDN
                     WTWRSLGTTPFPGSLTIATDDFSLELATRTAGPFVLNGDKGYQLKHDLESVASFSISA
                     PFLDVKGSMFLEGRRIEVTGNAWLQKEWGSNLFEEGQQGWDWFTFNLDNDKALSISRY
                     RHQSRVPYIFGTLSTSSGKVIPLTEKDVTVYPILYTTLADGKRIPLQWAIEIPSQDIY
                     VQTKAIQQEMWLPFLIPYWEGPINVAGSKSGRGFMQLTGY"
     gene            complement(149495..151948)
                     /locus_tag="AOT11_07785"
     CDS             complement(149495..151948)
                     /locus_tag="AOT11_07785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="ASM95164.1"
                     /translation="MLWPVVKALLGHYRRYPLQILLVWLGLTLGVSLLVGVTAINHHA
                     QESYQNGEKLFNNPLPYRIRPKHSANKIPQGFYIQLRRAGFQQCTPFDMHHIKTADGM
                     GLTLIGMDPVAMLQLEKETSLNRATSLALMNPPYPILISQDLAEHMAWQDGDFIALED
                     GSQLGPLRVDREQRLNGSRMVADISLLRMLKRSSGLSVIACAEMPPEKLEHLKRYLPN
                     GLTLVRNSQDELESLTKAFHLNLTAMGMLSFLVGLFIFYQAMSLSLIQRQPLVGILRQ
                     TGVTGMQLAKALLLELTILVLVAWACGNVLGLFLANELIPAVSASLGDLYDANVGLSI
                     GWSWESSLYSLLLAVLGALISCLWPLIRLLKSQPIRLSAKLSLVRFAGKEFAWQALAA
                     CGFAVAAIAVYQAPKTPESGFTIIALMLMSVALFMPFLMWKVFNSFSYTLRWVNLRWF
                     FADMAASMSYRGVAMMAFMLALAANIGVETMVGSFRDTTDKWLTQRLAADLYIYPTNN
                     SAARLSNWLEAQPEVDEVWWRWEKELADERDIVQVVSTGPSDGELEALTVKLGVPNYW
                     YHLHHSKSVMISESMALKLDIRPGDYLDLAAPLGGGWLVVGVYYDYGNPYNQVLLSHR
                     NWLYAFAGSGNVGLGVLLKDNVNGEGLKHRLENIFRLTSERVFDNNNIYSQAMRVFDH
                     TFAIADTLGNITLVIAVFGLFFATLAGEMSRQKNISILRCLGVSGKELIILGGLQLFV
                     FGVISALIAVPLGMALATLVVDIVIKQSFGWSLQLQIDVIEYGETILWAMIAIMLAGA
                     LPVIRLVKNTPMKSLRDSF"
     gene            complement(151929..152600)
                     /locus_tag="AOT11_07790"
     CDS             complement(151929..152600)
                     /locus_tag="AOT11_07790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="ASM95165.1"
                     /translation="MLQLSDLCKGYVDGGEFHPVLQGAELSLKQGEQLALMGESGSGK
                     STLLNLISGLDIVDSGEIMFPGFAMNDAPEHLRTAYRRNNIGHIFQQFNLLPTLNIAD
                     NIRFCRQLKGLPDDKGLWRQILSALDLMPLLGRYPEEVSGGQQQRAAIARALYMEPKL
                     LLADEPTGSLDERNAEAVMRLLTSLTRQLNCTLLLVTHSEKVAKHMEGMIRLQGGQLH
                     VMARS"
     gene            152779..154269
                     /locus_tag="AOT11_07795"
     CDS             152779..154269
                     /locus_tag="AOT11_07795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95166.1"
                     /translation="MKMRQHENTQTDALLVKENGMKKVLVLGASGYVGSQLIPKLLEQ
                     GYQVTAAARHIDHLRARVLPHPSLTFHYLNLADQEQTHALIPQFELIYFLVHGMAHGH
                     DFVDYELSLADHFYQALVGSNVKHVIYLSAIQPQSGCSQHLLARKMTGDVIRKANIPV
                     TELRAGVIIGPGSAAFEIMRDFVYHLPVLIAPKWVDSKANPIALENLNHYLLCLAEED
                     VKESAMYEVGGPDTLSYREQFRLICQATKRPFRLVSTSLLTPKMASYWLGLVTSVPSN
                     IGKALLAGLEHDYIASSQAIREKYPQPLIRYQDAVAQAVKNEGTFVRSNVWGFDPTAL
                     QRWQPGYGYYAKQAGASIRTQASAESLWKWVQKIGNRKEGYFFADILWRTREWLDVLF
                     GGSRPIRRSPLGPELKVGDYIDSWKVIRCEKQQFLSLFFGMKGPGLGRLEFTIHDHGH
                     YRELNVTAWWHPQGFPGLLYWFAMMPAHLFIFNGMVKAIVKKALNH"
     gene            complement(154298..154957)
                     /locus_tag="AOT11_07800"
     CDS             complement(154298..154957)
                     /locus_tag="AOT11_07800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-acetolactate decarboxylase"
                     /protein_id="ASM95167.1"
                     /translation="MSNYTSEIQRLVNTALAELAAEHQSGKLVDAPIANNHFLVRWVT
                     KALKGQRFDRCVVADLTRWQKAGRSKGNDAALLPTFQRISAFYASFFAQEGAPKAITD
                     KQIEAFLDEMENAGWEVSTSDPIVGCGKVQIFTEGQNSLALCAQQCENCFDGELLVKP
                     MSWFVRGHHAGFVEKASAAGFMVHKVTDYKSNVKYHGEYLVFPSNLGNQLAEIPLSFT
                     C"
     gene            complement(154957..156159)
                     /locus_tag="AOT11_07805"
     CDS             complement(154957..156159)
                     /locus_tag="AOT11_07805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="ASM95168.1"
                     /translation="MTNQSQAVSQSQISLFLFAVLGAIGALTPLAIDMYLPAMPTIAR
                     DLGVDAGAVQFTLTAYTAGFALGQLIHGPLADSFGRRPVLLLGVLFFGLAAVVSATTN
                     GIDALTYVRTAQGFAGAAAAVIIQAVVRDMFDREDFARAMSFVTLVITIAPLVAPMIG
                     GHLAIWFGWRSIFWVLAFFAVIVIALVWWQIPETLKVENRQPLRFKTTMRNYLKLCCN
                     KTAMGLILSGAFSFSGMFAFLTAGSFVYIDIYGISPDQFGYLFGLNIVAMIIMTSLNG
                     RMVKKVGSHFMLRLGLTVQLIAGLGLFVSWLLDLGLWGTVPFVVLFIGTLSTIGSNAM
                     ALLLSGYPNMAGTASSLAGTLRFGTGSLVGALVAILPSGVTWPMVLVMSACSVLSALF
                     YWIFGRKA"
     gene            complement(156398..157099)
                     /locus_tag="AOT11_07810"
     CDS             complement(156398..157099)
                     /locus_tag="AOT11_07810"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8X2.1"
                     /note="catalyzes the synthesis pseudouridine from
                     uracil-516 in 16S ribosomal RNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA pseudouridine(516) synthase"
                     /protein_id="ASM95169.1"
                     /translation="MRLDKFLCDALGATRKEATKILKSGEVTVNEQVQKSGAVKVTEE
                     CVVEWQGRELVTQGPRYIMLYKPEGFVCSHEDGFNHTAFVLLDEVKMDELHFAGRLDV
                     DTTGLVLITDDGKWSHRITSPKHKCDKTYRVWLADPIGSDYAEKLAAGVQLRNEKELT
                     LPAQMTIVNADENEVLLTIHEGKYHQVKRMFAALGNKVEQLHRERIGAIELDENLEPG
                     EYRYLTQEEIDSVWK"
     gene            157173..158915
                     /locus_tag="AOT11_07815"
     CDS             157173..158915
                     /locus_tag="AOT11_07815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005450616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="ASM95170.1"
                     /translation="MYTLRPYQADSVKAVVHYFRRHSTPAVIVLPTGAGKSLVIAELA
                     RLARGRVLVLAHVKELVEQNHAKYEGYGLQGSIFSAGLGRKETQHQVVFASVQSVVRN
                     LEQFRNQFSLLVIDECHRVPEEKSSSYQKVISHLTELNPGIKILGLTATPYRLGIGWI
                     YQYHTRGQVRSEEARFFRDCIFELPIRYLLDEGFLTPARMMDAPVLAYDFSQLKPANT
                     GRYKEAELDMVIDKAKRATPQIVEQILHLAQTKQGVMIFAATVRHAQEIHGLLPADDS
                     AIVIGDTPTPERDEIIRRFKAREIKFLVNVSVLTTGFDAPHVDLIAILRPTESISLYQ
                     QIVGRGLRLSPGKEECLVLDYAGNSYDLYQPEVGDPKPDSNSEIITIPCPACGFNNNF
                     WGKLDSNGFLLEHFGRRCQGYFTDEESGEREHCGYRFRAKYCGECGADNDIAARICHE
                     CDATLVDPDKKLKEALNLKDALVFECLEMVLSVHKNPEGKSQLKVSYLGDNQAQVHEF
                     WPLTTAKQKLLFKNQFVRPHLADKHRPFEEASPTKVVAHQHRFRPPQFVIARKSGRFW
                     KMRDKIFEDELQER"
     gene            159001..159390
                     /locus_tag="AOT11_07820"
     CDS             159001..159390
                     /locus_tag="AOT11_07820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95171.1"
                     /translation="MLNSKLTCALLFSSLLVAPAMAQNLEQDGHRLVQDVYKEGTAIE
                     FDEDQNEVYQAVQQGLIKPFSELYSTVDKQLNGRLIKVELEEDDDEWIYELKLVHDNH
                     VIKVEYNATTLELIEIKGRNLHDVIKK"
     gene            159402..160061
                     /locus_tag="AOT11_07825"
     CDS             159402..160061
                     /locus_tag="AOT11_07825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004414242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator"
                     /protein_id="ASM95172.1"
                     /translation="MKILVVEDDPRLGEQIIESLEKTGWVPELSQDGIDALYRATSEE
                     WDAMVLDLGLPKLDGLTVLKGIRDENINTPVVILSARDTLTQRVEGLNAGADDYLTKP
                     FEMVELIARIRAQLRRASGNASPVMQIGDLSLDTRTSKVMWQGQAVSLTALEYKVVAY
                     FVHNADKVISRTELVEHIYKQDFDRDSNTIEVFIGRIRKKIAPNIIKTVRGLGYQLNA
                     N"
     gene            160051..161400
                     /locus_tag="AOT11_07830"
     CDS             160051..161400
                     /locus_tag="AOT11_07830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM95173.1"
                     /translation="MPTKRPLYKHLSLKSRLFLAACLWVTAMIIAAGVGIPKLVKEYL
                     VSDVESQLRLALDEISANLEAGKNGSIVLSSRLSDPRFSQPYSGLYWTATINNQTLRS
                     RSLWDRTIQIKQGAIRKTVLGAKNERLIVLEQDVFLPEYVKPVHIVIGMDEAPMKSTL
                     DHLTGQLWMILGLLFVGVMTVIGLQIAWSFRPLGKLQRELKALRAGSQQQLEANYPTE
                     VSPLIDDLNALLFHYQELLQRARNHAGNLSHSLKTPLSVLRNEISQLDVESSHKLLPP
                     VEQIQQHIDYHLGRARMAGSMNILSVKSNPSERVDAISMAFDKVYAERELLLINELDS
                     ELEVAVDQSDLDEMLGNLLENSYKWARSQIRVHSTLASDDQLTLIIEDNGPGIAEEHL
                     TQVLKRGVRLDETTPGTGLGLNIVAEMAYSYRGDLTLEHSQLGGLRANLTLKLAAKG"
     gene            161581..161859
                     /locus_tag="AOT11_07835"
     CDS             161581..161859
                     /locus_tag="AOT11_07835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017030070.1"
                     /note="the Ctc family of proteins consists of two types,
                     one that contains the N-terminal ribosomal protein L25
                     domain only which in Escherichia coli binds the 5S rRNA
                     while a subset of proteins contain a C-terminal extension
                     that is involved in the stress response; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25"
                     /protein_id="ASM95174.1"
                     /translation="MKFEAVVRTELGKGASRRLRLAGQFPAVVYGGEAAPVAVALNHD
                     DIVNQMDKPEFYEAITLVIGGAEVKVKPQDVQRHAFKPKVEHMDFIRI"
     gene            162369..163994
                     /locus_tag="AOT11_07840"
     CDS             162369..163994
                     /locus_tag="AOT11_07840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95175.1"
                     /translation="MNFWQIRILPVTILGALLSGCGSDSSSSPTQPSYLEPNQRYDLL
                     YRATFGPTPNSYQQMASVGYQAWLDQQFSMPPSFHLPLLQSYVIEGDTLTQSDRVAVW
                     WHQANHAPDQLRQRVAFALSEIFVVSRYGASLNGRAPELTHYYDMLLEHAFGNYRDLL
                     EAVTRHPVMGDYLSMMANQHADPQKNRFPDENYAREVMQLFSIGLYQLNQDGTPLLNN
                     GALLPTYSQDDIENLARVFTGWHLADKSNGSWTSKQGDWFQAMAPYADKHDSDEKVVM
                     GERFPAGQSIEQDMAQAMAMLTNHANTGPFIARLLIQRLVTSNPSPQYVERVTLAFND
                     NGKGIRGDLKAVIQAILLDPEALNGSTERLKEPLISMTNLYRALEAKSADPTGRYHNS
                     NGTFFAFGQAPLSSPSVFNFFSPDYAPNAQMKEKGLVAPEFQILSWNNFINISNQMWS
                     ATGNSQYDSEENPKKIVVNLAPLEALANDHPALIAELSRRFLSEQISPELAVIIEQNL
                     NQLKDHQQNTKVRNALHIILNSQEFHTEVSNVW"
     gene            163988..165301
                     /locus_tag="AOT11_07845"
     CDS             163988..165301
                     /locus_tag="AOT11_07845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal protein"
                     /protein_id="ASM95176.1"
                     /translation="MVTRRQFISALAATPLVSMLGSKPSFALPTNDYKALVCVFLFGG
                     NDGFNMLVPTSDAHYDEYARARPDIALAKESLLPLTLATGSTLSFGLHPAMNELQALV
                     NRGKAIPIVNSGVLVEPTTKAELLNGTRALPPFLFSHNSQQAEWQRGWAGSSSTLGWA
                     GRMMDVLSNGQLEVSPTFSINGYVQWLNGEKQRANLINPDGMPTLWANNNTLRKQSFD
                     QVLALQPDSLFAQAFDQVKSDSITIRDQLSAALTSSPEEPHFPDNRLSQQFHTVARLI
                     KSSEQLGHQRQVYFVGMGGYDTHANQLVAHQTLLAELSQSLDAFNTSLENAGIAHQVT
                     TMTMSDFGRRLASNGSGTDHGWASNHWVMGGALQSGRIYGQWPSLVLDGENDFNRGRM
                     IPTTSVEQIGATVAKWMGIQTEQQLLDIFPNLKHFAQKDLGFLAG"
     gene            complement(165316..166914)
                     /locus_tag="AOT11_07850"
     CDS             complement(165316..166914)
                     /locus_tag="AOT11_07850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95177.1"
                     /translation="MPVLRPSLRAILLSVMLLVSVVPIVLFSYWAVQHALEKEYRAVH
                     EKHLLLAKNLSAALERYSVDVLSVFESISDEFDSNELSAQQINLLQQLNLHALARYSK
                     NAMQRRVLFGEPVYFPKTLDVNADQITRVTPVISQFLPQPTIYLYREDKYGRVWVAAM
                     ANEYVVQLQEAVSFGEKGHAAIVDNTGSVLAHPNKEWQAQAKNIAKISVVKRMLRGET
                     GVERFYSPAMKADMIAGFTVTPTLGWGIMIPQPVSELDAAINDFKKVTLVVAIACFVI
                     CFILSWQLSGLLMRPIRKLTKQIQGMTETESRISHLETIEGFTGIKETQALVESFNLM
                     TNEVNRGRKELEFRVLERTKELKSAERFARHLASHDSVTDLPNRTAVRQAIAKFLERK
                     QPFSLLFIDLDGFKAVNDEYGHQTGDLLLKAVAQRLLDTVGQEDMAARYAGDEFIVLL
                     KNQSTQEATKIAQALLETIAIPVIVERKALVIGASIGLVTVDVETTSTNVDSLIHEAD
                     IAMYQAKSAGKGRVVQVQKVNESS"
     gene            complement(166998..167180)
                     /locus_tag="AOT11_07855"
     CDS             complement(166998..167180)
                     /locus_tag="AOT11_07855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95178.1"
                     /translation="MATKGQDGIIAFMKFVSSAVSAILISEIIANLFIKIMNGGHELQ
                     MMAFIPPLNAVSYKSL"
     gene            167606..167827
                     /locus_tag="AOT11_07860"
     CDS             167606..167827
                     /locus_tag="AOT11_07860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95179.1"
                     /translation="MKRASKSYRLQLIREVVTRRELQTSNDPMANYIYQLMTDKTHST
                     HDVEQNHKFVGSHFDEHAGGWVNDKWGLK"
     gene            complement(167895..168143)
                     /locus_tag="AOT11_07865"
     CDS             complement(167895..168143)
                     /locus_tag="AOT11_07865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S protein"
                     /protein_id="ASM95180.1"
                     /translation="MEQLEFFTVPSPCVGVCSVDDKGYCNGCMRKREERFNWLNMTPS
                     EQLHVIKLCRQRYRRKLAQGKDPSSTKEEVQSPQQDLF"
     gene            168340..168786
                     /locus_tag="AOT11_07870"
     CDS             168340..168786
                     /locus_tag="AOT11_07870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein HslJ"
                     /protein_id="ASM95181.1"
                     /translation="MKLSSKTLLAAISMPLLMTACVSNGDNMKQLTAQDLQHHNWELV
                     SIDGNAITINEHQQAPRLEVGENMMANGNAGCNNFFGQAELKDNQFRIEKMGMTMKMC
                     IDDAMSTEQAVSQTLSDWSDITLTKDSLVLKNSNHTLTFTLKDWKN"
     gene            169064..170209
                     /locus_tag="AOT11_07875"
     CDS             169064..170209
                     /locus_tag="AOT11_07875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95182.1"
                     /translation="MKRLTTLLTGALLSASVFATTPSWQQIEEKAQGQTVFFHAWGGS
                     QEINDYLRWAGGELKTRYGVTLKHVKVTDIAETTTRLIAEKAAGKNQGGSVDMVWING
                     ENFKSMKNNDLLYGPFVEQLPSWQYVNKTLPVDSDFSEPTLGLEAPWGVGQLVFIHDE
                     KTLNNPPTSFSEMLSYAKAYPNRISYPRPPQFHGTSFLKAVLIELTDNDPALAKPVNE
                     QEFQLITKPLWQYLDEFHRVAWRQGKQFPTDSAESFQLLDDGQLDLAITFNPNAVYSA
                     QANGTLAESTKTFAMSKGALSNIHFLAIPWNANATEGALVTINFLLSPEAQSRKGDLS
                     IWGDPSVLENQYLTGSAKNTRLFKSVAEPHPSWQTALEAEWQKRYGN"
     gene            170248..171948
                     /locus_tag="AOT11_07880"
     CDS             170248..171948
                     /locus_tag="AOT11_07880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter permease"
                     /protein_id="ASM95183.1"
                     /translation="MFRAAYLILILVCIAPVIPGLFGVLLSSFGYIPPVGLHQLSSVG
                     FEAVFNWTGVEKSIALTVFSALFSTYLACLFTFAILQALWQNRHWKKVESLLSPLLAM
                     PHVAFAIGFAFLFSPTGLVARVAVQTLDVGLSTDDSAWFVNDPYALGLTIALALKEIP
                     FLLLMSVPVLQQLNVAQLSQVSASMGYSPAQFWWKTVLPQWLSKMRFPLFAVMAYGVA
                     VVDLSLILGPTNPATFAVLVWQWFSDPELELLPRAAAGAMVLFVIASLLMAAIMLFEK
                     SVTGYFGRWQYSGRFGFSLPGKTLFAFSALLALTMFPLMLLWSFAHRWRFPDLLPSRY
                     SLRFWQAEWQNVLPTVEQSLLFALATASVAVLLALVAHEYRDKHRIHLPGYVIALPML
                     IPQLSILFGLQIATLYLSSDAYSLWVLWSHVFFAFPLVYLALDGPWRSYNQNYTRAAL
                     SLGKAPIWVFIRIKMPILMPAILYAWAVGASVSLAQYLPTLILGAGRITTITTEAVAL
                     SSGSDRRVTAIYALWQAILPFVFFSIALFIGHLQTRGRHARVKDTKTHDVLSRKPRHP
                     "
     gene            171914..172564
                     /locus_tag="AOT11_07885"
     CDS             171914..172564
                     /locus_tag="AOT11_07885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="ASM95184.1"
                     /translation="MTFCLENLAIHKRSGETLFSDINLTIDAGEIVSLMGPSGCGKST
                     LLSLIAGHLSDEFKYSGTLSLNQRDLAPLAPHQRQVGILFQDDMLFPHLNIWQNLAFA
                     LPNDIKGTERKTQAINALDKIALSELADSYPEQISGGQRARVSLIRMLLAKPQMALLD
                     EPFSKLDKELRVQFRDWVISQLQQANIPALMVTHDIDDVPPGSRVLHWPWEQCNVR"
     gene            172554..173177
                     /locus_tag="AOT11_07890"
     CDS             172554..173177
                     /locus_tag="AOT11_07890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95185.1"
                     /translation="MLDRFSIKVIRWPLTQSAQVLNHYGVTANQITILGFALGCFALP
                     ALMAEQYLLALAFIVLNRVCDGLDGALARIQGITDAGGFLDISLDFLFYSLVPFGFVL
                     ANPEQNAIAGAFLIFSFIGTGSSFLAFAVMAGKRGIDNPVYQNKSLYYMSGLTEGTET
                     IACFVLFCLFPHSFATLAYLFGAACWFTTGTRIYSGFHTLNQVDEEE"
     gene            173283..174812
                     /locus_tag="AOT11_07895"
     CDS             173283..174812
                     /locus_tag="AOT11_07895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422211.1"
                     /note="Required for the expression of anaerobic nitric
                     oxide (NO) reductase; acts as a transcriptional activator
                     for the norVW operon; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM95186.1"
                     /translation="MSQTIDQAVLKIALNLSSTLSSEQQYQHLIDGIASVFPCDAAAL
                     FVFDQDGFLTPVAVKGLSPAVLGRRYFPATHPRLERILQSRHTVRFDADCALPDPFDG
                     SLLTEDQCIDVHDCLGSSLYVDGQLVGVLTMDALTVGAFDYLDPVMVETFTALTAATL
                     RNIAQFKALKAQNKKQKSVTQTLIQQARSQQGEMVGFSPQINQLRKQITTVAPSDYAV
                     LIMGETGTGKELVAHNVHAQSHRSDKPMIYVNCAALPEGLAESELFGHVKGAFTGANQ
                     HRAGKFELADGGTIFLDEVGELPLVLQAKLLRVIQQGELQRVGSDKHLLVNVRIIAAT
                     NRNLEKEVETGHFRADLFHRLNVFPIKVPALREREGDIPVLAGYLLEKVRHQFNEPNL
                     HVHPKLLNQLEHLPWYGNVRELEHTLTRAALHAIQQGQTTIKSDHIGTLTNQSDVKNT
                     STFFPEHAQGMRELVESYQKQLIEHALSQSDGIWAKAAEFLQMDRGNLYRMGKKLGVK
                     V"
     gene            175015..176676
                     /locus_tag="AOT11_07900"
     CDS             175015..176676
                     /locus_tag="AOT11_07900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017448691.1"
                     /note="has hydroxylamine reductase activity, catalyzes the
                     reduction of hydroxylamine to ammonia and water; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxylamine reductase"
                     /protein_id="ASM95187.1"
                     /translation="MFCIQCEQTIQTPAVKGCSFAQGMCGKTAEVSDLQDVLVYLLQG
                     VSYWATQAHRYGIINDEINQWAPKAFFSTLTNVNFDPERILQLTSQAAQFKAQLKDQV
                     LTASSLANSPLSEVPAVAEFELPENAQAILAFAPQVAVNRGKESVHEDVIGLRLLCLY
                     GLKGAAAYMEHARVLEQTNNDIYAEYHEIMAWLGTDPDDLGELLECSMRIGLMNYKVM
                     EMLDHGETATFGHPVPTAVNVKPVKGKCILVSGHDLHDLEKILQQTEGKGINVYTNGE
                     MLPAHGYPELNKYPHLVGNYGSAWQNQQKEFANFPGAIVMTSNCLLNPNVGQYADRLF
                     TRSIVGWPGVAHIEGDDFSAVIESALAQPGFQHDEIEHMITVGFGRNALMNAAPAVID
                     QVKQGNIKHFFLVGGCDGDKAERSYYTDFTEAAPEDTLILTLACGKFRFNKNTFGDIN
                     GIPRLLDVGQCNDAYSAIQLALALAQEFDCGINELPLTLVLSWFEQKAIVILLTLFAL
                     GVKGIYTGPTAPAFLTPNLIAIIQEKFDMRSIGNVQDDLNTILAA"
     gene            176738..177781
                     /locus_tag="AOT11_07905"
     CDS             176738..177781
                     /locus_tag="AOT11_07905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="ASM95188.1"
                     /translation="MFFEWQGNEPATLQCVDKFFETDDTVSIRLADLTESLLFQFKPG
                     QFVNLGVEIDGKMEFRAYSISSLAGDEYLQFTIKRVEGGKVSNFIIDSLLIGDTVQAL
                     APAGEFNCVDHPPREFDGQRKALLISAGCGVTPVFAMAKHWLSNEMNVDIEFLHIARS
                     AQETIYFDHLSTYQSAYAHFHLKLLLKDAQGTTHPQGRFNAQWLQDLVPDFATRTIYL
                     CGPNQFMQDTQDYLQVLGFNMNNFYHESFTPEKADAMEASDEAVCISVPDFAQTINAQ
                     KGQLLADVLENAGLPLIVACRSGICGSCKCKVANGQVRTISQETLTDEEIAQGYVLAC
                     SSHIESDLDVSLH"
     gene            complement(177853..178785)
                     /locus_tag="AOT11_07910"
     CDS             complement(177853..178785)
                     /locus_tag="AOT11_07910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="ASM95189.1"
                     /translation="MQASHLTTFFQHVESQLQQAPDEIRRLFHGRGRRFEGLEQITCD
                     WLHGQLIVNLFKQVDEAFLQCLREGLLALTNTPLWQEKLGRCVVIQHRYADGDPAEVL
                     VGELEARPVVVESGLKYQLDIGRNQNFGLFLDMRYGRDWVRENAKQKNVLNLFAYTCG
                     FSVAAIAGGADKVVNVDMAKSSLSKGRDNHKLNEHNINQVSFLGYDIFKSWGKIKKAG
                     PYDLVIIDPPSFQKGSFALTKDYKKILRRLPELLTEQGEVLACVNSPAVSSDFLIESM
                     KEEAPQLTFRERLDNPPEFMDIDSEAALKVLRFN"
     gene            complement(178806..179501)
                     /locus_tag="AOT11_07915"
     CDS             complement(178806..179501)
                     /locus_tag="AOT11_07915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="ASM95190.1"
                     /translation="MFDILFTHPDFLIINKHPNVSVHKDDGDTMLLQEVANVSGDEHL
                     YLIHRLDKMTSGILLLGRNSTAASALSQRFAQREVEKFYLAIGAKKPKKKQGTIIGDM
                     ERSRRASWKLVNSKQNPAITQFFSLAGEPGERAFLCKPYTGKTHQIRVALKSVGSSIV
                     GDPIYNAGSDSDRGYLHAFCLGFQYQGEQYHFVCDPRNQADLGEKWNSEALNQAIEQW
                     LTPWQLNWPTINK"
     gene            complement(179605..181221)
                     /locus_tag="AOT11_07920"
     CDS             complement(179605..181221)
                     /locus_tag="AOT11_07920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM95191.1"
                     /translation="MKMSVRKKLYAGFGSVLAIMLVMVATIWVEVTESHAVANEVRQD
                     DVPEVVFYLILVDEAGDVYRDAMGVVTGVEGAAQDYRDNKGEFAAALREVRKLETPGG
                     EDDRRLEKIESSMKQFTDAFEAQILAKNGQGDIDESLIVALRKLYQTHLIPIENMLDE
                     ASEEEIAGADGAMGALEDSLSNIERTIMILTAIGIVLTCTIAYLLSNSITVRLSKLDE
                     VAQRVASGDLTAEDIEDQSGDELANLATSVNKMQHSLVNLISSISSVTREVQVVTGDL
                     NKVSRDIVQGASAQADKANLIATAAEELSLTISEVAQQGSSTFEEAKRSEASAEEGRN
                     VIVEMVASIQQVSQQMSDMSVQMNELGTHSEQIGSVIKVIEDIAAQTNLLALNAAIEA
                     ARAGEFGRGFAVVADEVRALAERTTKATKEVAGIIQAIQSGTHEAVTYTQDNCRLVEI
                     GVEQSQGAVSSLEAIVAGAANVQSMVNSIATAAEEQTAVTKEIASDITAISDISEQSL
                     ALANRSSESVAGLSGKVAQLDQLIGKFRIA"
     gene            complement(181349..182776)
                     /locus_tag="AOT11_07925"
     CDS             complement(181349..182776)
                     /locus_tag="AOT11_07925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+-dependent transporter"
                     /protein_id="ASM95192.1"
                     /translation="MSNTSAAPRDTWGSKLGFVMAAAGSAVGLGNIWKFPYTAGESGG
                     GAFVAIYLFFVIFIGFSVMLTEFAIGRKTGLSAVGAFKSTDRRWTFTGVLGVFSGLLI
                     MGFYPVVGGWALAYIFKVGGGLLSTPDTIGSSFGAFISDPVQPLLWMGIYLLLNIVIV
                     MRGVSGGIEKAGKVLMPLLFIILIIVSVKGLMLPGAMAGLEFLFMPDFSKVDSNVVLA
                     ALGQAFFSLSLGMGCMMTYGSYLKKQENLVQTTGMVTAMDTGVAILAGVAMFPAMFAF
                     GMEPAAGPGLVFVVVPQLFSEMGGVIGLVLALLFFIGLTVAALTSSVSLLEVVVSYLI
                     DEKGMKRSTAVISSSVVMASLCIFASLSLGGVGPKLFDTGAFDIFDLLTDKIFLAVGG
                     MLVCIFAGWRLSREDLEKEITNDGKVSFPLFGVWYNLVKYIIPVAIAIVAVMGIKSGF
                     DSGKGEIMVLGISIFVFAGLLSKKL"
     gene            183129..184583
                     /gene="cls"
                     /locus_tag="AOT11_07930"
     CDS             183129..184583
                     /gene="cls"
                     /locus_tag="AOT11_07930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571992.1"
                     /note="catalyzes the transfer of a phosphatidyl group to
                     phosphodidylglycerol to form cardiolipin
                     (diphosphatidylglycerol); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthase"
                     /protein_id="ASM95193.1"
                     /translation="MDKFYHFLTLAGIGLYWVLIAGVTFRVVLKRRAVSVSLAWLMII
                     YILPVLGVACYFLFGELNLGRKRAERAKEMFTPFATWFSQLNDCQAHTPESMGRHIYR
                     IDELCNTRLGLPALSGNTLSLQRSPEEILHSIIRDIEKAQSSIRMVFYIWHPGGLADS
                     VASALIQAAKRGVDVKLLLDSAGSPRFFRSHWHQMMVNAGIQVVQALEVSPWRIFLRR
                     LDLRQHRKIIVIDDEIAYTGSMNLVDPAYFKQSSGVGQWVDIMVRLTGPTVNVLSAIH
                     CWDWEVETGARQLPRLPECPLDSTQYQNPIQVVPSGPGMPENLISQVLILAINQANHS
                     VTITTPYFVPSLNLLDTLKMTAQRGIDVQLIIPHKNDSLMVQWASRSFYSELMEAGVK
                     IFEFYGGLLHTKSVVIDQEFCLVGTVNIDMRSLWLNFEVTLAVDDEHFTQQMHQLQQH
                     YKSQSHAVKRSDWNKRSLYSRFLERLYYLFNPLL"
     gene            184708..185916
                     /locus_tag="AOT11_07935"
     CDS             184708..185916
                     /locus_tag="AOT11_07935"
                     /EC_number="4.4.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080694.1"
                     /note="catalyzes the formation of L-homocysteine from
                     cystathionine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="ASM95194.1"
                     /translation="MSEGKQTKLVTAGRDKKWTNGVVNPPIQRASTVVFDTVADKHHA
                     TVNRANKTLFYGRRGTHTHFAFQEAMTQIEGGAGCALYPCGTAAISNAILSFVETGDH
                     ILMVDTCYEPTRDFCDKIMKKMGVETTYYDPMVGEGIRELIKPNTKILFLESPGSITM
                     EVQDVPTLARIAHEHGIIVMLDNTWGAGVNFSPFEHGVDISIQAATKYIVGHSDVMLG
                     TAVASEPYWDQLREQSYLMGQCVSPDDAYLGLRGLRTIDVRLRQHEQASLKVAQWLAT
                     RPEVDHVRHPALESCPGHEFFNRDFTGGNGLFSFVLKTSYPRATTALLDGMKHFNMGY
                     SWGGFESLILANEPKSFSSLRTVANPNFEGTLIRLHIGLENVEDLIADLEAGFERYNA
                     LILERETSLS"
     gene            complement(185988..186557)
                     /locus_tag="AOT11_07940"
     CDS             complement(185988..186557)
                     /locus_tag="AOT11_07940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosidase"
                     /protein_id="ASM95195.1"
                     /translation="MMSEQKTCAWAMNHPLEREYHDAEWGKPVYDDTILFEFITLEGA
                     QAGLSWITILKKRQGYREAFEGYDLKRLAQQGEQRVEAIIAQYDVVKHRGKIASVFSN
                     ARAALALQEEFGSLSNALWPFVDHQPIVNQWQSMDEVPAVTEQSKALSKFLKKRGFKF
                     VGETICYAFMQAVGMVDDHLIDCPCKAHR"
     gene            complement(186618..189725)
                     /locus_tag="AOT11_07945"
     CDS             complement(186618..189725)
                     /locus_tag="AOT11_07945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter AcrB"
                     /protein_id="ASM95196.1"
                     /translation="MSDKPVVSPQSDDEVTGIAAYFIRNRVISWMISLIFLIGGVAAF
                     FGLGRLEDPAFTIKDAMVVTSYPGATPQQVEEEVTYPLEKAIQQLTYVDEVNSISSRG
                     LSQITVTMKNNYGPDDLPQIWDELRRKVNDLKGQLPPGVNAPQVIDDFGDVYGILLAV
                     TGDGYSYKELLDYVDYLRRELELVDGVSKVSVTGQQQEQVFIEISMKRLSSLGLSPTT
                     VFNLLSTQNVVSDAGAIRIGNEYIRIHPTGEFQNVDQLGDLIITESGAQGLIYLRDVA
                     DIKRGYVEVPNNIINFNGKLALNVGVSFAQGVNVVEVGKSFDRRLAELKYQQPVGIDI
                     SEIYSQPKEVDKSVSGFVVSLGQAVAIVIIVLLFFMGLRSGLLIGLILLLTVLGTFIF
                     MQYFKIDLQRISLGALVIALGMLVDNAIVVVEGILIGTQKGRTRMQAATDIVTQTKWP
                     LLGATVIAVTAFAPIGLSEDATGEYCGTLFTVLLISLMLSWFTAISLTPFFADMFFKG
                     QKVNVSESGEEVDPYNGMIFVVYKNFLEFCMKRAWLTMIVLVVGLGVSLYGFTLVKQA
                     FFPSSTTPMFQADIWLPEGTDIRATNTKLKALESWLSQQDDVEHITTTAGKGLQRFML
                     TYAPEKSYAAYGEITTRVTSYEALDALMAKFRQHVKENFPEINYKLKQIELGPGGGAK
                     IEARIIGSDPTVLRSIATQVMDIMYADAGATNVRHDWRERTKVLEPQFNESQARRYGI
                     TKSDVDDFLAMSFSGMAIGIYRDGTTLMPIVARLPDEERVDIRNIEGMKIWSPALSEF
                     IPLQQVTLGYELLWEDPIIVRKNRKRVLTVMADPDILGEETASTLQKRLMPQIEAIQL
                     PPGYSLEWGGEYESSRDAQASLFTTMPMGYLFMFLITVFLFNSVKEPLIVWLTVPLAV
                     IGVTTGLLALNTPFGFMALLGFLSLSGMLLKNGIVLLDQIEIEMKSGKDPYVAVVDAA
                     LSRVRPVCMAAITTILGMVPLLPDIFFKPMAVTIMFGLGFATILTLIVVPVLYRLFHK
                     VAVPK"
     gene            complement(189718..190803)
                     /locus_tag="AOT11_07950"
     CDS             complement(189718..190803)
                     /locus_tag="AOT11_07950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="ASM95197.1"
                     /translation="MNKWIGLTALSAALLLAGCGQQNQPAALADPNVKIVSLTDEEMI
                     DSLYFPAVANAAERSHLSFRVSGEVRNLYVKEGDRIKKGDVIAELDPTDYRLDVDNAQ
                     ARFSVVDSQFKRSEPLVKKGLLAKSQFDEIAAQRQIALAELELAKLRLSFTQLKAPVD
                     GIISRVSVDQFENVQVGQQVVNIHSVDEVEILIQLPDQLYVNQPTREKLEQVDALVRV
                     RSGNEYSAKIKEFTTEPDPKTGTFTVTLTMPMPENEYILDGMAVEVTSRGEGVGLELN
                     SGIRVPIEAIFNADGDDLNREDKFVWVLNADNSVSKRQVVVGKASKESAQIIEGLTHS
                     EQVVVAGIARLRDGIKVNVISQEANNE"
     gene            complement(190805..191836)
                     /locus_tag="AOT11_07955"
     CDS             complement(190805..191836)
                     /locus_tag="AOT11_07955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="ASM95198.1"
                     /translation="MRKALVFLAVATALGGCGRELPPIPEPDSRPAKLFTVSVGDARF
                     ERTFPAVSEAGDKAVLTFRVPGQLQTIDVTAGQRVAKGQVLATLNPDEYALLAKQARA
                     NFKLADVQYERYKKLRADKVVSEQDFDQAQANHNSARATLEQAEANLRYTKLIAPYDG
                     TISLIPAENHEYVAAKQGVMNIQTNQLMKVIFQLPDHLLGRFSQGVEPNAVMRFDAFP
                     GSEFPLRFQEIDTEADTKTGSYKVTMIMERPADIGVLPGMAGSVHVSGKSQSATQIPT
                     SAIFKQDEKKYVWRVNDQSIVELAEVELNDKREVVNGLNDGDQIIISGVSGIESGIKV
                     REWVKERGL"
     gene            complement(192000..192389)
                     /locus_tag="AOT11_07960"
     CDS             complement(192000..192389)
                     /locus_tag="AOT11_07960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein C"
                     /protein_id="ASM95199.1"
                     /translation="MNSRELYRDPINGKLSGVCAGIANYLAIEVWLIRILVISAALLG
                     GSFLVILAYLALTFMLEKQPIQYQEDLKMRHDHKLKAKPWQQGQTAESLLAILEADFN
                     RIESKVRDMEAYVTSDTFKVNREFNKL"
     gene            complement(192382..192615)
                     /locus_tag="AOT11_07965"
     CDS             complement(192382..192615)
                     /locus_tag="AOT11_07965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein B"
                     /protein_id="ASM95200.1"
                     /translation="MTTFMIAGPLIVFLIFVAPLWLFLHYRSQRKVGSGLSDIDLQKL
                     ESLSGQAEKLQSRIDTLERILDAENPNWRRRYE"
     gene            complement(192631..193302)
                     /locus_tag="AOT11_07970"
     CDS             complement(192631..193302)
                     /locus_tag="AOT11_07970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein A"
                     /protein_id="ASM95201.1"
                     /translation="MGIFSRFADIINSNISALLDKAEDPEKMIRLIIQEMEDTLVEVR
                     TNSAKAIADKKELARKVEAMESQISDWQQKATLALTKQREDLARAALIEKQKLQDLIK
                     GLHTEQTLVEETIEKLTGEIGKLETKIAETRAKQQALMIRNQTASNRRDVQRHLSSGR
                     TNEAMAKFEQYARRVDELEAEADVYANTGSAKSLEQEFAELQAQDEIEKELAKLKEQV
                     NSDKK"
     gene            193533..194570
                     /locus_tag="AOT11_07975"
     CDS             193533..194570
                     /locus_tag="AOT11_07975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="ASM95202.1"
                     /translation="MKQNLIGESPAFLSVLDKVSKLAPIERPILIIGERGTGKELIAQ
                     RLHYLSKRWDKPLLSLNCATLSEGLIDSELFGHESGSFTGSKGKHKGRFERAEGGTLF
                     LDELATAPLMVQEKLLRVIEYGEYERVGGHQPLTADVRLVCATNADLVKMADEGQFRA
                     DLLDRLAFDVITLPPLRERQEDILLLAEHYAIKMCRELKLDYFVGFTSYANQQLTQYR
                     WPGNVRELKNVVERAIYRHGLNPDPIDELIFNPFATGWESEKAEQDQPNASSTSSISA
                     NDDQVSPPATTEFSFPIDYKQWQEEQDIKLLNQALEASKFNQRQAADLLGLSYHQFRG
                     MVRKYALVGQN"
     gene            194747..196363
                     /locus_tag="AOT11_07980"
     CDS             194747..196363
                     /locus_tag="AOT11_07980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="ASM95203.1"
                     /translation="MKTLIQLTLGLLGFSLLTGCGKDIDHKEVRQTGFVFCGQTNLKT
                     FNPQLIDSGITADTLSPQIFDTLLTLDPQTHQPIPSLAESWQVNKTGTEYTFTLRKNV
                     AFQTTDWFTPSRPLNAEDVVFSFRRIIDPSHPYHLVGGGNYPWFAGIDFANLLVDVVP
                     LADDQVKFILSRPNFAFLSNLATAHSVILSAEYANQLAAKDAKERIDMYPVGSGPFLL
                     DEYQINDLVRLRRHEGYWRNPVKMEQVVFDISQRGTGTLAKLLRNECDVLRSPISSQI
                     PIIENNPNMELTATPAMNVAFIAINTSHSALKDVRVRQALNLAINRQNILDSVYYGTG
                     TKAYTLLPPNSWAYQKDSVKVRFDRNYALALMREAGYEKGLSLTMWVPLEPRVYNPSP
                     RKTAELIQSNLADIGIDLALITDERNERVTTDHTQGDLSLTGWVGDTGDPDNFLRPLL
                     SCSSERAGINVAMWCNSDFDFLLDLALETEKNRYRLNLYRQAQNILNEEFPVIPLAHG
                     VQFRAHDKSLIGFKSSPFNSQPFDTVERAY"
     gene            196363..197325
                     /locus_tag="AOT11_07985"
     CDS             196363..197325
                     /locus_tag="AOT11_07985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ASM95204.1"
                     /translation="MFWYAVRRLNLFVITLAILTMVGFSILRLDPESVWARAEYWHGW
                     SIYLSELAQLNFGVSKSGAAIYDELAVVFPATLELCFFAFLVALLIGIPFGTIAGMKQ
                     GKWVDTTISFVSMSGYSAPLFWVALLMLMVFSLHFEIFPVSGRYDLLYEIQHVTGFAI
                     IDAFLAKGPYKAHALQSVIEHMVLPCLVLALAPTTQVIGLMRASVADVMSQNYIRAAR
                     IKGLTTREIVTQHVLRNAIPPIIPKVGVQLSSMLTLAIITESIFNWPGIGRWLLDALS
                     NRDYVSIQAGVMVVATLVLTANILSDLIGAMINPLVRKEWYANR"
     gene            197312..198199
                     /locus_tag="AOT11_07990"
     CDS             197312..198199
                     /locus_tag="AOT11_07990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ASM95205.1"
                     /translation="MLTDSVYQEEHIPTQFERFWRSFRSNNLAMFGLWCLVLLLLVTI
                     SAPWLVPHDPQQQTAQLLVPPSWSPAGTVEYFLGTDDLGRDILSRLIMGAQPTLGASI
                     IITAIAAIIGCFIGVLAGMTRGLLSSTLNHLLDTVMSIPSLLLAIIFVAFFGVGEFTV
                     LLAVGLALIPRFIRSVYIAVHTEVEKDYVMAARLDGANNFYLLWNSILPNVLVVIATE
                     ITLALSVAILDITALGFLGLGAQAPSTEWGAILGDSVELIYLAPWTVTLPGLSIMFTV
                     VVINLVGDGVRRALNAGIE"
     gene            198199..199194
                     /locus_tag="AOT11_07995"
     CDS             198199..199194
                     /locus_tag="AOT11_07995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080706.1"
                     /note="involved in resistance to antimibial peptides;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="ASM95206.1"
                     /translation="MPLLDIRHLTIEIETPQGLVKAVDRMSLTLNEGEIRGLVGESGS
                     GKSLVAKAIVGVCKDNWKVTADRMRLGNIDLLQLTPSERRRVIARDIAMIFQEPSTCL
                     DPSEEVGKQLIESIPWRTFDGKWWERFKWRKKRAIALLHKVGIKDHVRLMKSYPYELT
                     DGECQKVMIAMAIATAPKLLIADEPTNDLDPITQNQILRLLSRMNQLNNTTILLIGHD
                     LTNITQWANRITVMYCGQSVESADTDSILEAPKHPYTAALLKAMPDFSHWIPHKQKLQ
                     SLPGSIPPLQHLPIGCRLGPRCPYAQRQCVEIPYARRIKNHKFSCHFPLNTEKDS"
     gene            199191..199976
                     /locus_tag="AOT11_08000"
     CDS             199191..199976
                     /locus_tag="AOT11_08000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="ASM95207.1"
                     /translation="MSALLEVENLSKNFVTRSGLFKRRVQQAVKPVSFTLEAGQTIGF
                     IGQNGSGKSTLARMLAGMVEPTSGEIRVNGERLEHRDYATRCKLIRMIFQDPNTSLNP
                     RIQIGRILEGPLKRNTNMPPEARLKRVKDTLLRVGLLPEHAYFYPQMLATGQKQRVCL
                     ARALILQPSIIVADEALNGLDMAMRSQIINLFLELQEEMGVSFVYVSQHIGIVKHITD
                     KVMVMHDGEVVESGDTQIVLSDPQHPLTQRLVENHFYKTPSHY"
     gene            200046..200828
                     /locus_tag="AOT11_08005"
     CDS             200046..200828
                     /locus_tag="AOT11_08005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95208.1"
                     /translation="MNNVWVKPLIGIALMLLTSSTHALEKTWLQPAFVSNAFIQVALR
                     NEYSPGEKKVRKWNSPIRVYVEHQVADKALHKSLLEMHLRDLSAITGLSIETTSDKTQ
                     ANVVWVFTQESNYQSEVKRLMGRQSANNLGSAVCKAGFKTRQSAIYYAAIVIPVDKAR
                     EHGKLVACIVEEVTQVLGLPNDSDQAYPSIFNDNSPEELLSPLDIVLLKLLYQPEIKA
                     GMSEAEVKPVLNTLLTRFADNGTLSQSVDVATQTELFQFIGY"
     gene            complement(200930..201319)
                     /locus_tag="AOT11_08010"
     CDS             complement(200930..201319)
                     /locus_tag="AOT11_08010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95209.1"
                     /translation="MTTPLSQDQIRTINSYDQEQRLRYCVKEIVAQRQVWILTDEHGC
                     VMLNTEEEECVPVWPNKEFAEEWATGDWQECQAESISLNKWHSRWTRGLEDDELSVVV
                     FPSINEEGVVLFPDEFDFELKKQAAKR"
     gene            complement(201451..202356)
                     /locus_tag="AOT11_08015"
     CDS             complement(201451..202356)
                     /locus_tag="AOT11_08015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="ASM95210.1"
                     /translation="MILVVGHKNPDSDSICSAIVATELLKARGVEAMPIRQGEINRET
                     QHILEVAGAEVPELRTSVAGETVWLVDYSDLAQAPDDIAEAEVAGIVDHHRLGDVMTV
                     NPMEAWIWPVGCTNTVLFNMFKIEGHAISEKIAKLMMSAILSDTVGFASPTCTQKDKD
                     AVAELAQIAGVTDIDAFTKDLLIAKTNIEGLSAAQLVEKDLKGYPFNGRDVVVGQVEL
                     ATLEQVDGMIEALEADLQRRCDEDGLAFAAVMLTDITTAWTRLIYKGEWSDKLTKHEK
                     DGLLMMENTLSRKKQGWPWLQVELA"
     gene            202535..203749
                     /locus_tag="AOT11_08020"
     CDS             202535..203749
                     /locus_tag="AOT11_08020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95211.1"
                     /translation="MNATKFFSSTHPLLQPTQFRLAHKRLILPVALLVLLFSDTTRQV
                     TVTTLSDSFWAVSCYVAATLAIYHYLSGFMSRPNRVTQLYRASRHYQVFFAALLGALP
                     GCGGAIVVTTQFISGRVGFGAIVAVLTSTMGDAAFLLLAAKPVTGLGVIALGIAVGTL
                     SGMVVNAFHGDDFLRPKVSDEPNQPHCCQNKPDAHTPFEQRAINLQGAFWKWLLIPAA
                     VIALLGSFQVDVNLLLGLEENTIEWMGAIFAVTSMFLWALTKELGSYQSAVSEDEKII
                     DSHPIQKAAQDTNFVSAWVILAFLAFELTHYFSGLNLHATFSGLGVWMPLIGVAVGML
                     PGCGPQILMTSLYLSGAAPLSAQLANAISNDGDALFPAIAMAPKAALVATIYSAIPAF
                     IVGYGYFFLFEY"
     gene            complement(203851..205590)
                     /locus_tag="AOT11_08025"
     CDS             complement(203851..205590)
                     /locus_tag="AOT11_08025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="ASM95212.1"
                     /translation="MKSPYILGNHIPFEVNDDELEVTINNNEVHFCYHGMHNRTIDYR
                     FELFRTPFNFEAQAQLLGDGFQMLAQTTGTRDQVTDIGRCPDNNPQYRLYSQHASKRY
                     YNYLVIEESQGYTLFGFTSCRRFAGYFELEQTGNHWHVVAYLDGEQTEIQDWETNTLE
                     SVVLLEGESLSELYAEFAQHIAIHHPIRAGVKQNAPVGWCSWYAYYADVSQQNILANV
                     EQMQGSLESLEWVLLDDGYQAFMGDWLTPSDKFSGGVKQLIAQIRASGKKPAIWLAPF
                     IAQPESEIFRKHPEWFVKHEDGSLLKAEDITYGGWRCTPWYILDTSNPEVQEHLTHVV
                     KTMREEWGVELFKLDANYWGTLKGQRYQKGITGVEAYRLGMEAIAQGAGDAWLLGCNA
                     PMWPSLGLVDAMRVSDDVERHAHRFEQIAKETFYRSWQHRKLWQIDPDCATFTSLPNQ
                     GAQRQEYEFHRNVLLACGGLLLSGDPLPEITPFAKSCLAKLMVRQKHNQNAAKFTAFS
                     LNHAFLKLTEKNDLHCLFNYDGQQDKEFTLISDTPVHWYDYWTQERLSDEPCQLFVTQ
                     LNPGLNAKAIVTA"
     gene            205827..206744
                     /locus_tag="AOT11_08030"
     CDS             205827..206744
                     /locus_tag="AOT11_08030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95213.1"
                     /translation="MMTSKPNHQTRLSAPIIFIGPGRSGSTVISEFVMAHHSLGWPDN
                     YCEWFPSLPSLAWLTRLTNNSLWYVSGEKAQLNHTLPLNNLLPRPAEAWPFWQKITRD
                     EIDFSRGFLLHQRASTEEKQRIRTYLNQHLRAQGKTRLAMKFTGPGRVEYLSSIFPDA
                     LFINVVREPVATVNSLLKVPFWQAQGLHQLWWQGAYSNHELETYQRIRHDPVCSTAFQ
                     LNKILKTTEEEISRTKVKSLTVHYEDFVRDPQFIVHQIMHFCHLPPCERMRNKLRNSP
                     IRDQNKAAKVSGIAKRVSTWCENEKTLES"
     gene            complement(206834..207823)
                     /locus_tag="AOT11_08035"
     CDS             complement(206834..207823)
                     /locus_tag="AOT11_08035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95214.1"
                     /translation="MKKTVLAVALSLVAGSAIAADVNQNVSERARESMIDLILSGEEF
                     SVGGQVAVGGYYEEGRPDREFYNDGVTGFDLFINYQKGNVVGQFAGEFDLADNYSSMD
                     AKFTVIDTWVGYKTGFGVASIGYANDSALDAVDGAADLTIEFGASASDASDVNQVIKF
                     EGMKEGFKYGIAYYGDREADASGQRGFNGYVGFKNEQFQVNAGYEKNDEKNHKPAVEG
                     GDLVEQLYLVNGVITLGDIAFGANVAQHDTFNSDDFILYSASVGYTIDKLYLAAGYAA
                     KDYDHSASKESVNFGGSYQFTNKLSALVDIKVDLSDDNNSDDLAAFFKVAYDF"
     gene            complement(208188..208757)
                     /locus_tag="AOT11_08040"
     CDS             complement(208188..208757)
                     /locus_tag="AOT11_08040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95215.1"
                     /translation="MFWPFKKYDVEMSPEVHGVITLERVPQEGMTVVRELFYEGYNKG
                     KAILDETQTNEQGEFSFPSMTIRSRLPGDIFGQNFHVNQFLFVQWKNKKLKLWGATLP
                     IQSGREVSEMLSSISCELTNVPRIHAVETSSDERLPISVHSICDWNSPSINTYVYDQS
                     TDTYVRYKKTPQPLESIFNAKHRVKLDAE"
     gene            complement(209029..211491)
                     /locus_tag="AOT11_08045"
     CDS             complement(209029..211491)
                     /locus_tag="AOT11_08045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020194959.1"
                     /note="catalyzes the reduction of trimethylamine-N-oxide
                     to form trimethylamine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trimethylamine N-oxide reductase I catalytic
                     subunit"
                     /protein_id="ASM95216.1"
                     /translation="MAITRRSFLKGVATTSAASVIGPSLLASASANAVETTGTWKVSG
                     SHWGAFRAHIYAGKVQEIKPLELDQNPTEMLNGIKGIIYSPSRVRYPMVRLDWLKKHK
                     YSADTRGNNRFVRVTWDEALDLFYRELERVQKEYGPWALHAGQTGWNQTGSFNNCTAH
                     MQRAVGMHGNYITKVGDYSTGAGQTILPYVLGSTEVYAQGTSWSEILENADNIILWAN
                     DPVKNLQVGWNCETHESYAYLAQLKEKVAKGEINVISVDPVKNKTQRYLENDHLYVNP
                     MTDVPFMLAIAHVLYTENLYDKKFIDTYCLGFEEFINYVQGKTKDKVEKTPEWAAPIC
                     GVKADKIREFARMLVKGRTQILMGWCIQRQEHGEQPYWAAAVVAAMIGQIGLPGGGIS
                     YGHHYSSIGVPSTGFAGPGGFPRNLDAGMKPKWDNNDFNGYSRTIPVARWIDCLLEPG
                     KEINYNGGKVKLPDFKMMVISGCNPWHHHQDRNRMKQAFQKLQTVVTIDFAWTATCRF
                     SDIVLPACTQWERNDIDVYGSYSSRGLIAMHRLVDPLFQSKPDFQIMKELTERFGRSE
                     EYSRGMSEMDWIRSLYNDCKKSNEGKFEMPEFDEFWEKSVLDFGQGQPWVRHADFRQD
                     PEINPLGTPSGFIEITSRKIGRYGYEHCQEHPMWFEKSERSHGGPGSDKHPFWLQSCH
                     PDKRLHSQMCESEEFRATYAVKGREPVYINPLDAKAKGIKEGDLVRVFNDRGQLLAGA
                     VLTDSYPRGVIRIEEGAWYGPLSEKVGAICTYGDPNTLTQDIGSSELAQATSANTCIV
                     DFEKFTGKVPPVTSFGGPIEVA"
     gene            complement(211516..212700)
                     /locus_tag="AOT11_08050"
     CDS             complement(211516..212700)
                     /locus_tag="AOT11_08050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004413424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="ASM95217.1"
                     /translation="MKSLIIKLWRTVTRPAVHISLGVLTVGGFIAGVIFWGGFNTALE
                     ATNTEEFCVSCHTMRDNVYQELQDTVHWKNHSGVRATCPDCHVPHNWTDKIARKMQAS
                     KEVFAQVFGNYDEPGVFEARRIELAKHEWDRFSANKSLECKNCHNYDSMDFTQMSPTA
                     RIQMKQAAEKDQSCVDCHKGIAHKLPAGMDSIGGIVGDLEQMASSTDYSVGKELVSVR
                     HLPIYFDAQGQTEAGLLNPASTVKVVEDKGDYVEIEIDGWRKAKGFGRVIQEDFGKNI
                     AVASLLKEASMDDKIVTTGEEKVDELTGLPWEKVAAKVWIKKESMLNDINPVWEKSRE
                     AYKTNCSVCHTQPAEAHFDANTWPGMFDGMLAFVNLDTDSEALILKYLQKHSSDYAEG
                     HH"
     gene            complement(212751..212930)
                     /locus_tag="AOT11_08055"
     CDS             complement(212751..212930)
                     /locus_tag="AOT11_08055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006879503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trimethylamine N-oxide reductase system protein
                     TorE"
                     /protein_id="ASM95218.1"
                     /translation="MSDVNKIESAEKRSLEWKSFLFITVVLFPILSVAFVGGYGFIVW
                     MLQVFFFGPPGAHGM"
     gene            213509..214303
                     /locus_tag="AOT11_08060"
     CDS             213509..214303
                     /locus_tag="AOT11_08060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="ASM95219.1"
                     /translation="MDSVIDLTWGALLAFSSLLIIPLIISHFYQLAIAKEAMLSVGRM
                     ALQLILVGFYLEYLFTLNDWRINVLWLLVMLSVGASSIVSKAHLPQTQLLLPTLFGLA
                     GGMLPILSVLLVGIIKPTPWYHTQYMIPLAGMLLGNSLSGNIVALQNLFDCYRNRKNE
                     YEAAIALGASPRYASLLFVRQAIQKSFAPILASMAATGLVTLPGMMTGQILGGASPMV
                     AIKYQLIIMIAIFVTLTLSVVITLELALHRCLDRNGQVKTNTLDTK"
     gene            complement(214721..215563)
                     /locus_tag="AOT11_08065"
     CDS             complement(214721..215563)
                     /locus_tag="AOT11_08065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate transporter FocA"
                     /protein_id="ASM95220.1"
                     /translation="MNFNQFDSLLPPQAAERAAEIGEGKATKDPVKSFLLAISAGIHI
                     GIAFVFYTTVTTGGADLPWGITRLIGGLAFSLGLILVVVTGGELFTSSVLTLVARASG
                     KISWRVLIKNWFVVYVGNLVGAILLVVCMLITKQYMFDHGQVGLNAMAISQHKMHHSF
                     FSAVALGIMCNVLVCIAVWMTFSGRTLTDKIAVMILPVAMFVSAGFEHCIANMFQVPM
                     AIGIKNFAPAEFWQMTGANIADYADLNMMDFLLNNLLPVTLGNIIGGGVFVGMWYWLI
                     YLRD"
     gene            complement(215863..217251)
                     /locus_tag="AOT11_08070"
     CDS             complement(215863..217251)
                     /locus_tag="AOT11_08070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein"
                     /protein_id="ASM95221.1"
                     /translation="MNKMKLVLTASMMLSIVGCQSTPEEKATQEVTNEVAENASTPFV
                     GIQQSHQQWSQALQDSGKLAIYAPENFKDLTSAWKEASEIYTKLEKDPSLASKSYSLF
                     SSDTYAQAYQEQIKLVDQNFAALEKLKAKADVILADSIAQMDYLAEINAAKLYANDYN
                     KVLSQYKKLFSYVVVDELEEAQEKQVVFLNTAKQLEVKVVHKTFILPLQQELKTLKKE
                     DFNEVAPVSFATAENVINIAANIAQTNPRDKAAIELAVASAQFEIEHVKQVTHQVKLL
                     ASVEDDAFENSVLEIENKLLAISKAVDGSDYRDVMLREQSEKILASVKRMHEANKTTD
                     LSQQVTELNSKVKVLETKAAEQKTALEKANQRELALNAHIEREAAHIKSLEELVANLK
                     LQLAAKDQPVATVAQAEPVQEGITSEEQVPQVEEAAPEAEVTETEEAASDGEASSETV
                     SPETQPEIAAAE"
     gene            217612..217845
                     /locus_tag="AOT11_08075"
     CDS             217612..217845
                     /locus_tag="AOT11_08075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="ASM95222.1"
                     /translation="MKFTEEHLAEMNLLLQFDLSSAATGIKVHKDAAESAQAAVKRLF
                     DKGLCTQIDGGYLTDEGIEVAEHAEKTLRVLSA"
     gene            complement(217983..218408)
                     /locus_tag="AOT11_08080"
     CDS             complement(217983..218408)
                     /locus_tag="AOT11_08080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95223.1"
                     /translation="MTQGERLFHAVAFELLALAIIVPATSLMTGKGASALAIVGIGLS
                     IFTVIWNYIYNQYFDQWFGANRAERGLKMRLLHTLGFEGGLIFITIPVISWFLSISIL
                     QALLLEAGFLLFFLFYATGFNWLYDRVQPYQWMNALFSR"
     gene            218498..219373
                     /locus_tag="AOT11_08085"
     CDS             218498..219373
                     /locus_tag="AOT11_08085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM95224.1"
                     /translation="MFTIEQLQAFVTTSEKGSFSAAARALGKAQSVISQHIMNMELDC
                     GVDLFDRTGRYPVLNSSGLALLPYAKATLEQLERLSNKASSLFEPSASQLILAVDEGV
                     PLLTLPHVFRTLEASFPELQIECLTASSPDIIELVESGRATTGIILSETVLPSTIDFS
                     SLGAVAFDVFVSTEHPLASMSLTHSDQLKLHRQLVIRSKNTQFSSLNQAFGPDVWYAD
                     NYFMLLEMAKAGFGWCLLPEHLIGAEQHGLVKIQNPQLQFGWQANIDVIQHQKWHSDP
                     VHLETRRLLRNLFGK"
     gene            219376..220206
                     /locus_tag="AOT11_08090"
     CDS             219376..220206
                     /locus_tag="AOT11_08090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="ASM95225.1"
                     /translation="MKKILIIGAGWLGLPFAQQLSALKHQVIVTRRSTDSLREVPLEL
                     ENKAVLDLANDDAAKKVRAIVDNNAIDIVVGSFPPGFRKGSGEEYAHQWQKIVDGIKD
                     SAVQKVIMVSSTTVYPNQPGEMREDDATLAKANCENALFSDKARVMLQAEQSLLDSGK
                     NFTILRLSGLFGPHRHPARFVPHLKQISSRAPANMLHLDDAIKALLFAIHAVDQQVLN
                     VSTPTTVDKATFYQAALESAQLKVDFPPVVAVEDKRIVVDKLLQSGFQFQYQSTLDAL
                     "
     gene            220203..220841
                     /locus_tag="AOT11_08095"
     CDS             220203..220841
                     /locus_tag="AOT11_08095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95226.1"
                     /translation="MKLFRQIEQLWQYMQLQHHLTPADCLLVMCSNDLRVAEHAANLY
                     KQGYAPYILFSGGEGRFTEGRFEKSEAETFAELAKASGVPEEAILLETKSSNTGENVR
                     FSEQLLIDKGLVFDSFILVQKPFMERRALATFEKQWQGAYSRLLVSSTGEAFFDYINE
                     EMPLMLVLEALLEDFERIKHYPAKGFQTEQPLPDDVETAYQEIREKLTSLLV"
     gene            complement(220943..221521)
                     /locus_tag="AOT11_08100"
     CDS             complement(220943..221521)
                     /locus_tag="AOT11_08100"
                     /EC_number="2.7.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008080575.1"
                     /note="catalyzes the formation of thymidine 5'-phosphate
                     from thymidine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine kinase"
                     /protein_id="ASM95227.1"
                     /translation="MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRY
                     GIGKVSSRIGLQAEAQLFKADTNLYQEIAALNEVEKRHCILVDECQFLSKEQVYQLTE
                     VVDKLHIPVLCYGLRTDFLGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEH
                     GNAIKEGDQVAIGGNDRYVSVCRQHYKEALGK"
     gene            complement(221601..222983)
                     /locus_tag="AOT11_08105"
     CDS             complement(221601..222983)
                     /locus_tag="AOT11_08105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004726421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine--tRNA ligase"
                     /protein_id="ASM95228.1"
                     /translation="MLKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTF
                     VSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGETCDSLTERLIGEMHADFDA
                     LNMKRPDVEPRATQYIQEIIELVERLIDRGFAYVADNGDVMFEVNKFDEYGKLSKQDL
                     DQLQAGARVDVETAKRCPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILG
                     NHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFT
                     IRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSLRGLDLAAAPAG
                     GEEYVSRFTAAMNDDFNTPEAYSVLFDMAREINRLKTEDLANASALGALMRELADVIG
                     ILHQDPDAFLKGDAGNDDEVAEIEALIKLRNDSRAAKDWANADMARDKLNEMGIVLED
                     GPEGTTWRRK"
     gene            223189..223683
                     /locus_tag="AOT11_08110"
     CDS             223189..223683
                     /locus_tag="AOT11_08110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020332956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="ASM95229.1"
                     /translation="MITLHTNFGDIKIELNAEKAPETSANFLQYCREGFYDNTIFHRV
                     IDGFMIQGGGMESGLREKSTREPIKNEANNGLSNKVGSIAMARTMDPHSASSQFFINV
                     NNNTFLDFRSESRDGWGYCVFGEVVEGMDVVNKIKGVSTGSYGMHQDVPLEDVVITGA
                     TIEE"
     gene            223742..224473
                     /locus_tag="AOT11_08115"
     CDS             223742..224473
                     /locus_tag="AOT11_08115"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572017.1"
                     /note="catalyzes the formation of 2,3=diacylglucosamine
                     1-phosphate from UDP-2,3=diacylglucosamine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-2,3-diacylglucosamine hydrolase"
                     /protein_id="ASM95230.1"
                     /translation="MTTLFISDLHLTPSRTDITECFVQFMRNEAVNAEALYVLGDLFE
                     FWIGDEDCTPFAERIRNEFKALTTAGVPVYFIQGNRDFLLGRRFCHETGITLLDDICT
                     IDLYGEKVVILHGDTLCIDDLKYQEFRKTVHQPWLQWIFKRIPWFIKKRIVAKVQSGV
                     RDDKQHKSLEIMDVNQQEVEQVMSQFCVKLMIHGHTHRPNIHHFEHDNIPLTRIVLGD
                     WYSQGSVLKVTADGYSLEQRPFFTE"
     gene            224581..225795
                     /locus_tag="AOT11_08120"
     CDS             224581..225795
                     /locus_tag="AOT11_08120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM95231.1"
                     /translation="MKYSYVARQPILDQNRKTIGYELLFRDGPKNTFPEVEPELATSR
                     LLSDHFLSTHYNTLGNKLGFVNFPYQSLINLVPTLFPKESLVIEILEDCEPTDELYEA
                     IIKLHKAGYHIALDDFVPNRAWKRFLPYIHIIKFDIRIVPIEKAAQFIASLRKLKIKF
                     LAEKVETYQEFEQAIKAGFDYFQGYFFSRPEMIQKRRINPSFLTVVQLCKEIADEPID
                     FNEVERLFSIDVTLSYKLMTYVNSGYTLTAKIKSFRQALIYLGEEKLRRFISLVAVAS
                     VHEDKPDSLYSLAVQRARACELLLGHTSTKYDPGQAFLTGLFSLLDSLLDQPLGDIIE
                     DIPVDEEIKLALSERSGQLGTILSTITAYEQANWELASQYQQQLGISEHQLCMAYSKA
                     TEWTQELLSQTP"
     gene            225871..226374
                     /locus_tag="AOT11_08125"
     CDS             225871..226374
                     /locus_tag="AOT11_08125"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MLR9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97791.1"
                     /translation="MAASCPCGSNRTYALCCEIAHKHHADVITPEQLMRSRYSAHVLG
                     LVDYVVNTYHPSCHAEEQREGIAESIENDWCKLEVVKAEAGSNENEGFVEFNAYFNED
                     GKRYCMTERSRFVKEEGLWYYIDGTFPEEEPEQDPRLNQSVSSLKVGRNDPCICGSGK
                     KFKKCCG"
     gene            complement(226564..227199)
                     /locus_tag="AOT11_08130"
     CDS             complement(226564..227199)
                     /locus_tag="AOT11_08130"
                     /EC_number="3.5.4.19"
                     /EC_number="3.6.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422250.1"
                     /note="catalyzes the formation of 1-(5-phosphoribosyl)-AMP
                     from 1-(5-phosphoribosyl)-ATP and the subsequent formation
                     of
                     1-(5-phosphoribosyl)-5-((5-
                     phosphoribosylamino)methylideneamino)imidazole-4-
                     carboxamide from 1-(5-phosphoribosyl)-AMP in histidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="ASM95232.1"
                     /translation="MSFKTAEVSSLAERINWEKVDGLVPAIVQDFQSSQVLMMGYMNQ
                     EALVKTGETGQVTFFSRTKERLWTKGETSGNVLQLVNMSLDCDNDTLLVKVNPIGPTC
                     HTGTTTCWDGDPQEESQMVWLHQLEQLLAARKSADPDSSYTASLYARGTKRISQKVGE
                     EGVEVALAATSGDKAELVCESADLIYHLMVLLQDQGLSMNDVINKLKERHN"
     gene            complement(227196..227969)
                     /locus_tag="AOT11_08135"
     CDS             complement(227196..227969)
                     /locus_tag="AOT11_08135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005495716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="ASM95233.1"
                     /translation="MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGA
                     DELVFYDITASSDGRVVDKSWVARVAEVIDIPFCVAGGIKSAEDAARILEFGADKVSI
                     NSPALANPQLITDLADKFGVQCIVVGIDSYYDKETGKYQVYQFTGDEERTKATQWETR
                     DWVQEVQKRGAGEIVLNMMNQDGVRNGYDIEQLNMVREVCKVPLIASGGAGAMEHFAE
                     AYQKANVDGALAASVFHKQVINIGELKQYLKQQGIEVRL"
     gene            complement(227951..228688)
                     /locus_tag="AOT11_08140"
     CDS             complement(227951..228688)
                     /locus_tag="AOT11_08140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014231491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="ASM95234.1"
                     /translation="MIIPALDLIEGQVVRLYQGDYGQVTEYKVDPAEQFNLYHQAGAN
                     WLHLVDLTGAKDTTARQLDLIAKLLASTPANIQIGGGVRSEQDVVDLLEAGAQRVVVG
                     STAVKQPELVKGWMEKYGAEKIVLALDINIDQDGTRKVAISGWQEDSGVTIEALINDY
                     LTVGLQHVLCTDISRDGTLEGSNVELYVDLCKQYPQVQFQSSGGIGSLADIEALKGSG
                     VAGVIVGRALLDGKFTAEEAFACWQSE"
     gene            complement(228701..229315)
                     /locus_tag="AOT11_08145"
     CDS             complement(228701..229315)
                     /locus_tag="AOT11_08145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005427529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="ASM95235.1"
                     /translation="MTEQKVVIIDTGCANVSSVKFAIERLGYDVTISKDPQVVLSADK
                     LFLPGVGTASEAMKNLEERDLISLVKQVEKPLLGICLGMQLLGKVSQEKGQKADALVE
                     CLGLCDGEVKLLQTGDLPLPHMGWNTVSAKTGHPLFKGIEEGEYFYFVHSFAMPVGDY
                     TIAECEYGNPFTAAVQSGNYYGVQFHPERSSKAGAKLIQNFLEL"
     gene            complement(229342..230415)
                     /locus_tag="AOT11_08150"
     CDS             complement(229342..230415)
                     /locus_tag="AOT11_08150"
                     /EC_number="3.1.3.15"
                     /EC_number="4.2.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012127627.1"
                     /note="catalyzes the formation of
                     3-(imidazol-4-yl)-2-oxopropyl phosphate from
                     D-ethythro-1-(imidazol-4-yl)glycerol 3-phosphate and
                     histidinol from histidinol phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="ASM95236.1"
                     /translation="MSKQQKILFIDRDGTLIVEPPVDFQVDRLDKLKLEPFVIPSLLS
                     LQEAGYRLVMVTNQDGLGTDSYPQEDFDAPHNMMMEIFESQGVKFDDVLICPHFEKDN
                     CSCRKPKLGLVKEYLQAGKVDFQNSFVIGDRQTDLQLAENMAIRGIQYNPESMGWKQI
                     LKDLTVKARVAEVIRTTKETDIKVVVNLDEQGGNAISTGLGFFDHMLDQIATHGGFQM
                     VCQVEGDLHIDDHHTIEDTALALGQALKEALGDKRGIGRFGFSLPMDECLAQCALDLS
                     GRPYLKFDAEFSRDQVGDLSTEMVVHFFRSLTDTLACTLHLSSAGDNDHHIIESLFKA
                     FGRTLRQAIKVEGTELPSSKGVL"
     gene            complement(230485..231525)
                     /locus_tag="AOT11_08155"
     CDS             complement(230485..231525)
                     /locus_tag="AOT11_08155"
                     /EC_number="2.6.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020332949.1"
                     /note="catalyzes the formation of L-histidinol phosphate
                     from imidazole-acetol phosphate and glutamate in histidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="ASM95237.1"
                     /translation="MEKLARKSVQKLTPYLSARRIGGTGDVWLNANESPFDNEYRTNF
                     ARLNRYSDCQPKALIAAYAAYAGVKPEQTLTSRGADEGIELLIRAFCEPNEDAILYCP
                     PTYGMYSVSAETIGVERKTVPLTEDWQLDLAGIEANLDKVKLVFVCSPNNPTGNLVKR
                     EDIIALLEMTKDRAIVVMDEAYIDFCPEASTVDLLAQYSNLAILRTLSKAFALAGLRC
                     GFTLANEELINVLLKVIAPYPVPVPVAEIATQALSEAGLARAKFQVLDLNANRAYLQV
                     GLSMIAGLEVFEGWGNYLLVKFPNGDELFKAAWESGIILRNSPIKDCVRVSVGSRDEC
                     EKTLGFIRNYYS"
     gene            complement(231536..232831)
                     /gene="hisD"
                     /locus_tag="AOT11_08160"
     CDS             complement(231536..232831)
                     /gene="hisD"
                     /locus_tag="AOT11_08160"
                     /EC_number="1.1.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MLS6.1"
                     /note="catalyzes the oxidation of L-histidinol to
                     L-histidinaldehyde and then to L-histidine in histidine
                     biosynthesis; functions as a dimer; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="ASM95238.1"
                     /translation="MRTVVWQSLSETQQDAILERPAITEGANITAAVAEVIAKVRAEG
                     DAALIELTEKFDRVKPESIRVTEQEIEDASARLTSKMKQALEQAYANIAKFHNAQKPT
                     PIKVETQPGVVCEQVTRPIQKVGLYIPGGSAPLPSTVLMLGVPAQIAGCRKVVLCSPP
                     PIADEILYVAKLCNIDEVYNVGGGQAVAAMAYGTESVTKVDKIFGPGNAYVTEAKRQV
                     SNDFRGAAIDMPAGPSEVLVIADETADADFIAADLLSQAEHGPDSQVVLVTPSVLIAD
                     QVTDAVQKQLNQLSRASIAEKALASSLIIIADSLTQAVSISNYYGPEHLIVQTKNPRE
                     LLPLLDNAGSIFLGDWSPESAGDYASGTNHVLPTYGYTRTYSSLGLADFSKRMTVQEL
                     SAEGLKNLAPTVVTMAEAEGLDAHKRAVTIRVEKLTARS"
     gene            complement(232837..233733)
                     /gene="hisG"
                     /locus_tag="AOT11_08165"
     CDS             complement(232837..233733)
                     /gene="hisG"
                     /locus_tag="AOT11_08165"
                     /EC_number="2.4.2.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006074105.1"
                     /note="long form of enzyme; catalyzes the formation of
                     N'-5'-phosphoribosyl-ATP from phosphoribosyl
                     pyrophosphate; crucial role in histidine biosynthesis;
                     forms active dimers and inactive hexamers which is
                     dependent on concentration of substrates and inhibitors;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="ASM95239.1"
                     /translation="MQTQRLRIAIQKKGRLSEECQGLLKKCGVKFNIMGERLVVHSEN
                     MPIDLLLVRDDDIPGLIMDGVVDLGFIGENVLEEVRLERKATGDACQFETLSRLDFGG
                     CRLSIAIDKDEKYNGPQDLAGKRIATTYPQLLKAYMDRQGVAFSTCMLTGSVEVAPRA
                     GLADAIADLVSTGATLEANGLKEAEVIFQSKATLIQRSGEFAQDKQALIEKLLTRMQG
                     VQQAKESKYIMLHAPVDKLEQIKALLPGAEDPTVLPLSAEKQRVAVHLVSTENLFWET
                     MEQLKELGASSILVLPIEKMME"
     gene            complement(234094..235695)
                     /locus_tag="AOT11_08170"
     CDS             complement(234094..235695)
                     /locus_tag="AOT11_08170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter"
                     /protein_id="ASM95240.1"
                     /translation="MNLIDFATSPISLLPPIVALTLAILTRKVLVSLGVGILLGAVLL
                     NDYSVGSAAAYITDKVSAVFIEDGGINTWNMSIVGFLLLLGMTTALLTLSGGTRAFAE
                     WAQTRVKSKRGSKLLAAFLGVFIFVDDYFNSLAVGAISRPVTDRFYVSRAKLAYILDS
                     TAAPMCVVMPASSWGAYIMTIIGGILVSHGITEYSALGAYLRLVPMNFYAIFALLMVF
                     AVAWFGLDIGKMREHEIAASQGRGFDNDADTDLKEAHEIDEELDIRESDKGKVTDLVM
                     PIIALIIATVASMLYTGGQALAADGKAFDLLGAFENTNVGTSLIYGGLVGLAVALFTV
                     FKQGLPVAEIARTLWIGAKSMFGAILILIFAWTIGSVIGDMKTGSYLSTMAQGNITPH
                     WLPVILFLLSGLMAFSTGTSWGTFGIMLPIAGDMAGATDIALMLPMLSAVLAGSVFGD
                     HCSPISDTTILSSTGARCHHIDHVATQLPYALAVALVSCIGFVVLGMTASVMFSLAAA
                     TMAFIIVCAILSWLSKAKIESCQQA"
     gene            236471..236878
                     /locus_tag="AOT11_08175"
     CDS             236471..236878
                     /locus_tag="AOT11_08175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM95241.1"
                     /translation="MSELTKTLLNIRSLRAFSRELTLEQLEEALDKLTTVVAERQEAE
                     AKERAAKAEQEAKLAAIAEQIAKDGIDVEALISALAGETKVKSKGKRAPRPAKYKYVD
                     TNGEEKTWTGQGRTPSAIQAQLDAGKSLEDFEI"
     gene            complement(236924..238228)
                     /locus_tag="AOT11_08180"
     CDS             complement(236924..238228)
                     /locus_tag="AOT11_08180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572025.1"
                     /note="catalyzes the formation of inosine/guanosine
                     monophosphate from inosine or guanosine and ATP; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine kinase"
                     /protein_id="ASM95242.1"
                     /translation="MKFPGQRKSKHYFPVHARDPLVSQAQESKKMTRTHIIGIDQTLV
                     DIEARVTSEMIEKYGLSKGHSLVIDDVTAEALYQQLKQENLITNEYAGGTIGNTLHNY
                     SVLADDRSTLLGVMSQDIKIGSYGYRYLCNTSSRMDLNYLQGVDGAIGRCFALITEDG
                     ERTFAISEGQMNQLHPDNIPEKIFKKASALVLTAYLIRCKEGDPMPDATMKAIEYAKK
                     YDVPVVLTLGTKFVIQDDPTFWQEFIRDNVTVVAMNEDEAEALTGESDPLAASDKTLD
                     WADMVLCTAGPLGLFMAGYTEDSAKRETSLPLLPGCIAEFNRYEFSRPTKKASCENPI
                     KVYSHISPYMGGPEKIKNTNGAGDAALSAVLHDMAANKYHKENVPNSSKHVYEFLTYS
                     SFSQVCKYANRASYEVLVQHSPRLSRGLPEREDSLEEAYWER"
     gene            complement(238345..238614)
                     /locus_tag="AOT11_08185"
     CDS             complement(238345..238614)
                     /locus_tag="AOT11_08185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95243.1"
                     /translation="MTDEMQFMQEADLIEIIENQLEDGNPIKVKETLMRLMMTGTPRE
                     DAVAMMACSMSIEIFDVMKNDGEFNLKRYSENLDCLPDLSFMEGE"
     gene            238804..239928
                     /gene="mnmA"
                     /locus_tag="AOT11_08190"
     CDS             238804..239928
                     /gene="mnmA"
                     /locus_tag="AOT11_08190"
                     /EC_number="2.8.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572026.1"
                     /note="catalyzes a sulfuration reaction to synthesize
                     2-thiouridine at the U34 position of tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-specific 2-thiouridylase"
                     /protein_id="ASM95244.1"
                     /translation="MSDNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEED
                     DDSEYCTAAEDLADAQAVCDKLGIHLHKINFAAEYWDNVFEYFLSEYKAGRTPNPDIL
                     CNKEIKFKAFLEFADEVLDADYIAMGHYVRRSFPENGEKPQMLRGLDGNKDQSYFLYT
                     LSHEQVARSLFPVGELEKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP
                     AQPGNIESPEGEVLGQHQGLMYHTLGQRKGLHIGGRKGGGGNEEPWFVAEKDLKRNVL
                     IAVQGQDHPMLKSEGLIASQLHWVEREPIRDVVKCTVKTRYRQQDIPCTIIPIDDENI
                     KVIFDEPEIAVTPGQSAVFYQGDVCLGGGIIEKRIKYTQA"
     gene            239939..240556
                     /locus_tag="AOT11_08195"
     CDS             239939..240556
                     /locus_tag="AOT11_08195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790614.1"
                     /note="HflD; UPF0274; in Escherichia coli this protein is
                     peripherally associated with the membrane and appears to
                     act with lambda CII protein; in Haemophilus influenzae a
                     knockout of the HI0638 gene affected paracytosis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysogenization regulator"
                     /protein_id="ASM95245.1"
                     /translation="MANTLYDRTIAFAGMCQAVALVQQIARNGHCDQDAFETSIKAIL
                     NTNPANTLDVFGNESQLKLGLECLVKGIDSTPTGSEVTRYLISLMALERKLMGRNDAM
                     SQLGDRIQMVQRQTEHYDLFEEQMISNVASIYLDVISPIGPRIQVTGTPTVLQQTSNQ
                     HKVRALLLSGIRSAVLWRQVGGRRRHLIFGRKKMVEQAQILLARM"
     gene            240705..242075
                     /locus_tag="AOT11_08200"
     CDS             240705..242075
                     /locus_tag="AOT11_08200"
                     /EC_number="4.3.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017034898.1"
                     /note="Catalyzes two discrete reactions in the de novo
                     synthesis of purines: the cleavage of adenylosuccinate and
                     succinylaminoimidazole carboxamide ribotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="ASM95246.1"
                     /translation="MELSALTAVSPVDGRYGSKTIALREIFSEYGLLKYRTIVEIRWL
                     QKLAATAEIAEVPAFSAEANHFLDDLAANFSEADALRIKEIERTTNHDVKAVEYFLKE
                     KVADVPELHAVNEFFHFACTSEDINNTSHALMLKEARETVILPEIRNLIDAIKALAVE
                     YRDIPLLSRTHGQPASPSTMGKEMANVAYRMERQYKQIENVEILAKINGAVGNYNAHL
                     SAYPELDWHKFSEEFITESLGVTWNPYTTQIEPHDYIAELFDAVARFNTILIDFDRDV
                     WGYIALGHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLANAVFGHLAQKLPISRW
                     QRDLTDSTVLRNLGVGVGYAIIAYTSTLKGISKLEVNREALLAELDKNWEVLAEPVQT
                     VMRRYGIEKPYEKLKELTRGKRVDGEAMRNFIDGLELPAHEKARLKEMTPANYIGQAI
                     ELTDKL"
     gene            complement(242285..242818)
                     /locus_tag="AOT11_08205"
     CDS             complement(242285..242818)
                     /locus_tag="AOT11_08205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95247.1"
                     /translation="MNKHNVFIVLLVMTLNALVGCSSDLKDFQQASPKFELFEYFSGN
                     VKAWGMVQDYSGKQTRRFEVEIVGSVENNTLTLVEDFVFDDGEIDQRIWRITRLADGR
                     YQGEADDIIGVAEGMELGNALQWRYDFELQIDGSSLTVSFDDWLYRQDEKHVFNLTKI
                     KKFGVEVGTITLFFQRQ"
     gene            complement(242820..243383)
                     /locus_tag="AOT11_08210"
     CDS             complement(242820..243383)
                     /locus_tag="AOT11_08210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95248.1"
                     /translation="MMRKASCVIRSTFLSILLGFSSSSHSQTGAADIETWQQWLTVGE
                     ARLSWFVFDIYDSKLVTPNGEFEVNADVTPHPLALEIRYLRDISREDLLSATEEQWQK
                     MGIAAKKPWRDSLELIFPNIKKGDKLTYITDGEKGRLLINRHDSDKAEVVGNVADQEL
                     NDAFLAIWLSPKTQYPSLRAKLIGWNQ"
     gene            complement(243340..243855)
                     /locus_tag="AOT11_08215"
     CDS             complement(243340..243855)
                     /locus_tag="AOT11_08215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter permease"
                     /protein_id="ASM95249.1"
                     /translation="MALILASAWFNLVWFLAVIGTEQWQWVTLCFALMTLGYQHRVDQ
                     KTWKPTLLIAVVGCLVDSLNQYLSIFQFTSTFLPVWLLSLWIVFAWYAYQLKRILLRF
                     APFYVLTVGALGGCLSYYAGYKLNAVDYGYSVLITASIVFLEWAIITLFIIKVLRHDE
                     KSKLCHSEYVS"
     gene            complement(243860..245116)
                     /locus_tag="AOT11_08220"
     CDS             complement(243860..245116)
                     /locus_tag="AOT11_08220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclopropane-fatty-acyl-phospholipid synthase"
                     /protein_id="ASM95250.1"
                     /translation="MLNTSSMALTSPLSTAQKAARNLIFKCLQHMEIGTLTVIESFQS
                     DTQERSERFVGTNNHKPGVAISATIEVKHPAFYSRLMRGGSIAAGEAYMDGWWDSPDL
                     TSLMKLMALNLNALDGLENQSSWVTKLLYKLSHWSNRNTQENSRKNIHAHYDLGNDLY
                     RVFLDERMLYSSAIYHSDSESLEQAQINKMDRLCQQLQLKPTDEVIEIGTGWGAMAIY
                     MAENYGCRVTTTTISDEQYDYAQQQIAERGLTERIQLLKKDYRDLTGQFDKLVSIEMI
                     EAVGKQYLPSYIKVCQSLLKPGGLMAIQAITIADQRYEYYSNNVDFIQKYIFPGGFLP
                     SVTSLAQATTQYSDLVIRDLFDIGMDYAKTLQEWHRRFNHAEEQVKRLGYDERFIRMW
                     RYYLSYCEGGFLARSISTVHMTLQRA"
     gene            complement(245152..245925)
                     /locus_tag="AOT11_08225"
     CDS             complement(245152..245925)
                     /locus_tag="AOT11_08225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="ASM95251.1"
                     /translation="MSMVISSRLFVGNVRHRRFTPVEHSLNYQLFMPAIDLDELAQLE
                     KEVWGFGTRWWHWARFKRSDYVGEGCLKRAVQEKLTELTGESVRGRVIAVCHLRYLGL
                     YFSPVNFYYVFDEKEHWRYLLAEVSNTPWNERHYYAISADEHDSSFGWKQTKAFHVSP
                     FNPIEQSYIWRLKPLSEKLHIHLECHKENKQFDATMAMSAEPFSSNNLLKRLIVTPIQ
                     TVKVLVGIYWHAFKLWKKGAPFYSHPKYRSPANQTENNN"
     gene            complement(245922..247214)
                     /locus_tag="AOT11_08230"
     CDS             complement(245922..247214)
                     /locus_tag="AOT11_08230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011150008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="ASM95252.1"
                     /translation="MKIAIIGTGISGLTCGYHLHKAHDITLFEANDYIGGHTATIDFK
                     LNGKDYSVDTGFIVYNDRTYPNFINMMDEIGVTGRATQMSFSVRNDSNGLEYNGHTLA
                     TLFAQKRNWFKLQFYGFIFEILRFNKLAKASAHDDQIAQQTLGEFLDTHGFSDYFSDN
                     YILPMGAAIWSSTLADMRAFPLTFFLRFFLNHGLLDVTNRPQWYVIDGGSKAYIPPLT
                     KGFSDRIRLNCPVEKVIRDSTGVTLYVAGEAQRFDHVIFACHSDQTMSLLEDASSDEA
                     SILSRMAYQANEVVLHTDDSLLPRRKAAWASWNYLLDGKEGEETRLPSLTYNMNILQH
                     IEAEHTFCVTLNSSDKIDENKVIRKFVYHHPVFTTESIVAQQRRGDIQGRNHTWFCGA
                     YWYNGFHEDGVRSALDVVRGINLVQAKKDTISFHQGAA"
     gene            complement(247231..247956)
                     /locus_tag="AOT11_08235"
     CDS             complement(247231..247956)
                     /locus_tag="AOT11_08235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="ASM95253.1"
                     /translation="MNSVLITGATSGIGKQLAQDYADAGAKVIACGRNRQVLQELEDY
                     SPAIATISFDVTDYQQTREALSVLPFIPNVWLFNAGDCEYMDDGIVDAQLMQRVFSVN
                     VFGVVNCIEASQAHFQPGHKVVIVGSIASELALPRAEAYGASKAAVGYFARSLSLNLQ
                     TKGIDVVTVFPGFVSTPLTDKNTFAMPMIITVEQASKAIRQQLASGKQHIYFPARFTA
                     LIRLLALLPYRWQKALASKLIAQ"
     gene            complement(247953..248372)
                     /locus_tag="AOT11_08240"
     CDS             complement(247953..248372)
                     /locus_tag="AOT11_08240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM95254.1"
                     /translation="MDVIAVSNVYRSLSKSNLEILADVYHQQVVFEDAAHRLEGWSAL
                     KDYFQSLYENVIDCRFDIHEHQQVDQSGFLTWTMTLKHPKLKKGEAVSVKGVSHLKFH
                     EGKVIYHRDYFDLGEMLYEHLPILGSVVRSIKQRLGQ"
     gene            complement(248614..249480)
                     /locus_tag="AOT11_08245"
     CDS             complement(248614..249480)
                     /locus_tag="AOT11_08245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422272.1"
                     /note="metalloprotease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein HtpX"
                     /protein_id="ASM95255.1"
                     /translation="MKRVMLFLITNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAA
                     VFGFGGAFISLMMSKGMALRSVGGVVIESPRNETEHWLLETVSRQAQQAGIGMPTVAI
                     YDSPDINAFATGAKRDDSLVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQ
                     GVVNTFVIFLSRFIANMVASNNSDEEGEGSNMMVYFAVSIALELVFGFLASFITMWYS
                     RHREFHADAGAARLVGKEKMIAALERLKMSQESKLDGTMMAFGINGKQSLTELLMSHP
                     PLDKRIAALRNF"
     gene            complement(250051..250734)
                     /gene="bioD"
                     /locus_tag="AOT11_08250"
     CDS             complement(250051..250734)
                     /gene="bioD"
                     /locus_tag="AOT11_08250"
                     /EC_number="6.3.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8N2.1"
                     /note="DTB synthetase; dethiobiotin synthase; involved in
                     production of dethiobiotin from ATP and
                     7,8-diaminononanoate and carbon dioxide; contains
                     magnesium; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthetase"
                     /protein_id="ASM95256.1"
                     /translation="MMKAFFIAGTDTDVGKTVASKAILHALAAKDLRTIGYKPVAAGS
                     DKTPEGWRNSDALHLQKAATVVVDYEDINPYALELPASPHIAAKHEKVEIDYAVLSSK
                     LAQHKENADVVLVEGAGGWRVPVSDTDSLSTWVKQEDLPVVLVVGIKLGCLSHALLTA
                     EVIKADGLNLVGWVANRVNPGTEHYAEIIDMLEERLEVPKLGEIPYIPSAKRKDLGKY
                     INADVLLEL"
     gene            complement(250731..251540)
                     /locus_tag="AOT11_08255"
     CDS             complement(250731..251540)
                     /locus_tag="AOT11_08255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-[acyl-carrier protein]
                     O-methyltransferase BioC"
                     /protein_id="ASM95257.1"
                     /translation="MEMAKVSFTVEEAYVDKLAIAQAFGKAAKSYDQHAAFQREVGHK
                     LLDKLPQDLSGLRVLDLGCGTGYFSWQLLQRGAAVVCADLSHEMLEQAKARCGQESVS
                     YRVADAESLPFEQDEFDIVFSSLALQWCEDLSRPLREMNRVVKPHGQVLFSTLLDGSL
                     NELKQAWAKIDSYQHVNRFISANQVKIALAQSHSHNHHLDLTDITVWYESAFAVMRDL
                     KGIGANHVSGRSHGLTTRQALKRVEREYQTFQNHLGQVPASYKVCLGVIQL"
     gene            complement(251540..252697)
                     /locus_tag="AOT11_08260"
     CDS             complement(251540..252697)
                     /locus_tag="AOT11_08260"
                     /EC_number="2.3.1.47"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8N0.1"
                     /note="catalyzes the formation of 8-amino-7-oxononanoate
                     from 6-carboxyhexanoyl-CoA and L-alanine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="ASM95258.1"
                     /translation="MTQAFNERIAQALKQRRKQGLNRQSEVIFSGNQAVLEHQGKRYL
                     NFSANDYLGLANDQSLVRAWQQGLSLYGCGSGASPLVTGYTPAHSNLAASLCDWLGYE
                     SATLFGSGFSANQALLFALLEKGDLLVQDKLNHASLIEAGLFSPATMKRFKHNDLKAL
                     DTILNRADCPSLVVTEGVFSMDGDCSPLAEMHALTQRHSASLMVDDAHGVGVLGEEGR
                     GSCALANVKPDFLVVTFGKAFGLSGAALLTDKSSGDFLAQFARHHVYSTALPPAQAFA
                     LTHAVELIRTQQWRRDKLNELQTLFAEYLGEHDSYVSTQTPIKPWLIGETQQAVTVAQ
                     RCREQGIWLTAIRPPTVPQNTARLRITLSANHTKEQMHTLAQVLLTVTGEH"
     gene            complement(252681..253733)
                     /locus_tag="AOT11_08265"
     CDS             complement(252681..253733)
                     /locus_tag="AOT11_08265"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MLV0.2"
                     /note="catalyzes the formation of biotin from
                     dethiobiotin; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="ASM95259.1"
                     /translation="MEVRHNWTHAQVRELMEMPFMDLLFEAQQIHRQYHPKNYVQVST
                     LLSIKTGACPEDCKYCPQSARYQTDVEKERLMEVERVLDAAQKAKNAGSTRFCMGAAW
                     KNPKERDMPLLTDMIKGVKDMGLETCMTLGMLTPEQAKQLASAGLDYYNHNLDTSPEY
                     YGNIITTRTYQDRLDTLSHVRDAGMKICSGGIIGMGESANDRAGLLVELANLPTHPES
                     VPINMLVKVKGTPLETAEEVDPFDFIRLIAVARIMMPTSAVRLSAGRENMNEQMQTLC
                     FMAGANSIFYGCKLLTTPNPSEDKDMQLFNKLGINSQQVSQKPDEITENELLDRVVES
                     VAARPTKDDLFYDASL"
     gene            253874..255151
                     /locus_tag="AOT11_08270"
     CDS             253874..255151
                     /locus_tag="AOT11_08270"
                     /EC_number="2.6.1.62"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572036.1"
                     /note="catalyzes the formation of
                     S-adenosyl-4-methylthionine-2-oxobutanoate and
                     7,8-diaminononanoate from S-adenosyl-L-methionine and
                     8-amino-7-oxononanoate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="ASM95260.1"
                     /translation="MDLAFDRQHIWHPYTSTLTPLTCYPVNSASGVYIKLEDGTTLID
                     GMSSWWSTIHGYNHPHLNQAAHRQIDQVSHVMFGGITHQPAISLCKKLLSLVPNNLEH
                     VFLADSGSVAVEVSLKMALQYWHAKGERRPKFLTLQHGYHGDTFAAMSVTDPDNSMHS
                     LYKGFLPEHIFAKSPTGGFWDEWKQEDLTDFAQKIEQHHQELAAVILEPIVQGAGGMR
                     IYHPEFLKGVRALCDKYGLLLIADEIATGFGRTGKLFACEHADIQPDILCVGKALTGG
                     YMTLSATLTSKHVADTVCGGEAGCFMHGPTFMGNPLACAVATASLELIEQGQWQQQTK
                     QIESLFSELLPKLEEHDLVKNTRWLGAIGVVETHRPVNMETIQALFVEQGVWIRPFGR
                     LIYMMPPFISEPDHIEQLVNAIETALQRPECFV"
     gene            complement(255212..256519)
                     /locus_tag="AOT11_08275"
     CDS             complement(255212..256519)
                     /locus_tag="AOT11_08275"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7MSW8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine--tRNA ligase"
                     /protein_id="ASM95261.1"
                     /translation="MLDSKLLRTELHETAAKLARRGFKLDVETIGKLEEQRKSIQVEV
                     ENLQSTRNSISKQIGQLMSAGDKEGAEKIKQQIGSLGSDLDAKKLELDALMAQLDDII
                     LSVPNIPADEVPNGKDENDNLEISRWGEPKSYDFELKDHVDLGEMGDGLDFASAVKIT
                     GARFIVMKGQFARLHRAIAQFMLDLHTEEHGYTEMYVPYLVNADSLFGTGQLPKFGKD
                     LFHTEPLTEKASDEEPRKLSLIPTAEVPVTNLVRDTISDEADLPLKMTAHTPCFRSEA
                     GSYGRDTRGLIRMHQFDKVELVQITKPEDSMNALEELTGHAEKVLQLLELPYRKVLLC
                     TGDMGFGSHKTYDLEVWVPAQNTYREISSCSNMWDFQARRMQARFRRKGEKKPELVHT
                     LNGSGLAVGRTMVAILENNQEADGRIAIPTVLQKYMGGATHIG"
     gene            complement(256611..257960)
                     /locus_tag="AOT11_08280"
     CDS             complement(256611..257960)
                     /locus_tag="AOT11_08280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012127604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination factor protein RarA"
                     /protein_id="ASM95262.1"
                     /translation="MSNYTLDFSGDEDFRPLAARMRPETIEQYIGQQHILGPGKPLRR
                     ALEAGHIHSMILWGPPGTGKTTLAEVAANYANAEVERVSAVTSGVKEIRAAIEKAREN
                     KMAGRRTILFVDEVHRFNKSQQDAFLPHIEDGTVTFIGATTENPSFELNNALLSRARV
                     YKLTSLNKEEISLALNQAINDKQRGLGNTPAHFADNVLDRLAELVNGDARMSLNYLEL
                     LYDMAEDNAQGAKEITLKLLAEVAGEKVSRFDNKGDIWYDLISAVHKSIRGSNPDAAL
                     YWAARMISAGCDPLYIARRLLAIASEDVGNADPRAMQVALSAWDCFTRVGPAEGERAI
                     AQAIVYLACAPKSNAVYTAWKQALSDAHNLPEFEVPFHLRNAPTGLMKDLGYGEGYRY
                     AHDEPGAYAAGEQYLPAEIADRKYYQPTNRGLESKIAEKLDYLANLDANSPQKRYEK"
     gene            complement(257967..258563)
                     /locus_tag="AOT11_08285"
     CDS             complement(257967..258563)
                     /locus_tag="AOT11_08285"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MLV4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein carrier protein LolA"
                     /protein_id="ASM95263.1"
                     /translation="MKKWLVVFFLSASALANPQQELNQRLGMNDGFSANFNQTVTSPD
                     GEVVMEGEGSVDIARPSLFRWSTSLPDENLLVSDGKTLWYYSPFIEQVSIYWQEQAVQ
                     QTPFVLLTRNQSSDWENYQITQDGSVFTLVPKAADSTQGQFQIDIDEKGIVHGFNVIE
                     QDGQKGIFKFTDIKLGKPAAARFTFNVPEGVEVDDQRN"
     gene            complement(258636..261593)
                     /locus_tag="AOT11_08290"
     CDS             complement(258636..261593)
                     /locus_tag="AOT11_08290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="ASM95264.1"
                     /translation="MFKENAKKVQTIIKTSEEAQSSRLNGFQRLKECCLILGVLTSAF
                     LSIALITFSPADPSWSQTSWGGDISNAGGQFGAWVADTLLFTFGLLAYLLPVLLVIVT
                     WVFFRTRDEDERIDLMLWGTRLLGLVILILTSCGLADINFDDIWYFSSGGVLGDVLNS
                     LALPTLNLLGTTLVLLFAWGAGLTLLTGISWLSIVEWIGSLFLDVCQWALNRLRGEKT
                     EVIAPELQPMALSDDEPKAQPQIEAQQDEIVEEERIPDPLPMEPVVQIRREYPIHMPQ
                     TVSYQTVADELDELEDSSFERAKKLNATIEELEQEALSVNDLPDDAMSAERARYNVAD
                     IAQVSAEHSQTTQVEHAQDFSVDVEEFDHVISLSELDKISEEIDEPVMVGFAEEAPLH
                     RNEAQSVAIAESREPMFSHPGVESTTQHTTQEESVELPAADSVGDVNPEVEDYVEENE
                     EQDQDVTAFQNMVSKAQQNMAATQNPFLMKQDTTLPVPKEPLPTLELLYHPEKRENFI
                     DKEALEQVARLVESKLADYKITAEVVGIFPGPVITRFELDLAPGVKVSRISSLSMDLA
                     RSLSAIAVRVVEVIPGKPYVGLELPNMSRQTVYLSDVIDSPQFKNATSPTTVVLGQDI
                     AGEALVADLAKMPHVLVAGTTGSGKSVGVNVMILSMLYKASPEDVRFIMIDPKMLELS
                     VYEGIPHLLAEVVTDMKDASNALRWCVGEMERRYKLMSVMGVRNIKGFNEKLKMAADA
                     GHPIHDPFWQEGDSMDTEPPLLEKLPYIVVVVDEFADLMMVVGKKVEELIARLAQKAR
                     AAGIHLILATQRPSVDVITGLIKANIPTRVAFTVSTKTDSRTILDQGGAESLLGMGDM
                     LYLPPGSSHTIRVHGAFASDDDVHAVVNNWKARGKPNYIDEIISGDQGPESLLPGEQM
                     ESDEDLDPLFDQVVEHVVQSRRGSVSGVQRRFKIGYNRAARIVEQLEAQGIVSAPGHN
                     GNREVLAPAPPRE"
     gene            complement(261738..262232)
                     /locus_tag="AOT11_08295"
     CDS             complement(261738..262232)
                     /locus_tag="AOT11_08295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004734558.1"
                     /note="mediates a global response to leucine; acts as a
                     regulator for several genes involved in the high-affinity
                     branched-chain amino acid transport system; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine-responsive transcriptional regulator"
                     /protein_id="ASM95265.1"
                     /translation="MVDNYKKPSKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTP
                     CLERVRRLERQGYITGYTALLNPQYLDASLLVFVEITLNRGAPDVFEQFNAAVQKLDD
                     IQECHLVSGDFDYLLKTRVSDMGAYRKLLGDTLLRLPGVNDTRTYVVMEEVKQTNQLV
                     IKTR"
     gene            262388..263512
                     /locus_tag="AOT11_08300"
     CDS             262388..263512
                     /locus_tag="AOT11_08300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine dehydrogenase"
                     /protein_id="ASM95266.1"
                     /translation="MIIGVPKEIKNHEYRVGMIPASVRELISHGHQVFVETNAGAGIG
                     FSDDDYIAVGASILPTAADVFAKAEMIVKVKEPQAVERAMLKEGQILFTYLHLAPDFP
                     QTEELIKSKAVCIAYETVTDHMGRLPLLAPMSEVAGRMSIQAGAQTLEKSHGGRGLLL
                     GGVPGVEPAKVVVIGGGVVGANAARMAVGLRADVTILDRNVDTLRKLDEEFQGRAKVV
                     YSTEDAIEKHVLEADLVIGAVLIPGAAAPKLVTKEHIAKMKPGAAVVDVAIDQGGCFE
                     TSHATTHAEPTYIVDDVVHYCVANMPGAVARTSTFALNNATLPYIVKLANKGYREALT
                     ADKGFLLGLNVIHGKVTCKEVAESFNLEYVDPAEAIRMFN"
     gene            complement(263628..264830)
                     /locus_tag="AOT11_08305"
     CDS             complement(263628..264830)
                     /locus_tag="AOT11_08305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="ASM95267.1"
                     /translation="MQKQFQLLDEWLTEHQGFWRFEPFHQSLHEQLPWVDTHPDMCAW
                     LNSLSVQELSQYKLDPTSLITDLGRFIPDSKTVLANIALTPHSTTTIKLAERFDVGIP
                     GRKLKQIEAMGSYSLTRHQGSEWLEWCSGKGYLGRVLSSQTRQRVTSFEYQLPLCQSG
                     QSEADALNLPMHFVQGDALECESKQYFKPEQHAVALHACGDLHVRMMQYGCEKGVAAM
                     TIAPCCYHLIQSDAYQVLSSVAKLSRIRLSRSELRIPLQQTVTGGSRVQRHRQLEMTF
                     RLGLDLLLRQECAFKEYAPVPSIKKSQLSLGFEAFCRWAAELKEWSLPQVNFELYEAE
                     GAKRFWRMEMLSLVQQIFQRAIEMWLIYDKAMYLQEQGYQVSLSEFCDRDITPRNILI
                     HASDRKNT"
     gene            complement(264889..265863)
                     /gene="cysB"
                     /locus_tag="AOT11_08310"
     CDS             complement(264889..265863)
                     /gene="cysB"
                     /locus_tag="AOT11_08310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012127599.1"
                     /note="LysR-type transcriptional regulator; contains
                     helix-turn-helix (HTH) motif; in Escherichia coli this
                     protein regulates cysteine biosynthesis by controlling
                     expression of the cys regulon; autoregulates expression;
                     crystal structure of Klebsiella aerogenes showed tetramer
                     formation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ASM95268.1"
                     /translation="MKLQQLKYIVEVVNHNLNVSATAESLYTSQPGISKQVRLLEDEL
                     GIQIFERSGKHLTQVTRAGEDIVRISQEILARVESIKAVAGEHTHPEMGTLNISTTHT
                     QARYALPDVIKGFVKRYPKVSLHMHQGTPSQMSEAIAKGTANFAIATEALHLYQDAIM
                     LPCYHWNRSIVVPKEHPLAKKEKVTIQDLASYPLVTYVFGFTGRSELDTAFNRVGLTP
                     RVVFTATDADVIKTYVRMGIGVGVIASMAVDKEQDKDLVSIDASHLFGASTTSIGFRR
                     GTFLRSYMFDFMERFAPHLTRPVVEQAISLKSNAEIDEMFKDIVLPVR"
     gene            266200..266964
                     /locus_tag="AOT11_08315"
     CDS             266200..266964
                     /locus_tag="AOT11_08315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein"
                     /protein_id="ASM95269.1"
                     /translation="MNIGLIIALVAVLLVLVIGYNVMLQYKVKAETAKRQESARYVAV
                     IDATEELIGHAHHIPYSKDLLVCLNNRILDALENMAALDPKSKQLAQRVEAMKQQIEH
                     LKNNYQGGESTAFKVPNSDKQAIVMLKLVKRLRDTIRNEHNKGRFDTQAYVEENARLE
                     TMQIRINIENVIKRAHDSIARGQAGTAVQLLRKGIDVLSTKNDAYSVQAKEKLETMLN
                     EVDKKRSDKNAVELQQMEEKERNNDMDALFGDKKKW"
     gene            267036..267809
                     /locus_tag="AOT11_08320"
     CDS             267036..267809
                     /locus_tag="AOT11_08320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA hydroxylase"
                     /protein_id="ASM95270.1"
                     /translation="MISLEAYQDLLGPINHFLQCETPSEWVEEAKKPENLPTILIDHL
                     LCELKAGQSAMYLIRKYAVDKESSHTLLDWFKPYEDFAYRGIGSIETLKGKSNFSKAI
                     MAKSDSPYSQELIDKMVLLIKEELHHFYQVLEIMCSRGIEYENVTASRYAKGLLSHMK
                     THEPETLIDKLIVGGYIEARSCERFAKLAPHMDDDIAKFYVSLLRSEARHYQDYLTLA
                     EQIAGKDISERVAYFGQIEAQLICSKDNDFKFHSGVPTR"
     gene            complement(267880..271524)
                     /locus_tag="AOT11_08325"
     CDS             complement(267880..271524)
                     /locus_tag="AOT11_08325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ASM95271.1"
                     /translation="MHFKKVALASAITAILAGCGADDQAYDTLSKPENSFEKTNVKTD
                     QVYLYMPSMANAPKFAGSMAPFMQGQEKLVTLAFEASQDNSGSGELKVRMISPDVISQ
                     GEIDKGQLGRWINNPDDTSLVLSIPVDYVDYQCRENDYGECTNKEEKVDNNEVRWQDR
                     RFFEPSFDDVKVAEATWNQLFTFASGCYTKVGSPRVAANANTGWKGYEVTADGVINFE
                     VKQDYRIANNWRCMINSLSSNGFDMDKLSFTASQFYSLVPLDLVRSSSTEYEPVMYLK
                     GDEDTFGFFANEVGRPDPSYVDGQFDQKFSYLHRFNPSLEFIDYHLSDSFDQNEETRF
                     FKQVTKDVIDRINPQLEKVGVPKIRLHEPSGKLSGDLRYNVINLIDEPLDNGLAGYGP
                     SAVNPLTGEIVHAHVNQYSGVLRSISDWLWDRIAQDYNKGRVELVAKPDAGSTSNATN
                     STGESTTSNSVASITEASQSTEVVSLGDMVAFEQSPMANESMADVIAAVKEELEANDE
                     NVSFEDLSAIKELERRLWAENNMYPVSALRSGATLKSLPSSIGGMSFNFQDASLWSNG
                     QIGEVGSLKEWADLTEKQQEELSLFIVGVFYAKTLVHELGHNFGLRHNFKGSNDASNY
                     FKDHELAEHGLKVVPGYSSIMDYNPSLLNALPVFGPYDLAALRFGYKRQVEATETVVN
                     QADNTTSEQTVYLDAGQYDAQLREEILDPYKAPSDLLSDGTIKALVSENPAIPMRDFA
                     FCTDGNVSLNDDCNRHDEGRNRSEIMSYKLETYDDLYYKRTVRGMRENFSEGTMMSYT
                     VRRVQEFQDWRNALHVYDRYRELVFSSPLSHIQMQGLPKAQEAFCSDEANATRWPFAV
                     YCGAPLAVDKARDQLVNILITPDHTCEIEKADGSFTYKKLAEIMGNYSMRNNFPINFV
                     PTTCFDDTIKASLATGEKVVGEIGKFLNSGKAPRPAPVNNYSNYIDYIGHWPDKLAAS
                     VALVDRVGMRRSTDRSTTSLLELPETTGLANGFFQFYPKGDLLLDTLILGEEFLYLNF
                     KDEQGNYSRPKGDFTAITWNDKIETMPYYGSWSVRNYFALPRFEEVPLTKAILTAMVW
                     HSAGNMVDQRDEVLARKISMRSEPVGSMSDLRTFKRSNGTTYYATPENSYAWNMIAFT
                     NDIKALQEAEAASVDLTTVTLEAVVLADYQDAEKRAELLKKYAYQLKSLENLPVYNRT
                     SYLSDDLHAH"
     gene            complement(271554..272435)
                     /locus_tag="AOT11_08330"
     CDS             complement(271554..272435)
                     /locus_tag="AOT11_08330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95272.1"
                     /translation="MEVNNMQHTTKWKITPLAILLGALFSSSIYAEENSQTNGESNTE
                     STSEAQSSCIWCNVSGSASLAYDSNLYDTNDYRSVRNFSWNGTLNYKLSDKTGLYFST
                     GGYRALEDKVGTYATDSVFGASYSNIYEFGETGKIGLSGQLTIPTSEISQDTKLYTAI
                     RISTPIRFQMLGGNYSVTPRVRKNFYKYETMNGRVLTEWVYSISVGGSYSFDDLTIGA
                     SALGGNGMSYKGIRSRQFTYGASAYASYGITDNWSTSFTVSTAGFYSDAERGTLGNID
                     LFDTDKATYIAQLTFSF"
     gene            complement(272662..273480)
                     /locus_tag="AOT11_08335"
                     /pseudo
     CDS             complement(272662..273480)
                     /locus_tag="AOT11_08335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017018602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
     gene            complement(273528..274349)
                     /locus_tag="AOT11_08340"
                     /pseudo
     CDS             complement(273528..274349)
                     /locus_tag="AOT11_08340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012533920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
     gene            complement(274368..276209)
                     /locus_tag="AOT11_08345"
     CDS             complement(274368..276209)
                     /locus_tag="AOT11_08345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95273.1"
                     /translation="MQYTKVSLATLAALSAFSFQTFAQSLPSDLNWLTNKNEPLFASE
                     EAKRGGTLTTYMVSFPQTLRSVGPDANSGLRHYFMDGAPKLAQRHPNTGKWIPQLADS
                     WAFDADNKTVYFKLDKNAKWSDGEGVTADDYVFMMKYYQSKDIIDPWYNDFFTNSIKE
                     VVKYDDYTIAIKTATAQSDDALMVLINMPSNGVQPRPEHFFKGTKDDNKDGMPDNFVR
                     AFNFKAEPTTAAYYMENVEKGKRVTFKHVGEDWWGYSNRYYQNRYNVDKVRINVIRDQ
                     DIALKHFEKGSLDFFDMILPEYWHSKADSEGFEKGYIQKFWGYNQAPQGAGGLWMNTA
                     MPLLDDINVRKGIMLSTDYDGMITNIMRGDYSRKPHGLGFGHGQYDKPDNKAPEFDAE
                     KAIAYFEKAGFDKIGADGIRVNEKGQRLSFAITYGYQSWTPRIAFLKEQAKLAGLEFT
                     LNLVDGSSAFKYILEKKHQLAFLNMGSGEIPAYWEYLHSDNANKPQTNAHTNYSSPEL
                     DKLIEAYDAEFDQEKRFALSHQIQEYVADANIIVPGYMVPYTRAVHWRWLKTPQTAMT
                     KATENIFHPMDIGNFWIDKELKKETEKAMKSGKTFPKVAVVDDRYKM"
     gene            complement(276236..277279)
                     /locus_tag="AOT11_08350"
     CDS             complement(276236..277279)
                     /locus_tag="AOT11_08350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ASM95274.1"
                     /translation="MFTVSPLTQKKIKAFKNIKRGYWSFIVLATLLVLSLFAELLVNS
                     KALIVKYQGDWFFPVISDVRSGTDFGLDYASEADYRVLQKKFAQADEGNFVLMPIVPW
                     NPYEQDFSGDFPPTAPNAETKHYLGTDVIGRDILARLVYGFRTAMGFALVTMAISYAI
                     GTVVGCAMGFFGGKFDLFVQRLIEIWSMVPFLYVIMILVSITQPTFALFVAINVLFGW
                     MGMTWYMRTMTYKESAREYVMAAKALGASTMRILLHHILPNTMVMIVTLAPFTIAGNI
                     TALTALDYLGLGLMPPTPSWGELLQQGKSNLDSPWIVSSVVTSIVAVLVMVTFIGEAI
                     RAAFDPKKFTRYV"
     gene            complement(277279..278277)
                     /locus_tag="AOT11_08355"
     CDS             complement(277279..278277)
                     /locus_tag="AOT11_08355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014545089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95275.1"
                     /translation="MALIVPTFLGITILIFAITRFVPGGPVERMLASMHSGSDSATVS
                     VAGNNSALSEDQMAELNAFYGLDKPVVEAYWDWLTRLLVLDFGESTRYYEPVGTMIAE
                     RLPVSLFYGGMTFFISYFISIPLGYYKAIKHGSVFDSASSIMIFVGYALPGYVVGVFL
                     ITVFAYNLEWFPMGGFVGDDFDDYETFWLQFKDIMWHAVLPLICYLIGDFATLTMTMK
                     NSLMENLSSDYIRTAISKGLPFKKAVKKHALQNSLIPIASHFGNSLLFFMTGSFLIEV
                     IFNIDGIGLLGYESIIERDYPVVMGIVAINAVMLMVGNILSDLCVALTDPRVRFGA"
     gene            complement(278844..279542)
                     /locus_tag="AOT11_08360"
     CDS             complement(278844..279542)
                     /locus_tag="AOT11_08360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="ASM95276.1"
                     /translation="MIDQKVIVALDYDNKADALAFVDRIDPASCRLKVGKEMFTLFGP
                     DFVRELHKRGFSVFLDLKFHDIPNTCSKAVRAAAELGVWMVNVHASGGERMMTASREI
                     LEPYGKDRPLLIGVTVLTSMEQSDLVGIGLNVAPQDHVIRLATLTKNSGLDGVVCSAQ
                     ESSLLKNALGKEFKLVTPGIRPLGSEQGDQRRIMTPLEAVQAGSDYLVIGRPITQAVD
                     PAAVLQAINTSLTK"
     gene            complement(279627..280796)
                     /locus_tag="AOT11_08365"
     CDS             complement(279627..280796)
                     /locus_tag="AOT11_08365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95277.1"
                     /translation="MLELLFLLLPIAAAYGWYMGHRSAQDDKQKHSNQISQQYVTGLN
                     LLLSDQSDKAVDHFIELLQVDNDTIDTHLALGNLFRSRGEVDRAIRIHQNLISRSGLT
                     IEQKNIALQQLAKDYMVSGFLDRAEKIFEQLVEEPEHRDAALQQLVLIYQQTREWDKA
                     IHYAHLLVKTGKKSIRKNIAHYWCELAMLEQADGNKTKSISHFKKALQEDPKCVRASI
                     SLGRIYLEMEEYRKTIEYLEHVLEQDADFVSEALPILAECYHHLGQEDQLVEFLRACI
                     SKKAGVSAELMLAQLVAHHESVGAAQELLTRQLIKNPTMKGFYRLMDYHLAEAEDGRA
                     KESLTTLQAMVGEQLKIKPHYRCRKCGFSTHSLYWHCPSCKGWGTIKPIRGLDGE"
     gene            complement(280812..281078)
                     /locus_tag="AOT11_08370"
     CDS             complement(280812..281078)
                     /locus_tag="AOT11_08370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95278.1"
                     /translation="MKIIKIIAVIALFLIALALGSQNQEVVTFNYLLAKGDFHLSTLL
                     GGVFVAGFALAWAIFASLQFKMRLKIRKLNKQIKKQSTQVEKQA"
     gene            complement(281217..281498)
                     /gene="ihfB"
                     /locus_tag="AOT11_08375"
     CDS             complement(281217..281498)
                     /gene="ihfB"
                     /locus_tag="AOT11_08375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748547.1"
                     /note="This protein is one of the two subunits of
                     integration host factor, a specific DNA-binding protein
                     that functions in genetic recombination as well as in
                     transcriptional and translational control; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor subunit beta"
                     /protein_id="ASM95279.1"
                     /translation="MTKSELIERLCAEQTHLSAKEIEDAVKDILEHMASTLESGDRIE
                     IRGFGSFSLHFREPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNIG"
     gene            complement(281749..283419)
                     /gene="rpsA"
                     /locus_tag="AOT11_08380"
     CDS             complement(281749..283419)
                     /gene="rpsA"
                     /locus_tag="AOT11_08380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020327821.1"
                     /note="in Escherichia coli this protein is involved in
                     binding to the leader sequence of mRNAs and is itself
                     bound to the 30S subunit; autoregulates expression via a
                     C-terminal domain; in most gram negative organisms this
                     protein is composed of 6 repeats of the S1 domain while in
                     gram positive there are 4 repeats; the S1 nucleic
                     acid-binding domain is found associated with other
                     proteins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="ASM95280.1"
                     /translation="MTESFAQLFEEFLNETEFQQGTIVKGTVVAIENGYVLVDAGLKS
                     ESAIPAEQFKNAAGELEVEVGSEVDVALDAVEDGFGETQLSREKAKRHEAWIVLEKAY
                     EEAATVVGIINGKVKGGFTVELNGIRAFLPGSLVDVRPIRDTAHLENKELEFKVIKLD
                     QKRNNVVVSRRAVIESESTVERDELLETLQEGSEVKGIVKNLTDYGAFVDLGGVDGLL
                     HITDMAWKRVKHPSEIVNVGDEILVKVLKFDRDRTRVSLGLKQLGEDPWVAIAKRYPE
                     GHKLSGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDEVEVMVLE
                     IDEERRRISLGLKQCKANPWQSFAEAQAKGDKVTGKIKSITDFGIFIGLDGGIDGLVH
                     LSDISWNVAGEEAVREFKKGDEISAVVLAVDAERERISLGIKQMENDPFNAYVADNKK
                     GALVNGTVTAVDAKGATIELEDGVEGYIRASEVSRDRVEDATLILSVGDKVEAKFTGV
                     DRKNRVINLSIKAKDEAEEQEAMASINKADDAAFGNAMADAFKAAKGE"
     gene            complement(283529..284209)
                     /locus_tag="AOT11_08385"
     CDS             complement(283529..284209)
                     /locus_tag="AOT11_08385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="ASM95281.1"
                     /translation="MSSQTPVVTVDGPSGAGKGTLCMLLSKKLGFQLLDSGAIYRVLA
                     LAAIHHGVDTESEDALVPLATHLDVQFVAEGDLVKVILEGEDVSKELRKEETGMAASK
                     VAALPRVREALLRRQRAFEAAPGLVADGRDMGTVVFPNAKAKIFLDASAEERAHRRLK
                     QLQDKGLDVRFDDLLSEIQERDDRDRNRPVAPLRPAEDALVLDSTSMSIDEVVEKALQ
                     YIESKLAE"
     gene            complement(284402..285463)
                     /locus_tag="AOT11_08390"
     CDS             complement(284402..285463)
                     /locus_tag="AOT11_08390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005533592.1"
                     /note="multicopy suppressor of htrA(degP); Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="ASM95282.1"
                     /translation="MEFLLDYGLFLAKVVTFIVAVVVLLILAKSVSGKSSAIKGELEI
                     TDLSELHKSNVEHLEHYLHDEAYLKARHKAERKEEKEKDKLREKEIKKAAKEGKLDHK
                     REPHLFVLDFNGSIDAKEVKSLREEITAILAVAGEGDEVLLRLESGGGMVHGYGLASS
                     QLDRIKAARLPLTIAVDKVAASGGYMMACVADKIVSAPFAIVGSIGVIAQIPNFNKLL
                     KKHDIEFEQMTAGEYKRTLTMFGENTDKAREKFKQELEETHDLFKDFIRERRPELELE
                     KVATGEHWFGTQAHALGLVDEIATSDDLIVAACKEKTVLAVHYVQKKKLADKLAGSAA
                     QVADSVILKLAERGQKPIV"
     gene            285594..286337
                     /locus_tag="AOT11_08395"
     CDS             285594..286337
                     /locus_tag="AOT11_08395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="ASM95283.1"
                     /translation="MDYSISTDALKDKVILVTGAGAGIGRQAALTYAKHGATVILLGR
                     NVKNLESVYDEIEASGYPQAAIIPLDLKGATKQNYIDMAETIEGQFGRLDGLLHNAGV
                     LGTLSPFDQISEEDFDDILQINVKSEFLMTQALLPLLRKAQAGRIIFTSSTVGHSGRA
                     FWGTYAISKFAVEGMMQILADEFSNSPIRVNAINPGATRTRMREKAYPGEDANTLKTP
                     ADLMPLYLHLMDPATTDVNGQCIDAQPKR"
     gene            286466..287149
                     /locus_tag="AOT11_08400"
     CDS             286466..287149
                     /locus_tag="AOT11_08400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="ASM95284.1"
                     /translation="MQNIIQTLKNQQLIWHANSTRCANESRYQTSGIDELDKLLGGGF
                     PQHGVVEMESALGIGELRLLANYLKQQQDLIVLIHPPAVLNAAFWRNMDFPLANCLVI
                     HSVSTKEALWATEQCLKSGVCRTVILWQDEMEIHQVKRLQVASEQGGCVLFIFRPYQS
                     HRLSLPLSLSLRLSPTEHGIHVELLKRRGGWGQGAVDIDYHRQYPQLTLASQIPNHTV
                     IPFPAVMQG"
     gene            287152..288549
                     /locus_tag="AOT11_08405"
     CDS             287152..288549
                     /locus_tag="AOT11_08405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="ASM95285.1"
                     /translation="MHLWLYLSFPRLQTDSMLATQHPLAVVHPQSHQVVQINDLASDV
                     GLAVGMGLASAATLCSQLQVIVYDEKLEHRKLKEIAQWLYFMTADLVLDPPSGIWVRV
                     SHMLNLYQGLDNYWHTLSEHLATLAVSYHASTGFSPLSAKLLAKAGHPIISDNQTDLL
                     TKVKKHPLTFSELKATTIEKLQRIGIHTFDALLTLPLQELARRFDIELVNYIGKLTGQ
                     LKHPVDFYHPPSRFKQELELLFELDNVQWLEKPLEKLFRQLESYLTIRNKTAHELQLT
                     LFQRNDLSEAISLHSAQGEYRSQQWRKLSALTLESTVLQAPVTRLQLEVIREGEPNAH
                     PTDLFSHRTGQLSRLELYSLLQAKLGADSIATLSLNHDPRPEKATRYQSTLTEAPSEE
                     IECQLLRPSFLLPAPAPLQHHVSLIHGPERIVSGWWDGDEIMRDYFIARTDQGQWLWV
                     FRDQKKQWFLHGLFC"
     gene            288565..291639
                     /locus_tag="AOT11_08410"
     CDS             288565..291639
                     /locus_tag="AOT11_08410"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8I6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="ASM95286.1"
                     /translation="MFYAELFCQSNFSFLTGASHPEELIVQANFLGYHSLAITDECSL
                     AGIVRAHSAIKQHQLSVKQIVGSFFKLNTECQFVLLCPNREAYAELCRIITNARRRCE
                     KGQYQLSQWDIMSIKHCLLIWLPTGQTSDEQWATWLSRYQQSRLWLGLQRHLRHDDEH
                     YLHHCQTLANQFDLPITACGGVLMHRPERLPLQHTLTAIRQGCTVEQLGTQLLTNAEQ
                     SLRSEKKLRKLFKPQWLAESLYIASLCSFDLDSLRYEYPSELIPDGYTPNSYLEHLVE
                     QGKKQRFPEGVPNAIEQTIQKELALIKEQKYPFFFLTIHDIVMFAKQQGILYQGRGSA
                     ANSVVCYCLQITSVDPRQIAVLFERFISKERDEPPDIDVDFEHERREEVIQYIYQKYG
                     RQRAALAATVISYRFKSAVRQVGKALGIEETQLDFFLKNINRRDRQAGWQVQLVELGL
                     RPDSLKGQHFIQLVEEIIGFPRHLSQHVGGFVISSGPLYELVPVENAAMPERTIIQWD
                     KDDLESLKLLKVDVLSLGMLTAIRKCFRSIEQHHQQRLSIADITRRQDDQAVYKMIQK
                     ADTIGVFQIESRAQMSMLPRLKPACYYDLVIQIAIVRPGPIQGDMVHPFLKRRDGEEP
                     ISYPSVHVQEVLERTLGVPIFQEQVIKLAMVAAGFSGGEADQLRRAMAAWKKNGHVFK
                     FKTKLINGMLERGYELDFAERIFEQICGFGEYGFPESHSASFAVLAYCSAWLKHYYPA
                     EFYTALLNSQPMGFYSPSQLVQDAKRHGIAVLPICVNLSNAEHQLVTLASGELAIRLG
                     FNLIKGLSHEGITRLLTHRPAQGYQCISEVKQILRQAKDIQSLASANAFYQLADNRYL
                     ARWQVMDNLNELPLFQTLPSISNNPLTKPSDYQNALEDYAATGLSLAEHPVALLEKAG
                     GLTRFTRANQLNQCSHRSLVTVIGLVTGKQSPGTAAGVTFFTLEDDTGNINVVVWQAT
                     SRAQKQAYLTARLLMVKGILEREGDVIHVIAGRLIDLTEKLSGLSPKSREFH"
     gene            complement(291700..292641)
                     /locus_tag="AOT11_08415"
     CDS             complement(291700..292641)
                     /locus_tag="AOT11_08415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="ASM95287.1"
                     /translation="MSGVLNTVDQRTNLVGENRLELLLFSLNSRQLFAINVFKVREVL
                     KVPPLTKLPGAHANIRGVASLRGEPVPVIDLRRSIGFPASKLEGQEENLIITEYNRSI
                     QGFLVGQVRNIINTAWTEIQPPPKTSGRSNYLTAITHVKEGKESKIVEIIDVEKVLAE
                     IIDYDVTISEGILDSKLSNEMVGRKVLVVDDSSTARNQIRDTLSQLGLHIIECCDGLE
                     ALNLLKSWCDEGKDLNKELLLMITDAEMPEMDGYKLTHEVRSDPRMSKLFITLNTSLS
                     GSFNEAMVQKVGCDRFISKFQPDLLVQVTQDRLREII"
     gene            complement(292824..294041)
                     /locus_tag="AOT11_08420"
     CDS             complement(292824..294041)
                     /locus_tag="AOT11_08420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080805.1"
                     /note="mlc, controls the expression of genes involved in
                     the phosphotransferase and phosphoenolpyruvate systems,
                     regulates genes involved in the uptake of sugars; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM95288.1"
                     /translation="MYMAQPGHIDHIKQVNAGRVYKLIDLKGPISRIDLSKESELAPA
                     SITKITRELIEAHLVHETTVQEAISRGRPAVGLQVNNAGWQFLSMRLGRGYLTIALHE
                     LGGEVLIDTKIDIHERDQDDVLARLLHEIEEFFQTYADQLDRVTSIAITLPGLVNSEQ
                     GIVLQMPHYNVENLALGPEIYKATGLPVFIANDTRAWALAEKLFGHSQGNENSVLISI
                     HHGLGAGIILDGRVLQGRHGNIGELGHIQIDPQGKLCHCGNRGCLETVASSKAIREEV
                     MERIANGESSILEELEDVTIESICEAAANGDALAVDVIEKLGRYLGSAIAIVINLFNP
                     EKVLIGGVINQAKEVLYPAIRRCIEEQSLPVYHQDLELVESRFYKQATMPGAALIKQA
                     LYDGLLLMKVVEG"
     gene            294311..295759
                     /locus_tag="AOT11_08425"
     CDS             294311..295759
                     /locus_tag="AOT11_08425"
                     /EC_number="2.7.1.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572062.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     pyruvate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="ASM95289.1"
                     /translation="MTQPLRRTKIVTTLGPSTDKDNVLEEIIRAGANVVRMNFSHGSA
                     EDHKTRAEKVRNIAARLGRQVAILGDLQGPKIRVSTFKEGKIFLSVGDLFTLDSDLPK
                     GEGDQKSVGLDYKALPQDVGPEDILLLDDGRVQLQVLTVDGNKVNTRVIVGGPLSNNK
                     GINKKGGGLSADALTEKDKQDILLAAEIKVDYLAISFPRNGADMDYARRLARDASLEA
                     KLVAKVERAETVRNDENIDDIIMASDVIMVARGDLGVEIGDPELIGVQKKLIKRAKEL
                     NRVVITATQMMESMIENPMPTRAEVMDVANAVLDGTDAVMLSGETAAGKYPVETVRSM
                     AEVCIGAEKTWEPGSQNYRIDKSFVTAEETIAMSTIYAANHMEGVKAMVTLTESGRTA
                     LMTSRLNSTLPIFALSPNERTLNRCSLYRGVTPVFFDTKVETGFDVAMAALSTLRKKK
                     LLDFGDLVIITQGDIMDVEGSTNCMRILPVFD"
     gene            complement(295792..296970)
                     /locus_tag="AOT11_08430"
     CDS             complement(295792..296970)
                     /locus_tag="AOT11_08430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="ASM95290.1"
                     /translation="MAINSGIVTNSYTNLDIERYAKYQQGKTSLVAQGGGQRGIFTAG
                     VLDAFILSDFDPFHEFYGTSAGALNLCAYLCRQHGLGKAFILDLTTDSEFFNLFGYIR
                     QKQYLGLEWALDKIRSYPYKLDLDLGETILGERQAYASVTETSTLTDRYLPMFGPIWH
                     DTMLATCAIPKLYAKPVMINGTEYVDGGVSASVPVQEPWRRNARSIVVIRTEPFSATE
                     NTAPLNLNEMKPREADWFRNSFGNVQLKWQDRVSRWREDWSLFFQQQIADSQATPDHK
                     FRLLNGGRWLFGADNIYRLSHLIGDNFDSGLADMLMVHYQTYSLTRDFLAKPPDDTFI
                     IQITPDAPLRSSSLLSGRDELLFDYDCGVQAGYRFIKQYQLVKQQRMLSRLNQTNDNR
                     "
     gene            297204..297797
                     /locus_tag="AOT11_08435"
     CDS             297204..297797
                     /locus_tag="AOT11_08435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95291.1"
                     /translation="MLKHLSLLSCTLLLMFAPLASANKLIVTPFVGYTFGGAVEDENQ
                     NTFDLNAAPNYAIAIETPLDKGRVGLFYSYQSSEVDVIKQDYGFHYLYFQSSIYYPTD
                     SGLSSYLGMGLGASYADVDWADDKVGFSTSIFGGIEYPITSNLLISAQIRWLGTVVDN
                     DSSAACVVPTTGQNCVIQFETDWVNQFQSNLGLTFKF"
     gene            298252..299712
                     /locus_tag="AOT11_08440"
     CDS             298252..299712
                     /locus_tag="AOT11_08440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006959272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="ASM95292.1"
                     /translation="MKREQWGSRAGFILAAVGSAIGLGNIWRFPYMAYENGGGAFFIP
                     YLFAMITAGIPFMILEFSMGQKYRGSAPATLGKIHPKFEWLGWFQVGVAAVIAVYYVA
                     VIGWAISYFGMSFTQSWGSDTNAFFFSEYLALGDNSPTNLGSIQWKIALAMLIAWGIT
                     YAAIVGGVKSGIERASKIMMPILFIMVLLLIGRMIFLPGALDGVNYMFEPDFSKIWDV
                     KVWAAAYGQIFFTLSIGFAIMLAYSSYLPEKSDITNNAFMTVLINCGFSILAGIMIFS
                     VLGYMAQEQGKPITEVVSAGVGLAFVTIPAAINLLPAPYILGPLFFLALVVAGLSSHI
                     SIMEAVTSALIDKLNWSRKKAATIVIGSGLVVSMAFATNGGLLLLDLVDHFANNVGIM
                     AGGLVEIILMAWLLNKVADVREYVNKISDFTIGTWFDVCLKFITPAVLAVILATKLMT
                     LFTEGYGGYDLTLGWAIIAALFVMGFVINATNRKEA"
     gene            complement(299878..300279)
                     /locus_tag="AOT11_08445"
     CDS             complement(299878..300279)
                     /locus_tag="AOT11_08445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95293.1"
                     /translation="MKKWLVASLCLFPFATLAAEQKTDLAVGMAVDQQLSVVIELNQQ
                     YRGVIGNDGLALDYLAKKGTFNQDIPVTWYVGVGGWAEWNDDFGFRVPLGLNWDLTHG
                     WDLYGQIQPELSLYKGAELQLGGAVGIKYQF"
     gene            complement(300661..302091)
                     /locus_tag="AOT11_08450"
     CDS             complement(300661..302091)
                     /locus_tag="AOT11_08450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004746563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS glucose transporter subunit IIBC"
                     /protein_id="ASM95294.1"
                     /translation="MFKNLFANLQKVGKALMLPVSVLPVAGILLGVGAADLSFIPDIV
                     SNLMEQAGGSVFGQMALLFAVGVALGFTNNDGVAGLAAIVGYGIMTATLAVMAGVMGV
                     EKIDTGVLGGILVGGVAAWAFNRFFKIQLPEYLGFFAGKRAVPIITGFTAIALGILLS
                     IVWPPIGGAIASFSDWAAHQNPQVAFGIYGIVERSLIPFGLHHVWNVPFFFEAGSCVN
                     AAGEAQNGVLTCYLVADEASRAAGNGFGQLAGGYMFKMFGLPAAAIAIAHCAKPENRA
                     KVMGIMASAALTSFLTGITEPIEFSFLFVAPVLYGIHALLAGSAYVVANTLGFVHGTS
                     FSHGLIDFLVLSGNAQKMGLMIGVGLVYAAIYYVVFRFVIQAMDLKTPGREDETEEAT
                     ATSGSDLAGELVAAFGGKANITGLDACITRLRVAVADTAAVDQDKLKKLGAAGVVVVA
                     GGVQAIFGTKSDNLKTEMDEWIRNHG"
     gene            complement(302535..303302)
                     /locus_tag="AOT11_08455"
     CDS             complement(302535..303302)
                     /locus_tag="AOT11_08455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNAse"
                     /protein_id="ASM95295.1"
                     /translation="MFVDSHCHLDKLNYDDLHIDVADVINKAKQVNVEQLLSVGVTLD
                     SFPKMLELIEPFDNVHASCGVHPLDVESPFCLDKMKAYASHSKVVAIGETGLDYHYKP
                     ETQALQRERFEQQVALAVELNKPLIIHTRQAREDTLAILRNGGADKCGGVIHCFTEDL
                     AFAEAAMALGFYISISGIVTFRQATELKEVVKHIPLERLLIETDSPYLAPVPHRGKEN
                     QPAYVIEVAAYIAQLKNISLASVGEKTTQNFKNLFLR"
     gene            complement(303293..304249)
                     /locus_tag="AOT11_08460"
     CDS             complement(303293..304249)
                     /locus_tag="AOT11_08460"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422304.1"
                     /note="catalyzes the DNA-template-directed extension of
                     the 3'-end of a DNA strand; the delta' subunit seems to
                     interact with the gamma subunit to transfer the beta
                     subunit on the DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="ASM95296.1"
                     /translation="MTHYPWLASTWQGLQSAMSAQRLPGAILLQSDVELGVDELIEKF
                     SAALLCKTYPDEGCGFCHSCELLKSQNHPDLHFIRPEKEGKAITVEQIRQCNRQAQES
                     SQMGGYRLFVIESAEAMNESASNALLKTLEEPSGSCLFLLICHDKKRLLPTIISRCQQ
                     WSITPPEVSESMQWLQQQGISVNESFLKLAHYSPVTAMHMAKESEFQHYEKLERQFVD
                     FLIQADSDYVSLCQTIQAATLRNLSWLWLLLSDAQKVHFGLQNEETLQGSQALGQLPL
                     SGLQTSMVKLNQLNQQLHQFSGLNEELMIINWLIETREALCL"
     gene            complement(304254..304892)
                     /locus_tag="AOT11_08465"
     CDS             complement(304254..304892)
                     /locus_tag="AOT11_08465"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8H5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="ASM95297.1"
                     /translation="MKQAKFIVIEGLEGAGKSTAIQTVLDTLRQAGINEIAQTREPGG
                     TPLAEKMRALVKEDHPGEHLHDMTELLLLYAARVQLVENVIKPALHEGKWVVGDRHDL
                     SSQAYQGGGRQIDATLMKNLRDTALGEFKPAFTLYMDIDPKVGLERARGRGELDRIEK
                     MDISFFERTRQRYLELAKSDASIVTINAEQSIEQVANDIRSALNLWLEQLQD"
     gene            complement(304889..305905)
                     /locus_tag="AOT11_08470"
     CDS             complement(304889..305905)
                     /locus_tag="AOT11_08470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="ASM95298.1"
                     /translation="MIKKIIGLLFIAALMIGVAAVWAYSQTKTYVNQPLKIEGSEIIT
                     IPSGSGFGRTLAILTEKGWIDEPTPLARLIPKLYPEITRIKAGTYQIQSEMSLYQALE
                     VFNLGKEHQFTITFVEGSRFQEWMVQMAQDPYLVHELAGLSEEEIAKRLEIPYEKLEG
                     LFLAETYHYTYGTSDVELLKRAHEKLNRVLDKHWQQRQEKLPLDNSYEALILASIIEK
                     ETAIDEERERVASVFVNRLNKRMRLQTDPTVIYGMGEAYDGNIRKKDLRTPTPYNTYV
                     INGLPPTPIAMAGEASIAAALNPENSSYLYFVASGKGGHVFSKTLAEHNRAVRAYLRE
                     LKKR"
     gene            complement(305902..306705)
                     /locus_tag="AOT11_08475"
     CDS             complement(305902..306705)
                     /locus_tag="AOT11_08475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-amino-4-deoxychorismate lyase"
                     /protein_id="ASM95299.1"
                     /translation="MYWVNGVVATEVSLSDRSFQYGDGCFTTMKTLNGQIEHWPLHIE
                     RMEACLQVLSIPLPDWALVEQWLHQAALPDARGGLKLHISRGEGGRGYSPSGVATPNV
                     TISCFSYPVHYSQWQQHGVELGVCQTPLGLNPILAGHKHNNRLEQVLCKAELDALGYQ
                     DGVTFNVQNHVIETTIANLFWVKNGVLFTPDLTLSGVSGVMRRLVMGEAQRRAIACQE
                     IKADLSSLLEAEEVFMTNSLLGVAPINQILETRYPIGTTTRYFQGIFNS"
     gene            complement(306791..308032)
                     /locus_tag="AOT11_08480"
     CDS             complement(306791..308032)
                     /locus_tag="AOT11_08480"
                     /EC_number="2.3.1.179"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P55338.2"
                     /note="FabF; beta-ketoacyl-ACP synthase II, KASII;
                     catalyzes a condensation reaction in fatty acid
                     biosynthesis: addition of an acyl acceptor of two carbons
                     from malonyl-ACP; required for the elongation of
                     short-chain unsaturated acyl-ACP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="ASM95300.1"
                     /translation="MSKRRVVVTGMGMLSPVGNTVAESWKSLLEGKSGIVNIDHFDAT
                     NFSTRFAGLVKDFNCEEYMSKKDARKMDLFIQYGIAAGIQALDDSGLEITDENAHRVG
                     VAIGSGIGGLDLIEAGHTALVEKGPRKVSPFFVPSTIVNMVAGNLSIMRGMRGPNIAI
                     STACTTGLHNIGHAARMIAYGDADAMVAGGAEKASTPLGMAGFGAAKALSTRNDEPQK
                     ASRPWDKDRDGFVLGDGAGIMVLEEYEHAKARGAKIYAELVGFGMSGDAYHMTSPSED
                     GSGGALAMEAAMRDAGIVGTQVGYVNAHGTSTPAGDVAEIKGVKRALGEEGAKQVKVS
                     STKSMTGHLLGAAGSVEAIITVLSLVDQIVPPTINLDNPEEGLDIDLVPHTAKKVDME
                     YAICNSFGFGGTNGSLVFKKI"
     gene            complement(308124..308360)
                     /locus_tag="AOT11_08485"
     CDS             complement(308124..308360)
                     /locus_tag="AOT11_08485"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8G9.3"
                     /note="carries the fatty acid chain in fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="ASM95301.1"
                     /translation="MSNLEERVKKIIVEQLGVDESEVKNEASFVDDLGADSLDTVELV
                     MALEEEFDTEIPDEEAEKITTVQAAIDYVTANAQ"
     gene            complement(308526..309272)
                     /gene="fabG"
                     /locus_tag="AOT11_08490"
     CDS             complement(308526..309272)
                     /gene="fabG"
                     /locus_tag="AOT11_08490"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080819.1"
                     /note="catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="ASM95302.1"
                     /translation="MTDLLNLSGKVALVTGASRGIGRAIAETLVARGATVIGTATSEN
                     GAAAISEYLGENGKGFALNVTDAESVESVLKAINDEFGAVDILINNAGITRDNLLMRM
                     KDDEWNDIMDTNLTSIFRLSKAVMRGMMKKRDGRIINVGSVVGTMGNAGQANYAAAKA
                     GVIGFTKSLAREVASRGVTVNTVAPGFIETDMTRALNDEQRATTLANVPAGRLGDPRE
                     IAEAVVFLASPAAAYITGETLHVNGGMYMV"
     gene            complement(309285..310208)
                     /locus_tag="AOT11_08495"
     CDS             complement(309285..310208)
                     /locus_tag="AOT11_08495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008080199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl CoA-ACP transacylase"
                     /protein_id="ASM95303.1"
                     /translation="MSKFAIVFPGQGSQAVGMLADLGEQYEIVKQTFAQASEALGYDL
                     WALVQNGPAEDLNQTFRTQPALLASSVAIWRVWQELGLAQPDNLAGHSLGEYSALVCA
                     GVIDFQEAIKLVELRGQLMQEAVPAGTGAMYAIIGLDDEAIAKACEEAAQGDVVSPVN
                     FNSPGQVVIAGSKDAVERAGALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALES
                     IEFKAPQLPVINNVDVVAETDPAKIKDALVRQLYSPVRWTESVELMSSQGVEKLLEMG
                     PGKVLTGLTKRIVKSLEAVAVNDVASLDAVK"
     gene            complement(310284..311234)
                     /locus_tag="AOT11_08500"
     CDS             complement(310284..311234)
                     /locus_tag="AOT11_08500"
                     /EC_number="2.3.1.180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422310.1"
                     /note="FabH; beta-ketoacyl-acyl carrier protein synthase
                     III; catalyzes the condensation of acetyl-CoA with
                     malonyl-ACP to initiate cycles of fatty acid elongation;
                     differs from 3-oxoacyl-(acyl carrier protein) synthase I
                     and II in that it utilizes CoA thioesters as primers
                     rather than acyl-ACPs; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="ASM95304.1"
                     /translation="MYSKILGTGSYLPSQIRTNADLEKMVETSDEWIVARTGIKERRI
                     AAENETVADMGFYAAQNAIEMSGIDKDDIDLIIVATTSGSHTFPSSACQVQAKLGIKG
                     CPAFDLAAACSGFVYALSIADQHIKTGMCKNVLVIGSDTLSKTCDPTDRSTIILFGDG
                     AGAVVVGASEEPGILSTHIYADGEFGDLLSLEVPERGKDADKWLHMAGNEVFKVAVTQ
                     LSKLVKDTLAANNMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSA
                     ATVPTALDEAVRDGRIQRGQTLLLEAFGGGFTWGSALVRF"
     gene            complement(311240..312265)
                     /locus_tag="AOT11_08505"
     CDS             complement(311240..312265)
                     /locus_tag="AOT11_08505"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8G5.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acyltransferase"
                     /protein_id="ASM95305.1"
                     /translation="MQSITVALDAMGGDFGPRVTVPAAVQALSHFPELKVILTGDQQQ
                     ITSQLSLLGYKPDARLSVQHCDRMISNSEKPSLALRNSQGSSMRHAIELVADSTADAC
                     VSGGNTGALMALSRFILKLLPGIDRPALISALPTVTGGRSWMLDLGANVSCDADTLFQ
                     FAVMGSALAEEHLNRAPRVAVLNVGEEETKGNDLVKRCAELLSQTQAVHFVGYIEGNQ
                     ILKNAADVIVCDGFVGNVCLKASEGTAQLFIEKIKTSMMASSIKGWIARILFSELFNE
                     LKTLNPDQYNGASLLGLRGIVIKSHGSADVSALVNAIGEAVHEVKRQVPSRISDRLEA
                     VLLERHY"
     gene            complement(312276..312446)
                     /gene="rpmF"
                     /locus_tag="AOT11_08510"
     CDS             complement(312276..312446)
                     /gene="rpmF"
                     /locus_tag="AOT11_08510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014204674.1"
                     /note="some L32 proteins have zinc finger motifs
                     consisting of CXXC while others do not; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="ASM95306.1"
                     /translation="MAVQQNRKTRSKRGMRRSHDALTTAALSVDATSGETHLRHNVTA
                     EGYYRGKKVINK"
     gene            complement(312482..313006)
                     /locus_tag="AOT11_08515"
     CDS             complement(312482..313006)
                     /locus_tag="AOT11_08515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L32p"
                     /protein_id="ASM95307.1"
                     /translation="MQKVKIPRTVDPAKAAQKRLDYDGIIQASLFKRLAEMTEGVKRD
                     AEVYLSFEIDEQRLVVISGKANIEVGLECQRCNETFTHLCEVEFTYTPYYSEKSEQDA
                     PECYDLVDLNEYGEVDLIQLVEDEFILELPQIAMHDEADCSVDSNNMVFGEIPEEIEE
                     TKPNPFDVLKSLKR"
     gene            313156..313740
                     /locus_tag="AOT11_08520"
     CDS             313156..313740
                     /locus_tag="AOT11_08520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422311.1"
                     /note="Maf; overexpression in Bacillus subtilis inhibits
                     septation in the dividing cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor Maf"
                     /protein_id="ASM95308.1"
                     /translation="MENYQLVLASTSPFRQQLLEKLAIPFSTLSPNCDETPLEGESPQ
                     QLVLRLAESKAQSCQINQPSLVIGSDQVCVIDGNIVGKPHSRQNAIAQLTAQSGQSIV
                     FYTGLAVYNSETGETRSCIDEFKVHFRPLTQAQIERYVDKEQPFFCAGSFKSEGLGIA
                     LFEKLEGKDPNTLVGLPLIDLIDLLAQQGMHILG"
     gene            complement(313780..314727)
                     /locus_tag="AOT11_08525"
     CDS             complement(313780..314727)
                     /locus_tag="AOT11_08525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="ASM95309.1"
                     /translation="MNEIRTKVQIVDIDEDMAGQRIDNFLRNQLKDVPKSMIYRIVRK
                     GEVRVNKKRVKAEYKLAAGDVVRIPPVTVEKKDPETAPSTKLNKVAELQDLIIYEDDH
                     LLVLNKPSGTAVHGGSGLKFGAIEALRALRPEARFLELVHRIDRDTSGILLVAKKRSA
                     LRHLQAQFREKTVQKYYFALVMGEWKNSCKVVNAPLLKNEVNSIVRVNPNGKPSETRF
                     KVIEKFEQATLLQASPITGRTHQIRVHTQYSGHPIAWDDRYGDRRFDAYTAQHGLNRL
                     FLHAANIRFTHPATEQPMEINAPMGEQLEKVVQSLRTSR"
     gene            315385..318498
                     /locus_tag="AOT11_08530"
     CDS             315385..318498
                     /locus_tag="AOT11_08530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="ASM95310.1"
                     /translation="MKRMLINATQKEELRVALVDGQRLYDLDIESPGHESKKANIYKG
                     RITRVEPSLEAAFVDYGAERHGFLPLKEIAKEYFPDGYSYQGRPSIKEVLTEGQEVIV
                     QIEKEERGSKGAALTTFISLAGSYLVLMPNNPRAGGISRRIEGDERTELKSALSTLEL
                     PQGMGLIVRTAGVGKSAEELEWDLNVLLKHWAAIKDASESNPAPFLIHQESNVIVRAI
                     RDYLRRDIGEILIDSNTIYERAKEHIQLVRPDFVNRVKKYDGEVPLFSHYQIESQIES
                     AFQREVRLPSGGSIVIDPTEALTSIDINSARATKGGDIEETALNTNLEAADEIARQLR
                     LRDLGGLVVIDFIDMTPVRHQREVENRLREAVRLDRARVQIGRISRFGLLEMSRQRLS
                     PSLAEASHHICPRCSGTGVVRDNESLALSVLRLIEEEALKDNTAQVLAVVPVPIASYL
                     LNEKRRSVNHIERIQEVKITVVPNSDMETPHFEVIRVREGEEVDLLSYLLPKKLEAMK
                     EAEGKESPETEYKPKKIEEPVLKGFASPAQSVPAPTPAPKAVVAKVANEKPQAEEKPG
                     LFGRLIKALGSFLFGSAEEKAEAEKTERKDDREKGNRRQKRDRNDRRRNNRDNRDNNR
                     DRDGKRRQRNRDENVVETQDEAIKPRSQQKRKQRPAQNKADNAVESKANAKVAEKGLQ
                     LAAEAQGASKQEGQKTPSKAEKVKERRQRRKLNKPVRVKDQLEQAEETLMDVAPVVEA
                     EVFNKQNTPVSEKSEKVVADSVDAMDNNENEEKPRRNRRSPRHLRASGQRRRRGRDRR
                     PNPFRLRKGGVASPEMAMGKVMPRYIPKPVAKKEEAVKEEVVTAVAAVPAMQGGVACP
                     EMAMGKVIISRDITAAQAPTETKPKRSKSRHNRPAKAAVVEVVTEEPMVENAAVAPIQ
                     ETEIQKIEPQVESASQPVEQVSIETTEVVAEIVETTEVVAEVESATETVANETEATVA
                     VVGSSIKVIKAQASAPMTKAPGPQELIEIQVVAAPFKAERYSQRGAGSQVATSQASAA
                     MTKPEMV"
     gene            318759..320318
                     /locus_tag="AOT11_08535"
     CDS             318759..320318
                     /locus_tag="AOT11_08535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate permease"
                     /protein_id="ASM95311.1"
                     /translation="MFEFPQFSKHSVKNDVLSGLTVALALVPEAVAFAFVAGVDPMVG
                     LYAAFIVGLVTSIFGGRPGMISGATGAMAVVMVSLVSSHGVQYLFAAIMLAGILQIAA
                     GLFKLGKFIRIVPHPVMIGFVNGLAIVIFLAQLGQFKMADAAGGLTWLPQDQMLLMLG
                     LVALTMAIIHFLPKLTTAVPSSLVAIVTVTGLVIGFDLETRTVVDFLRTMSGDEGATL
                     AGSLPTFALPMVPFNLETLQIIFPYAVILAAIGLIESLLTLTVLDEMTNTRGQSNREC
                     IGQGMANMTCSVFGAMGGCAMIGQSMINVNSGGRGRLSGIVAAVALLMFILFAAALIE
                     MIPLAALVGVMFMVVIGTFEWATFKLARRVPKQDFFVIVLVTVVTVMTDLAVAVAVGV
                     IASALMFAWNHAKHIYADTRMNEEGSKEYRIHGPIFFGSTANFLELFNAQQDPSDVIV
                     DFADSRVTDHSAIEAIETLAERYSAVGKTLHLRHLSPDCRKLLDKAGSLVEINVKEDP
                     SYKVATDVLAG"
     gene            complement(320365..320823)
                     /locus_tag="AOT11_08540"
     CDS             complement(320365..320823)
                     /locus_tag="AOT11_08540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein tyrosine phosphatase"
                     /protein_id="ASM95312.1"
                     /translation="MKKILVVCMGNICRSPTGEAVLRAKAQQLGVDVEVDSAGTIGYH
                     AGNTPDHRAMQAGQQRGYSFSGIRSRQVDAEDFVKFDMILAADKANLADLFDICPKEY
                     RHKVSLFLSHAELDVDEIPDPYYGGEEGFDLVLDLIEAASEAILENVAKN"
     gene            320904..321545
                     /locus_tag="AOT11_08545"
     CDS             320904..321545
                     /locus_tag="AOT11_08545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cob(I)yrinic acid a,c-diamide
                     adenosyltransferase"
                     /protein_id="ASM95313.1"
                     /translation="MSMSDESVSSENLSTEQVKAQRHKERQQKVKEQVDAKIAQAQEE
                     KGLLLVITGNGKGKSTSGFGTIARAVGHGKKCAVAQYIKGTWDNGERNLLEKLGVEFQ
                     VMATGFTWETQNKESDTQAAQTVWKECQRMLQDDSIDVVLFDELTYMVSYGYVELDEM
                     VEALNNRPKMQSVIITGRGAHRTLIEMADTVSEVKNVKHAFESGIKALKGVDW"
     gene            complement(321618..323726)
                     /locus_tag="AOT11_08550"
     CDS             complement(321618..323726)
                     /locus_tag="AOT11_08550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein AsmA"
                     /protein_id="ASM95314.1"
                     /translation="MKKLFLILAAPITVVVMAAIALVTLVNPNQFKPLITEQVAKQTG
                     LELVIEGDIEWQFFPSIGFSLGKTELKNPQGFSQENLFKVESVGIDISVMPLLDKVLQ
                     IGDVRLDGAEFHLETRKDGQKNIDALTQQQKAQQETVQQEVSSEPTTDASQQPGAAAG
                     WRMELAGITVSNAKLVNQDRQAGTSLELYDVNFSLSEFAFDQWTKAEFSAKGKNNQQQ
                     FSANGKLEFQLAQDFSSYALRNIELNSQFSDPATKMDTIKLVLDTFEFDKDNALTFEI
                     KGQASGMELSANGSAQLHVDAAISTVMVKAFQLESQLNGKSLPQSPMKVAMSSEVTFD
                     VPSSHLSLVLNKLTANAIALDGKADVTLAEIPKVRFSLHSPEIDLDEFLGLTQPSQET
                     ASTNSSNDKNAHPEANNEVEPDLSALKTLDVIGQVSIDKLKANNAKLQNVITKFTVNR
                     GIATLDRFDANLYQGSINASAKLDARRSPATYSVKKRIKGVQVQPLLVDVAQNDKLEG
                     TGNIDVDVKGSSLTPSGIQKNLVGTVEINFADGAVNGINVAQMIRENYAKIKGKKLDA
                     TDGVQKTDFSSMTATLTLNKGKVTTNNMHMQSPLLRIRGKGEANYINQTVDFTVSTSI
                     VGSLEGQGGKDIDELRDVTIPINISGSWADPKFKLVFDDVLKQKAQKEIDRGVEKLTD
                     KIKDEKTKEAVDGLLKGLFN"
     gene            complement(323869..324510)
                     /locus_tag="AOT11_08555"
     CDS             complement(323869..324510)
                     /locus_tag="AOT11_08555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridine kinase"
                     /protein_id="ASM95315.1"
                     /translation="MSEKSQCVIVGIAGASASGKSLIASTIYNELRAKVGDHQIGVIT
                     EDCYYNDQSHLSMEERVKTNYDHPNALDHDLLCEHLEKLMKGESVEVPEYSYTEHTRT
                     ENTTTMTPKKVIILEGILLLTDPRLRDLMHATVFMDTPLDICLLRRVKRDVEERGRTM
                     ESVLKQYQKTVRPMFMQFIEPSKQYADIIVPRGGKNRIAIDVLKAHIAKLLKA"
     gene            complement(324693..325772)
                     /locus_tag="AOT11_08560"
     CDS             complement(324693..325772)
                     /locus_tag="AOT11_08560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="ASM95316.1"
                     /translation="MHQFTSKQDFCHWLNQFEHETLAPQWSEVHGVVMVQADGTFAIQ
                     FPFAAQQLQDALSEWIVQQQQRGAVPPFAFTVSQQVKALETQVSQPVRGVKNIIAVTS
                     AKGGVGKSTTAVNFALAIASQGAKVGLLDADIYGPSLPIMLGSVDQRPDVRDGKWMQP
                     ILAHGIYTNSIGYLVDKNEAAIWRGPMASKALSQLLNETEWPDLDYLVIDMPPGTGDI
                     QLTLSQQIPVTTSVIVTTPQDLALADAKKGAAMFEKIGVPVAGIVENMSYHICRQCGA
                     KEHIFGQGGAVQMAQQFGLSLLAQVPLHISVREDLDSGVPTVVARPESEHGRIYRQLA
                     LQICSSMYWNGKAKPETILFTRIDG"
     gene            325929..328001
                     /gene="metG"
                     /locus_tag="AOT11_08565"
     CDS             325929..328001
                     /gene="metG"
                     /locus_tag="AOT11_08565"
                     /EC_number="6.1.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790659.1"
                     /note="methionine--tRNA ligase; MetRS; adds methionine to
                     tRNA(Met) with cleavage of ATP to AMP and diphosphate;
                     some MetRS enzymes form dimers depending on a C-terminal
                     domain that is also found in other proteins such as
                     Trbp111 in Aquifex aeolicus and the cold-shock protein
                     CsaA from Bacillus subtilis while others do not; four
                     subfamilies exist based on sequence motifs and zinc
                     content; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine--tRNA ligase"
                     /protein_id="ASM95317.1"
                     /translation="MANDPRNFPPRKLLVTCALPYANGSIHLGHMLEHIQADIWVRYQ
                     RLRGNIVNFICADDAHGTPIMLKAQQMGMSPEEMIAAVSIEHQKDFAGFDISFDNYHS
                     THSDENRELASHIYLQLKKNGFISSRTISQLFDPEKEMFLPDRFVKGTCPKCKSEDQY
                     GDNCDACGETYSPTELINPKSAVSGATPVMKDSEHFFFDLPQFESMLKEWTRSGSLQT
                     ETANKMQEWFESGLQQWDISRDAPYFGFEIPGEKDKFFYVWLDAPIGYMGSFKNLCDK
                     RDDLDFDEYWNKDSKTELYHFIGKDIVYFHSLFWPAMLDGSGFRKPNNVFVHGYVTVN
                     GAKMSKSKGTFVKASTYLDHLDPECLRYYYAAKLNSRIDDLDLNLEDFTQRVNADVVN
                     KIVNLASRNAGFIAKRFEGKLAENFVEPELYNEFVAAADRIAELYEAREFGRAIREIT
                     ALADKANQYVDEKAPWVVAKQEGKDQELQEICSVGINLFRVLMTYLKPVMPALAARTE
                     AFLNEELTWEGVAQPLTAHEITAFKALFNRIDPKNIEAMIEASKEDAAAEMAAKEKAE
                     ASNAAQETELSKDPIAEEIEFDDFAKVDLRIAKIVACESVPKADKLLKFQLDIGGEMR
                     QVFSGIKAAYNPEDLVGKYTVVVANLKPRKMKFGMSEGMILAAGPGGKDLWILEPHEG
                     AQPGMRVM"
     gene            328317..329129
                     /locus_tag="AOT11_08570"
     CDS             328317..329129
                     /locus_tag="AOT11_08570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95318.1"
                     /translation="MFVLLSSLISIAILLVLFYLSHKRERQQEQKYQVISTLREIVQL
                     LRQHRSATHLSLLYKQVHSSEIHRTQTEVLAKCQALIELASGESKPLYRILLSQYQTL
                     FSHWQEQSIAKNQFLHGKMLRHTLFLVDETTVAWLAESERDELIDEYHCHWQVIIENL
                     DALTQLRIAIQDLHQPQGRERFAHCAQRMVRRLNQLTLLSPYHIAAPASVEVIRELEM
                     YANLQQEKLNKVNAYELTSLISATIFRCYDEMLDEMIESLYLPLPRLALRFN"
     gene            complement(329937..330458)
                     /locus_tag="AOT11_08575"
     CDS             complement(329937..330458)
                     /locus_tag="AOT11_08575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond formation protein DsbE"
                     /protein_id="ASM95319.1"
                     /translation="MNNKVIKLLVLVSIVGIVTFTAVLGIERQNAGHTTPATVIPLPN
                     IDAKDLFSANTITTQDLISDQYRVMNVWASWCGICRDEHTFIMSLKQQGIDVIGLNYR
                     DNKREALDYLESEGNPYSKVIYDPDGIVSIDFGVIGTPETYLINPNGEIMIKFRGKLD
                     QKQWDKHFATYFK"
     gene            complement(330439..332358)
                     /locus_tag="AOT11_08580"
     CDS             complement(330439..332358)
                     /locus_tag="AOT11_08580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="ASM95320.1"
                     /translation="MEAELGLICLIFAAVGSSVAVILHAMNRLLSKQTPLALMLGCGY
                     LVALSSAFSLLYLILAFVADDFALAYVASHSNSQLPVIFKIAASWGGHQGSMLFWVVT
                     LSLWACLIRSRDEFSSQYKADYIAVMLMLTAIFAWFTLLTSNPFEYAPSLASDGRDLN
                     PMLQDVGLILHPPLLYLGYVGFASILALGVAALLQPSSIHHWFQAGRDWAMVAWGFLT
                     LGIIVGSWWAYNELGWGGWWFWDPVENASLLPWLTATALLHTLVQSKRQGGVNKSSYV
                     LAFLTFGFSVLGTFIVRSGILTSVHAFAVDPTKGIVLLLVMAFIFLFTFALLILKSDS
                     IPAKAITHWLSRQYLTLVAMGLLLIATSTVFLGTFYPMIYELLRLGSISVGAPYFNTM
                     IAPLSLLGLLAMGWGPLLKWQQGLFQSRKRVLTEFVLSAVLGAMLYLLQVQVWAPMTL
                     LFWCVTTWVIVSHLRLLFVMPPTKRRQKLPMVLSHIGIALVCLGAMMNAQHSFERNVR
                     VEPDSYHQFDGFSIRYQGIDWSIGPNYTAERASVALILADRQFQLLPERRHYPVRVMN
                     MTEPAIKSFWHGDYYLTLGEKVGPKAYALKIQYRAYIWWIWLGGLMVVAAVFTALQPV
                     QQRVKVERYCEQQSY"
     gene            complement(332372..333328)
                     /locus_tag="AOT11_08585"
     CDS             complement(332372..333328)
                     /locus_tag="AOT11_08585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572081.1"
                     /note="membrane protein, may be involved in the transfer
                     of electrons from quinones to c-type cytochromes; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="ASM95321.1"
                     /translation="MNGFESAFHFDSLVWDWIIAIYLFLAGMSAGAVMITVYLKRKVI
                     VGDPAQNGIMKAMAWLAPFGIISGLTILIFHLTKPLEFWKIMIFYNPTSVMSMGVILF
                     QVYMAVLFVWIGIIFQKTIVDFLGDKLTFVDGLLTWFKRFENSIELFLAFLALVLAAY
                     TGFLLSALKTYPMLNNPVLPLLFLFSSLSSGAAACLMFGILVFKESVKDPSVSWVHGF
                     ERPVVLFELFVLVTFFTGLIFAGGQAEMAAWNAISGGFWAQWFWVGVVLIGMLLPLTL
                     NWLVPAEVRHKHAYIFVVTTLSMVGVLMLRTFILYAGQMTVV"
     gene            complement(333330..334016)
                     /locus_tag="AOT11_08590"
     CDS             complement(333330..334016)
                     /locus_tag="AOT11_08590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="ASM95322.1"
                     /translation="MSCSRRNFLAGGGALIMTTGIAGTSMVTGRLAFAEEDKGQAIRY
                     GMIHDETACIGCTACTDACREVNKVPEGVSRLEIIRSEPHGEYPNVDYRFTRKSCQHC
                     ENPPCVYVCPTGAAYKDEKTGIVDVHKEKCVGCGYCLAACPYQVRFFNPVDHSADKCN
                     FCRDTNLAQGKLPACVESCPTKALIFGDLNDPQSDVNRVLTEKVYYRDKVHLGTKPKL
                     FKIPHQKGEV"
     gene            complement(334018..334605)
                     /locus_tag="AOT11_08595"
     CDS             complement(334018..334605)
                     /locus_tag="AOT11_08595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="ASM95323.1"
                     /translation="MGNIKLAIVIMLKSILAFSFYGYSFSAIADTSVATEATDSSRFQ
                     VELIRDRDYKCVQCHKDSKETLSGSHGEDAHKILGREVNCTECHNNIGPDHREGAPLV
                     TKYSSAQSKQGTEKVFMDTSAILKANSACTDCHQPQYLQEDSWTHDVHAKNLTCSNCH
                     DVHANKAKVLGLERKEKIKMCVDCHSDFNQKEEER"
     gene            335057..336481
                     /gene="nrfA"
                     /locus_tag="AOT11_08600"
     CDS             335057..336481
                     /gene="nrfA"
                     /locus_tag="AOT11_08600"
                     /EC_number="1.7.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8E5.1"
                     /note="catalyzes the formate-dependent reduction of
                     nitrite to ammonia; cytochrome C552; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C nitrite reductase"
                     /protein_id="ASM95324.1"
                     /translation="MSIKHWMASSVSVTALVMTALLNITAVSAEEKGLVDPRNDAFEL
                     NHPDQYQSWKKTSESVEIEDALAEDPNMVILWAGYGFAKDYNKARGHFYALDDVRQTL
                     RTGGPQDAKSGPMPMACWSCKSPDVARVIDERGEDGYFEGKWARLGAEIANPIGCADC
                     HDTRSEKFKNGEPELALTRPYVERAFQAINKPFEQQSRLDKQASVCAQCHVEYYFTGP
                     TKAVKFPWDMGTGVQQMEEYYDALGFADWTHAVSKAPMLKAQHPGFETWREGIHGKNK
                     VVCVDCHMPKVKKEDGTVYTDHKVGNPFDRFEDTCAQCHTQSKDQLREIVSTRKAQVL
                     NMKLTAEKQIVAAHFEAGAAWKAGATEDEMKPILQDIRHAQWRWDYAIASHGVHMHAP
                     EVALEVLGTAVDRAADARTKLVRLLATKGITEPVQIPDISSKAAAQKALGMDMEKMNA
                     EKQHFLKTVVPDWDKAAAERESKY"
     gene            complement(336544..336774)
                     /locus_tag="AOT11_08605"
     CDS             complement(336544..336774)
                     /locus_tag="AOT11_08605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NrfF protein"
                     /protein_id="ASM95325.1"
                     /translation="MELLSTYLTIIMVMLIAYPFVLVGLKAASNGCEVTKVKVTNRFN
                     YGFSLILLIFMIAHIQTETFYAAGLLEMFKPE"
     gene            complement(337074..337715)
                     /locus_tag="AOT11_08610"
     CDS             complement(337074..337715)
                     /locus_tag="AOT11_08610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="ASM95326.1"
                     /translation="MDSWLIIATIMMLFFLISIWMAAAKWAAKQWYLLSFLTLVGAVI
                     TYGVLQSSRPEPKPENAMLKSMTVEDLMAQLQVQLKENPNDAELWFQLGQGYLLNKEL
                     DAALICFDYAIQLTEQPSSTQLAAKATALYYLGSQQMGDEVSLLLEQALQLEPYNEAA
                     LSLVANDHFISFRFQQAINTWTYLLDSNDPKLDRESVIRSIDQAKALMQTPTR"
     gene            complement(337861..340572)
                     /locus_tag="AOT11_08615"
     CDS             complement(337861..340572)
                     /locus_tag="AOT11_08615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="ASM95327.1"
                     /translation="MSDLAKEITPVNIEDELRGSYLDYAMSVIVGRALPDVRDGLKPV
                     HRRVLYAMNVLGNDWNKPYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYML
                     VDGQGNFGSIDGDSAAAMRYTEVRMAKIAHELLADLDKETVDYVPNYDGTEQIPAVLP
                     TKIPNLLVNGSSGIAVGMATNIPPHNLTEVIDGCLAYINNEAITIDELMDYIPGPDFP
                     TAALISGRKGIIDAYKTGRGKIYMRSKAEIEVEKNGKETIIVTEIPYQVNKARLIEKI
                     AELVKDKKVEGISALRDESDKDGMRIVIECKRDAVGEVVLNNLYAQTQLQTTFGINMV
                     ALDNGQPKLFNLKEMLKCFVDHRREVVTRRTIFELKKARDRAHILEALALALANIDEI
                     IELIRNAATPAEAKAGLVARGWDLGNVAAMLESAGTDAARPDWLEPQYGIRDGQYFLT
                     ETQAQAILDLRLHKLTGLEHEKILDEYKALLDEIKELMHILASTERLMEVIREELQSV
                     RDAFGDVRRTEITAATHDIDLEELIAREDVVVTLSHEGYVKYQILSDYEAQRRGGKGK
                     SATKMKDEDYIERLLVANTHDNILLFSTRGKTYRLKVYQLPLASRTARGKPIVNLLPL
                     EENERITAILPVTEFSADKFIFMATGDGTVKKTSLDQFSNVRANGLIAVNLRDEDSLI
                     GVDITDGESEIMLFSKSGKVVRFKEAEESPVLDENGQPVLDENGQPEIKFKGVRPMGR
                     TAAGVRGMKLADGDQVVSLIVPKNEGDVLTVTENGYGKRTVLSEYPTKGRGTQGVVSI
                     KVSERNGSVVGAVQVEDGDEFMMITDAGTLVRTRVAEVSQVGRNTQGVTLIRTAEDES
                     VVGLQRIDEVEETELPEGEEVDATEATEQAPQAQAPQADNDDAADQE"
     gene            340603..340869
                     /locus_tag="AOT11_08620"
     CDS             340603..340869
                     /locus_tag="AOT11_08620"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95328.1"
                     /translation="MYNTCKVQKYNTQFPSSASLSLSFYQVVTSVENQSKRNCTFFVY
                     AADKGCNFDQFSTKSSFSMEEKSEGVIMPSYFQGSRIIQSSAYD"
     gene            340862..341569
                     /locus_tag="AOT11_08625"
     CDS             340862..341569
                     /locus_tag="AOT11_08625"
                     /EC_number="2.1.1.64"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8E0.1"
                     /note="Involved in ubiquinone biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="ASM95329.1"
                     /translation="MTKTQNVDPNEIKKFEDMASRWWDLEGEFKPLHQINPLRLDYVL
                     SKADGLFGKKVLDVGCGGGILAESMAKEGAVVTGLDMGKEPLEVARLHALETGTKLTY
                     IQSTIEDHAAENAQMYDVVTCMEMLEHVPDPQSVIRSCAALVKPGGHVFFSTLNRNIK
                     SYLFAIVGAEKLLKIVPEGTHDHDKFIRPSELIKMIDQTDLCEQGITGLHYNPLSDTY
                     KLGRNVDVNYIVHTQKF"
     gene            342037..344319
                     /locus_tag="AOT11_08630"
     CDS             342037..344319
                     /locus_tag="AOT11_08630"
                     /EC_number="1.17.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422331.1"
                     /note="Catalyzes the rate-limiting step in dNTP synthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="ASM95330.1"
                     /translation="MNQQLTVTKRDGRKENIDLEKLHRVITWAAEGLDNVSVSQVELR
                     AHIQFYDGITTSDIHETIIKSAADLISEETPDYQYLAARLAVFHLRKKAYGQYEPPTL
                     YDHVARLVDMGKYDKHILEDYTKAELDELDAYLDHKRDLDFSYAAVKQLEGKYFVQNR
                     VSGQIYESAQFLYILVAACLFAKYPRETRLDYVKRFYDATSTFKISLPTPIMSGVRTP
                     TRQFSSCVLIECGDSLDSINATASSIVRYVSQRAGIGINAGRIRALGSEIRGGEAFHT
                     GCIPFYKYFQTAVKCCSQGGVRGGAATVFYPMWHGEARSLMVLKNNRGVEENRVRHMD
                     YGVQLNKLMYQRLVEGGNITLFSPSDVPGLYDAFFENQAEFERLYVKYENDPSIKKET
                     VKALEMFTLLMQERASTGRIYIQNVDHCNTHSPFDAEVAPVRQSNLCLEIALPTKPLA
                     NVEDDSGEIALCTLSAFNLGAINTLDDLKELSELVVRALDALLDYQDYPLPAAYKSTM
                     NRRTLGVGVINYAYYLAKHGVKYSDGSANGLTHRTFEAIQYYLLKASVELAKEQGKCP
                     LFHETNYAKGLMPIDTYKKDIDLICDEPLHYDWDALRAEIMEHGLRNSTLTALMPSET
                     SSQISNATNGIEPPRGYVSVKASKDGILKQVVPDFIELKNNYELLWNIGSNDGYLHLV
                     GIMQKFVDQAISANTNYDPARYESGKVPMKKLLQDLLTAYKFGVKTLYYHNTRDGAKD
                     EQKDAVQPQDDDCAGGGCKI"
     gene            344400..345533
                     /locus_tag="AOT11_08635"
     CDS             344400..345533
                     /locus_tag="AOT11_08635"
                     /EC_number="1.17.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422332.1"
                     /note="B2 or R2 protein; type 1a enzyme; catalyzes the
                     rate-limiting step in dNTP synthesis; converts nucleotides
                     to deoxynucleotides; forms a homodimer and then a
                     multimeric complex with NrdA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     beta"
                     /protein_id="ASM95331.1"
                     /translation="MAYSTFNQTKNDQLKEPMFLGQSVNVARYDQQKFEIFEKLIEKQ
                     LSFFWRPEEVDVSSDRIDYNKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSL
                     PELETWIETWSFSETIHSRSYTHIIRNIVNDPSVVFDDIVENEHILKRAKDIAHYYDD
                     LIQLTNDYHRFGEGEHVVNGETIKVSLYELKKKLYLCLMSVNALEAIRFYVSFACSFA
                     FAERELMEGNAKIIKLIARDEALHLNGTQHMINILRNGQDDFSFMQIAEEAKQQCFDL
                     FKEAAEQEKEWAEYLFKDGSMIGLNKDILCQYVEYITNIRMQAVGLPVAYPNATSNPI
                     PWINAWLSSDNVQVAPQEAEISSYLVGQIDNEVHSDDFEGFEL"
     gene            345533..345811
                     /locus_tag="AOT11_08640"
     CDS             345533..345811
                     /locus_tag="AOT11_08640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Fe-S)-binding protein"
                     /protein_id="ASM95332.1"
                     /translation="MPKIRINKLHSFESNRANTILETMEQAGLLPEYNCRDGHCGACR
                     CKLESGEVEYVGFAMAYTQSNEILPCICRAKTDVILSDVNYVMKEKRA"
     gene            complement(345907..347142)
                     /locus_tag="AOT11_08645"
     CDS             complement(345907..347142)
                     /locus_tag="AOT11_08645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="damage-inducible protein CinA"
                     /protein_id="ASM95333.1"
                     /translation="MKIAMLSTGEEVLHGDIVDTNAAWLSSVMYEQGFALTKRSTVGD
                     QMNALVEELLMLSFNNDVVIVNGGLGPTTDDMSSAAAAKAAECKIVLFKEWLTRMEEM
                     YRERNRPMPDSNLKQAMLPEIAEIVDNPIGTACGFKMNINEAVFYFTPGVPREFKVMV
                     ETQILPDLKKQWPDNEAFQCSRLYTFGLSESGISDKLDALKLPQGYELGYRSSLPFIE
                     VKLFGPKDALDERVKVMQLIYKLLEGNVVSVDESMTQHIGHMLKEKGLTLATAEQSSF
                     GYLASWLQSDDNIAEQSGHAWVLSAKGSESIDNSNPLAAVFALAGATREKCSTDLALV
                     TGKLNGKQFSVALSAHGGEWGMVLELNRVYGKEDASRVISTVAADLLRRYLEKKPMFG
                     EYFSVTKVKEMFVPSSLVK"
     gene            347315..348223
                     /locus_tag="AOT11_08650"
     CDS             347315..348223
                     /locus_tag="AOT11_08650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquitin--protein ligase"
                     /protein_id="ASM95334.1"
                     /translation="MSKQILKTTALSGLILTASASATEQYDFSKHIEFSYSTNCLQEY
                     CVSDNLYSYKPTTTLSLDEPSNELNLDAGTQPKHYIVPQDKDWDYLMGQTYTILGLSV
                     ATVGLMTLLPESITKWDDDARDISNLGSKWKDNVSSGPVWDRDEHFLNYIMHPYFGGV
                     YYTAARHAGYNEFESFLYSSVMSTFFWEYGVEAFAEVPSWQDIFITPFFGAVVGEIML
                     ETEQNIIANGGEVLGSETVGDVSLFFLNPVGHIHYWVSNAWGGSAEVNFVSNPWFGNQ
                     DAAKYALDSGYAYDNQFYGFDFKVTF"
     gene            348421..348933
                     /locus_tag="AOT11_08655"
     CDS             348421..348933
                     /locus_tag="AOT11_08655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM95335.1"
                     /translation="MNSVFIVNFVGRASPTTIKQLAAITHENGGKWLISKVNFIEDQV
                     AAVIKIDMPSQHVQTVKDAFSSHPDLIVQFVDSDSTIHDKETIFQLRLDSNDRAGIVN
                     EITHVLDNQGISILDMDCQRVFIAGGGGVSSSLFTANMAIKLPVELDIEDVANELESL
                     SEDTRVIIES"
     gene            complement(348996..350129)
                     /locus_tag="AOT11_08660"
     CDS             complement(348996..350129)
                     /locus_tag="AOT11_08660"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8D2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxynorspermidine decarboxylase"
                     /protein_id="ASM95336.1"
                     /translation="MNKEQLKTPFFMIDEAKLIQNLEIAKQLKEISGVKLVLALKCFS
                     TWGVFDIIKPYLDGTTSSGPFEVKLGYEKFGGETHAYSVGYSEDDVREVAELCDKIIF
                     NSQSQLAAHRHIVEGKASIGLRLNPGVSYASQDLANPARQFSRLGVQADHIDPAVFDS
                     INGVMFHMNCENKDVDAFIALLDSISERFGAYLNKLDWVSMGGGVFFTWPGYDVEKLG
                     LALKAFSEKHGVQMYLEPGEAIITKTTDLVVTVVDLVENGMKTAIVDSATEAHRLDTL
                     IYKEPASVLEASENGEHEYVIGSCSCLAGDQFCVAKFDQPLQVGQRLHILDSAGYTMV
                     KLNWFNGLKMPSVYCERTNGEIQKLNEFGYEDFKRTLSLWSVQ"
     gene            complement(350208..351452)
                     /locus_tag="AOT11_08665"
     CDS             complement(350208..351452)
                     /locus_tag="AOT11_08665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000025721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="saccharopine dehydrogenase"
                     /protein_id="ASM95337.1"
                     /translation="MAILQIGAGGVGWVIAHKAAQNNDVLGDITIASRTLDKCEKIIE
                     SIHGRNNLKDSSKKLEARAVNADDVDSLVALIKEVKPDLVINAGPPWVNLTIMEACYQ
                     AKVSYLDTSVAVDLCSEGQQVPEAYDEQWKYRAKFEEAGITGILGAGFDPGVVSVFAA
                     YAVKHLFDEIDTIDVMDINAGDHGKKFATNFDPETNLLEIQGDSFYWENEEWKRVPCH
                     TRMLEFDFPKCGNFKVYSMAHDEVRSLKEFIPAKRIEFWMGFGDRYLNYFNCMRDIGL
                     LSPEPLTLHDGTVVQPLQVLKAMLPDPTSLAPGYTGLTCIGTWVQGKKDGKARSVFIY
                     NNADHEVAYKDVEHQAIAYTTGVPAITAALQYFRGAWAEAGVFNMEQLDPDPFLETMP
                     AIGLDWDVLELTPGQPTIHTLK"
     gene            complement(351468..354347)
                     /locus_tag="AOT11_08670"
     CDS             complement(351468..354347)
                     /locus_tag="AOT11_08670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class III"
                     /protein_id="ASM95338.1"
                     /translation="MSTAFEVDTNTIATIFSSQVPVVEGIYDLTPDQVLLDQAEHESE
                     VRSYPRRLPIAIKQAYGCLVEDTRGQIFLDCLAGAGTLALGYNHPEINQALKEQLDSG
                     LPYQTLDIATTAKTNFIKSVKAFLPEELGSNCVIQFCGPSGADAVEAAIKLAKQTTGR
                     NTMFAFRGAYHGMTNGTMGMMGNLNTKARRTGLMSDVHFMPFPYSLRCPFGLGGDEGA
                     KASIRYIERLLNDDEAGIMKPAAIIVEPVQGEGGVIPAPAFWLRELRRICDEHGMLLI
                     FDEIQCGVGKSGYHFAFEEAGIVPDVLCLSKAIGGGLPMSLLVINKKHDTWRPGEHTG
                     TFRGNQLAMVSGAKALEIITRDKLVEHANVAGQYLRHGLEKIQQRVDCIAEVRGKGLM
                     LGVEIRKPGSELNKFGEPVSDGQLTLAIQRAALERGLMVEKGGRDGSVIRFLPPLIIS
                     FEQLDFALRILEEAILAAGGNLKAVEENAEWKKHFIHTGVNGSKEFASVMNHTTAALK
                     NAFEEVDAPYSGMDPKALESAIYAVDLDNKNAPLKAIIDETTELVVKNSIFTQHPDCI
                     AHLHTPPLMPAVAAEAMIAALNQSMDSWDQSSSATYVEQKVINWLCDKYELGAKADGI
                     FTSGGTQSNQMGLMLARDWIADKLSGHSIQKLGLPDYADKLRIICSKKSHFTVQKSAS
                     WMGLGEKAVLTIDAHANGTMDVTKLEAAVEQAKAEGLIPFAVVGTAGTTDHGAIDDLN
                     TIADVAEKHDLWMHVDGAYGGALILSSQKARLKGVERAQSVSVDFHKLFYQTISCGAV
                     LVNDKQNFKFLLHHADYLNREHDELPNLVDKSIATTKRFDALKVFMTMQNVGPKALGA
                     MYDHILGQTLEVADLVRNTEGFELLAEPSLSTVLFRSTLGSDLDELNKTLRLEALTRG
                     VAVLGETIVDGKTALKFTILNPCLKMSDFESLLSKINTLAAELAQ"
     gene            complement(354937..355012)
                     /locus_tag="AOT11_08675"
     tRNA            complement(354937..355012)
                     /locus_tag="AOT11_08675"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(354977..354979),aa:Gly,seq:gcc)
     gene            complement(355038..355124)
                     /locus_tag="AOT11_08680"
     tRNA            complement(355038..355124)
                     /locus_tag="AOT11_08680"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(355088..355090),aa:Leu,seq:taa)
     gene            complement(355184..355259)
                     /locus_tag="AOT11_08685"
     tRNA            complement(355184..355259)
                     /locus_tag="AOT11_08685"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(355224..355226),aa:Gly,seq:gcc)
     gene            complement(355263..355336)
                     /locus_tag="AOT11_08690"
     tRNA            complement(355263..355336)
                     /locus_tag="AOT11_08690"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(355302..355304),aa:Cys,seq:gca)
     gene            complement(355603..356160)
                     /locus_tag="AOT11_08695"
     CDS             complement(355603..356160)
                     /locus_tag="AOT11_08695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005530466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="ASM95339.1"
                     /translation="MRLNIPNILSLMRLFLIPVFVVAFYLPYSWAPFAAAMVFWVAGF
                     TDWLDGMLARKLGQTSRFGAFIDPVADKVLVATALILITEHYHSIWVTIPAVTMIARE
                     IIISALREWMAEIGKRASVAVSWVGKVKTVSQMFALWVLIWRYDDWMVWLGFGALYIA
                     TFLTYWSMVQYLMAAKDDLLNEEHH"
     gene            complement(356207..358039)
                     /gene="uvrC"
                     /locus_tag="AOT11_08700"
     CDS             complement(356207..358039)
                     /gene="uvrC"
                     /locus_tag="AOT11_08700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422340.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrC both incises the 5'
                     and 3' sides of the lesion. The N-terminal half is
                     responsible for the 3' incision and the C-terminal half is
                     responsible for the 5' incision; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="ASM95340.1"
                     /translation="MTQIFDSVSFLKTVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLS
                     SYFRKKVDSEKTKALVSNIAKIDVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSY
                     PYIFLSAHRHPRVSLHRGAKKKKGEYFGPYPDSGAVRETLHLIQKIFPVRQCEDTVYA
                     NRTRPCLMYQIGRCAGPCVSSVISDVDYAELVGYLRLFLQGKDNQVLELLVQKMELAS
                     QQLKFEDAAKFRDQIQAIRRVQEQQYVSEDSQEDMDVLGFAQENGIACIHILMIRQGK
                     VLGSRSHFPKIPQNTNAQEVFDSFLTQYYLSHNEARTIPSRIILNQELAADVEAIQLA
                     LSDVAGRKVQFHTSPSGSRGRYLKLSNTNALTAMTTKINHKMTINQRFKALRDVLAMD
                     SIARMECFDISHTMGESTIASCVVFNSEGPVKQEYRRYNITGITGGDDYAAMGQALER
                     RYAKQLDVEKIPDVIFIDGGKGQLNRAHEIIAQYWGDWPKRPVMIGIAKGVTRKPGLE
                     TLITVDGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAKRGKTRKTSALEGIEGVGP
                     KRRQALLKYTGGLQELKRASVEEIAKVPGISHSLAEIIYQALKQ"
     gene            complement(358041..358685)
                     /gene="sirA"
                     /locus_tag="AOT11_08705"
                     /gene_synonym="uvrY"
     CDS             complement(358041..358685)
                     /gene="sirA"
                     /locus_tag="AOT11_08705"
                     /gene_synonym="uvrY"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017033557.1"
                     /note="in Escherichia coli the protein UvrY is part of a
                     two-component system along with BarA that is needed for
                     efficient switching between glycolytic and gluconeogenic
                     carbon sources possibly by regulating the Csr system; in
                     Salmonella SirA and BarA regulate virulence gene
                     expression also via the Csr system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator"
                     /protein_id="ASM95341.1"
                     /translation="MINVFLVDDHELVRTGIRRIIEDVRGMNVAGEADSGENAVKWCR
                     SNHADVVLMDMNMPGIGGLEATKKILRVNPDVKIIVLTVHTENPFPTKVMQAGASGYL
                     TKGAGPDEMVNAIRIVHSGQRYISPEIAQQMALSQFSPASENPFKDLSERELQIMMMI
                     TKGQKVTDISEQLNLSPKTVNSYRYRLFSKLSINGDVELTHLAIRHGMLDTETL"
     gene            359042..361411
                     /locus_tag="AOT11_08710"
     CDS             359042..361411
                     /locus_tag="AOT11_08710"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422341.1"
                     /note="Has polymerase, DNA-binding and 3'-5' exonuclease
                     activities. In Aeropyrum pernix this protein is sensitive
                     to aphidicolin and stable at 95#C; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase II"
                     /protein_id="ASM95342.1"
                     /translation="MTITHGFVLTRHARDRFSGTQIELWLSTEDGPHQLLIDGEKPVF
                     FIDDNQCEDAQRLANEYHPDVQVEFKPLPLKDFSHTPMAACYCQTNRDAYTLSSLFTQ
                     HDITVLESDIRLADRYLMERFIRGSLAFTGTFKTQNAHVQVTNAKCRQGDYTPTLKVV
                     SLDLECSEKGILYSIGLDSPMDSRVIMIGEPEAADTPIQWVQDEKQLLLALIAWFEQF
                     DPDVIVGWNVIDFDFRLLQKRAEWHQLKLTLGRGNQTSYFRSSSQSQQAFITIPGRVV
                     LDGIDTLKTATYHFRSWSLESVSRELLGEGKAIHNVHDRMAEINHMFRHDKPSLAKYN
                     LQDCVLVNRIFAHTHLLEYVIERSKLTGVELDRVGGSVAAFTNLYLPQLHRAGYIAPN
                     LQPENWVASPGGYVMDSLPGLYDSVLVLDFKSLYPSIIRSFLIDPLGLVEGLKLESGK
                     APHQAVPGFRGGQFHRTKHFLPEMIETLWQARDVAKRNNDKAFSQAIKIIMNSFYGVL
                     GSSGCRFFDTRLASSITMRGHEIMKQTKLLIEQQGYQVIYGDTDSTFVSLNGRFEQPE
                     ADAIGRQLVSLINQWWKHHLEQEFNLNSILELEYETHYRKFLMPTIRGSETGSKKRYA
                     GLIQKGREERIVFKGLESARTDWTPLAQRFQHQLYMMIFHDQDPTDYVREMVEQTRVG
                     AFDDELVYQKRLRRKLSDYQKNVPPQVRAARMADEINERLGRPLQYQNRARIEYLITL
                     NGPEPKEYQSSAIDYQHYVDKQLKPVADAILPFIGKDFSQLSDSQLGLF"
     gene            complement(361436..363538)
                     /locus_tag="AOT11_08715"
     CDS             complement(361436..363538)
                     /locus_tag="AOT11_08715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="ASM95343.1"
                     /translation="MEKQASLSWTVVGINLKKVSKRLAPSLQAIREGMIWLIPCLMLS
                     AFALFFASMGEFVGGGRSGWINALYDVHNAIAAFFPYLMTATISYVLAMQWKLARPPM
                     ALLSIIFLLIVGHVVPADDTLKMFHIVIAIVTPLYAIPILAHLLHVPQLRITNSDSGG
                     KLVKESLNLVLPALLTAFIVVAINYLIFSMFSFGDGLKLVQLDYANEPYEFGIAFAAM
                     NSLLWFLGVHGYYALLPLVELLQQASSLNYSTFVAGGEGHYAMNLSMMGTFVFIGGSG
                     ATLSLVVAMLLFAKQKSLKLIAIASIPIGLINVNEILLFGLPIILNPRMFLPFFLTPA
                     VHVVTTLLAIEIGVIDVPSASVPFNAPIIINAWLATSGDWGGVLLQLFNIAVGVVIYY
                     PSVRNLNRLYSNREIKIDFLDTVYVRRREEADTLKDDPIATANDRARRAQEVEQRLEH
                     IGRKEFCLEYQPQVSHQTGRVVGCEALIRAIEPDGTLVYPGTFLPWLEEAGLMKDVDL
                     WVLKTVAKDIQEWNRIGLYVPVSINLTPAFLADKEYMDKLEYILAPVASQVHIEITEE
                     TLLVDEQVLARSFNLLHQLGVAVYIDDFGTGFSSLSYLNRFEVDAIKVDRSFVLALDN
                     EKGKKVFMSLLSVAEQLGLEVVIEGVESQQQLNHIPAKEHISIQGWYYSRSLQHNSFI
                     QYCINANHIKPIVEIEKI"
     gene            complement(363637..364404)
                     /locus_tag="AOT11_08720"
     CDS             complement(363637..364404)
                     /locus_tag="AOT11_08720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="ASM95344.1"
                     /translation="MTLPVIDPKQPFQAKFEPVIKDVLMCLKSGLGDNLHSVYVYGSV
                     ARKTAQEGKSNLDIVVVTHRPFTEQRATVFNTLKWRVQKSFPQVIGVAVKTAEVRDIA
                     SLDSLFTWGFMLKHCCVCVYGSDLAECFGEYVPSWEIAKHWNMDVEDWLAVYRNKIAR
                     ATSVEQQIEPQKVIAKKLLRASYSLVMYKDQHWYDDPIECGRQFLQYHPEKEVEIRRL
                     TILLTGQAIPKRSVVGLLDGFGEWLVKQYQKTEFKIG"
     gene            364637..365203
                     /locus_tag="AOT11_08725"
     CDS             364637..365203
                     /locus_tag="AOT11_08725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="ASM95345.1"
                     /translation="MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGRGGSKIYKMRCT
                     DLATGARVEERYKSDDVLETVEMNKKAVSFSYIDGDDYIFMDNADYSQYVFKHADVED
                     DLLFINEDTQGIHVILVNGESVGLELPSSVELVIEETDPSIKGASASARTKPARLSTG
                     LVVQVPEYIATGDRVIINTAERKYMSRA"
     gene            365206..365526
                     /locus_tag="AOT11_08730"
     CDS             365206..365526
                     /locus_tag="AOT11_08730"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6LRZ3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95346.1"
                     /translation="MADLISYDDAIDAAYDIFLEMAPDNLEPVDVILFTAQFDDRGAA
                     ELVDINDDWAGHVGFDVDKEIYAEVRIGLVNEENDVLDDVFARMLISRDPDQKFCHIL
                     WKRD"
     gene            complement(365578..366540)
                     /locus_tag="AOT11_08735"
     CDS             complement(365578..366540)
                     /locus_tag="AOT11_08735"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D8C0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="ASM95347.1"
                     /translation="MNEKLQKVLARAGHGSRRELEALIKSGRVSVNGIVAKLGERLED
                     EQAVVRIDGHVVSVKAQEEVICRVLAYYKPEGELCTRHDPEGRRTVFDRLPKIRGSRW
                     ISVGRLDANTSGLLLFTTDGELANRLMHPSRQVEREYLVRVFGEVNEHKVRNLVNGVE
                     LDDGLARFEDVVYTGGEGMNHTFYVVINEGRNREVRRLWESQDCTVSRLKRVRYGDIY
                     LDKKLPRGGWMELELKDVNYLRELVELRPEKETMIELNNSSRKRDRARSQKIRRAVKR
                     HEERVSTPKGRSNNAARRKPSKADGQTNKTNSRNQAGSRSKPQR"
     gene            366876..367586
                     /locus_tag="AOT11_08740"
     CDS             366876..367586
                     /locus_tag="AOT11_08740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hcalcium-binding protein"
                     /protein_id="ASM95348.1"
                     /translation="MSGTTVDLNWIFGTAQDDDLKGTVGSETTDIFFGFGGDDKFVGF
                     GGNDYIFGGWGNDTLLGGRGNDFISGGSGNDFLSGGLGNDTLFGGSGDDIIYDYEGNN
                     FLSGGWGNDTLVVGHGDSMLSGGCGKDTFVLTNHLPINVHDQQVPVNDIEVKAEILDF
                     NLCYDKISFNIGKDTDGDGIRDTFLQSRDDLDLSFNQWGDAVFSSEEWGVELTLTGVS
                     QYDMNWIDHYGIELFDFA"
     gene            complement(367661..368281)
                     /locus_tag="AOT11_08745"
     CDS             complement(367661..368281)
                     /locus_tag="AOT11_08745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009843677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95349.1"
                     /translation="MSQFFYVHPENPQARLINQAVAIIRNGGVVVYPTDSGYALGCQL
                     ENKQALDRICQIRRLDEKHNFTLLCRDLSELSIYARVDNTAFRLLKNNTPGPYTFIFK
                     GTKEVPRRLMNAKRKTIGIRVPDNRIALDLLDALGEPLMSTSLILPGKEVTEADPEEI
                     RDKLEHAVDVILNGGYLGEQPTTVIDFSEGDAVVARIGSGDPAPFE"
     gene            complement(368312..369193)
                     /locus_tag="AOT11_08750"
     CDS             complement(368312..369193)
                     /locus_tag="AOT11_08750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine tRNA ribosyltransferase"
                     /protein_id="ASM95350.1"
                     /translation="MRIDLHSHTTASDGRFSPQDLIERALAFDLDVLAVTDHDTVEAL
                     AEMHRYVDEKQLPIKIINGIEISTVWQNKDIHVVGLNVDPNNMTLNQLIEQQQEHRVS
                     RAELIAQRLQKATREGVLEEVRQIADGAPITRAHFAKWLVDNGYAKTMQQVFKKYLTR
                     NNPGYVPPNWCSIEDAVKAIHAAGGQAVLAHPARYNLTAKWLKRLLQAFAEAGGDAME
                     VAQPQQSQQERRNLADYAIQYKLLASQGSDFHYPSPWMELGRNLWLPAGVEPVWKDWG
                     LEPVDKVQTVSTNAPEL"
     gene            369279..369404
                     /locus_tag="AOT11_08755"
     CDS             369279..369404
                     /locus_tag="AOT11_08755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Trp operon leader peptide"
                     /protein_id="ASM95351.1"
                     /translation="MLQEFNHNQKAKLVLHNENVNAAELAWWRTWTSSWWANVYF"
     gene            369582..371147
                     /locus_tag="AOT11_08760"
     CDS             369582..371147
                     /locus_tag="AOT11_08760"
                     /EC_number="4.1.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422349.1"
                     /note="with component II, the glutamine amidotransferase,
                     catalyzes the formation of anthranilate from chorismate
                     and glutamine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase"
                     /protein_id="ASM95352.1"
                     /translation="MNKAINITTLGQLELLSTTVPYHSDPTRLFHTLCENKRDSLLLE
                     SAEIDSKQDLKSLLIVDSAVRMVCHGHVVTMTALSDNGKNLLTHLTKNVAKEVEHQFD
                     GQQLTLTFSSPDDRLDEDSRLREASSFDALRLVQHSFDLTEKDKHAIFIGGLFAYDLV
                     ANFEPLGEARAINQCPDYVFYVAETLMVVDHQTESCHLQATLFADDSQKEALNQRIEQ
                     IRTLCATPKALPKAIHLDEVEVDTNISDDAFCQVVRDLKQYVVKGDIFQVVPSRRFTL
                     PCPSPLAAYKELKVSNPSPYMFYMQDELFTLFGASPESALKYETHTNQVEIYPIAGTR
                     RRGKRANGEIDFDLDSRIELELRTDKKENAEHMMLVDLARNDVARISRAGTRHVADLL
                     KVDRYSHVMHLVSRVVGQLRDDLDALHAYQACMNMGTLTGAPKIRAMQLIRDVEGARR
                     GSYGGAVGYLTGEGTLDTCIVIRSAYVENGIAQVQAGAGVVFDSSPQAEADETRGKAQ
                     AVISAIQKAHKES"
     gene            371150..371728
                     /locus_tag="AOT11_08765"
     CDS             371150..371728
                     /locus_tag="AOT11_08765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit II"
                     /protein_id="ASM95353.1"
                     /translation="MADIVFIDNFDSFTYNLVDQFRSLGHQVKIYRNSIATDTIVDAI
                     EQLERPVVLLSPGPGAPSEAGCMPELIARVKGKVPVIGICLGHQAIVEAYGGTVAGAG
                     EIIHGKVSMMEHQSHAIYQGLPSPLAIARYHSLVATHVPQTLTVTAEVNGLVMSVVNE
                     EDKVCGFQFHPESIMTTQGATLLANAINWALA"
     gene            371747..372745
                     /locus_tag="AOT11_08770"
     CDS             371747..372745
                     /locus_tag="AOT11_08770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="ASM95354.1"
                     /translation="MEAIINKLYQQESLTEQESQQLFDTIIRGELDPILMASALTALK
                     IKGETPDEIAGAAKALLANAQPFPRPDYDFADIVGTGGDGHNTINISTTAAFVAAACG
                     LKVAKHGNRSVSSKSGSSDLLDSFGINLAMSAEDTRSAVDSIGVAFLFAPQYHSGVKH
                     AMPVRQTMKTRTIFNILGPLINPARPNIELMGVYSQELVRPIAETMLKMGMKRAAVVH
                     GSGLDEVAIHGDTLVAEIKDGVIHEYTLTPADFGVNTHPLEAIKGGDPEENKAIITHL
                     LTGKGTEAQLSAVAVNVALLMRLFGHEDLKANTQQAIDAMNSGKAYQLVEKLAQHA"
     gene            372754..374181
                     /locus_tag="AOT11_08775"
     CDS             372754..374181
                     /locus_tag="AOT11_08775"
                     /EC_number="4.1.1.48"
                     /EC_number="5.3.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572098.1"
                     /note="monomeric bifunctional protein; functions in
                     tryptophan biosynthesis pathway;
                     phosphoribosylanthranilate is rearranged to
                     carboxyphenylaminodeoxyribulosephosphate which is then
                     closed to form indole-3-glycerol phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="ASM95355.1"
                     /translation="MTNNNEKLSEHVSLQEAQMAEVLAKIVRDKYQWVAERKQAQPLA
                     SFQATLTPSDRSFYQALQGQRTVFITECKKASPSKGLIREDFDLDYIASVYNHHADAI
                     SVLTDEKYFQGSFDFLPQVRQQVRQPVLCKDFMVDSYQVYLARHYQADAILLMLSVLN
                     DEQYQTLADVAHQLQMGVLTEISNDEELERAVKLGAKVIGINNRNLRDLTTDLNRTKV
                     LAPTLRRLAPEATVISESGIYTHQQVRDLAQYADGFLIGSSLMAEKNLELAVRKVTLG
                     ENKVCGLTHPEEAAKAYQAGAVFGGLIFVEQSKRAVNIEQARLTMSGAPLNYVGVFQN
                     HPVTLVAETANQLQLHAVQLHGNEDADYIAQLRKQLNESIEIWKAYGVTDQAPTLITQ
                     DVDRHLFDAQVGQQSGGTGTTFDWALLDDPSHIMLAGGLNPDNAQKAASLGCLGLDLN
                     SGVEESPGKKDLTKLQQAFAAIRNY"
     gene            374257..375447
                     /locus_tag="AOT11_08780"
     CDS             374257..375447
                     /locus_tag="AOT11_08780"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790680.1"
                     /note="catalyzes the formation of L-tryptophan from
                     L-serine and 1-(indol-3-yl)glycerol 3-phosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="ASM95356.1"
                     /translation="MTKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPDFRSEF
                     MGLLQEYAGRPTALTLTRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGK
                     NEIIAETGAGQHGVATALACALLGLKCRVYMGAKDVERQSPNVFRMKLMGATVIPVHS
                     GSATLKDACNEALRDWSGSYETAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAR
                     EGRLPDAVIACVGGGSNAIGMFADFIEEETVRLIGVEPAGKGIDTDQHGAPLKHGKTG
                     IFFGMKAPLMQDENGQVEESYSVSAGLDFPSVGPQHAHLNAIGRAEYDSITDDEALDA
                     FQELARSEGIIPALESSHALAHALKMARNNPEKEQLLVVNLSGRGDKDIFTVHAILEE
                     KGAI"
     gene            375447..376253
                     /locus_tag="AOT11_08785"
     CDS             375447..376253
                     /locus_tag="AOT11_08785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="ASM95357.1"
                     /translation="MDRYQATFERLAAQKQGAFVPFVTVCDPNPELSLKIMDTLVQAG
                     ADALELGIPFSDPLADGPTIQGANIRALDSGATPDICFDLVGQIRAKYPDLPIGLLMY
                     ANLVYSRGIENFYQRCAQAGIDSVLIADVPTNESAEFVAAAEKFGVHPIFIAPPTASD
                     ETLKQVSQLGGGYTYLLSRAGVTGAETKANMPVGDMLAKLEQFNAPPALLGFGISEPE
                     QVKQAIDAGAAGAISGSAVVKIIESHLNEPDAMLTALANFVSNMKSATQK"
     gene            376593..377855
                     /locus_tag="AOT11_08790"
     CDS             376593..377855
                     /locus_tag="AOT11_08790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid:proton symporter"
                     /protein_id="ASM95358.1"
                     /translation="MEVLKEKSLLRNIGVQVVIAMIVGTAVGALMGDSASMFAPLGAI
                     FINLIKMLVIPLVAVALISGAAGLGNSQSAGKVGFVTLGYFGLTSALAVALALFMGEV
                     FKPGMGIDVSGVEGMFSAEYASKGELPTFWATITGMIPTNVFQSLNEANILQILVFCL
                     FLGIAISKQEKEKREPIMNGVNCIVDSMVWMINKVMVIAPLGVFGLMAEAVGTFGFGA
                     LMVVFKLFVVYVAAILIFGFVAYPLMIQLFTKTSAKKFISAMKKPQAVALSTASSMAT
                     LPVTMDTVEKELGVRNSTASFVLPLGATINMSGNAIYYGLVAIFFAQLFNIDLSMGAY
                     IAIIVTATLGAVGQAGVPGPSFLVVAVLLAAGIPIEGLPLLFALDRIFDMIRTALNIT
                     GDAACAVIVDALLDEENEKQAEMNKQEA"
     gene            377896..378282
                     /locus_tag="AOT11_08795"
     CDS             377896..378282
                     /locus_tag="AOT11_08795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95359.1"
                     /translation="MRYPFFMPAESAKGGKLKVALILLLAHNHQKRQIHHAVCASTQN
                     EDSIMTLHRRTYYGLIHHGMKALLLDRIGHFTEDEYHHYLGITTGKTTCFSMTDDELE
                     VTVENLRTEGYLEDMKRVIAQFQGAA"
     gene            378414..378977
                     /locus_tag="AOT11_08800"
     CDS             378414..378977
                     /locus_tag="AOT11_08800"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P59366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septation protein A"
                     /protein_id="ASM95360.1"
                     /translation="MKQILDFIPLIIFFALYKMYDIYVATGALIAATAIQIVVTYALY
                     KKVEKMQLITFLMVAIFGGMTIFLHDDNFIKWKVTIVYAVFAIGLTVSHVMGKSAIKG
                     MLGKEITLPESVWANINWAWVGFFTFCAGLNIYVAYQLPLDVWVNFKVFGLLAATLVF
                     TVLTGGYIYKHLPKEQNGQSSDVPTDE"
     gene            379058..379456
                     /locus_tag="AOT11_08805"
     CDS             379058..379456
                     /locus_tag="AOT11_08805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA thioester hydrolase"
                     /protein_id="ASM95361.1"
                     /translation="MSQEFHSPKGQLLLRTLAMPADTNANGDVFGGWIMSQLDLAGGI
                     LAKEISHGRIVTVSVSGITFKKPVSVGDVVCVYGECTKIGRTSMSINLEVWVKPVRDH
                     GIEDRFMVCDATFNYVAIDADGKPRPIVTA"
     gene            379558..379854
                     /locus_tag="AOT11_08810"
     CDS             379558..379854
                     /locus_tag="AOT11_08810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000270412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family transcriptional regulator"
                     /protein_id="ASM95362.1"
                     /translation="MWYVIFSQDVENSLEKRLSVRPQHLERLQALQDEGRLLTAGPMP
                     AIDSDNPGDAGFTGSTVIAEFPSLQEAQAWADADPYIAAGVYANVIVKPFKKVF"
     gene            379854..380246
                     /locus_tag="AOT11_08815"
     CDS             379854..380246
                     /locus_tag="AOT11_08815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95363.1"
                     /translation="MFKKVLSASLVLLALAGCSSNGEKERQLELMASNRAGVLSAGLP
                     IEYGPLKVMRISSSKNIVEIMMIYNTDATGAKPTQELLSTSVSKYCEDATVRNQLDMG
                     LMYRIKIRNSRGQLIIDEMVTAASCQPQ"
     gene            complement(380344..381294)
                     /locus_tag="AOT11_08820"
     CDS             complement(380344..381294)
                     /locus_tag="AOT11_08820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathionyl-hydroquinone reductase YqjG"
                     /protein_id="ASM95364.1"
                     /translation="MGKLIEGVWHDVWYDTKQTKGKFVREDAGFRDWIENKPQAPFQP
                     ESGRYHLYVSLACPWAHRTLIFRKLKGLEEHIDVTVVCPDMLSDGWKMGLPEPLFGHT
                     KLHQIYTQAKPDYTGRVTVPVLWDKKTNTIVSNESSEIIRMFNSEFNQLTGNQDDYYP
                     DSLREVIEEWNAFIYPNINNGVYRCGFATTQEAYEEAYYALFSALDRVDHHLATHRYL
                     AGSQMTEADWRLFTTLIRFDAVYVGHFKCNQKRIADYPHLNGYMKELYQIEGIAETTD
                     FYHIKRHYYFSHIGINPTQVVPLGPNLDLDSDHGREGIGR"
     gene            complement(381480..382475)
                     /locus_tag="AOT11_08825"
     CDS             complement(381480..382475)
                     /locus_tag="AOT11_08825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080880.1"
                     /note="with OppABCD is involved in the transport of
                     oligopeptides; OppF and OppD are ATP-binding proteins;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="ASM95365.1"
                     /translation="MSAQEKKILLDVKDLKVHFSIASKSAWPWSKPSSLKAVDGVNIR
                     LYEGETLGVVGESGCGKSTFARAIIGLVNATEGEVVWLGQDLTKMKEVQRRETRKDMQ
                     MIFQDPLASLNPRMTIGDIIAEPLETFYPELGKQEVKSRVKEMMAKVGLLPNVINRYP
                     HEFSGGQCQRIGIARALILNPKMIICDEPVSALDVSIQAQVVNLLKELQKELGLSLVF
                     IAHDLSVVKHISDRVLVMYLGNAVELGTSEALFADPKHPYTRALMSAVPIPDPKLERA
                     KTIQMLEGDLPSPMNPPSGCVFRTRCPQATEACAQTKPTIQGNDTHAVSCLHVEM"
     gene            complement(382472..383443)
                     /gene="oppD"
                     /locus_tag="AOT11_08830"
     CDS             complement(382472..383443)
                     /gene="oppD"
                     /locus_tag="AOT11_08830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transporter ATP-binding component"
                     /protein_id="ASM95366.1"
                     /translation="MSLLDVKDLRVEFTTQDGIVTAVNDLNFSLNQGETLGIVGESGS
                     GKSQTVFAIMGLLAKNGIISGSAKFEGKEILNLPEKELNKVRAEQIAMIFQDPMTSLN
                     PYMKVSDQLMEVLMLHKGMGKAEAFEESVRMLEAVKIPEARKRITMYPHEFSGGMRQR
                     VMIAMALLFRPKLLIADEPTTALDVTVQAQIMDLLNELKQEFNTAIIMITHDLGVVAG
                     SCDKVLVMYAGRTMEYGTVDEIFYNPSHPYAEGLLKAIPRLDTEGEILPTIPGNPPNL
                     LRLPPGCPYQERCHRVIDRCKREAPILTPFADGRQRACFSEWEAWTK"
     gene            complement(383472..384374)
                     /locus_tag="AOT11_08835"
     CDS             complement(383472..384374)
                     /locus_tag="AOT11_08835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572108.1"
                     /note="with OppABDF is involved in the transport of
                     oligopeptides of up to 5 amino acids into the cell;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ASM97792.1"
                     /translation="MLTKKENLEALEKFSENLEIEGRSLWQDARIRFMRNKAAMVSLF
                     ILMVMTLAVIFLPMLAPFTFDDTDWYAMHVGPNAEHWFGTDSLGRDLYVRTLIGGRIS
                     LMVGVLGALVAVTIGTLYGAASGFIGGRTDRIMMRILEILYAVPFMFLVIVLVTFFGR
                     NIVLIFVAIGAIAWLDMARIVRGQTLSLRSKEFIEAAHVCGVSKWKIITRHIVPNVLG
                     IVAVYSTLLIPSMILTESFLSFLGLGVQEPMTSWGALLQEGSQTMEVAIWQLAFPALF
                     MVVTLFCFNYVGDGLRDALDPKDR"
     gene            complement(384392..385312)
                     /gene="oppB"
                     /locus_tag="AOT11_08840"
     CDS             complement(384392..385312)
                     /gene="oppB"
                     /locus_tag="AOT11_08840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006071811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transporter permease"
                     /protein_id="ASM95367.1"
                     /translation="MLKFIIKRIFEAIPTMLVLITVSFFLMRFAPGNPFSSEKPLPPE
                     VMANIEAKYGLDKPVLEQYTTYLFNVIQGDFGPSFKYLDYSVNELISVALPVSAKVGF
                     IAFIFTVILGVTVGTIAALKHNTWVDYTIMSTAMIGVVMPSFVLAPALIYLFALHWDL
                     FPAGGWHDGGLKYLVLPVIGMSLLYVATFARITRGSMIETLNSNFIRTARAKGLSYPY
                     IIVKHALKPAMLPVVSYMGPAFVGIITGSVVIETIFGLPGIGKLFVNAAFNRDYSLVM
                     GVTILIGFLFILFNAIVDILLAMIDPKIRY"
     gene            complement(385415..387046)
                     /locus_tag="AOT11_08845"
     CDS             complement(385415..387046)
                     /locus_tag="AOT11_08845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080884.1"
                     /note="is involved in the transport of the murein peptide
                     L-alanyl-gamma-D-glutamyl-meso-diaminopimelate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="ASM95368.1"
                     /translation="MYKNKITQALLLGAGLTLATTSLSALAADVPAGTKLAAKQELVR
                     GNGTEVATIDPHKSQGVPESHVIRDLLEGLVNQDADGNTIPGVATSWETTDNKTFTFH
                     LRKDAKWSNGDPVTAQDFVYSWQRAVDPATASPYSWYMEYTKMKNAKDIVAGKKDKSE
                     LGVKAADDYTLVIELETAVPYFVMMTGHTTMKPVHKATVEKFGDQWTKPENFVGNGAF
                     VVDKWVVNERLEMVRNTKYWDDSKTVINKVTFLPIENAVAEMNRFLSGEIDFTSTLPT
                     EHFKRLKKEHPESVSVEGSLCTYYYSFNTKKKPFDDVRVRKAISYAIDRDIVANAILG
                     QGQKPAYFLTPEITANFNPELPEYGKMSQKERNAEAARLLEEAGYGKGNPLKFTLLYN
                     TNENHKKIAVALGSMWKKTLGLDVNLENQEWKTYLSTKDQGDFEVARAGWCGDYNEAS
                     SFLTLMVSANTTGGQHWGNAEYDALIDKALKSTSEAERTALYLDAENLMAKDMPIAPI
                     YQYVRSRLLNPRVGGFPSNNAEEKIYSKDLYIIAK"
     gene            complement(387603..388058)
                     /locus_tag="AOT11_08850"
     CDS             complement(387603..388058)
                     /locus_tag="AOT11_08850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin synthase catalytic subunit"
                     /protein_id="ASM95369.1"
                     /translation="MDNRISVQVEDFDIAAEYAWLSQGSAAGAVVTFVGKVRDMNLGD
                     NVTGLSLEHYPGMTEKALGEICDQAEQRWPLLNVRVIHRVGDLNIGDQIVYVGVSSAH
                     RGAAFEACEFIMDYLKTKAPFWKKERTTETTRWVESRESDAQAAERWQS"
     gene            complement(388060..388305)
                     /locus_tag="AOT11_08855"
     CDS             complement(388060..388305)
                     /locus_tag="AOT11_08855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin synthase"
                     /protein_id="ASM95370.1"
                     /translation="MIKVLFFAQTRELVGVDSVDVEANFDTVESLRAHLAEQEGKWSL
                     ALEAGKLLAAVNQSIVPLETTLQDGDEVAFFPPVTGG"
     gene            complement(388302..388781)
                     /gene="moaC"
                     /locus_tag="AOT11_08860"
     CDS             complement(388302..388781)
                     /gene="moaC"
                     /locus_tag="AOT11_08860"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MM73.1"
                     /note="MoaC; along with MoaA is involved in conversion of
                     a guanosine derivative into molybdopterin precursor Z;
                     involved in molybdenum cofactor biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaC"
                     /protein_id="ASM95371.1"
                     /translation="MSQFTHINASGEANMVDVSAKAETVREARAEAFVHMAPETLQLI
                     VSGQHHKGDVFATARIAGIQAAKKTWDLIPLCHPLLLSKVEVQLEAIEAENKVRIESV
                     CKLAGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGSVRLLEKTGGKSGHFKVEA"
     gene            complement(388792..389287)
                     /locus_tag="AOT11_08865"
                     /note="molybdenum cofactor biosynthesis protein B;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(389366..390355)
                     /gene="moaA"
                     /locus_tag="AOT11_08870"
     CDS             complement(389366..390355)
                     /gene="moaA"
                     /locus_tag="AOT11_08870"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MM75.2"
                     /note="together with moaC, is involved in the conversion
                     of a guanosine derivative (GXP) into molybdopterin
                     precursor Z; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic pyranopterin phosphate synthase MoaA"
                     /protein_id="ASM95372.1"
                     /translation="MAQQFEDRFHRKFYYLRLSVTDVCNFKCTYCLPDGYQPSGQKNS
                     SFLNLAEIRRVVKAFADCGTSKVRITGGEPSLRKDFTDIIHTVASTQGIKRVATTTNG
                     YRMEKHIGEWKEAGLNQVNVSVDSLDPRMFHQITGENKFHQVMSGIDRAFEVGFEQVK
                     VNVVLMKDLNHNELPAFLHWIKHRPIQLRFIELMQTGEMDTLFQQHHVSGVAIRNHLI
                     ANGWLLKVKAANDGPAQVFVHPDYQGEIGLIMPYEKDFCASCNRLRVSAKGKLHLCLF
                     GDRGVELRDLLQQDSQESALIERIQAELQTKSVSHFLNDGNTGMTPHLASIGG"
     gene            390670..391560
                     /locus_tag="AOT11_08875"
     CDS             390670..391560
                     /locus_tag="AOT11_08875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95373.1"
                     /translation="MNIYASKKVVAVGGGHGLGRMLAALKEFSGNATGIVATTDNGGS
                     TGRIRHCQGGIAWGDTRNCINQLITEPSISSMMFEYRFKGSGELDGHNLGNLMLTALD
                     NLSVRPLDAINLVRDMLKVQVNILPMSEHPSDLTALSTDGRWVTGETNVDEMDTDLRR
                     LDLSPEVPATKEAVTALEEADAIILGPGSFLTSIMPPLLLPELGKAIAHNKKAKLIFV
                     ANLSPEFGPAGRMSFKDKLEWCERACQGRKIDVVLGDTEHPELKDRWHFVTQSLASAN
                     RDWRHDRKKLRLAIEQQLTE"
     gene            complement(391647..391994)
                     /locus_tag="AOT11_08880"
     CDS             complement(391647..391994)
                     /locus_tag="AOT11_08880"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MM77.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphorelay protein LuxU"
                     /protein_id="ASM95374.1"
                     /translation="MELLNQKKIASLTEEIGADNVPVLLEIFLNELESYLKVLCDATY
                     SDKLVYLKDISHALKSSAASFGADALCHFAVEIDTRAKEGDALDETQDVVTMIDRLHQ
                     TQQAYLNWQANGF"
     gene            complement(391994..393394)
                     /locus_tag="AOT11_08885"
     CDS             complement(391994..393394)
                     /locus_tag="AOT11_08885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="ASM95375.1"
                     /translation="MQQITTTKQRYLLMVEDTASVAALYRSYLMPLGIDINIVGTGRD
                     AIDSLKHRIPDLILLDLRLPDMTGMDVLHAVKASHPDVPIIFMTAHGSIDTAVEAMRH
                     GSQDFLIKPCEADRLRVTVNNAIRKASKLKNDSDSAGSQNYQGFIGSSQKMQQVYRTI
                     DSAASSKASIFITGESGTGKEVCAEAIHAASRRGDKPFIAINCAAIPKDLIESELFGH
                     VKGAFTGAATDRQGAAELADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMK
                     SVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRERGEDVIEIAYSLLGY
                     MSHEEGKNFVRFSQSVIDRFNEYEWPGNVRQLQNVLRNVVVLNNGKEITMEMLPPPLN
                     QPFERKESAQPDLSELISVRDICPLWLTEKLAIEQAIKACDGNIPRAAGYLDVSPSTI
                     YRKLQAWNEKEEKQKA"
     gene            complement(393702..395732)
                     /locus_tag="AOT11_08890"
     CDS             complement(393702..395732)
                     /locus_tag="AOT11_08890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572115.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. The beta-hairpin of the
                     Uvr-B subunit is inserted between the strands, where it
                     probes for the presence of a lesion; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit B"
                     /protein_id="ASM95376.1"
                     /translation="MSKLYDLVSDYAPSGDQPTAIKQLTEGLDAGLAHQTLLGVTGSG
                     KTFTLANVIAQAQRPAILLAPNKTLAAQLYGEMKAFFPNNAVEYFVSYYDYYQPEAYV
                     PTTDTFIEKDSSVNAHIEQMRLSATKALLERKDAIIVASVSAIYGLGDPEAYLQMMLH
                     IRRGDVMDQRDILRRLAELQYSRNDIAFERGQFRVRGEVIDVFPAESDQDAVRIEMFD
                     DEIDCISVFDPLTGVVKQRDLPRFTIYPKTHYVTPRERILQAIENIKQELRERQTYLR
                     DNNKLLEEQRISQRTQFDIEMMNELGFCSGIENYSRYLSGRAEGEPPPTLFDYLPHDG
                     LLIIDESHVTVPQIGAMYKGDRSRKETLVEYGFRLPSALDNRPLKFEEFEALAPQTIF
                     VSATPGNYELEKSAGEIADQVVRPTGLLDPVLEVRPVATQVDDLLSEIRIRAVKDERV
                     LVTTLTKRMAEDLTEYLHEHDVKVRYLHSDIDTVERVEIIRDLRLGEFDVLVGINLLR
                     EGLDMPEVSLVAILDADKEGFLRSERSLIQTIGRAARNLHGKAILYADSITKSMKKAM
                     DETERRREKQQAYNEKIGIQPQALKRNIKDIMELGDITKSRKQKVSKTVPLSKVAEPS
                     LSYNVLTPQQLEKEITKLEAQMYKHAQNLEFELAAQKRDEIEKLRQQFIANS"
     gene            complement(395827..396015)
                     /locus_tag="AOT11_08895"
     CDS             complement(395827..396015)
                     /locus_tag="AOT11_08895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95377.1"
                     /translation="MNEKNKKWGKDVDDKNVFFADRAMIGRRRISELKLISQKNVMKW
                     LTLFNNKSGHCRLIRLAD"
     gene            396342..396417
                     /locus_tag="AOT11_08900"
     tRNA            396342..396417
                     /locus_tag="AOT11_08900"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:396375..396377,aa:Asn,seq:gtt)
     gene            396613..397191
                     /locus_tag="AOT11_08905"
     CDS             396613..397191
                     /locus_tag="AOT11_08905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017027035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transporter RsxA"
                     /protein_id="ASM95378.1"
                     /translation="MTEYILLLIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLA
                     TTFVLTMASVCAYLVESYILEPLHIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRL
                     LGIFLPLITTNCAVLGVALLNINENHSFVESIIYGFGAAVGFSLVLILFASMRERISA
                     ADVPVPFKGASIAMITAGLMSLAFMGFTGLVK"
     gene            397193..397789
                     /locus_tag="AOT11_08910"
     CDS             397193..397789
                     /locus_tag="AOT11_08910"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D889.1"
                     /note="part of membrane-bound complex thought to be
                     involved in electron transport to nitrogen; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transporter RnfB"
                     /protein_id="ASM95379.1"
                     /translation="MTTIMIAVLAIALLATLFGAILGFASIRFKVEADPIVDQIDAIL
                     PQTQCGQCGYPGCRPYAEAIANGDSINKCPPGGQATIEKLADLMGVEAEESAHDLEGK
                     VKKVAFIHEDMCIGCTKCIQACPVDAIVGGTKALHTVIKDECTGCDLCVAPCPTDCIE
                     MIPLETTTETWKWQLNAIPVVNISEANPNSATSRDQNN"
     gene            397802..400327
                     /locus_tag="AOT11_08915"
     CDS             397802..400327
                     /locus_tag="AOT11_08915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transporter RnfC"
                     /protein_id="ASM95380.1"
                     /translation="MLSLIEQIRTGALWDFPGGVHPAENKRQSNQQPLVHAALANEIV
                     LPLKQHIGKPGNILVNVGDHVLKGQLLTQSNAGFTLPIHASTSGTITAIETRTVAHPS
                     GLSEMCVVITPDGQDTWCEKQPVVDYSQQNSDYLLDVIRMAGISGMGGAGFPTAKKIQ
                     SGLGRTEILIVNAAECEPYITADDKLLQEHAEEVLQGIEIVEHILQPKLTIIGIEDNK
                     PEAIKALESAAQNKDIVIRVIPTKYPSGGEKQLIKVLTNKEVPAGGIPADIGILVQNV
                     GSLYAIKRAVIDGEPMVNRVVTLTGNTFETPRNVWVPLGTPVHALLEQFGYQADKKLP
                     RLIMGGPMMGFSLPHANVPITKTSNCILAPTRKEISPAGYEMECIRCGACAEACPASL
                     LPQQLQWHAKAEEFDKCEELNLKDCIECGACAFVCPSEIPLVSYYRQAKAEIRTRAQE
                     ADAAERAKLRFEEKKARMEREKEERENRFKKAAEDRRKEMKSTGGDDAIAAAIARVKA
                     QKTQDSEQTPSVKPAVAAAIAKAKAKQAAAADSGSSEPDNSEMVKLREERKRLARERK
                     AEKEQSTIPDSQEQGDKKSAVAAAIARAKEKRAQQPPLASSESSAEEPEDKKAAVAAA
                     IARAKARKAQQTGEPAPEQNREESQVADDDPKKTAVAAAIARAKARKAQQTDEPAPEQ
                     NREESQVADDDPKKAAVAAAIARAKARKSQQAGEPAPEQNREELQPAEDDPKKAAVAA
                     AIARAKARKAQQAGEPAPEQNREESQPADDDPKKAAVTAAIARAKARKAQQTDKPAPE
                     QNREELQPAEDDPKKAAVAAAIARAKARKAQQAEQKQNTEENE"
     gene            400327..401394
                     /locus_tag="AOT11_08920"
     CDS             400327..401394
                     /locus_tag="AOT11_08920"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transporter RnfD"
                     /protein_id="ASM95381.1"
                     /translation="MSFFIASSPHAHSRKSTPDLMKWVALCALPGLLAQTYFFGWGTF
                     VQLILAITIALSLEALVMLLRKRPPMRALRDHSALVTAWLLAVAIPPMAPWWIITIGL
                     LFAIVIAKHLYGGLGQNPFNPAMIAYVVLLISFPVQMTSWSAPLPLIEAGHEVAKDPV
                     TFGDLLSLIFTGLTIDGSSLQQVRAGIDGITTATPLDAFKTGLHSGATSSEILSQPIF
                     EGFAGVGWQWVNLAYLAGGLILLKQRVIQWHIPVGFLGALLVMSSFFSLFFPGETASP
                     LFHLLSGATMLGAFFIATDPVSASTTIKGRILFGAIIGSLVFIIRSWGGFPDGVAFAV
                     LLANMCVPLIDYYTKPRTYGH"
     gene            401410..402045
                     /locus_tag="AOT11_08925"
     CDS             401410..402045
                     /locus_tag="AOT11_08925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790695.1"
                     /note="part of membrane-bound complex hought to be
                     involved in electron transport to nitrogen; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transporter RnfG"
                     /protein_id="ASM95382.1"
                     /translation="MLNAIRKNGLTLAIFACATTGLVAMTQYLTKDQITLQEQKQLSS
                     VLNQVIPQSAHDNLLFESCTLVSDSALGSDKAMPAYIATRNGQATAIAIESVAPDGYN
                     GAIKIITGIDASGTVLGTRVLSHQETPGLGDKIDLRVTDWITSFTGKQLNDDNYNSWK
                     VRKDGGEFDQFTGATITPRAVVKAVRNTVEFVNSHREQILNQPLNCGGRYE"
     gene            402038..402730
                     /locus_tag="AOT11_08930"
     CDS             402038..402730
                     /locus_tag="AOT11_08930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="ASM95383.1"
                     /translation="MSEHKKLLKNGMWDNNPALVQLLGLCPLLAVSSTVTNALGLGIA
                     TLLVLVGSNVTVSLIRNYVPKEIRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFI
                     PLIVTNCIIIGRAEAYASKNDPLPAALDGFWMGMGMTTVLVVLGAMREIIGNGTLFDG
                     ADLLLGEWASALRIQVFQFDSSFLLALLPPGAFIGVGLLIALKNVIDTQLKARQPKQE
                     KPAIERARVTNA"
     gene            402802..403443
                     /locus_tag="AOT11_08935"
     CDS             402802..403443
                     /locus_tag="AOT11_08935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006963075.1"
                     /note="DNA-(apurinic or apyrimidinic site) lyase; has
                     apurinic or apyrimidinic endonuclease activity and DNA
                     N-glycosylase activity; removed damaged DNA at cytosines,
                     thymines and guanines; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="ASM95384.1"
                     /translation="MNKDKRIQILERLRENNPNPQTELNWNSPFELLIAVLLSAQATD
                     VSVNKATDKLFPVANTPQAMLDLGVEGLKEYIKTIGLFNSKAENTIKTCRILLEKHNG
                     EVPEDRAALEALPGVGRKTANVVLNTAFGWPTIAVDTHIYRVSNRTKFAPGKNVDEVE
                     QKLLKVVPKEFKLDVHHWLILHGRYTCIARKPRCGSCIIEDLCEFKEKVYPEN"
     gene            403468..403884
                     /locus_tag="AOT11_08940"
     CDS             403468..403884
                     /locus_tag="AOT11_08940"
                     /EC_number="4.4.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005476906.1"
                     /note="Ni-dependent; catalyzes the formation of
                     S-lactoylglutathione from methylglyoxal and glutathione;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase I"
                     /protein_id="ASM95385.1"
                     /translation="MSNGRILHTMLRVGNLEKSIQFYTEVMGMQLLRTNENKEYEYTL
                     AFLGYGDESQGAVIELTYNWGKTEYDLGSAFGHIAIGVDDIYVTCDAIKAAGGNVTRE
                     PGPVKGGTTHIAFVKDPDGYMIELIQNKQASAGLEG"
     gene            404014..404448
                     /locus_tag="AOT11_08945"
     CDS             404014..404448
                     /locus_tag="AOT11_08945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95386.1"
                     /translation="MISEWEKHTLLADTALQLDDPIRSILHYQQAYNLSEDIIASSTV
                     EADDKLLISVISCHNLAQFWRWAGDTDYELKYLQLASEKVLTLIPQCPHHQCESFIES
                     IGCCKKALFDFLKRHPNPKIAQLVEKIDTATHCEIIAKFKLN"
     gene            complement(404445..405326)
                     /locus_tag="AOT11_08950"
     CDS             complement(404445..405326)
                     /locus_tag="AOT11_08950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein MotY"
                     /protein_id="ASM95387.1"
                     /translation="MKKWLITSGLVLTTFASLPSAAMTKRYIATPQQSQWEMVMNSPL
                     ECRLVHPIPNYGDAEFSSRASKKIVLDFELKMRRPMGETRNVSLISMPPPWRPGENAD
                     RITNIKFFQQFNGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSAVLFQQ
                     KYNVFSDCVANLLPYSFEDISFTILHYERNGDKLTKASQKRLSQIAEYVRYNSDIDLV
                     LVSTYTDSTDGTSVSQNLSERRAESLRDYFKALGLPEDRIQVQGYGKRRPIADNATPI
                     GKDKNRRVVISLGRSEV"
     gene            405525..406178
                     /locus_tag="AOT11_08955"
     CDS             405525..406178
                     /locus_tag="AOT11_08955"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MM91.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease T"
                     /protein_id="ASM95388.1"
                     /translation="MTVENTALTLKKRFRGYFPVVVDVETAGFNAQTDALLEICAVTL
                     SMDENGDLHPASTIHFHVEPFEGANLEKEALEFNGIRDPFSPLRGAVTEQEALKEIYK
                     LIRREQKAADCSRAIMVAHNAAFDLSFVNAANERCKLKRVPFHPFATFDTATLSGLAY
                     GQTVLAKACKTAGMEFDNREAHSALYDTEKTAELFCGIVNKWKALGGWPLIEDENEK"
     gene            406207..407532
                     /locus_tag="AOT11_08960"
     CDS             406207..407532
                     /locus_tag="AOT11_08960"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P46231.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="ASM95389.1"
                     /translation="MNPVVISVCVMLVLALMRVNVVVALTFSAIVGGLVAGMGLGDTI
                     AAFESGLGGGATIALSYAMLGTFAVAISKSGITDLLARSVIKHLNGKESDASTTGLKY
                     AVLVALVLVTMSSQNVIPVHIAFIPILIPPLLGVFAKLKLDRRLVACVLTFGLITPYM
                     VLPVGFGGIFLNNILLKNLHDNGLESVVASQVPTAMLLPGAGMVFGLLTAIFFSYRKP
                     REYRETELTVVHEESKGINKKHILVAALGIIAALSVQLYTGSMIIGALAGFMVFTFGG
                     VIAWKETHDVFTKGVHMMAMIGFIMIAAAGFAAVMKQTGGVETLVQSLSTSIGDNKGL
                     AALLMLVVGLLVTMGIGSSFSTIPILATIYVPLSIAFGFSPMATIALVGTAAALGDAG
                     SPASDSTLGPTSGLNADGQHEHIWETVVPTFIHYNIPLIIFGWIAAMVL"
     gene            complement(407662..408291)
                     /locus_tag="AOT11_08965"
     CDS             complement(407662..408291)
                     /locus_tag="AOT11_08965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="ASM95390.1"
                     /translation="MKIKLYYVHDPMCSWCWGYKPTLEKLKQQLPGVIQFEYVVGGLA
                     SDSTLPMSPEMQQKIESIWHQIEQRLGTQFNYEFWTRCTPVRSTYQACRAVIAAGFQD
                     SYEQMLEAIQHAYYLRAMPPHDEATHRQLAQEIGLNVQQFENDVTGRLLEGVFEDQLS
                     LARSLGVNAYPSLVLQINDAYFPIEIDYLSTEPTLKLIRERIVENMPAQ"
     gene            complement(408400..408738)
                     /locus_tag="AOT11_08970"
     CDS             complement(408400..408738)
                     /locus_tag="AOT11_08970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="ASM95391.1"
                     /translation="METIDKIKQQIAENPILLYMKGSPKLPSCGFSSQAAQALMACGE
                     KFAYVDILQNPDIRAELPKYAEWPTFPQLWVEGELIGGCDIVIEMFQKGELQPLIKEA
                     TARAAGNDAE"
     gene            409039..409623
                     /locus_tag="AOT11_08975"
     CDS             409039..409623
                     /locus_tag="AOT11_08975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008077955.1"
                     /note="SodB; iron binding; present under aerobic and
                     anaerobic conditions; destroys free radicals; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="ASM95392.1"
                     /translation="MAFELPALPYAKDALEPHISAETLEFHHGKHHNTYVVKLNGLIP
                     GTEFEGKTLEEIIKTSTGGIFNNAAQVWNHTFYWHCLAPNAGGEPTGAVAEAINAAFG
                     SFEEFKAKFTDSAINNFGSSWTWLVKKADGSLAIVNTSNAATPITEEGVTPLLTVDLW
                     EHAYYIDYRNLRPDYMNGFWALVNWDFVAENLAK"
     gene            409745..410248
                     /locus_tag="AOT11_08980"
     CDS             409745..410248
                     /locus_tag="AOT11_08980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="queuosine biosynthesis protein QueD"
                     /protein_id="ASM95393.1"
                     /translation="MQIHTLDKASIINELSFGNGISQAVQQGRRADFALLLSMFSEDA
                     RHITPVEQIETQEMTDAVLRKQFGLSEPQKLRSDQSSYAISAEQAKQFHNAGLPSAKL
                     SHYLSAEPLAYMPEETFDLPEEVYQNLSGHERAKLATPEVKLLPEAGLYNHLSTALVK
                     AKFAAYA"
     gene            410469..411152
                     /locus_tag="AOT11_08985"
     CDS             410469..411152
                     /locus_tag="AOT11_08985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="ASM95394.1"
                     /translation="MDIKNALILVTSAGSLLGRTVAAHFARLGAIVILCDQDQTSLSE
                     THKELYAITQDVYPITLQDYSQSSIQSLFDHIQAQFNRVPNVLVNCWTSSPLPLLNTE
                     ATSEGFIEKLSSTAGALYGYVQVCAERMRRTETKGVIVNVISHDDHLNFTGVESVTSL
                     VSGFTHSWAKELTPFNIRVGGVIPSVSHHHGQIDATHWAQVQDELIRNAEYIVANEYF
                     SGRVVTTEV"
     gene            complement(411175..411558)
                     /locus_tag="AOT11_08990"
     CDS             complement(411175..411558)
                     /locus_tag="AOT11_08990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma"
                     /protein_id="ASM95395.1"
                     /translation="MKSKLLVVLLFSSSTQASLIIDKNGIDEKEYIYDLHQCEALSEQ
                     VEKETQSRGAVGGALKGAAIGSAGTAIAGGSGSEGAKKGAAVGLAAGVIGGSRDRREN
                     SKNYQEQKHQVLRNCMTNRGYVILN"
     gene            complement(411785..414460)
                     /locus_tag="AOT11_08995"
     CDS             complement(411785..414460)
                     /locus_tag="AOT11_08995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001145584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetaldehyde dehydrogenase"
                     /protein_id="ASM95396.1"
                     /translation="MPVTNLAELDALVERVKAAQAEFATYSQEQVDKIFRAASLAANQ
                     ARIPLAQQAVAESGMGIVEDKVIKNHFASEFIYNKYKDEKTCGVLEEDDNLGTMTIAE
                     PVGIICGIVPTTNPTSTAIFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAA
                     GAPKDIIGWIDQPSVELSNALMKHDGIALILATGGPGMVKAAYSSGKPAIGVGAGNVP
                     VVIDETADIKRAVASILMSKTFDNGVVCASEQAAIVVDSVYDEVKERFASHKAYVLNK
                     AEADKVRKVLLIDGNLNAKIVGQPAPAIAEMAGVKVPADTKVLVGEGLGKVSYDDAFA
                     HEKLSPTLGLFRADNFEDAVAQAVTMVEIGGIGHTSGLYTNQDVNADRIRYFGDKMKT
                     ARILVNIPTTHGGIGDLYNFNVAPSLTLGCGSWGGNSISENVGPKHLINKKTVAKRAE
                     NMLWHKLPKSIYFRRGSLPIALSDLEGKKRAFLVTDRFLFNNGYADDVVQLLKAQGME
                     VQTFFDVEADPTLSVVEKGAAAMQSFQPDVILALGGGSPMDAAKIMWVMYEHPETHFE
                     ELAMRFMDIRKRIYKFPKMGQKAELVCITTTSGTGSEVTPFAVVTDDKTGAKYPLADY
                     ELTPQMAIVDANLVMNMPKSLTAFGGYDAVTHALEAYVSVLANEYSDGQALQALKMLK
                     EYLPSSYANGAKDPIAREKVHNAATIAGIAFANAFLGVCHSMAHKIGAEFHLPHGLAN
                     ALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADHLGLSQAGDRTAQKIERLL
                     AWLDELKGNLDIPLSIQSAGVAEADFLAKVDELAVEAFDDQCTGANPRYPLIAELKEV
                     LLASYYGKAFVEGETFEGTTVIKKKADQVAPKAKK"
     gene            415108..415746
                     /locus_tag="AOT11_09000"
     CDS             415108..415746
                     /locus_tag="AOT11_09000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006877465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95397.1"
                     /translation="MQTFEVAIFLQFFLGLVAAVNPVGIMPVFVSLTGHMTPEEKYKT
                     ALTANVAVAIILTVSLLAGQMLLDMFSISLDSFRVAGGLLLLSIAFSMMSGKLGEDKQ
                     NKQEQSEYVSREQIGVVPLAMPLMAGPGAISSTIVYGSRYPSMFDTMGIVITIVAFSF
                     CSWLLFRSAPIIVRFLGQTGINVITRIMGLILGALGIEFIANGLRNLFPGLA"
     gene            415798..416658
                     /locus_tag="AOT11_09005"
     CDS             415798..416658
                     /locus_tag="AOT11_09005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ion transporter"
                     /protein_id="ASM95398.1"
                     /translation="MSRQSLKHHLYVIIFGTHTPAGRAFDIGLIVAILTSLLVLLLES
                     IPSIRAQWASELKYLEYGFTALFTLEYLLRLYCSPKPAAYARSFYGVVDLLAILPTYL
                     AFLFPSAAFMGVIRLLRVMRIFRILKLVRYLQDSNLLMRSLLMARRKILIFFSAVAIL
                     VTIFGSLIYVIEGPHNGFTSIPKSIYWAIVTITTVGYGDLVPQTNIGKAIASLTMLLG
                     YSILAVPTGIITAELNQEMNSHRQLVKCPNCSRAGHESDALFCKHCGSELADPDKRVV
                     AVQSTESDKK"
     gene            complement(416707..417246)
                     /locus_tag="AOT11_09010"
     CDS             complement(416707..417246)
                     /locus_tag="AOT11_09010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="V10 pilin"
                     /protein_id="ASM95399.1"
                     /translation="MRVVFCMYKKFRGFTLIELIVVIVLVAVLAVIAAPRFLNLQSDA
                     RRSVVEGLAGAVTNAAEMAYGKTAVEGMEELESYHVPNYGIVQYGYPSVSRGGMESFL
                     QIDTGYHDLEREWVWAAHNNGSVSDPDWWIITQSQWLADGNIVDFNKAIEESRCYVKY
                     TAAMEPGADFAVETITDGC"
     gene            complement(417347..418462)
                     /locus_tag="AOT11_09015"
     CDS             complement(417347..418462)
                     /locus_tag="AOT11_09015"
                     /EC_number="1.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428851.1"
                     /note="catalyzes the formation of 4-aspartyl phosphate
                     from aspartate 4-semialdehyde; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="ASM95400.1"
                     /translation="MRVGLVGWRGMVGSVLMQRMVEEKDFDLIEPVFFSTSQIGIPAP
                     NFGKDAGLLQDAFNIDALKQLDAVITCQGGGYTEKVYPALREAGWKGYWIDAASTLRM
                     APDSIITLDPVNLAQIQQGIHSGTNTFVGGNCTVSLMLMALGGLYKQGMVEWMSAMTY
                     QAASGAGAQNMRELISQMGVINDAVSSELANPSSSILDIDRKVAETMRSSSFPVDNFG
                     APLAGSLIPWIDVKRENGQSKEEWKGGVEANKILGLQNSPIPIDGTCVRIGAMRCHSQ
                     ALTIKLKQNVPLDEIEEIIASDNEWVKVIPNERDITAQELTPAKVTGTLSIPVGRLRK
                     MSMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAEKQ"
     gene            418874..420310
                     /locus_tag="AOT11_09020"
     CDS             418874..420310
                     /locus_tag="AOT11_09020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antiporter"
                     /protein_id="ASM95401.1"
                     /translation="MKQEITRLPSLPQVLISLGLFLLLAFSFTAKLDLPIQLALYIGW
                     FIIMVLGLRLGHQYKDLEKAALNGISNGLGAVLILLAVGALVGTWISGGIVPTIIYYG
                     LKAIHPSIFLLATMIICSLTALATGTSWGAAGTAGIAMMGIGQGLGVPAPITAGAVLS
                     GCYFGDKMSPLSDSVILASSMSNVEVMEHIKGMLPIALISYIITGIMFTAFGFHYAGN
                     VDMSQVESVIKAMDQQFYITPYSFVPVIIVLALLAMRMPSFPVISFGSLLGIIWAVMI
                     QDVDFLTAFNTAWAPFAISSGVDFIDSILNRGGMSSMLGSVAVIVFGLGFGGLLDKVG
                     VLETIAKLFERRVQNAGSLATSTIGTAFMGNVFGSAMYVSLILTPKICAKNYDRLGYK
                     RKNLSRNAEFGGTLTSGMVPWSDNGIYMASILGVATLSYAPFMWLSFVCIAVTIFTSY
                     MGWFVDKCEPTAQASEDETLAETRQQTA"
     gene            complement(420400..421584)
                     /locus_tag="AOT11_09025"
     CDS             complement(420400..421584)
                     /locus_tag="AOT11_09025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM95402.1"
                     /translation="MVAFYKSFCLPILALMSLSGCSLLEVKLDSQVTPLTQQELNTRL
                     HTREYALQFFTQVEQTADTLKSRYPATDTLHQSYILLWKINAEEGLARAAYQVSPTAA
                     LIDSWVFTQQMADYFSQGPGREQFELALASDASQALLTQVEELASDLLKNSSYKSSEQ
                     FVREFATQHPFTDLKFNPTPAYRAWLKANDINEDEAIATLGTMPEALGDVSDRLSLIS
                     EQTPKIMSWKAELIALNSHISGEDLSQTLASMKATSEAFQDFVKNNPEYMKNLAEQMA
                     IELQPLVVDIDQKTSRQMSKLDEQRAALEAMVARERVELFAMIEREREALNKMVTQER
                     VSFTQDMDKLSQDVVALAMDKLVELIKSVIIYFVLFIAVIFFAPLGLGYALGKRAQRK
                     IS"
     gene            complement(421669..423003)
                     /locus_tag="AOT11_09030"
     CDS             complement(421669..423003)
                     /locus_tag="AOT11_09030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95403.1"
                     /translation="MVRLSNKWVFRYSLGLALVWLCSVAFVWMQITNMRAAVDAVEEV
                     GNKIEEVHAAFSYKREQRIQKLDEISLNVQLIYALRIQLEATYVHSFFAPDITQFLHV
                     TDRYIDSVKTILQIDTRLSDLVAEVRRQRLQQTHADSILSFALLGSYISEATLSNSTR
                     LSPVFKDIDNLVLLSNELEEAQRVPLQKLLAQSAVVLGQNAEVNHLVNQVSTHEVYAQ
                     QSWLEEQYHHIVLQSIVIVIAVSGLCFLGLLWLLYWGNTLVKSPQQSAENEVLHVPTE
                     TLRERLSSEAVQTEERQEQSSRQSDTALLEQRTEIDRNRSMSTTAVPQGSEELPPIKI
                     DLMMDSLSGDEESVQMLLSVFVQDHADEHSNFVATYRDDPETAQRIVHSLKGVAASLG
                     ADALRKVAMEIESSMKHGHEPTEQQLQQLKECIDKTVAYAHRILNREIIISS"
     gene            complement(423118..424119)
                     /locus_tag="AOT11_09035"
     CDS             complement(423118..424119)
                     /locus_tag="AOT11_09035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid-associated protein NdpA"
                     /protein_id="ASM95404.1"
                     /translation="MSLHLSNVILHQLSKNDQDELMVNYRSESLVNDSSTENLVAELH
                     RVFHSKAGKGFGCFQSDSEFQIWLNELQRGELDFYDFSQKCAVRLKEELAKYPFADEG
                     ILVFAEYQSLATDYLFVGILPLNQSLKVTEGLDISATDYLDINKMDIAARIDLSVYEA
                     DKDSNRYLSYIKGRVGRKVADFFLDFLQAEVGLDSKQQNQVLMQALDDFCTDAKLEKQ
                     EVNEYKKQVYEYCNGQIKAGEEVEIRELSGELPPSPSGASFLEFTQEQGYGLEESFPA
                     DRGLVRKLTKYVGAGGGLNVSFDSLLLGERIFYDPETDTLTIKGTPPNLRDQLTRNR"
     gene            424204..424431
                     /locus_tag="AOT11_09040"
     CDS             424204..424431
                     /locus_tag="AOT11_09040"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D866.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95405.1"
                     /translation="MPITSKYTDEQVESILTEIGAVLDKHGATPELSLMIAGNIATNV
                     LNQQVAASQRKLIAEKFAQALISSLQEPKTH"
     gene            424453..426273
                     /locus_tag="AOT11_09045"
     CDS             424453..426273
                     /locus_tag="AOT11_09045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ASM95406.1"
                     /translation="MVDSGNSYGERVSRLVGWGHWFAFFNIIAAMLIGTRYITQSPWP
                     ETLLGQFYLVVSWVGHFGFLVFALYLLILFPLTFLLPSQRLFRLTSVVFATTGLTVLL
                     IDTQAYQSINLHLTPVVWELLFSDDKSALSADLQHLFIVLPLIFFLQLGLSEWVWKKQ
                     RKLAHKHIGRPLAAVFFVCFIVSHLIYMWSDAYFYNPVTSQRANFPLSYPMTAKSFME
                     KHGLLDRDEYLKRLEANENNVELVRYPLDQLTFNRRGNNLNVLMISVNNLRSDRLSAE
                     QMPNMFEFASNNQWFTNHYSSSNDGYGIFGLFYGLPTSYASSIKAQGTAPIFLKVLQD
                     HGYQFGLFSGNGFNEPLYSEVIFRNQHLATQIEAEKNAQQAVTHSDANAVDAWNEWVV
                     NQAKSPWFSYIEVTELDNIETASLPTTANASDKFKQAYDVAVRQADSTLQRIFATLDE
                     QQLSDNTVVIITSNHGSEFNETQTNSWGANSNYSRYQLQVPMVIHWPGKLPAQFGQST
                     SHLDLSVTLLQDLMGVASNPADFSSGRNLFDESKRRWILAGDTREIALITPNQTTVID
                     KFGNFKLYDNHYQRVRDDSPKLPVLMQGLTELQRFYAKSN"
     gene            426359..426449
                     /locus_tag="AOT11_09050"
     tRNA            426359..426449
                     /locus_tag="AOT11_09050"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:426393..426395,aa:Ser,seq:tga)
     gene            426749..427411
                     /locus_tag="AOT11_09055"
     CDS             426749..427411
                     /locus_tag="AOT11_09055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter KtrA"
                     /protein_id="ASM95407.1"
                     /translation="MRRAEKQFAVIGLGRFGLAVCQELTDSGAQVLAIDVNEERVKLA
                     ASFVTQALVANCTHEETMAELKLDDYDMVMVAIGADMNSSILATLIAKEAGVKSVWVK
                     ANDKFQARVLQKIGADHIIMPERDMGIRVARKMLDKRVLEFHPLGSGLAMTEFVVGSR
                     LMGKTLGELALCKVPGVQVLGFKRGPELVKAPELDVELEIGDMIILVGPQDALANKLS
                     SL"
     gene            427408..428778
                     /locus_tag="AOT11_09060"
     CDS             427408..428778
                     /locus_tag="AOT11_09060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ktr system potassium transporter B"
                     /protein_id="ASM95408.1"
                     /translation="MNPFSSNNGLFYLADKASKQSKGNEPRIILLSFLAVLLPSAILL
                     TLPVFSVSGLSITDALFTATSAISVTGLGVVDTGQHFTLAGKILLMLLMQIGGLGQMT
                     LSAVLLYMFGVKLSLRQQALAKEALGQDRQVNLRRLVKKIVVFAFVAELIGFVLLAFR
                     WVPEMGWQSGLFYALFHAISAFNNAGFALFSDSMMSFVDDPLVIFTLAALFIFGGLGF
                     TVVGDVWMNWRRGFHFLHLHTKIMLVATPALLIIGTLLFFVLEQHNASTMGELSTSGQ
                     WLAAFFQSASARTAGFNSVDLAQFTQPALLVMIVLMLIGAGSTSTGGGIKVSTFAVAF
                     MATWAFLRQKKHVVMFQRTVNWPTVTKSLAIIVVSGAILTTAMFLLMITEQAQFDKVM
                     FETISAFATVGLTAGLTAELSEPGKYIMIVVMIIGRIGPLTLAYMLARPEPTLIKYPE
                     DTVLTG"
     gene            428915..429382
                     /locus_tag="AOT11_09065"
     CDS             428915..429382
                     /locus_tag="AOT11_09065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97793.1"
                     /translation="MFVGKTTELAFTSCLSSNLKQIIAQVLAKLAEPIEDGRHELDGD
                     NAFFLVMSDHTQPLALRKSECHQRYLDVQILLSGKETFGYSLQPFEALDEDYLAERDL
                     AFSHHVVDEKFVTLGENEFIIFPPGQPHRPLIAPEGEGSPVRKVVIKVDGATL"
     gene            429588..431063
                     /locus_tag="AOT11_09070"
     CDS             429588..431063
                     /locus_tag="AOT11_09070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthetase"
                     /protein_id="ASM95409.1"
                     /translation="MLLCACTSLENHTPFDKQPSYQLGYQADSRLSAYLNHHPQDREN
                     LTAFFPLDKGHDALLARLALIEAADKTLDLQYYIFRDDETGQLLTWRLFEAAQRGVRV
                     RILLDDMQKRNDNGLARLSAHPNIQIRLFNPHQYRTARTLAMASNFSRLNRRMHNKSL
                     TADSVVAIVGGRNIGNEYFSVNSPVEFGDFDLMLYGNSVEQTAEQFDLYWNSLHAVPI
                     EWLTDNPISVTEAELQTWLKEAQLEQKFTQGQYDFTQLQLYEQFTDKSLVWYWGKGQV
                     WYDLPDKVDTQAPQLADNLASLLRTVKDSLVLISPYFVPTERGTQALVEAAQRGVDIT
                     IVTNSLASNDVFAVHGWYAKYRQDLVEAGIQLWETKASARIDSKWSFTGSSRSSLHAK
                     VLLIDHRLLFAGSMNWDPRSALLNTEMAAVIEHPDYVQASEAKLPMGLKTNAYQVRMK
                     KGQVAWFDHQSQAWFDSEPEATVWRKIGAWFAGILPIEEQL"
     gene            complement(431087..432001)
                     /locus_tag="AOT11_09075"
     CDS             complement(431087..432001)
                     /locus_tag="AOT11_09075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95410.1"
                     /translation="MKVEPSNTEILVVDDTVDNVKLLSQLLQNEGYLVKGALSAKSAL
                     RMCQKKKPDLILLDIMMPEVDGYELCRQLKKDPSTQDIPVIFLSALDHVQDKVRAFQI
                     GGVDYIQKPFEVMEVLARVRTHAGLVTLQRALIEQNEQLKRMATTDALTGLVNRRYLA
                     DMAGKVSGNFALILFDIDNFKTINDQYGHHVGDEVLVRIAEITRRVIGQHGYCARWGG
                     EEFLILLPNFDVKRAYDLAAGIQYEFNESKGALGAYHFTASFGVACNLGALSFHQVIR
                     QADAAMYQGKKSGKNRVVSSRAMESREL"
     gene            complement(432040..434196)
                     /locus_tag="AOT11_09080"
     CDS             complement(432040..434196)
                     /locus_tag="AOT11_09080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ASM95411.1"
                     /translation="MAMVTICPETLPIGWLSITHEGWIEAYNQQAQSCELWLQPLMVG
                     EALTCAHSSRTFHEWVKQLSAQSPPLSIMSSRATHWTLSASPRTQGGFDLWLQEAVCD
                     DALRDENARLRRDIERLDFAAQGANLGIWDFNPSTGCIIGNKTWAIQKKLDPDHLFSD
                     DALFSEIINGIEKWSEIVHPDDVAETTDKIQAHLDGETELYHAEFRVRCGDGQWKWIL
                     DLGRVFERDQDGVPVRMNGIHVDIDKLKRLQQSLSETKDKAEVANRAKSIFLANMSHE
                     LRTPLNAVLGYTQLMKCDQRLTAKHHEYLDIINRSGEHLLSLINDVLDMSKIDAGHSV
                     VERKWFNFREVSEEINDLMQMKAMQKQLTLHCRVEDSVPHFVLGDVVKTRQVLINLLG
                     NAIKFTYRGNVRLNIASEALQNGQHKVTFEVSDTGIGISEENQGRVFQPFEQLDSDIT
                     QNGTGLGLSISKQFVELMGGQLVLKSELHRGSTFSFSLVMETSEHLVENKPANLPRVL
                     GLKSGSFSPKILIAEDQLDNQTLLATLLQQAGFTVKLARDGEEAVALHKSWSPDFIWM
                     DRRMPKKDGLQATKEIRAASENSQVKIVALTASVFNDEIEEMLASGMDDFARKPFMPQ
                     DLFYMMKKHLDLDYDYEQGQDEAENISFDDLDLSFLDDLTNESTQDIVEAIEQGQQQE
                     LYYLFEQTIANSEVRTRLNSLVENYQFDELYELFQE"
     gene            complement(434442..435380)
                     /locus_tag="AOT11_09085"
     CDS             complement(434442..435380)
                     /locus_tag="AOT11_09085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase"
                     /protein_id="ASM95412.1"
                     /translation="MMSIPLIYHPIYSQLPLPEGHRYPIMKYHHLYQAVCRYQQQHLE
                     WQRAFAFYQPEALSIEAIKQVHQQEYVDLLTTGLLPAAKMRRIGFPWSEQLIERTLTS
                     TAGTVLTAEKALQHGVAIHLSGGYHHAHFDYGSGFCLFNDLVMAAHKALEHVSVDKVL
                     IIDSDVHHGDGTATLCQRRDDIVTLSFHCDKNFPARKPDSDLDIGLPRECGDDAFLAA
                     FKEVVPMAIRLHQPDLIIYDAGVDIHVDDELGYLNVSTDALYQRDVFLFGQAKANAIP
                     VAAVVGGGYRTDHESLVPLHLQLLHAAYDVYRSTRD"
     gene            complement(435386..437356)
                     /locus_tag="AOT11_09090"
     CDS             complement(435386..437356)
                     /locus_tag="AOT11_09090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428840.1"
                     /note="decatenates replicating daughter chromosomes;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase III"
                     /protein_id="ASM97794.1"
                     /translation="MTRLFIAEKPSLGRAIAAALPNPQKKEQGFIRCGNGDIVTWCIG
                     HLLEQVEPDAYDERYKKWNMADLPIIPEQWQLRPRPSASKQLTVIRKLLKDASEVIHA
                     GDPDREGQLLVDEVLDYCKLSQTKKAQTQRLLISDLNLPAVKRALSSLRSNRDFVPLS
                     VSALARSRADWLYGMNMSRAYTLLGQKAGYQGVLSVGRVQTPVLGLVVRRDEEIENFV
                     PRDFFTLHALIPYQNDSERFDIKARWKPSEACQPWQDEEGRVLSRKLVENVASRIANQ
                     PATVTESEHKQTKQAPPLPYSLSALQIDAAKRYGMSAQQVLDTCQSLYEKHKLITYPR
                     SDNRYLPKEHYAQAASVSQAIANNAKELADAVSGADLSLKSKAWNDSKVEAHHAIIPT
                     PKQASVNALSGYEMKIYQLIARQYLMQFYPAATYAEAKLVFEIAGGVFIAKGRQLTFA
                     GWKALTGATEKEEDGADTVPPLAKGTVLTCREGVIKDCKTEPPKHFTEATLLQAMTGI
                     ARYVSDKELKKILRETDGLGTEATRAGILDTLFKRQLLSRQGKAILSTPAGRGLIHAL
                     PQESTYPDMTAHWEHQLQGMAERNQAYQPFMAALQQRISELMQQVKTSPVPSSLRQLP
                     PVERPAFKRKRRASTSKKTASTATKNRTNKSA"
     gene            complement(437442..437990)
                     /locus_tag="AOT11_09095"
     CDS             complement(437442..437990)
                     /locus_tag="AOT11_09095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="ASM95413.1"
                     /translation="MDALDLLLNRRSIGKLAAPAPEGKALENIIRAGLRAPDHGALTP
                     WRFVIAQGSGLHKLSDVLVKAAQAKGSEESVVEKVKNAPFRAPMVITVIAKVTESEKV
                     PAFEQHLSAGCAVQAMQMAAVAQGFQGFWRSGEWMFDTEVKQAFGLQGDDAIVGFLYL
                     GSAECSAMKVPERDLAKFVEYL"
     gene            complement(438164..440176)
                     /gene="fadH"
                     /locus_tag="AOT11_09100"
     CDS             complement(438164..440176)
                     /gene="fadH"
                     /locus_tag="AOT11_09100"
                     /EC_number="1.3.1.34"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080932.1"
                     /note="catalyzes the formation of trans-2- enoyl-CoA from
                     2,4-dienoyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dienoyl-CoA reductase"
                     /protein_id="ASM95414.1"
                     /translation="MSAMYPHLLQPLDLGFTQLRNRVLMGSMHTGLEEHKEGLQKLAA
                     FYEERAKGGVGLIVTGGFSPNLRGRLHPLSAEFSKPKHAQAHKVVTEAVHKHGGKIAL
                     QILHAGRYAMHPFAQSASGIKAPIAKFAPSEMSPRQIRKTIEAFANSAGLAQLAGYDG
                     VEIMGSEGYLINQFLCKRTNMRYDEWGGTYKKRMRFAVEIVKAVRKAVGSDFIIIFRL
                     SMLDLVEQGSTFEDVIMLAKALEDAGVTIINTGIGWHEARVPTIATQVPRGAFTWVTE
                     KVKPHVSVPIVTCNRINTPEEAERILASGQADMVSMARPFLADPHFIAKAEQAKSHLI
                     NTCIGCNQACLDNVFKGKRASCLVNPLACHETELVVKPASEKKRIAVVGAGPAGLACS
                     TTLAQRGHSVDLIERNDRIGGQFRLAMQIPGKEEFRETIRYFANMIDETGVNLRLDTD
                     ATLELLKEYDEVVLATGVEPRKVKIDGLTESSKVIDYQTLIREKTPVGNKIAIVGAGG
                     IGVDVASMVTEPAQHNLDDWLQEWGIDKEMTQPGGLYPFPDAMSDKTVWLLQRRKGAV
                     GKGPGKTTGWIHKRTLEKRGVNLLGGVSYDGIKPEGLEITLNGKKQLLDADTIIICAG
                     QESVRPFEDKWHELGDKLHVIGGADYAGELDAVRAIKQGVTLATKL"
     gene            440422..442272
                     /locus_tag="AOT11_09105"
     CDS             440422..442272
                     /locus_tag="AOT11_09105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572151.1"
                     /note="SppA; catalyzes the degradation of cleaved signal
                     peptides; essential to maintain secretion of mature
                     proteins across the membrane; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide peptidase SppA"
                     /protein_id="ASM95415.1"
                     /translation="MKSLFKLIGLVFKGIWKAITFVRLALTNLIFLLSIALVYFIYFY
                     GHDTQPQVEQPSALVLNLSGPIVEQSLYINPMDSFAGSLFGEEIPKENVLFDVVDTIR
                     YAKDDEKITGLVLSLRDMPETNLTKLRYIAKALNEFKASGKPIYAVGAFYNQSQYYLA
                     SYADKIYLAPDGGVMLKGYSAFNLYYKTLLEKLDVTTHVFRVGTYKSAIEPFVRDDMS
                     PAAKESATRWLTQLWGAFVDDVANNRQIDPKTLNPSMEEFLSQLKSVNGDLAALSIKL
                     GLVDELATRQQLRTQLAEKFGASGDDSYKAISYYDYRATMRDNFDVNADDIAIVVASG
                     TIMDGQQPRGTVGGDTVAGLLRQARNDDKVKAVVLRVDSPGGSAFASEVIRNEVQALK
                     DAGKPIVVSMSSLAASGGYWISMSADKIIAQPTTLTGSIGIFSVITTFEKGFNKLGIY
                     TDGVGTSPFSGEGISTGLSKGASQAFQMGIEHGYQRFISLVGNNRDLSLDAVDKVAQG
                     RVWTGYDALQHRLVDQIGDFDDAVAEAAKMAQLENYNLYWVEEPLSPTEQFIQEFMKQ
                     VKISMGVDIQSILPPSLQPVAQQMEQHASLLQNFNDPKGYYAFCLNCEVQ"
     gene            442377..443390
                     /gene="ansA"
                     /locus_tag="AOT11_09110"
     CDS             442377..443390
                     /gene="ansA"
                     /locus_tag="AOT11_09110"
                     /EC_number="3.5.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232580.1"
                     /note="converts asparagine to aspartate and ammonia;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-asparaginase 1"
                     /protein_id="ASM95416.1"
                     /translation="MTRKHIYIAYTGGTIGMKKSDHGYIPVAGFMEKQLANMPEFHRP
                     EMPQYTIHEYEPLMDSSDMTPEDWQHIANDIRDNYDKYDGFVILHGTDTMAYTASALS
                     FMLENLGKPVIVTGSQIPLAELRSDGQANLLNALHIAANYPVNEVTLFFNNQLMRGNR
                     SVKSHADGFNAFTSPNLPPLLEAGINIQISNSIKVGAQPEGEFKVHNITPQPIGVITM
                     YPGISHEVIRNTLLQPVNAMILLTFGVGNAPQNPELLAHLKEASERGVIVVNLTQCLA
                     GKVNMGGYATGCALAEAGVISGYDMTPEAALAKLHYLLSQNLSYEEVKAQMQQVLRGE
                     MSL"
     gene            complement(443448..443732)
                     /locus_tag="AOT11_09115"
     CDS             complement(443448..443732)
                     /locus_tag="AOT11_09115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95417.1"
                     /translation="MNTEQLLSAMTPEVYQRLTYAVETGRWPEGTPLSQTQRDSCMQA
                     VMLYQSKHNIDAEHMSVAAGGEICFKSKAELKKQFQSGQEDIVRVNPNRD"
     gene            443816..444655
                     /locus_tag="AOT11_09120"
     CDS             443816..444655
                     /locus_tag="AOT11_09120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95418.1"
                     /translation="MDHKQITMSNKIWLLALSIPLLLSGCLEGNKTTEELCQSQPGLR
                     CEKLNMDDGQCRVARTDLIWHRFEVLKSPSDNNKIKEYKLTAEYRKCLELASQITPID
                     QTALKQKRFNALVHSISELERIVQELSSSSEPESLYFLWSQTGNTNARRQFLQMEGTP
                     ALETAEMQYALATFYTTRDQTKTIQLLNHSLELTKDGKVNTEALKSLASTHQGLRQMK
                     QAYVWAMVAKEFDVPLATEREMQLMFGFSAQEYKQLDALAEQVASALEKGQYRSMMIP
                     SDL"
     gene            complement(444853..445317)
                     /locus_tag="AOT11_09125"
     CDS             complement(444853..445317)
                     /locus_tag="AOT11_09125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase B"
                     /protein_id="ASM95419.1"
                     /translation="MHKKSSTLIRKREISDVTKESKVVLKSDQQWREQLSEQEYHVCR
                     EQGTEPPFSGKLLHNKDSGEYACTCCNAPLFSSVNKYDSGCGWPSFDAPINEMAVLYL
                     DDFSHGMKRVEIRCARCDSHLGHVFPDGPKTTGERFCVNSVSLIFNKIETNE"
     gene            445606..446601
                     /locus_tag="AOT11_09130"
     CDS             445606..446601
                     /locus_tag="AOT11_09130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005418545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="ASM95420.1"
                     /translation="MTIKVGINGFGRIGRFVFRAAQERADIEVVGINDLIDVDYMAYM
                     LKYDSTHGRFNGTVEVEGGNLIVNGKTVRVTAERNPEDLKWDAIGVDVVAEATGLFLD
                     DATARKHITAGAKKVVLTGPSKDATPMFVMGVNHTSYAGQDIVSNASCTTNCLAPIAK
                     VLNDKFGIESGLMTTVHATTATQKTVDGPSAKDWRGGRGASQNIIPSSTGAAKAVGVV
                     LPELNGKLTGMAFRVPTANVSVVDLTVNLKNGASYEAICAAMKEASEGELKGVLGYTE
                     DAVVSQDFIGEVQTSVFDAKAGIALTDNFVKVVSWYDNEIGYSNKVLDLIAHISK"
     gene            446784..447668
                     /locus_tag="AOT11_09135"
     CDS             446784..447668
                     /locus_tag="AOT11_09135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-hexose-6-phosphate mutarotase"
                     /protein_id="ASM95421.1"
                     /translation="MDLNSLPALTVLSDCVTIVEKDNVKIVRVIHEKATAGISLFGGH
                     VVSYQPAGQADIIWMSDKAVFDGKTALRGGIPVCWPWFGRIAAPAHGFARTSEWELVE
                     HRENNNGVIVELALFPTEELHNLWPHMFDVRLVVEIGDELKVSLNILNIDDEAFTFSS
                     ALHTYLNVGDIEQTQTMGMGSEYIDSLKAGELCHGGEVLQLTDTIDRVYTQPEKEIVV
                     KDPVIERTLCIENQGHNSAVLWNPWAQGAAGMADMSDDGYKTMLCVESTLHADSIIQG
                     KTLNPGESHQLTTVLSAR"
     gene            447877..449913
                     /locus_tag="AOT11_09140"
     CDS             447877..449913
                     /locus_tag="AOT11_09140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ASM95422.1"
                     /translation="MLEKYKNQSVGFQLKLVITLCLIIAFGGTATLVYRNASDVLLEN
                     TLREHQSKVESMAATIAGQFDAYLQTAKVLESTFRNGYLAGIYVEDYQVDFNGKSLRN
                     ITQYGESLINDTKLVDSFTRDTGAVATIFAPFGDDFIRVSTSLKNPSGQRVVGTTLGY
                     NHPAYQKLRAGQAYYAQVKLFGESYITYYSPILDAQNKVTGVSFIGLPVQKATEDLFS
                     ALNQVKWGDTGYTIVVDNEQSNLGKYLLHPTRTQHDPSIIDTADYDGNKPYVAIFENK
                     SGLIRYRHEYQGTVGEKYLVYTEIPGWNWKLLGGTFISEVTKGSQTLLKLIIAIATAV
                     AVATFAILTFAINRNLHPLTTLNALMARLAKGEVSIQIASTGQPSKNEITNLTNGVAN
                     MANQLNMLVGEIRQTAETVYIASHSVSEDAGNNLSQADRQQEQVEQVVTAIEEMATSA
                     QSVAQQVESIADNVRSANEDSQSGLSLVEGVCIDVAELNDQLDRSAHAIKQVNTDSES
                     IQTVTKMIDEIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAHRTQTSVKDVV
                     QIIEKLKASTGNAVGLMSQSQQSANQVLDKAQEAGSSLEAIASQVHAIAAQAETIAAT
                     SEQQAQVSQEIAANAHSISDLNRQSRATSAQTSESAEELQKQANSLKSQVDFFH"
     gene            complement(449976..451664)
                     /locus_tag="AOT11_09145"
     CDS             complement(449976..451664)
                     /locus_tag="AOT11_09145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95423.1"
                     /translation="MTSTKHFSPFAVSLCLLSPVAWAAATNNTQVVNADGSVTITQTV
                     DESSSAPHYVSPGAYGFGIYSNANQDYGWQHTIAIPDGAQVLEAKLTIYAYDVDSEAF
                     RGENGEYDGVSVDGVQLNPGFLQGTNNTWSITEFALPIASLNDGLVNVFLDIDMNNGG
                     WLTTLDYSLMTVTYLVTSNTPPSVPELSRSQGLSTNDDLVVSIIGPTPADPDGDSVSY
                     NYRWFVDVGQGFFVDDEFAGKNNHTGASVSASQTNNGERWKVQVQAEDANGLISDITE
                     IEWPEIGDSDGDGVADANDYAPNDPTIAFYARTPTSGWYTLTYEDMWPFAGDYDLNDF
                     VSHYAYEVYTNANNQITRLDFTGQAVARGASVDNRFALSIAGIESADVSSLTRVVDGV
                     SASVAAENGHSGELVFVVLESISALLPGDANSDFYNTEMGDDRPVVDYSVSLILKSSM
                     PPLASHTLNPFIYRAAQRGREVHLMNYPSSDLANSNSFGQGVDVTDAQAGEFYLTAEG
                     LPWALSIPTAWKHPYENIDSTLAYPQVVDWAESGGVSSTTWFNTRVKGKCWKCN"
     gene            complement(451675..452151)
                     /locus_tag="AOT11_09150"
     CDS             complement(451675..452151)
                     /locus_tag="AOT11_09150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017790724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95424.1"
                     /translation="MNDFTKAVVWGTVSLGLLTGCGGGDGGGSGSAPTPEVQTQFSDI
                     TAPTGFEWKGSEHRQVTIKLVSNFSQQGGESMPIRGQHVVHLFSVVGDAEDSVAMFTG
                     LTDVSGELTYQIELAGHWQAIKAMSSVRGIECVSHTDIAVIVDEITVGCDIALDSD"
     gene            452517..454268
                     /locus_tag="AOT11_09155"
     CDS             452517..454268
                     /locus_tag="AOT11_09155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ASM95425.1"
                     /translation="MKAPWIPVALSGLALTGCFSDKDDTTLATAQPLKVTAADAIYYG
                     GEILTMAGDGPEYAEAVATLDEKIIYVGTKEGAMEHKFGQTQLIDLKGKTMLPGFVDP
                     HSHVYGVGLQAMVANVLPPPDGGANTVAKIIEILKASEQDETKKLFIEKTGWILGFGY
                     DDSLLDYYPTKADLDKVSTDKPVLIIHTSGHLSVANSKALEMVGITAKSKNPEGGVIR
                     RMPDSQEPNGVLEENAHFATLFRLTMLIDQELQDMMLAASQNMYAQYGYTTAQEGRAT
                     KEGYEALKRAAKQGDLLIDVVAYADMATSSDFMTSEYHSPQYTSHFRIGGVKLNFDGS
                     PQGKTAWLTQPYFHPPHGQKKDYAGYPTFTDTQAFEYVETAFKNGWQVLTHSNGDAAI
                     EQFIDAVTAANNKLGKQDRRPVLIHGQTIREDQIQRLAEQGIFPSLFPMHTFYWGDWH
                     RDSVLGHPRADFISPTKAVRDAGLMFSTHHDAPVALPDAFRVLDATVNRTTRTNKVLG
                     PDQRVDAYTALRAMTIWPAYQHFEEAMKGSIEVGKNADFILLDKNPLKVESATLKDLQ
                     VQQTISRGKVVFTNTAR"
     gene            complement(454541..455884)
                     /locus_tag="AOT11_09160"
     CDS             complement(454541..455884)
                     /locus_tag="AOT11_09160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="ASM97795.1"
                     /translation="MTKRKKRAAINLTRLPREYIDWLSRPIYRFIHIESAAGIVLFIS
                     TLLAVLLANSHLSEEFARFWQISLGMTVGDLVFERSLHKWVNDAGMTLFFFLIALELK
                     RELALGELRNPQLALLSIAAALGGMSIPPLFYLLLQYGESGQHGWGTVMATDTAFVIG
                     CLALLGRSIPSSLRIFMLSMAVVDDIGAIFVVAIGYGEAVDWQVLSYALLGFMLVRAM
                     AFLGVRSLVLFSIVGGAIWLVIDMSGVHPTITGVILGLLTPTNKWMSRQHLFIIMEAL
                     VPSSPSQQWSGDKREGEILKTAAAAARETLSPVERLEMLLHPWVGFVVLPLFALANAG
                     VSLTSVNLTSPITLAVFVGFVFGKPIGIVLFSWIAVWLGIAKLPENLNWGMVFGGGML
                     AGIGFTMALFIAELAYNPDQINAAKLGIFIASITSALIGFLCLRYFAAREKQKGT"
     gene            complement(455877..456869)
                     /locus_tag="AOT11_09165"
     CDS             complement(455877..456869)
                     /locus_tag="AOT11_09165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95426.1"
                     /translation="MKPINVGLVIALILGVSLSLYNALYTVNEVQQVVITQFGKPIGT
                     PIVNAGLKIKIPYIQEINMIDKRVLEWDGRPSDMPTKDKLYISVDLFARWRIIDPLQY
                     FLRLKDERSAQSRLDDILGSETRNAVAKHELIEIIRTNKNRKPLRDPLLSEAERALKI
                     GALVPIQKGRQLVEQEIFLAAAEKIKIFGIELLDIRFKRINYNESVRPKIYERMVSER
                     RQIAERFLSEGNGEAARIRGDRIRDLNMIQSEAYREVEEIRGQADAKAAEIYASAYNK
                     NPEATRLYEFTRTMQSYSTVLAENTTLVLSTNSELFKFLNGVEGSLNGTAESND"
     gene            complement(456866..457654)
                     /locus_tag="AOT11_09170"
     CDS             complement(456866..457654)
                     /locus_tag="AOT11_09170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017428826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95427.1"
                     /translation="MPLGIDAVKIVPVKRQLKQEFGFITPGASDPHQNPRINSRHQEM
                     QMVTGDLNAALVEWVVQYRISEPIHFLFEVREPSETLRYVSESVMREVVGDRTVDEVI
                     TIGRQEIESEALSKMQALSTKYVLGIRIDQVQLKNINPPQPVQASFNEVNQAQQEKEK
                     LINEARRDYNKVIPLALGEKDQRIREADGYRLKRINEAEGDTARFNALLLEYVKAPEV
                     TLRRIYLETMQVVLPNIRTKIIIDERSNSILPLLDLNKIQGDAK"
     gene            complement(458364..459548)
                     /locus_tag="AOT11_09175"
     CDS             complement(458364..459548)
                     /locus_tag="AOT11_09175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011081609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EBNA-1 nuclear protein"
                     /protein_id="ASM95428.1"
                     /translation="MLHPTRKMSSKLSNVENLYSLPRSRALPKPNLLRQQRETAVVYC
                     EGFFGESKGKTTNGLVRESNRFKIVSVIDSTKAGQDSGAYLYGHDNGVPICSSLSQAI
                     AVSDWIPEYFIYGLSPESGRLSLEERQLILTAMRLGMNIVIGLHEFLTDDPEFMEAAK
                     KNHVRIIDVIKPRPIDELELFANRLQTVLCPRILVMGTDCAIGKRTTALALTKVLERY
                     GLNVVMIATGQTGLIQGARHGIALEAIPSQYCVGELEAVVVEAYEEEGPDVIVIEGQG
                     ALSHPCFCTSASIIRGSQPHAVILQHSPTRVYLSGSEQYFMPDLDTEIELIELFAGVP
                     VIGITLNSQGLDEQSTAEVISHYADKYHRPVAELFTVSDEVLVEMVMEMFPELDLDSI
                     TI"
     gene            complement(460385..460756)
                     /locus_tag="AOT11_09180"
     CDS             complement(460385..460756)
                     /locus_tag="AOT11_09180"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95429.1"
                     /translation="MDGWNQVDRIVLGEGISRDELTLRRNGNHMVLMIGGLDSGDSIT
                     IENAYTDKRYRIEEVVLSDGSKVSPFELPDYVEPVINTDLLVQAMGAFDTRESVTNNA
                     VIDSVTSSFSPNLVVSAQIQL"
     gene            complement(460995..471050)
                     /locus_tag="AOT11_09185"
     CDS             complement(460995..471050)
                     /locus_tag="AOT11_09185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010074645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95430.1"
                     /translation="MQDIVRKIFNNRTLGIAELETNVLVLDSQLQGQRTTSKLLAAAD
                     VVVSVAGFLNKWPGLGIGVSVGAVVDAMDVYRKEMQQNDGLVGENTIASLVAASSDLI
                     AGISGAVAGKSKLWPLAAVSAGFSMLSVAAKHLSIHGSNVNQVKNNLKNEQKSLLDSL
                     RYQTESRRDAVIKDYESLIRQEAEKAGIDFSTVIDSGFSSEVDGLIELLNNEINADIE
                     KSLSLRIDLSVDRIEEIKDEYIGDFNTILGGYGDGGRVTSLLNTSLGIAVKKSRTKIL
                     DAAHNDFIEEVEDADLNRAQVLDFSAGLKDALRQANLKSGSVGGFVDKWIGRYQQALS
                     STRSNLIADSLSYKNGVLNGGMVLVEEVNKDLVQDYLNKRNELNEQYQIFEKLEKNRQ
                     IDLAHRDVASLVIENKKVFMEDVRNMHQTSAEYLRQKAIRLAAKANSKEGKVPNSIFN
                     KLGELHQEINNQIDNSRAATSNVLDSYLSNFTDLTHFLNISDVYIKEEHHRLNDGFSS
                     IISLLESIIDQLEELLDEEPDDEEQDSDNDGIPDDIDPDQDGDNDPNNHDDDSGSTGG
                     EGGTQGDAVHEGSNNSDRQRRIDPLVLDLDGDGLDFLSLDNSQAKFDLTGNSFATHTS
                     WLSGDDGFLAIDKNNDGSINNIDELFGREDITGFEELELLDSNGDGKISTEDAAFEQL
                     LIWQDKNGDGASTQEELKKLSDYNITEISLDRSASGAEKNDVLLEEVGHYVTVDANGN
                     RQEYLLGDVLFSTRPTYSEFVGEVTLTDAAKAIANIQGYGMMPDLNAAMSLNKEFEAQ
                     ILQFTRDLSSQTLTSGFDDILYGWAGSKRLTLADIDSTPNLSADENGLVRFPNANITL
                     SIEQLGVLKAYTGINTLEIGDGIWNANGQTHTTGQLYLEAWNSIRANLVAKFAVSQGL
                     LDHLIPSVTYDAASDTLQSTFDFKSRADATFQKVTSKLGNLKTANDAAELLLVLDVFE
                     QFESGFSKTQKECVIDLIKSAEPAAYDWLANNIDLVKKIDNSILLGTNTQGGSAADFA
                     IGSKGNDIINAGGGNDIVEGGLGDDTLHGQDGDDQLFGGVGNDTLTVNGSGSNTLEGG
                     EGDDLLKVNRSVDAYYQRDHVRKAVNTFNGGQGNDRLEGSAGAETYVFNRGDGQDTIN
                     DYDHNNWSSVDGWNQVDRIVLGEGISRDELTLRRNGNHMVLMIGGLDSGDSITIENAY
                     TDKRYRIEEVVLSDGTTLAPQDIPLYTIDGDNDIRGGGFAETVTVGDGNDTISLEGGN
                     DTIRSGGGVDTVDAGSGDDEVYAGLGDDTVLAGSGNDLVYGEEGNDTLHGQDGDDQLF
                     GGVGNDTLTVNGSGSNTLEGGEGDDLLKVNRSVDAYYQRDHVRKAVNTFNGGQGNDRL
                     EGSAGAETYVFNRGDGQDTINDYDHNNWSSVDGWNQVDRIVLGEGISRDELTLRRNGN
                     HMVLMIGGLDSGDSITIENAYTDKRYRIEEVVLSDGTTLAPQDIPLYTIDGDNDIRGG
                     GFAETVTVGDGNDTISLEGGNDTIRSGGGVDTVDAGSGDDEVYAGLGDDTVLAGSGND
                     LVYGEEGNDTLHGQDGDDQLFGGVGNDTLTVNGSGSNTLEGGEGDDLLKVNRSVDAYY
                     QRDHVRKAVNTFNGGQGNDRLEGSAGAETYVFNRGDGQDTINDYDHNNWSSVDGWNQV
                     DRIVLGEGISRDELTLRRNGNHMVLMIGGLDSGDSITIENAYTDKRYRIEEVVLSDGT
                     TLAPQDIPLYTIDGDNDIRGGGFAETVTVGDGNDTISLEGGNDTIRSGGGVDTVDAGS
                     GDDEVYAGLGDDTVLAGSGNDLVYGEEGNDTLHGQDGDDQLFGGVGNDTLTVNGSGSN
                     TLEGGEGDDLLKVNRSVDAYYQRDHVRKAVNTFNGGQGNDRLEGSAGAETYVFNRGDG
                     QDTINDYDHNNWSSVDGWNQVDRIVLGEGISRDELTLRRNGNHMVLMIGGLDSGDSIT
                     IENAYTDKRYRIEEVVLSDGTTLAPQDIPLYTIDGDNDIRGGGFAETVTVGDGNDTIS
                     LEGGNDTIRSGGGVDTVDAGSGDDEVYAGLGDDTVLAGSGNDLVYGEEGNDTLHGQDG
                     DDQLFGGVGNDTLTVNGSGSNTLEGGEGDDLLKVNRSVDAYYQRDHVRKAVNTFNGGQ
                     GNDRLEGSAGAETYVFNRGDGQDTINDYDHNNWSSVDGWNQVDRIVLGEGISRDELTL
                     RRNGNHMVLMIGGLDSGDSITIENAYTDKRYRIEEVVLSDGTTLAPQDIPLYTIDGDN
                     DIRGGGFAETVTVGDGNDTISLEGGNDTIRSGGGVDTVDAGSGDDEVYAGLGDDTVLA
                     GSGNDLVYGEEGNDTLHGQDGDDQLFGGVGNDTLTVNGSGSNTLEGGEGDDLLKVNRS
                     VDAYYQRDHVRKAVNTFNGGQGNDRLEGSAGAETYVFNRGDGQDTINDYDHNNWSSVD
                     GWNQVDRIVLGEGISRDELTLRRNGNHMVLMIGGLDSGDSITIENAYTDKRYRIEEVV
                     LSDGTTLAPQDIPLYTIDGDNDIRGGGFAETVTVGDGNDTISLEGGNDTIRSGGGVDT
                     VDAGSGDDEVYAGLGDDTVLAGSGNDLVYGEEGNDTLHGQDGDDQLFGGVGNDTLTVN
                     GSGSNTLEGGEGDDLLKVNRSVDAYYQRDHVRKAVNTFNGGQGNDRLEGSAGAETYVF
                     NRGDGQDTINDYDHNNWSSVDGWNQVDRIVLGEGISRDELTLRRNGNHMVLMIGGLDS
                     GDSITIENAYTDKRYRIEEVVLSDGTTLAPQDIPLYTIDGDNDIRGGGFAETVTVGDG
                     NDTISLEGGNDTIRSGGGVDTVDAGSGDDEVYAGLGDDTVLAGSGNDLVYGEEGNDTL
                     HGQDGDDQLFGGVGNDTLTVNGSGSNTLEGGEGDDLLKVNRSVDAYYQRDHVRKAVNT
                     FNGGQGNDRLEGSAGAETYVFNRGDGQDTINDYDHNNWSSVDGWNQVDRIVLGEGISR
                     DELTLRRNGNHMVLMIGGLDSGDSITIENAYTDKRYRIEEVVLSDGTTLAPQDIPLYT
                     IDGDNDIRGGGFAETVTVGDGNDTISLEGGNDTIRSGGGVDTVDAGSGDDEVYAGLGD
                     DTVLAGSGNDLVYGEEGNDTLHGQDGDDQLFGGVGNDTLTVNGSGSNTLEGGEGDDLL
                     KVNRSVDAYYQRDHVRKAVNTFNGGQGNDRLEGSAGAETYVFNRGDGQDTINDYDHNN
                     WSSVDGWNQVDRIVLGEGISRDELTLRRNGNHMVLMIGGLDSGDSITIENAYTDKRYR
                     IEEVVLSDGTTLAPQDIPLYTIDGDNDIRGGGFAETVTVGDGNDTISLEGGNDTIRSG
                     GGVDTVDAGSGDDEVYAGLGDDTVLAGSGNDLVYGEEGNDTLHGKTVMTNFLVVWATI
                     P"
     gene            complement(471062..471589)
                     /locus_tag="AOT11_09190"
     CDS             complement(471062..471589)
                     /locus_tag="AOT11_09190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95431.1"
                     /translation="MFSFFYALRVKKSDLILATVISTFTLIFSIVSNRVFLDPYKEGE
                     VYYSSYSHDGRHGSDGRGLSYSIIHNEIDGSDYKVQGFDFGRLSNKLNNYGTQRFDEG
                     EIEGIKVGLVSTSNENIYYVVYVEFNQQVMLESRPTIKTINENNFNNFIFGVVSSIFI
                     FFFIIIINSLINLSK"
     gene            complement(471801..473909)
                     /locus_tag="AOT11_09195"
     CDS             complement(471801..473909)
                     /locus_tag="AOT11_09195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C39"
                     /protein_id="ASM95432.1"
                     /translation="MIVTDLHPTLDVLCELANDYELAPDSSQLVHRLGKNDNSIDEID
                     LCRAALWSGLQARVVEANIDELQALPLPALVLMDEQWRLVKRISPKTVEIVDQHRRLN
                     LEVEAFKLTYQGKVLVARANFQAKEKIAFGFGWFIPAIKKHKRQFSWVIGVSLMIQLI
                     ALVSPLLFQNVIDKVLVSRSLSSLEVLGVAMLGLAVMGPLYGLLRSWLFSNLSSKIGA
                     ELSSKLYDHLTALPLSYFNERQTGQIIARMKEMDSIRQFLTGSGLTLILDLAFIGLFI
                     GVMLMYSSLLTSVVVISLVLYFLFWILVGKGLRTRVNHAFEAEADATAMLTESVMGIE
                     TVKTTATEWRFNKHWQEQLAHFTKASFAATNYGNWAGQGICLIQKLTAALLLWLGVKL
                     VLDGALTSGELVAFNMFAGHVTQPILRLAQIWQDFQHTLISLRRVGDILDVETESGSE
                     GLASVAPLKGKVAFDNVRFRYCEQSPDVLRGLSITIEPGEFVGITGPSGSGKSTLTKL
                     LQRLYSPTQGQVLIDGLDLAIADPVQLRRQMSVVLQESHLFSGTVAENIRLNCPEASD
                     EDVRNAAELAGVIDFIGDLPQGFNSPVGEKGALLSGGQRQRIALARALISNPSVLILD
                     EATSALDYESEAAIMSNMTKICEGRTVISIAHRLGTIKNADRILVINDGRISEEGEHN
                     VLIQEQGLYKHLWELQSGFS"
     gene            complement(473914..475278)
                     /locus_tag="AOT11_09200"
     CDS             complement(473914..475278)
                     /locus_tag="AOT11_09200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="ASM95433.1"
                     /translation="MAGIIEKIQPLKKKRQAPLDEQYEFLPSYLEVVEKPASPLAKTS
                     AWAISSLLIAALVWSIVGKLDIFASASGQVIVSSRSKVIEPFVQGEVEEILVKEGDRV
                     HQGDVLIKLNPIGAEAERARIASQIDFTLLEISRYQALLGDELPTLWLDPNVGSEELL
                     NASRMAIQSDWQERQAQLEGISAELDVNLANQLAVRNELSSLALLRNNVEERLDARKI
                     LMESKSIARMEVLDLEKELLDTQRAVFQQQSQLKVLQAEEKKLKDSRTTYLAGLKKDY
                     HHRLNELQGQYEGLAQELVKANNAIRQQVLLAPVNGTVQQLQVNTLGGVVQPAEELMV
                     IVPEDALLEVEAKLLNKDVGFVIPGQTVEVKIDTFPYTKYGTVPADVVHVSRDAVKDE
                     QFGMVFPVRIRLQKDNIKVEENLVPLQPGMTVVAEIKTGQRRVIEYLLSPLQQYQSEA
                     MRER"
     gene            complement(475281..477395)
                     /locus_tag="AOT11_09205"
     CDS             complement(475281..477395)
                     /locus_tag="AOT11_09205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C39"
                     /protein_id="ASM95434.1"
                     /translation="MVRAYPKRVALSRSAVVSSQVLLKLTGVSYQVPKEHTGDDLKSW
                     LKNASGQTDGQLRLKRLKEKKLAASHLPLAYQQHDGEFVVLARLSDEQALIQRHHEHV
                     PQVISRTTLQEVWAGQVIQYHESGRQFDIRWFIPEFLRYKKLLSSVLFFSFLLQLLAL
                     ISPLFFQVVMDKVLVHANISTLDVLAIVLVIVGVYEVLLKGLREYLFAHTTNRIDIQL
                     GGKLFGHLLSLPLIYFKTRQVGSIVARVRELSSIRDFLTSSAMTLSVDVAFSVVFFAV
                     MGWLSFPLMVMVVSTIPVYFILAWVTGAHLHKAVERQFSCGAKNTSFVTESVSGIQTM
                     KSLAIEPAMRRKWQGQVEDFAHANFDTQKITAVTNQIVQLVQKLTAVLVIWAGAMQVM
                     ALEMTIGQLIAFNMLLSHVHQPLGKLVDLWQQFIQTRVGIDALGDMLNLPPETEHSSV
                     QVDGVSGNIQLRNVVFSYQPKSPAVLKSIDLSIRAGETIGIVGPSGSGKSTITRLIQK
                     LYLPVSGSIHIDGIDLATISSSSLRQHIGVVLQENYLFNKTVRENICLKKPTADLEEI
                     IKAAKLAGAHDFILKLPMGYDTVLAEGGVSLSGGQRQRVAIARALLGDPKVLIFDEAT
                     SALDDESQEVIQNNMSAISQGRTVVIIAHRLSTVRSCDRIITVEAGQVTSQGSHEELV
                     AQNGIYRRLWQLQQAKQQEERE"
     gene            477669..478181
                     /locus_tag="AOT11_09210"
     CDS             477669..478181
                     /locus_tag="AOT11_09210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019819900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95435.1"
                     /translation="MPANPVPIDVKTKGQTWLLPPYNWSHRRIAKELDVSPSVVSKWR
                     NELVESGLLSTEPPLENTTTDYSAEQRFFIVIETATMSERELAEYCRSKGLFVDDVKT
                     WRALSIKAQSTTSASMSHKENKLLRDERRKVKALEKELARKDKALAEMAALLVLREKF
                     NALWEINEED"
     gene            478331..478822
                     /locus_tag="AOT11_09215"
                     /pseudo
     CDS             478331..478822
                     /locus_tag="AOT11_09215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
     gene            478897..479205
                     /locus_tag="AOT11_09220"
     CDS             478897..479205
                     /locus_tag="AOT11_09220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017422916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95436.1"
                     /translation="MTKRTRRLFSAEFKLEAAQLVLDQNYSVTEAAQAMNVGKSTMDK
                     WVRQLREERQGKTPKASPMTPEQIEIRELKKKLARLEEHNDILKKATALLMSDSLNNS
                     "
     gene            479202..480074
                     /locus_tag="AOT11_09225"
     CDS             479202..480074
                     /locus_tag="AOT11_09225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000584438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="ASM95437.1"
                     /translation="MIIKKLKQSYSIKTLCEVFNVHRSSYHYWLKRPTVINAETVKLR
                     SLVSEAHAASNGSAGARTIADIVTNQGVNLSRYRATKLMRTLGLVSCQVPRHRYRKAS
                     QEHIEVPNHLGRQFAITAPNEVWAGDVTYIWTGNRWMYLAVVIDLFARKVIGWSMSLS
                     PDSRLTGKALSMAYESRGKPKGVMFHSDQGSHYTSRKYRQLLWRFQIKQSLSRRGNCW
                     DNAPMERFFRSLKTEWVPTVGYRSFAEAQQEITRYIIGYYCQLRPHQYNGGLTPNESE
                     RLYWENSKTVANFS"
     gene            complement(480078..481793)
                     /locus_tag="AOT11_09230"
     CDS             complement(480078..481793)
                     /locus_tag="AOT11_09230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95438.1"
                     /translation="MTKLSDLLAIEDEAIKQTALKKMFMPYTEDVCVDGYEQETLTIL
                     LNLSSSHQADRCLDWLDVARAQRYLKDSENLDASLAEIQWFHTHNLKFPDCRVKDQRI
                     IARPLSTAEEFISSAVLAQRLGWAHNSAVYRHTLWLLNPFKWQSQPVCVLSLIQQKNP
                     VWLDLLTEFGLDVKSLARLQRAIEEQLPENSFPDSVSTYSKQLRFPWGDDYVSITPVV
                     SHALQCKLEIRARSPENKFSFVSSSLPNSASIGNLCGSLGGHMRVLNYPLGVKQTKGG
                     TLTENRQKSGHYFDDYQVTNAKICQVLNRLIGSEPSKTQRQRERARQVRSKILRKQIA
                     LWMLPLIELRDIAESEPNQQQLEHDDTLAQAFLSLPELELGSLASEFNRRLHLTFQNN
                     MYSAKFAYHPKLMQVAKAQVTWVLEQLSKPINNQDTHTGEQYIYLSSMRVQDAAAMSN
                     PCLCGVPSLTAIWGFMHDYQRQFNQLVNNDSPVEFLSFAFYVRNENIQSTAKLTEPNS
                     VAKARTVSNAKRPTIRSERLSDLEIDLVIRVHSESRISDFRSALKTALPVAFAGGALY
                     QPQLL"
     gene            complement(481796..483007)
                     /locus_tag="AOT11_09235"
     CDS             complement(481796..483007)
                     /locus_tag="AOT11_09235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017049068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95439.1"
                     /translation="MKTDIQHYSDESLESFLLRLSQEQGYERFSHFAEDIWFDTMEQH
                     EAIAGAFPLELNRINIYHAQTTSQMRVRVLIHLENQLKLNNFGTLRLALSHSKAQFSP
                     EYKAVHRLGSDYPFVFLGKRFTPICPLCISEAPYIRQQWQFISHQACEHHGCKLVHHC
                     PECQSRLEYQTTESISQCECGFELRNSPVADAPVAALLVARWLSGNDSRPLGLLKAEM
                     TLSERYGFLLWYVNRYGDIENISFESFVEYCSCWPRVLREELDELVNKADLIRIKDWK
                     KTFFNEVFGALLKDCRQLPSRQLERNSVLTQVLAYFTKLMATLTSSSKGNVGDVLLSP
                     LEVSTLLSCTTDEVYRLYEFGEIKAAIRPRMHTKIASHESAFTLRSVIETKLTRMCSE
                     NDGLSVYLPEW"
     gene            complement(483092..483319)
                     /locus_tag="AOT11_09240"
     CDS             complement(483092..483319)
                     /locus_tag="AOT11_09240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95440.1"
                     /translation="MFKSGTTKTTEVGFINRNNQKNHGTRGVAGNDHCQVSYKLECLE
                     IGCGAVYGSNGTDVFQRKCPKCQGGKPGIDF"
     gene            complement(483335..485098)
                     /locus_tag="AOT11_09245"
     CDS             complement(483335..485098)
                     /locus_tag="AOT11_09245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95441.1"
                     /translation="MVEKIRTVLDDARTNEQFKEIQLELLWRDLKRSNKSKTVSTKLV
                     SEQKKTKKEKNRERKERSQSIVKKAPKIVPTSVVKSPDVSPSPQRVHKMALKPASKKQ
                     VTPWPTWAQVKANKVVAVPKETVPVETAIHEPELEAVVLTNVLIQSTVQNPKLDVEVK
                     VPSSFEISEKTKVEPVVSSAATPKLETFRWPSTVAYEADESMPESNWPKVGMLSAVGY
                     CVGINGLGLKQRQELLSNVYSKRLPFVDSRKYVAEWGAPKSSERLKKLAEAIAAFVRN
                     AKRKKNNMSVAIREWEQDLAWLKEKYYLQHKFVWVWPKSALPNEEIEKLQITEAFENE
                     KVYASSREFLVEQYINDANELCCQICQSALPFKLGTGEYYFEEISVHSHAKKSSFSDL
                     LFCPNHRAMYQHANDKEVQLLEALGSSFQKDLKITLANKKHKIFVTEKHQVELRKLRS
                     ELSDITFEFVDKSLLGVSKVHLYELGGKWILSSKADVKLSEFSSSQEAKEWLKRFDAF
                     RKRESPTQIKEIRPQSRMKRKTGAGKVIHTSKSPILGLGSIKKSVTQSSYKTGFTTCS
                     NCRGDGGINGGCWKCGGSGWM"
     gene            complement(485317..486309)
                     /locus_tag="AOT11_09250"
     CDS             complement(485317..486309)
                     /locus_tag="AOT11_09250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95442.1"
                     /translation="MSLYNISNKNLTALTQTTFAAEGLQERQDLQEALKGCIDAIAPD
                     CLVISEEFSDWEDSRRRIDLLAIDRNANLVVIELKRDEIGAHMELQALRYAAMISTMT
                     FDKACEYFERYIAKEGLEINARETILEFVDLDENSLDDFGNDVRIVLASADFGKELTT
                     SVLWLRDKGIDISCVRLTPYRYKDDVLINAEQIIPVPEVEAYQVKFREKQAEQRTSKN
                     GQRDYSKYRFNGQVYNKRKLALAVLTHWIEQENPQSLSVIKDALKDYNLPRAVALFEE
                     IADKHMSRYHSAECDLITLTSGELIAISNQWGDNIPRLLDAMKSYGIATERIEN"
     gene            complement(486475..486954)
                     /locus_tag="AOT11_09255"
     CDS             complement(486475..486954)
                     /locus_tag="AOT11_09255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000205487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95443.1"
                     /translation="MTTAWLPDLVMMEDYNHNWEQYLAAIYAFFEADFVHSKPEFQGR
                     RLGLKRYPEYDGKSATFWHMTSTGDDETERVPDFRRCERIRWPRPIIENDQHESLKVW
                     TEPKGKNQRVHIWCEEEGYLVVLDDRGEYILPWTAFYIEREHQRKKYNKRWEKYKDK"
     gene            complement(486951..487661)
                     /locus_tag="AOT11_09260"
     CDS             complement(486951..487661)
                     /locus_tag="AOT11_09260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001290352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95444.1"
                     /translation="MSEIYNVYCDESCHLENDGIGVMALGALWCPLSKRAEIAKRIRE
                     IKVRHGLKAEFEIKWTKVSNSKLAFYLDIIDYFFDDDDCHFRGLVVPDKTVLDHPRFG
                     QDHDDWYYKMYFFMLKTIFDPQSKYRVYIDIKDTLGHEKIERLHDVMCNSHYDFSKSI
                     IERMQRIHSHEAEQLQMADLLIGALGYLHRGLDGNKAKLALIERIKDRSGYKLTQNTL
                     LRENKFNLFVWTGQGGFA"
     gene            complement(487829..489574)
                     /locus_tag="AOT11_09265"
     CDS             complement(487829..489574)
                     /locus_tag="AOT11_09265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit S"
                     /protein_id="ASM95445.1"
                     /translation="MSAEKLITDHIDIWTSAIQAKSASGRGSSKKRELYGIKKLRELI
                     LELAVRGKLVPQDPNDEPASVLLERIAVEKAQLVKEGKIKKQKKLPSIDDDDYLFDIP
                     SGWSWERLGNVGETNIGLTYSPKDAGETGIPVLRSANIQRGKIDLSDLVRVQKEVKDS
                     VLVEIGDLLICARNGSKALVGKTAQICELKEPMAFGAFMAIFRSCINDYIEVFLNSPV
                     YRKNLEGVSTTTINQITQSNLRSTICPIPPVEEQHRIVAKVDELMALCDQLEQQTEAS
                     LDAHQVLVETLLATLTNSQDATELMANWARISEHFDTLFTTEQSIDQLKQTILQLAVM
                     GKLVPQDPNDEPAAILLERIAEEKAQLVKEKKIKKQKALLPIAEDEKPFELPKGWEWC
                     RVNDISLFTTSGSRDWAKYYSESGALFVTMGNLSRGSYDLRMDNLRYVKPPIDGEGSR
                     TKLEPHDLLISITGDVGNLGRIPEGFGEAYINQHTCLLRFMPECRDKFFPELMRSPFA
                     KLQFDAPQRGIKNSFRLSDVGEMVIPLPPKEERTRITQKVDNMMSLCDQLKQRLRDSQ
                     QTQLQLTDAIVEQAL"
     gene            complement(489574..491064)
                     /locus_tag="AOT11_09270"
     CDS             complement(489574..491064)
                     /locus_tag="AOT11_09270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000028396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit M"
                     /protein_id="ASM95446.1"
                     /translation="MSISSVIKSIQDIMRKDAGVDGDAQRLGQLSWLLFLKVFDAQEE
                     ELELELDDYKAPINEKYLWRNWAADAQGITGDKLLEFVNDDLFHNLKNMAALVDTNPR
                     GYVVKEAFSDAYNYMKNGTLLRQVINKLNEIDFTDTKERHLFGDIYEQILRDLQSAGN
                     AGEFYTPRAVTRFIVDRLDPKLGENVFDPSCGTGGFLTCSINHIQERDKPETSEQYAT
                     FQKQFHGVEKKQLPHLLCITNMMLHGIEVPSQIKHDNTLNKPLSNWDSNINVIATNPP
                     FGGTEEDGIEKNFPAEMQTRETADLFLQLIIEVLDPANGRAGVVLPDGTLFGEGVKTK
                     IKKLLTEECNLHTIVRLPNGVFNPYTGIKTNILFFTKGKPTKEVWFYEHPYPEGVKNY
                     SKTKPMKFEEFQAEIDWWGKEEDGFASRVENNHAWKVSIDEIIARNFNLDIKNPYQGE
                     VVSHDPDELLASYQTQQQEITELRNQLKDILGNALSSSAQAADEVK"
     gene            complement(491218..492549)
                     /locus_tag="AOT11_09275"
     CDS             complement(491218..492549)
                     /locus_tag="AOT11_09275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="ASM95447.1"
                     /translation="MFFPSLKAVNYKLLFILLLSGLIPAIYSTSRVYFLGSIPDTWAF
                     SIAAQVAWLNVGYEVINEAMLIPLAYILGQVITSNTEGFTKRLNGAMVAFVAVYAAVT
                     LSVLLLAPDMTQAMQQSRELIEQTTHYIRLESVAIFISSVVELCLLVLVLKDEQRKLY
                     AFIAVKSLLIIGFDSLFVSQLSHSLLLGVNGVAYTNIVVNSILLVCALCWFHREGLFN
                     PKMAFNSVSWMKEWAKIGAKSGLESFVRNAAFIIMILQLVNQVQQAGIFWVSNQFIWG
                     WLLLPVMALGQLIKRDAACSNGLSVERVNVYFKLTGLVVLCWLLSVPLWDDFIAHIMG
                     VSDHQQVTDLVLLMLGFYVVFAFNNVIDSYFYGIGRTDLMLYQSLAVNTLFYGSAFVA
                     YQLGWFEPTLEGIALMFGVGITFDAIITIGLYRWLRANQGYESVTTKPALG"
     gene            complement(492625..495081)
                     /locus_tag="AOT11_09280"
     CDS             complement(492625..495081)
                     /locus_tag="AOT11_09280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="ASM95448.1"
                     /translation="MVEKFSKSQLSEADIISKFILPAIKENGWDDMNQIRQEVKLRDG
                     KVVVRGQIAARKKVKSADIVLYHKPSMPLAVVEAKANKHEIGKGMQQGLDYASLLDVP
                     FVFASNGDGFIFHDKTNPEQLETEIRLEDFPSPQMLWEKYCQWKGYSDDQLPLITQDY
                     YDDGSGKSPRYYQLNAINKTIEAVSEGQDRVLLVMATGTGKTYTAFQIIWRLWKSGAK
                     KRILFLADRNILVDQTKNNDFQPFGTAMTKIGNRTIDPAFEIHLGLYQAMTGQEEEKK
                     IFKNVRPDFFDLIVVDECHRGSASEDSAWREILEYFSSATQVGLTATPKETDEVSNIE
                     YFGEPVYTYSLKQGIEDGFLAPYKVVRVDIDVDLQGWRPTKGQVDKHGEVITDRIYNQ
                     SDFDRTMVIDERTELVAQTITNYLKRTDPMAKTIVFCNDIDHAERMRRALANCNPEQM
                     AKNEKYVMKITGDDEIGKAQLDNFINPKKAYPVIATTSELMTTGVDAKTCKLVVLDST
                     IKSMTKFKQIIGRGTRIDDKFGKLWFSILDFKKATELFADERFDGTPERVKVTKPEDF
                     ENPEDLDDIVDGMPEDENGEAAVDGESPFGDDIDPDTILEPTPPYTTSGEDTFGPGPD
                     EPIQEEVRKFHVSGVEVKKIAERVQYYDSDGKLVTESFKDYTRKAMATQFTSMDDFTR
                     KWNDADRKQAIIDELAEMGIIWEALEQEVGKDMDPFDMICHVVYDQPPLTRKERADNV
                     KKRNYFTKYGDVAQEVLSNLLDKYADAGVTEIENMTVLKVAPFNEIGRPTEIIKKGFG
                     DKEAYLKAVNELESEIYQTA"
     gene            complement(495205..496590)
                     /locus_tag="AOT11_09285"
     CDS             complement(495205..496590)
                     /locus_tag="AOT11_09285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95449.1"
                     /translation="MLRVWQADCTELAINKFASNRRPHFFCQATPGAGKTVMAAEVAR
                     RLFEEGMIDLVLCFSPSLSVAEGMQKTFAWKLECSFNGGLGSLGGSYTYQSIRFFDDN
                     FWNTISKHRVLVVFDEIHHCSFEEDGRSNSWGVEIVSKIQGLARYTLALSGTPWRSDR
                     LPIVMAEYSDPEGMLVCDYQYGLKQAVVDGVCRQPKIVLIDNEHLSITSGGNRQHFAS
                     ILDCLKQSDISYQSVIHNEEAMHYILNSACKKLAQIRELSPNAGGLVVAASIKHAKDI
                     QKRLVEQFNQSASIVTYHHVNPLNEIESFRHSNVQWIVSVGMISEGTDIPRLQVCCHM
                     SSVKTELYFRQVLGRILRVNDSLNQEAWLYTFAEESLVKFAERVEEDIPESCMFIGVE
                     KSVTSCCSDSPSDDTGSISESRTNNILPLEWATGPFLESVNSGFLSHEESDRIKLGSF
                     RERVIAAFDYV"
     gene            complement(496593..497129)
                     /locus_tag="AOT11_09290"
     CDS             complement(496593..497129)
                     /locus_tag="AOT11_09290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020480147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95450.1"
                     /translation="MNKVIRINPHMFNLLIEKGMDGFSVIDARDTLLNSDVTFPSKDD
                     ARKYIYKQLLSFEEKGWLSVVGTHRAKRYHQTSEFKALTVEPRVARKSKVNVDPIAIQ
                     IADTSLTALEQEKKQYEGELAITLGEIEEYQSLLTRFPHSRQKMQPLFSAARERSAKL
                     LGKINALTNWMKVAQGKV"
     gene            497231..497539
                     /locus_tag="AOT11_09295"
     CDS             497231..497539
                     /locus_tag="AOT11_09295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="ASM95451.1"
                     /translation="MQKNNPIPERLKAARKKAKITQKDLGVKIGMEPSSASGRMNHYE
                     KGRHVPDLGTLERMAEELNVPLNYFFCRNELSAELACVIDKMSDEEKAALLDNLSREK
                     "
     gene            complement(497543..498640)
                     /locus_tag="AOT11_09300"
     CDS             complement(497543..498640)
                     /locus_tag="AOT11_09300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95452.1"
                     /translation="MTMILKILKGTNLNLTPKQLEQLKSFETSFIEYPAITEIYSIFD
                     QLRFNHSLGGEPESFLLTGEAGSGKTALINNYLSRFQSGSTWGKQPVLSTRVPSRINE
                     QNTLTQFLVDLDCKSGGRGIRRRNEIALGEAVVKQLKRKSVELIIVNEIQELVEFSTA
                     EQRQVIANTFKYISEEARVSFVLVGMPYADVIATEPQWNSRLSWRRKIDYFKLLKAKS
                     HSNRTVSYGFDLEQKKHFARFVAGLSSRMGFDEPPVLTKNELLYPLFAMCRGECRALK
                     HFLKDALLTSFKDDADTIDRAILSRTFAFKFPYLDNPFDRPLEQLSLHQIDSGSAYHL
                     NAITTEDKIVAPRFTDAIPLSMLLSKNGLKV"
     gene            complement(498606..500471)
                     /locus_tag="AOT11_09305"
     CDS             complement(498606..500471)
                     /locus_tag="AOT11_09305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001134621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95453.1"
                     /translation="MPPDSDNIFGFFDEFEASEEESQLLPKELILEPVEISSTIDSLP
                     AKIQEEVLRRIKVITFVEKRLKGGWTEKNLNPILSLVESELQLTPPSWRTVATWKKSY
                     SEAGREPWALIPKHTFKGNRQKEMDSQSLIDEAIQNVYLTRERLSVAEAYRYYKSRVI
                     QMNRGIVEGKIKPIAERSFYNRINELPPYEVAIARFGKRYADREYRSVGQQVAATKPM
                     EFVEIDHTPVPVILIDDELDIPLGRPYLTMLYDRFSKCIVGCSINFREPSFDSVRKAL
                     LNSLLDKSWLKAKYPSIENEWPCHGKIDCLVVDNGAEFWSQSLEDSLRPLVSDIQYSQ
                     AAKPWRKSGIEKLFDQMNKGLVNALPGKTFTNPTQLQDYNPKKDAVVRVSVFLELLHK
                     WIVDYYHMAPDSREREIPYHKWHQSKWTPSYYDGAEKEQLRVELGLLRHRTIGVAGIR
                     LHNLRYQSAELIEYRKYCTPNDGKKLFVKTKTDPSDISYIHVYLESEKKYIKVPAVDN
                     SGYTNGLSLFEHQRIQKVRRLNTKDLADDEALADTFLYMKKRIQEETDRFRRVKSSKS
                     NLPKTGNTSKLAKFNDVGSEGPSSINVIPVRHKSEVVSDASEYLDDDDFEDIEGY"
     gene            complement(500474..501097)
                     /locus_tag="AOT11_09310"
     CDS             complement(500474..501097)
                     /locus_tag="AOT11_09310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017045287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="ASM95454.1"
                     /translation="MFDQTKKSSHVHNICKFMSLKNDAVVRTLSILEFDFCFHLEYNP
                     NIKSFTSQPFGFHYQFNNRKCRYTPDFLAIDHNEQSTFFEVKHSSQILKPDFRERFEE
                     KQRVALSEFNRRLVLVTEKQIRMGPTLDNFKLLHRYSGLRTVTEFQKRVLAFIQRKQM
                     VKLQEVSLYFGLSEQDTLISTLPWISSGHVKTDLNTIGFGLETCVWC"
     gene            complement(501467..503440)
                     /locus_tag="AOT11_09315"
     CDS             complement(501467..503440)
                     /locus_tag="AOT11_09315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ASM95455.1"
                     /translation="MIKKFGWLLSCVFVWVSFNCWAKSKEITVATEADDVVTRVLFDA
                     IAEQFALDVTYVNMPSFDAILDSVARGETDFAANITFTHEREKRFSYSHPTNIEYTYL
                     YSNTTNSLRDATRIGVPQDTIYGELIAVNHPDIQLVSYQGHEEAYVLISHGRVDGIVD
                     AINQLKPMLLKGTNAHLLNDEISIKPVSIVSQKGQHLEELTQFAQFIHSEQMQKRLRE
                     EITQYQFAIRKQALQQAIAQAPLDLDEPLTIKLEPIYPYVIYHPDGHVSGITAEVLQQ
                     SCDILTLNCQLVSRSDERWGEMLQGFIQQEFDLLAPLAMTKAREQFTYYTSPHYAPQS
                     VIVKRLGYKPNVYSHVSQLIAERVGVVEDDYFDALLTQMLPLKELSRFSDHDAMVSAL
                     LANRVDYITMDTATLNYLLRNELKLAIEQDDAIGVFDASKISIGLANTEKGRVLAPYF
                     SRAIEMLDLNSIIERYDVRPDWRSSLDMEQKFAAKTQTLFAAMLLLAFALSYYLHRLS
                     NTDNLTGLGNRRQLQRKYGNGIAGDLAILYIDVNNFKPINDTYGHHCGDMVLKAIAQE
                     IKSHWRGKGFRVGGDEFILIGKASQQEVEEAFERFSRIRLEQHIAGKPLIISSSIGLS
                     ARRERAMSLQKALHLADVDMYQSKNEQREMGYS"
     gene            complement(503565..504308)
                     /locus_tag="AOT11_09320"
     CDS             complement(503565..504308)
                     /locus_tag="AOT11_09320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95456.1"
                     /translation="MIFSILQFTITSLLAVVCAKAISMSAGDIPVLALVIPALWILPQ
                     GGIAGLVLLAAMTVYGLTLPMQPIALSVCVWILFPLLMVVFSKKSSLGVLLTAGMIVL
                     ALMVGIMVTQMAGKLTGSPWVTVVQVLSVMVIWWAANHWRPSSKHSWWPLLLLIPLWM
                     AGLPYAVLVALSITGIMACMESLNSLKTFSWNKLLCWTLPTVGFAALVVTPNVDVPNS
                     VFVVWICLLGTAWMTDYILNAEEEMKEQD"
     gene            504459..504761
                     /locus_tag="AOT11_09325"
     CDS             504459..504761
                     /locus_tag="AOT11_09325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95457.1"
                     /translation="MDHFLPQIFAVIQQIPFGKVTTYGEIARMAGFPGYARHVGKALG
                     NLPEGTKLPWHRVINSQGRISLQGSNLNRQRQLLQAEQIEVSEIGKISLKKYRWQP"
     gene            complement(504828..505253)
                     /locus_tag="AOT11_09330"
     CDS             complement(504828..505253)
                     /locus_tag="AOT11_09330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipo-like protein"
                     /protein_id="ASM95458.1"
                     /translation="MKKIILVMMSVFFGALLAGCQTSEPLVKDQGIQTISGTVFYRER
                     IALPEDAAVTLVLEDVSLADAPAKVIAKHKFITNGKQVPLSFDLAYDSKKIIANHRYN
                     VRARIEVNGRLRFISDTIVPVITDEANTHNVEIMVVGVR"
     gene            505444..506310
                     /locus_tag="AOT11_09335"
     CDS             505444..506310
                     /locus_tag="AOT11_09335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="palmitoyl-CoA hydrolase"
                     /protein_id="ASM95459.1"
                     /translation="MSKPLNELLSLLQLEKLEEGLFRGQSENLGLPQVYGGQVLGQAL
                     SAARYTVSDDRTVHSFHSYFLYPGDPEKAIIYDVENLRDGKSFSTRRVKAIQNGRPIF
                     YLTASYHGEAPGFEHQNTMPDIPGPENFMSESELASHIAEFLPAKLRQTFCGEKPIET
                     RPVTVINPLNPKKAEPKQYLWIRANGEMPDSQLIHQYLLAYASDWGFLVTALHPHEVS
                     LMTPKFQVATIDHSIWFHRPFKMDEWLLYVIESPTASNTRGLVRGEIYNQQGHLVATA
                     VQEGVMRFIDKK"
     gene            complement(506367..509414)
                     /locus_tag="AOT11_09340"
     CDS             complement(506367..509414)
                     /locus_tag="AOT11_09340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="ASM95460.1"
                     /translation="MRIEHGLILLLTANVLVGCGGGGGGSSAPAVVKPSKQYRAPLES
                     LDLTTTYVQIGQIVQPQLFQVKGDVAFELIDDESAQVVLLDSQGRIKVLKPGVAHVKA
                     IDTSDTFQTSESNFTITIQKGWNDALSISPLYLTTTQTTPSSLTVRGAKGELRYRVLS
                     DPDAIIDLSAQGEVQSRGRPGIARIQVSDLGDEFYSERSMETDVIVRAVDAESLSFAA
                     LSRSYQPGLVLAPKRLDTTPTERIVYQIVKSEPDWEVAEFSQQSQGMLAIKNSGKVTV
                     RATAYYPETYKTAQQTSEYDVTIDKAARQPLSVANMVTEYQANARLQPIVSNAKGELQ
                     YRLLSGADVLHIDPLANLPVIDGVGLAEVEVTEQNLRNYQVSSARFTIQIDKAPHQGI
                     KQDPISLTYQEDLRIPFEFSGQKGRLTLVSGSSSQLALVDKTLFIKQAGQYALQIEDD
                     GGELYQSTQFTLSIDVAKATAEPYQTQDYQETYYKDLQINLQRDLNPRTNDLLVLDNS
                     DPSVVKVLEGGILHVLKAGETRLTIQRAETNNYLAGPVQYVNVRINSADSQLRVEQSL
                     VEGTWTSVFGSIAAPAISGAEGKLNYYLAEGEPTDVIELDKDSGFMKMLNAGSVRVIV
                     KDTGSSGVNAGETSFTARVLPADNPVEIHYPNTIFEENQTIMPSLSIAMDKHSYRLIN
                     QADPTVKLTSGTEGALSMLHAGSFEIEATVSARNYQTVTKRVTGTISKAMAKALDYKP
                     QSVDFVPFKQVSLAMRSPIGTRSYKTILSDSTISVDPISGVITLKDYRGDNQDQAASI
                     VVSEDETRDYLALSQASLNFTLNAPKAEQADANHTLTEKQTVIISKLSGSEFASLQES
                     QFGLMGVDRVLRPTDEQFKEYGEGMIAIVRVKPIGSDVLTERRQLMLHIARFDDCATK
                     LDPDNIEPFKAIAFDTPGYCEDGSRTLRMTRVTVVDDSPLLEGPYEFVRPMIYYRKGE
                     RRFLPERDGGRYPREGEVVSSLTYGDPRTLYEWGILQLNYQRQ"
     gene            complement(509745..510206)
                     /locus_tag="AOT11_09345"
     CDS             complement(509745..510206)
                     /locus_tag="AOT11_09345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ASM95461.1"
                     /translation="MLDKVDLKLLSLLQQDGTLSLSDLAEQVNLTTTPCWKRLKRLED
                     EGFIEKKVALLNAEKLDLSFIAFVQIKTCDHSYAWYDRFVATVNDFPEVMEFYRMAGE
                     YDYMMKVLVKDMKNFDTFYKKLVNSVEGISNVTSTFAMEPLKYTTALPLGQ"
     gene            510336..511421
                     /locus_tag="AOT11_09350"
     CDS             510336..511421
                     /locus_tag="AOT11_09350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="ASM95462.1"
                     /translation="MCTDHNWINNAIRKIEADFQRSADTHLFKLDLPSLDGIDIYLKD
                     ESTHPTGSLKHRLARSLFLYAICNGWIGPETTVIESSSGSTAVSEAYFARLLGLPFIA
                     VMPKCTARKKIEQIEFYGGKAHLVDRSDQIYAESHRLAKELNGHYMDQFTYAERATDW
                     RGNNNIANSIFSQMKLEEHPEPSWIVMSPGTGGTSATIGRFIRYQKLDTKLCVVDPEN
                     SVFFDYFQSGDNTITGNTGSKIEGIGRPRVEPSFIAGVVDEMRKIPDAASVACTHWVS
                     KLIGRNVGASTGTNLYGVLQLACEMKQRGERGSIVTLLCDSGDRYLDTYFNEEWVKTN
                     IGDIQPYLEQLEIIERDGCVAPICCPA"
     gene            complement(511524..511841)
                     /locus_tag="AOT11_09355"
     CDS             complement(511524..511841)
                     /locus_tag="AOT11_09355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidine triphosphate deaminase"
                     /protein_id="ASM95463.1"
                     /translation="MTQFKYQELTQEQQDKLDAAAFRRLLAHLDANKEVQNIDLMILA
                     GFCRNCFSKWYKAEADVLGLDLDLDDARERVYGMTYEEWKTNHQPEATPEQLAAFEAK
                     QKK"
     gene            512006..512587
                     /locus_tag="AOT11_09360"
     CDS             512006..512587
                     /locus_tag="AOT11_09360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95464.1"
                     /translation="MKKIMLACSTLLLSQPVFAEKMGELPNYFYLGAGTIAFDVSAYG
                     DNSGSELSTPNFTIGFGKNFNEHVAVEGLFRYTQNEVTNSTAGTSLNLDYYQAGVSAL
                     LSTGNLGDSPISLFGRLSGLITQANMYDVTNNAVKISEEAGMIFNVGGGLGWDMGQNF
                     WLKAEYVYSFADAGFNDFYDKYSGFQLSIGKQF"
     gene            complement(512648..515761)
                     /locus_tag="AOT11_09365"
     CDS             complement(512648..515761)
                     /locus_tag="AOT11_09365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter AcrB"
                     /protein_id="ASM95465.1"
                     /translation="MLLSDVSVKRPVAALVLSLLLCVFGFVSFSKLAVREMPDIESPV
                     VSISTRYDGASATIIESQITSVLEDQLSGISGIDEISSTTRNSMSRITITFELGYDLN
                     TGVSDVRDAVARAQRSLPEEADDPIVFKNNGSGEASLYINLSSSEMDRTQLTDYIERV
                     LMDRFSLITGVSSVDISGGLYKVMYVKLSPELMAGRGVTATDITAALRSENLESPGGE
                     VRNDQTVMSVRTARSYNSVEDFQYLVVKRASDNTPIYLKDVADVFIGAENENSTFKSD
                     GVVNVSMGIVPQSDANPLEVAKRVHEEVDKVQKFLPEGTRLAIDYDSTVFIDRSISEV
                     YSTLFITGGLVILVLYIFIGQARATLIPAVTVPVSLISSFIAAYYFGFSINLITLMAL
                     ILSIGLVVDDAIVVVENIFHHIEKGESPLLAAYKGTREVGFAVIATTLVLVMVFLPIS
                     FMDGMVGLLFTEFSVLLAMSVIFSSLIALTLTPVLGSKILKANVKKNRFNDVVDLLFG
                     KLESGYRAVLKRALAWRWLAPLIILACMGGSYALMNQVPAQLTPQEDRGVIFAFVRGA
                     DATSYNRMSANMDLVEARLMPLLGQGFLKSFSIQSPAFGGQAGDQTGFVIMILDDWNE
                     RSVTAQQALGEVRKALAGIPDVRVFPFMPGFRGGSSEPVQFVLGGSDYNELRDWAEVL
                     KNKAEESPIMEGAEINYSEKTPELVVSVDKRRAAELGISIKEISDTLEIMLGGRKETT
                     FVERGEEYDVYLRGDENRFNNAADLSQIYLRTQSGDLVTLDTVTNVEEIASSIRLSHY
                     NKQKAITITANLSDGYTLGDALDFLDQQAIETLPGDITISYSGESKDFKENQSSVAIV
                     FALALLVAYLVLAAQFESFINPLVVMFTVPMGVFGGFLGLLIMQQGMNIYSQIGMIML
                     IGMVTKNGILIVEFANQLRDRGFEFEQAIIDASARRLRPILMTAFTTLAGAIPLILSD
                     GAGYESRVAVGTVIFFGMGFATLVTLFVIPAMYRLISRYTEAPGHVETELNQALSHDT
                     KGRVSHG"
     gene            complement(515761..516828)
                     /locus_tag="AOT11_09370"
     CDS             complement(515761..516828)
                     /locus_tag="AOT11_09370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="ASM95466.1"
                     /translation="MKKRILISFITLALMGTSSLSHAAPRGPSAVTVVAEKVQTHQIS
                     QSLALVGKLEAVQSVVIASEVSGKVESIQVKANQNVTKGQLLVKLEDDKALAAVSEAK
                     AYLKDEQRKLKEFERLVSRNAITQTEIDAQKASVEIAQARLTAANANLNDLHITAPFA
                     GTVGFVDFSRGKLVNSGTELLTLDDLSLMQLDLRIPERYLSMLSIGMPVTATSSAWGK
                     QVFTGKVVGIDSRINAETLNLRVRIQFENPENQLKPGMLLNTALAFPAIEAPIIPVQA
                     LEYSGTKRYVYVIGSDNKAKRTEVLLGARVENQVVIESGVSIGDKIVVQGIVNMRDGV
                     LVKEIGGAAAGQETVAKKDAQ"
     gene            517119..517203
                     /locus_tag="AOT11_09375"
     tRNA            517119..517203
                     /locus_tag="AOT11_09375"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:517153..517155,aa:Tyr,seq:gta)
     gene            517294..517378
                     /locus_tag="AOT11_09380"
     tRNA            517294..517378
                     /locus_tag="AOT11_09380"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:517328..517330,aa:Tyr,seq:gta)
     gene            517469..517553
                     /locus_tag="AOT11_09385"
     tRNA            517469..517553
                     /locus_tag="AOT11_09385"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:517503..517505,aa:Tyr,seq:gta)
     gene            517644..517728
                     /locus_tag="AOT11_09390"
     tRNA            517644..517728
                     /locus_tag="AOT11_09390"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:517678..517680,aa:Tyr,seq:gta)
     gene            517819..517903
                     /locus_tag="AOT11_09395"
     tRNA            517819..517903
                     /locus_tag="AOT11_09395"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:517853..517855,aa:Tyr,seq:gta)
     gene            complement(517950..519287)
                     /locus_tag="AOT11_09400"
     CDS             complement(517950..519287)
                     /locus_tag="AOT11_09400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ASM95467.1"
                     /translation="MSIQNYFADFLEESPVDVAQLTTFSEHIPDEWVAKAATLSDKAT
                     IRRRRLPSDMVLWLIVGMAFFRNESIAEVARRMNVCAEGLADEELLAKSALTQARQRL
                     GKAAPEWLFRQCSHTWGLERYPEDTWQGLQVFAIDGALFRTADTPELREHFGSGNTSS
                     ERQTPHPVLRVVTMMNVRSHVIVDAAISPYRRGEIPLAMPFIDSLPDNSVTLLDKGFY
                     GADLLLSLQNSGSNRHWLLPAKKGVKFRLVDNEESDDMLVEMKVSPQARKKNPNLPEK
                     WQVRAVTYQVQGKHKTVFTSLPREEYDAESVAELYHERWEIELGYRDIKSSMQHNALV
                     LRSKTVELVYQELWGLLLGYNLVRREASQAAVEHGRMANEISFKYACQFIASQLKVMS
                     KAVSPGNTPKRLKSLRGDLSILFIDKRPKPNRPRAVKISKTRYPVNRKAAPLK"
     gene            519441..519647
                     /locus_tag="AOT11_09405"
     CDS             519441..519647
                     /locus_tag="AOT11_09405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95468.1"
                     /translation="MAQITLFTPIIVTMATRKASLLRTGSNEKTFQTISNDLTYRTAA
                     ISNDSASPRDKKIPLIEMNGTCDD"
     gene            complement(519665..520534)
                     /locus_tag="AOT11_09410"
     CDS             complement(519665..520534)
                     /locus_tag="AOT11_09410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit Tim44"
                     /protein_id="ASM95469.1"
                     /translation="MKRLLSIVALLMVSVIATPIAEAKKMGGGKSFGKSYKTAPAPKQ
                     QQQNTNNIGKEQTAKQSSKKGLMGGILGGLLAGGLLAAFFGGAFEGIQFMDILIIGLI
                     AFVIFKLMRGLLASKQGSMNQHRQQPAFGGQAPKFEQSNVHNFEQSPNTPTGGFGFGA
                     QSDVPHNYPPGFDQVAFVNGAREHYRILQGAWNHNQLETIEEYVSPSLFEDLKAERAK
                     LDGEQHTDVMYVDAQIVRADYDASTAHLSLQFSGRYRDAVEGIEEDITDIWHLERDLT
                     APNAPWMIVGIQG"
     gene            520776..521366
                     /locus_tag="AOT11_09415"
     CDS             520776..521366
                     /locus_tag="AOT11_09415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="ASM95470.1"
                     /translation="MARRNDHTREELIALTLETVKEFLAEHSYHELSLRKLANMIGYV
                     PSTLVNVFGSYNLLLLHAVAQTLDELSVEAMKVVQDSNDKKQALAELAYCYHDFALQH
                     PHRWRLIFEHNMNGAELPEWQAKRIDNMTGMLEALLQQLAPSRTPTEVLQASRVLWSG
                     VHGITLLSVDDKFFSSEPIDGKELIDSLLTNYLTNW"
     gene            521381..523255
                     /locus_tag="AOT11_09420"
     CDS             521381..523255
                     /locus_tag="AOT11_09420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-phosphate glycerol 3-phosphate
                     acyltransferase"
                     /protein_id="ASM95471.1"
                     /translation="MAANSQSSLLTQRKFLPYFITQFFGAFNDNIFKNVLLLLVAFAG
                     TGALSISSDLFINLAAGLFILPFFLFSASAGVLADKYEKSWFIRKVKLFEIAIMLLGA
                     IGFITESYAILLLLLFLMGTQSAFFGPVKYALLPQQLKQEELVPGNALVEAGTFIAIL
                     VGTLGAGIIASHEQAKYVAAFCVVIFAVFGYLASRAIPVAHACAPELKFRWQPYRQTR
                     HTIAIAKSDRVVYQCIMAISWFWFLGAAYLTQFPNFTKIYLNGTESAVSFLLALFSVG
                     IALGSLACNKLSKGRIDVGIVPIGAFGITVFGYLMATSIPSELPRFHTFAQFVQYQPF
                     WSLFSYLLMIGVSGGLFIVPLYALMQHRAKESERAQVIAGLNIYNSLFMVASAVLGIV
                     CLAAIGISIPQFFVLLSLLNFLVAAYLFLQAPMFVVRFLVWVLTHTLYRVTHKNLHHL
                     PKDGGALIVCNHVSYMDALLLSAVCPRLIRFVMEEEYARLPILRRFLRTAGVIPISAS
                     NRTSIRRAFNDVEQALSEGHIVCIFPEGRLTENGDMNPFMRGIDIILRRSPVPVIPMA
                     LKGLWGSYFSRHKGRACKGLPSRFWSRLEIEAGLPIEPKAASAEVMQQKVAELRGDWR
                     "
     gene            523354..524289
                     /locus_tag="AOT11_09425"
     CDS             523354..524289
                     /locus_tag="AOT11_09425"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D825.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95472.1"
                     /translation="MNRKHLPFIFSLLLCLSPWVSSPTALVLGFLLASTGLVPSQLPI
                     STYTKKLLSYSIVGLGFGIQFQQAIAVTSDGIGLIVVTIVGTLLLGYLVAKVIKLETT
                     TAYLISAGTAICGGSAIAAVAPAIKAKDQQIALALATVFVLNSLALFIFPVIGHALAL
                     DQQTFGTWAAIAIHDTSSVVGAASAYGKQALTTATTLKLARALWIIPVALLSAMLFAR
                     GNGAEGKRKLVLPYFIFWYCGAIAFSDLFPQFETAYQGIFSVAKQALVVCLFLIGCSI
                     SVEKLKSAGAKPLIFGLSLWVVISTTSLSWLLLTR"
     gene            complement(524300..524476)
                     /locus_tag="AOT11_09430"
     CDS             complement(524300..524476)
                     /locus_tag="AOT11_09430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoic acid--CoA ligase"
                     /protein_id="ASM95473.1"
                     /translation="MVRGILIATAVLQLGIALLSDGLYRSLAELTAFLIVVAIVFDYR
                     RQSTTTLPHSHHSA"
     gene            complement(524573..526066)
                     /locus_tag="AOT11_09435"
     CDS             complement(524573..526066)
                     /locus_tag="AOT11_09435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinylbenzoate-CoA ligase"
                     /protein_id="ASM95474.1"
                     /translation="MAEMRTADRLVRRTAIGVAFIMVETAFVSEQPLWKYWAQQSPFS
                     MALTSSRYQFNWQQLNDEIERLAAVLGAQGVALGDVITLLGKNHVDMVLILLAAHQLG
                     AVVAITMPQSVPMFSAKLETLYREQQTRFIWLDPNVDGQTRSACSHDHRNVLLEISLA
                     SNHLNSLPDKHVCDYRADQLATIIFTSGSTGNPKAVAHTHRQHFASAQGLLEEFFFTQ
                     QDTWLLSLPLYHVSGMAIVYRWLFAGACLKVGHGALAEEIQGVTHVSLVATQLKRLLD
                     DNTPLQLSHVLLGGSHVEHTLAQAAQRKGIETWLGYGMTEAASTVTAKQIDSVSNAGH
                     LLKHRALQLIGQRIYIGGETLAEGYFFQGNLTTLVDEQGWFDSKDLGVWQGEELKIIG
                     RADNQFISGGENIHCEEIEAVLNEIDGVEQSIVVPMPDAEFGYRPVAVIQSPSLANRA
                     SYEQHLKEKLQKFKWPVAYYLMPETLLKEGIKVSRQAVKVWLGNQLS"
     gene            complement(526003..526992)
                     /locus_tag="AOT11_09440"
     CDS             complement(526003..526992)
                     /locus_tag="AOT11_09440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420937.1"
                     /note="catalyzes the dehydration of
                     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
                     to form O-succinylbenzoate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate synthase"
                     /protein_id="ASM95475.1"
                     /translation="MKSAKLYRYTLPMDSGVVLREEKLTERVGYIIELNVNGQKGYGE
                     VAPLPGFSLETIEEAGIEAQAQLELWMNTDHPIDYDALLPSVAFGLSTAMYELEGKLP
                     RDGNYLPAPLCTGDPDELIPVLNAMQGEKVAKVKVGLYEPIRDGMLVNLFLESIPDLT
                     LRLDANRAWTPEKAQQFAKYISPSLRQRIVFIEEPCQKPGDSLSFAINTGIAIAWDET
                     LQNALQQPDFALDDLTGVKAIVIKPTLIGSLPRCIALIKKAHSLGIKAVISSSIESSL
                     GLTQLARFAKWQLPDVTPGLDTISLFQSQLMVGWPKCALPIASLEEQQLVWHS"
     gene            complement(527132..527998)
                     /locus_tag="AOT11_09445"
     CDS             complement(527132..527998)
                     /locus_tag="AOT11_09445"
                     /EC_number="4.1.3.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080962.1"
                     /note="catalyzes the formation of
                     1,4-dihydroxy-2-naphthoate from O-succinylbenzoyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-ketocyclohexanecarboxyl-CoA hydrolase"
                     /protein_id="ASM95476.1"
                     /translation="MAKTVGITEAELYAPVNWNDCSAPYEDIQYHKSEDGIAKITIAR
                     PQVRNAFRPQTVKEMIQALADARYDSNVGVIILTGLGEDAFCSGGDQKIRGDYGGYKD
                     DSGVHHLNVLDFQRDIRTCPKPVIASVAGWAVGGGHVLHMMCDLTIAAENAQFGQTGP
                     KVGSFDGGWGASYMARIVGQKKAREIWFLCRFYNAQEALDMGLVNTVVPVEELEKETV
                     RWCREVLQHSPMALRCLKAALNADCDGQAGLQELAGNATMMFYMTDEGQEGRNAFNEK
                     RRPDFNKFPRNP"
     gene            complement(528024..528815)
                     /locus_tag="AOT11_09450"
     CDS             complement(528024..528815)
                     /locus_tag="AOT11_09450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-6-hydroxy-2,
                     4-cyclohexadiene-1-carboxylate synthase"
                     /protein_id="ASM95477.1"
                     /translation="MSGLSFNYQQGNGDGRSPVLVFLHGLLGSAEDWRATQCSLKEYP
                     TLTIDLAGHGQSVGIATSSAAESAQQVATVIELQLAQRPCILIGYSMGGRIAMQGLVE
                     HAFAALNLRGALIEGGNFGLVSEQEKQQRWISDSHWAKRFREEPIEQVLADWYQQGVF
                     SSLNHAQKQTLIAKRSANLGASVAEMLLATSLAKQPNLLPQLQRSSVPLHYVCGEKDT
                     KFQELARQSGLSCSIVDNAGHNVHQEQPSAFADIVRAFIHSVYQR"
     gene            complement(528796..530490)
                     /locus_tag="AOT11_09455"
     CDS             complement(528796..530490)
                     /locus_tag="AOT11_09455"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylate synthase"
                     /protein_id="ASM95478.1"
                     /translation="MNHDQAVLNRIWCETLFEELYRFGVRDVCVAPGSRSTPLALEAN
                     AHTRLKLHTHFDERGLGFLALGLAKASQRPVAVVVTSGTAVANLLPAVAEAGLTGEKL
                     VLLTADRPIELVGCGANQAIAQQGIFSNHVCASLNLPSPNTQTSLNWLLTSVDQVLHQ
                     QAVSGHAVHINCPFPEPLYSNTPKSIYQSYLDTVAVWRSEGGIYSNKQIPLPMPPSIA
                     EMEQRKGVVVIGNITLQEAKQAHQFAAQMGWPVLCDPQSGTTSDWSGYDIWLQNPAAR
                     AQLSQCDLIIQFGRRLVSKRLQQWLEQQVQVGCDYWYVSPDFERDNQSHLPQHHFVCS
                     IAAWLNVVTSREVQPVAWANELPRYSAEVNKQARAIAQSSLCEMMIALQLSSLVGSAD
                     LFLGNSLFVRMVDMVGQLHGVETFTNRGASGIDGLFATASGVQRARANPMLLMIGDTS
                     ALYDLNSLALYSHQETPVVIVVTNNDGGAIFDLLPVPPQQKQALYQMPHGYRFEFAAK
                     QFGLDYVCPTSLAELTERIVDHLAHGCGALVVEVNTPPNQASQHIKQLADHVRALV"
     gene            complement(530487..531809)
                     /locus_tag="AOT11_09460"
     CDS             complement(530487..531809)
                     /locus_tag="AOT11_09460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="ASM95479.1"
                     /translation="MYEVVLSHFHQAITNLIERVKNAKDDETRLVELLITKPTLTFID
                     WLEAQPVFPKFYWQSRDTREEVVALGQLHTFVEPGPAYTILSPGQRVWGGRSFDGSSE
                     KNRRCMPSFFFLPQIELIRLDDKWSLAVNLNGDKSRILHTLSKLTTEAKPLAPLTAHI
                     QSVEHLPEREGWCDLVSKVLKGIQAKAFKKVVLARKTTVHLDSALCAAQLLKASYLQN
                     HHSFHFMLSLDSKHSFIGSTPERLYLRQRQELYTEALAGTIGRGHNATQDMELASWLS
                     QDVKNLNENQYVVDDIVDRLTPHAESVEVESEARLVRLRKVQHLKRNIHVQLKAGVNG
                     VQLLSALQPTAAVAGLPRQESMQFIVENEPFARGWYAGSVGYISHEQAEFCVAIRSAL
                     IVDDSLHLFAGAGIVPGSIAEHEWSELDKKMSTLLSLISEHPPLGVAS"
     gene            532041..533255
                     /locus_tag="AOT11_09465"
     CDS             532041..533255
                     /locus_tag="AOT11_09465"
                     /EC_number="2.6.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011080966.1"
                     /note="broad specificity; family IV; in Corynebacterium
                     glutamicum this protein can use glutamate,
                     2-aminobutyrate, and aspartate as amino donors and
                     pyruvate as the acceptor; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="ASM95480.1"
                     /translation="MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPA
                     PFGFDAPDEILVDVIRNLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYIGN
                     GVSELIVMAMQALLNNGDEMLVPAPDYPLWTAAVALSGGKAVHYLCDEQADWYPDLDD
                     MRKKITPKTRGIVLINPNNPTGAVYSRDFLLEVIEIARQHKLMIFADEIYDKVLYDGA
                     VHTSVATLTDDVLVMTFNGLSKAYRVCGFRGGWMFMTGPKHLAQGYVNGLDMLASMRL
                     CANVPMQHAIQTALGGYQSINELILPGGRLLEQRDRAWELINQIPGVSCVKPKGAMYL
                     FPKIDTKKYSIKDDQKMVFDFLVQEKVLLVQGSGFNWPKPDHFRIVTLPHIEDLETAI
                     GRFERFLHGYSQ"
     gene            533372..533920
                     /locus_tag="AOT11_09470"
     CDS             533372..533920
                     /locus_tag="AOT11_09470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011149848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM97796.1"
                     /translation="MKLIQRWPLMRSVSSENVSEHSLQVAFVAHALALIKNKKFGGHI
                     NAERVAVLAMYHDSSEVLTGDLPTPVKYYNPDIAKEYKKIEAAAEQKLLSMLPEEFQE
                     DFRPFVISQQTSEEEAQIVKQADSICAYLKCLEELSAGNHEFALAKKRLDITLAERKT
                     PEMDYFLNTFAPSFELSLDEIS"
     gene            533926..535257
                     /locus_tag="AOT11_09475"
     CDS             533926..535257
                     /locus_tag="AOT11_09475"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8CWL9.1"
                     /note="dGTPase family type 2 subfamily; presumably
                     hydrolyzes dGTP to deoxyguanosine and triphosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="ASM95481.1"
                     /translation="MESTLSLTIRSQWLERHDDEHKIRRDDHRSPFQRDRARILHSAA
                     FRRLQAKTQVHGNSLEDFHRTRLTHSLEAAQLGTGIVAQIKKKQPEYRDLLPTDSLID
                     ALCLAHDIGHPPYGHGGEVALNYMMRDHGGFEGNAQTFRIVTQLEPYTEHFGMNLSRR
                     TLLGLIKYPAFISQTRAASQPAPVNHQRQIKAKQWSPAKGIYDCDKPLFDWVLAPLSE
                     TDKQQLNAMRDCSHDVLSHRKTRYKSIDCSIMELADDIAYGVHDLEDAIVLGLVTRSQ
                     WQEGAASQLADCGDPWFEKHISSIGEMLFSGQHHQRKDAIGGMVNALLTSIEVKPVDG
                     EFESPLLAFNAYLDIGMEKALSILKHFVSQYVIQIPQVQIVEYKGQQIIMDLFEALSA
                     DPQRLLPLPTRHRWELAETDTSKMRVIADYISSMTDGHARRLHQQLFSSHH"
     gene            complement(535279..535887)
                     /locus_tag="AOT11_09480"
     CDS             complement(535279..535887)
                     /locus_tag="AOT11_09480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ASM95482.1"
                     /translation="MSRYCSQCGKAKKACICQWIESLASDVELIILQHPSEEHRPLGT
                     ARILDLSLASCRLFIGEDFSQHAELNQLLGDESYLHWVLFPNEQAVTVEQVSQSDGSK
                     MRRLRFILLDGTWKKAFKIWQLSSNLQALPCVQLPDNLTGNYRIRKSPSDNALSTVEA
                     GFHILSYFQPENDFTPLITAFDKMIEFQIAQMPPGVFERNYR"
     gene            535867..536451
                     /locus_tag="AOT11_09485"
     CDS             535867..536451
                     /locus_tag="AOT11_09485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhombosortase"
                     /protein_id="ASM95483.1"
                     /translation="MRTIPRHTVNLTIFLTITSVLCLLLQQPLLSDWTEWHRQAINHG
                     EWWRILSGNFTHTNYPHLVMNLAGLWVIAHLFKPNWKTLALLLVMISVMVGLANLLTS
                     MQIYVGLSGTLHGLFAYFALRESLEGRKSSWLLVLGVVVKVAWEHWMGASASTSELIG
                     ARVAIEAHLAGMSSGFLLASLQPFYQRYLNAKAQ"
     gene            complement(536498..536800)
                     /locus_tag="AOT11_09490"
     CDS             complement(536498..536800)
                     /locus_tag="AOT11_09490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="ASM95484.1"
                     /translation="MKQVFTLLAMLMAFSFPSVSFADSATKAADKYEGIEISVNINTA
                     TAEEIAMMLKGVGIKKAQQIVDFREAHGPFKTVDELAQVKGIGKSTIEKNQSRIKL"
     gene            complement(536933..538792)
                     /locus_tag="AOT11_09495"
     CDS             complement(536933..538792)
                     /locus_tag="AOT11_09495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="ASM95485.1"
                     /translation="MMDRLREGVNSIAVKIILGLIILSFVFAGVGSYLVSGSSNSAAK
                     VGNVEIGRGEFEMAYQNERNRMQSQLGDYFSQLLADPAYVESFRKSVLDRMINDVLLD
                     QHAESLGLRISDAQVRSMILAMPEFQQDGKFNQDVYQATLRRAGYSADSFAEYMRREL
                     IRSQLLDALQTSEFTLPGEVDAEGKLFTQTRDVRTVTLNIRDFADKVTLTEEDIQKYY
                     DENKSRFTRPEQVKVSYIELAADSLKQQITISDDEVKQYYQEHLDKYSSEEQRRVAHI
                     LIEGDDQAKAQAILDELNAGADFAALAQEKSDDFGSADNGGELGWIERDVMDPAFEEA
                     AFALKNVGDVTGLVKSDFGYHIIKLEELKEPVVKPFSDVAAQIKQEMIDQKAVDQFYE
                     LQSELEKVAFEYPDSLEEASKAVGQEVKHTDFISQVDAPEILRTPAVTQAITSPEVKL
                     DGLNSEAIEIAPEHIIVVRVDDARDETVLPLTEVQDQVAAELSQVKGEQQALELGSEV
                     VTALKAGNTAILQEKDLSFGELEKIDRRSPLAQTVFAMTKPAAGNAVYGQSKDMEGNV
                     VVVALEKVEESLEPVLAQQISVQLQRVSAQRDLSSIVAILRANTDIEYFVVSN"
     gene            complement(538969..539241)
                     /locus_tag="AOT11_09500"
     CDS             complement(538969..539241)
                     /locus_tag="AOT11_09500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572181.1"
                     /note="histone-like DNA-binding protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein HU"
                     /protein_id="ASM95486.1"
                     /translation="MNKTQLVESIAANADISKASAGRALDAFIEAVSGTLQSGDQVAL
                     VGFGTFSVRTRAARTGRNPKTGEEIQIAEAKVPSFKAGKALKDACN"
     gene            complement(539435..541786)
                     /locus_tag="AOT11_09505"
     CDS             complement(539435..541786)
                     /locus_tag="AOT11_09505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005390529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="ASM95487.1"
                     /translation="MNLERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSISCLESAM
                     EANKQVLLVAQKQADTDEPTVDDLFEVGTVATILQLLKLPDGTVKVLVEGQQRAKINQ
                     FKESDFFLAEAEFIITPELDEREQEVIVRSAISQFEGFIKLNKKIPPEVLTSLGGIDE
                     AARLADTIAAHMPLKLADKQQVLETVDITERLEFLMGQMESEIDILQVEKRIRNRVKK
                     QMEKSQREYYLNEQMKAIQKELGESEDGVDEFEALQQKIDSAKMPKEAREKTEQELQK
                     LKMMSPMSAEATVVRSYIDWMVNVPWNKRSKVKKDLAKAEEVLNEDHYGLERVKDRIL
                     EYLAVQNRINKLKGPILCLVGPPGVGKTSLGRSIAAATGRQYVRMALGGVRDEAEIRG
                     HRRTYIGSLPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNNS
                     FNDHYLEVDYDLSDVMFVATSNSMNIPGPLLDRMEVIRLSGYTEDEKLNIAKRHLVAK
                     QVERNGLKPHEINIEDSAIIGIIRFYTREAGVRSLEREISKICRKAVKNILLKPELKS
                     VTVNIDNLKEYLGVQRFDYGKADDSNRVGQVTGLAWTEVGGDLLTIETEAMPGKGKLT
                     QTGSLGDVMQESIQAAMTVVRSRAEKLGINSDFYEKKDIHVHVPEGATPKDGPSAGIA
                     MCTALVSSLTGNPVKAEVAMTGEITLRGEVLPIGGLKEKLLAAHRGGITTVLIPKDNE
                     RDLEEIPDNVIADLKVIPVQWIDEVLKVALERDPTGVEFDAKK"
     gene            complement(541905..543185)
                     /gene="clpX"
                     /locus_tag="AOT11_09510"
     CDS             complement(541905..543185)
                     /gene="clpX"
                     /locus_tag="AOT11_09510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005473346.1"
                     /note="binds and unfolds substrates as part of the ClpXP
                     protease; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpX"
                     /protein_id="ASM95488.1"
                     /translation="MTDKSKESGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDL
                     CNDIIREEIKDVLPKRESEALPTPREIRAHLDDYVIGQDHAKKVLAVAVYNHYKRLRN
                     GDTTSDGVELGKSNILLIGPTGSGKTLLAETLARFLDVPFTMADATTLTEAGYVGEDV
                     ENIIQKLLQKCDYDVAKAERGIVYIDEIDKISRKAENPSITRDVSGEGVQQALLKLVE
                     GTIASVPPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVIEQRVATGTGIGFGAEV
                     RSKDESKTVGELFTQVEPEDLVKYGLIPEFIGRLPVTASLTELDEEALIQILCQPKNA
                     LTKQYAALFELEGADLEFREDALKAIAKKAMERKTGARGLRSILEGVLLETMYELPSM
                     DDVSKVVIDESVINGESEPLLIYTNSESQAAGAE"
     gene            complement(543256..543882)
                     /locus_tag="AOT11_09515"
     CDS             complement(543256..543882)
                     /locus_tag="AOT11_09515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011078149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="ASM95489.1"
                     /translation="MSYQEKNAMSPIIDALVPMVVEQTSRGERSYDIYSRLLKERVIF
                     LTGQVEDHMANLVVAQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVS
                     TVCMGQACSMGAFLLAGGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIK
                     TKLNKLLAEHTGQPLEVIERDTDRDNFMSADQAVEYGLVDAVLTHRSA"
     gene            complement(543988..545286)
                     /locus_tag="AOT11_09520"
     CDS             complement(543988..545286)
                     /locus_tag="AOT11_09520"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MMG8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="ASM95490.1"
                     /translation="MQVTVETLEGLERRLNITVPAANIEDAVTAELRNIAKNRRFDGF
                     RKGKVPMKMVAKMYGKAVRQDILGEVMQRHFIEAIIKEKINPAGAPTFAPVENKEGSD
                     LVFNATFEVYPEVELKGLENITVEKPAVEVKDADVEEMIETLRKQQATWTEVEEAAEA
                     GKRVSIDFVGSIDGEEFEGGKAENFPLEMGAGRMIPGFEDGIEGKTKGMEFEIDVTFP
                     EDYHAENLKGKAAKFAIKVNKVEARQLPELNDEFVAKFGVAEGGIDALKAEVRKNMER
                     ELKQAVKNRIKEQAIDGLVKENEIDVPAALIDQEINVLRQQAAQRFGGNVEAAMQLPR
                     ELFEEQAKRRVVVGLLLGEVIKAHELKVDEEKVKAIITEMATAYEDPTEVVTYYEQNE
                     QMMNNMRNVALEEQAIDAIIAKAQVSEKEVSFNELMNQPA"
     gene            545847..547634
                     /locus_tag="AOT11_09525"
     CDS             545847..547634
                     /locus_tag="AOT11_09525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011078151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ASM95491.1"
                     /translation="MSQRTPIVLMFFVIYLLCMLISGRYIWLTSYQALTQQHHSQLER
                     FAGHIQNKLDKFAHIPQLLAKDEPLIDALQQPNNSAQIDLTNRYLEEVNAVIQAADTY
                     LIDEYGNTIAASNWNIDRSFVGRNFAFRPYFKQAIVGQRSQYFALGSTSGQRGYYYSY
                     PVTYAGSIIGVVVVKMELLSIEDNWREKRSVFVADDENQIVFMSSDPAWLFKSLTPKT
                     ESELQRIRDSRQYLDKSIESLDFVGDLNAKQSEIKQGEPYSSGTMIVSSLPLPDLALT
                     IRVLSSKHNLVITTFGLLLVETLVFAILFLLGQLYYHRQQKHRQIERVQQEAKQKLEF
                     LLMERTAELQAEIAQRTKTEQALRLTQDELIQAAKLAVIGQMSASISHELNNPLAAIR
                     SFADNGRLFLEKEKYPRVDENLSRISALTERMAKISQQLRSFARKSAGDELVEARLMP
                     VLLSANELMKPSLKSARVQLETDFPEHDIHLVINTIQLEQVLINLITNAIEAMENTEE
                     KQLRITVDRALEQQIRVHIDDNGPGIDPAKFAQLCEPFHTTKKNGLGLGLSISQQILA
                     GMNGKLQVSHSPLGGARFTITLPTINTEV"
     gene            547636..548976
                     /locus_tag="AOT11_09530"
     CDS             547636..548976
                     /locus_tag="AOT11_09530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013572183.1"
                     /