LOCUS       CP009977             3248023 bp    DNA     circular BCT 02-SEP-2016
DEFINITION  Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 chromosome 1,
            complete sequence.
ACCESSION   CP009977
VERSION     CP009977.1
DBLINK      BioProject: PRJNA267132
            BioSample: SAMN03178087
KEYWORDS    .
SOURCE      Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759
  ORGANISM  Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759
            Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales;
            Vibrionaceae; Vibrio.
REFERENCE   1  (bases 1 to 3248023)
  AUTHORS   Lee,H. and Church,G.M.
  TITLE     Vibrio natriegens genome v1.0
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3248023)
  AUTHORS   Lee,H. and Church,G.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-NOV-2014) Genetics, Harvard Medical School, 77 Avenue
            Louis Pasteur, NRB 233, Boston, MA 02115, USA
COMMENT     Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: RS HGAP v. 3
            Assembly Name          :: Vnat1.0
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 96.48x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 11/24/2014 10:39:19
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452286)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,665
            CDS                          :: 4,459
            Pseudo Genes                 :: 42
            rRNAs                        :: 34 (5S, 16S, 23S)
            tRNAs                        :: 129
            ncRNA                        :: 1
            Frameshifted Genes           :: 10
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3248023
                     /organism="Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM
                     759"
                     /mol_type="genomic DNA"
                     /strain="ATCC 14048"
                     /isolation_source="salt marsh mud"
                     /culture_collection="ATCC:14048"
                     /type_material="type strain of Vibrio natriegens"
                     /db_xref="taxon:1219067"
                     /chromosome="1"
                     /country="USA"
                     /collection_date="27-Feb-2012"
     gene            55..1617
                     /locus_tag="PN96_00005"
     rRNA            55..1617
                     /locus_tag="PN96_00005"
                     /product="16S ribosomal RNA"
     gene            1700..1775
                     /locus_tag="PN96_00010"
     tRNA            1700..1775
                     /locus_tag="PN96_00010"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:1734..1736,aa:Glu,seq:ttc)
     gene            1778..1853
                     /locus_tag="PN96_00015"
     tRNA            1778..1853
                     /locus_tag="PN96_00015"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:1811..1813,aa:Lys,seq:ttt)
     gene            1884..1959
                     /locus_tag="PN96_00020"
     tRNA            1884..1959
                     /locus_tag="PN96_00020"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:1917..1919,aa:Val,seq:tac)
     gene            2316..5230
                     /locus_tag="PN96_00025"
     rRNA            2316..5230
                     /locus_tag="PN96_00025"
                     /product="23S ribosomal RNA"
     gene            5324..5440
                     /locus_tag="PN96_00030"
     rRNA            5324..5440
                     /locus_tag="PN96_00030"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            5484..5560
                     /locus_tag="PN96_00035"
     tRNA            5484..5560
                     /locus_tag="PN96_00035"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:5518..5520,aa:Asp,seq:gtc)
     gene            complement(6014..7354)
                     /gene="pssA"
                     /locus_tag="PN96_00040"
     CDS             complement(6014..7354)
                     /gene="pssA"
                     /locus_tag="PN96_00040"
                     /EC_number="2.7.8.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005373047.1"
                     /note="catalyzes de novo synthesis of phosphatidylserine
                     from CDP-diacylglycerol and L-serine which leads
                     eventually to the production of phosphatidylethanolamine;
                     bounds to the ribosome; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine synthase"
                     /protein_id="ALR14475.1"
                     /translation="MIVSRNPFEQLPSLAVNPEDFDVLYSAQEFRTRLLDAISKATSR
                     ISLVALYLEDDEAGREILTALYEAKQRNPGLDINICVDWHRAQRGLIGAETSEGNSAL
                     YKAFAQKYQHRIPVYGIPVRGREVFGVLHLKGFIVDDTVIYSGASLNNVYLNYHGRYR
                     FDRYHVIRNESLADSMAQFIQNEMIAHPAVNDLANQYKPETKEIKSAIRQLRASLSQA
                     SYQFESQAETEEDVKVTPLVGLGKRRNILNQQIVKLLAAAQNEIFICTPYFNFPKAIH
                     REVKRAMKRGVKVTIVVGDKIANDFYISPEEDFKTIGGLPYLYEVNLRRFAKANEANI
                     AARKLSIHLWKHDNNSFHLKGIWVDKRYMLLTGNNLNPRAWSLDLENGLLIQDNYAQL
                     TNKFEEEVSRILEHTHLICTYRQLEKVEDYPFGVQKLVRKITRLKADGVLKRIL"
     gene            complement(7450..7857)
                     /locus_tag="PN96_00045"
     CDS             complement(7450..7857)
                     /locus_tag="PN96_00045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005497562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="ALR14476.1"
                     /translation="MLNPIKLPLIKRLYKAHYPSGRAKRDELIITASHEGSIVALLRM
                     KSVENYRLLTGMLVVPEYRGTGVGNALLTHCKNKVFSDGDYCFAFMHLETYYSQHGFK
                     TIDSSKLPNSLKMAFQRYVDSGKDLIPMQFIPS"
     gene            7958..9001
                     /locus_tag="PN96_00050"
     CDS             7958..9001
                     /locus_tag="PN96_00050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="ALR14477.1"
                     /translation="MQIKTNASLKAYHTFGIEQTCSYLAVVESVDDVIQLFQEPAFKS
                     LPKLFLGKGSNVLFTEHYEGLVIVNRLLGKVVEETDEHYLLHIEGGEDWPELVSWCVE
                     RGLGGIENLALIPGCAGSAPIQNIGAYGLELKDVCDYVDILDLTTFESRRMNADECEF
                     GYRDSIFKHAFYGECFISAVGLKLNKEWKPINQYGPLQSIPTEKLSPASIFERVCQVR
                     QEKLPDPAKVGNAGSFFKNPVISQDHYDQLVEAHHDLVAYPAENGMKVAAGWLIDQCG
                     LKGISVNGAQVNPLQALVLTNVDNCSAQDVLALASLVKQTVWNKYQIELEHEVRFINR
                     GGETNLAEIEAAQ"
     gene            8998..9963
                     /locus_tag="PN96_00055"
     CDS             8998..9963
                     /locus_tag="PN96_00055"
                     /EC_number="6.3.4.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233289.1"
                     /note="catalyzes the formation of biotinyl-5'-AMP, also
                     acts as a transcriptional repressor of the biotin operon;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--[acetyl-CoA-carboxylase] synthetase"
                     /protein_id="ALR14478.1"
                     /translation="MRKEHATKLHILKTLSDGEFHSGEALGHDLGISRAAIAKHIKGL
                     SEWGVDIYRIQGRGYQLAHPMQLLDETRLTDSSEPKLELIPVIDSTNQYLLERVNESE
                     KGRVCVAEYQASGRGRRGRQWVSPFGSNLYLSMYWRLDAGMAAAMGLSLVIGIAAVEA
                     LEEMGIQGVKLKWPNDLYYQDKKLAGILVEMSGQAGGAANLVIGMGLNIGMPDKQPDI
                     DQPWTTLNQVCADLRLDRTQLALTLIEHWKTILVDYEMMGLAGFVDRWNRLDNFIGRP
                     VKLLMGAREVKGIVQGIDQQGGVVLETDNGLETYIGGEISLRKGD"
     gene            complement(9973..10896)
                     /locus_tag="PN96_00060"
     CDS             complement(9973..10896)
                     /locus_tag="PN96_00060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005536629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="ALR14479.1"
                     /translation="MSPFLSFDRANWADLRNSVPMTLSEEDLTALQGINENLTMEEAV
                     EIYLPLSRLLNLYVQARQSRNTVLQQFLNTEEHAPPFVIGIAGSVAVGKSTTARILKA
                     LLSRWENHPKVSLVTTDGFLYPKKVLEEKGIMHRKGFPESYDIKRLVEFMSDVKAGKP
                     DLEVPVYSHITYDITDELKKVDRPDVLIIEGLNVLQSGMDYPHDPHRVFVSDFLDFSI
                     YVDAESDTIEQWYVERFLKFRRGAFTKPGSYFSHYTQLSTEEAKNKAKEIWQSINGLN
                     LEHNILPTRERAHLILHKGVNHLVDKVSLRK"
     gene            11103..11178
                     /locus_tag="PN96_00065"
     tRNA            11103..11178
                     /locus_tag="PN96_00065"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11136..11138,aa:Thr,seq:tgt)
     gene            11232..11316
                     /locus_tag="PN96_00070"
     tRNA            11232..11316
                     /locus_tag="PN96_00070"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11266..11268,aa:Tyr,seq:gta)
     gene            11352..11426
                     /locus_tag="PN96_00075"
     tRNA            11352..11426
                     /locus_tag="PN96_00075"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11385..11387,aa:Gly,seq:tcc)
     gene            11440..11515
                     /locus_tag="PN96_00080"
     tRNA            11440..11515
                     /locus_tag="PN96_00080"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11473..11475,aa:Thr,seq:ggt)
     gene            11619..12803
                     /gene="tuf"
                     /locus_tag="PN96_00085"
     CDS             11619..12803
                     /gene="tuf"
                     /locus_tag="PN96_00085"
                     /EC_number="3.6.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7MXE4.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="ALR14480.1"
                     /translation="MSKAKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGEA
                     KDFASIDNAPEERERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGG
                     ILVVAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSE
                     YDFPGDDLPVIQGSALGALNGEEQWEAKIVELAEALDSYIPEPERAVDLPFLMPIEDV
                     FSIQGRGTVVTGRIERGILNVGDEVAIVGIKDTITTTCTGVEMFRKLLDEGRAGENVG
                     ALLRGTKRDEVERGQVLAKPGSITPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGDITLPEGVEMVMPGDNVQMTVELIAPIAMDEGLRFAIREGGRTVGAGVVAKI
                     FD"
     gene            13072..13452
                     /locus_tag="PN96_00090"
     CDS             13072..13452
                     /locus_tag="PN96_00090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004747599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="ALR14481.1"
                     /translation="MKANNAETPDSSNAADTFKWIVAFVLAAAAVVGNYLYGEMSVVI
                     RAAGVVVLIAAALGVAATTTKGKAAISFAKESRMEVRKVVWPTRQETMQTTLIVLAVS
                     IVMALALWGIDGIMVRLVALATGV"
     gene            13466..14014
                     /gene="nusG"
                     /locus_tag="PN96_00095"
     CDS             13466..14014
                     /gene="nusG"
                     /locus_tag="PN96_00095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013857954.1"
                     /note="Modulates Rho-dependent transcription termination;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antiterminator NusG"
                     /protein_id="ALR14482.1"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKMHGMEELFGEVLV
                     PTEEVVEMRAGQRRKSERKFFPGYVLVQMIMNDESWHLVRSVPRVMGFIGGTSDRPAP
                     ITDKEADAILNRLEKASEAPRPRTMYEAGEVVRVNEGPFADFNGTVEEVDYEKSRLKV
                     SVSIFGRATPVELEFGQVEKLD"
     gene            14180..14608
                     /locus_tag="PN96_00100"
     CDS             14180..14608
                     /locus_tag="PN96_00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005596690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="ALR14483.1"
                     /translation="MAKKVEAYIKLQVAAGMANPSPPVGPALGQHGVNIMEFCKAFNA
                     KTESIEKGLPTPVVITVYNDRSFTFVTKTPPAAVLLKKAAGVKSGSGRPNTEKVGTVT
                     DAQIQEIAETKAADMTGADIEAMKRSIAGTARSMGLVVEG"
     gene            14613..15314
                     /locus_tag="PN96_00105"
     CDS             14613..15314
                     /locus_tag="PN96_00105"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7MXE3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="ALR14484.1"
                     /translation="MAKLTKRMRVIREKVDVTKEYEINEAVALLQELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGREIRVAVFTQGANAEAAKEAGADIVGMEDLAE
                     QVKKGEMNFDVVVASPDAMRVVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     VRYRNDKNGIIHTTIGKANFSAEQIKENLESLLIALKKAKPSSAKGTFLKKVSISTTM
                     GAGVAVDQASLNTQA"
     gene            15607..16101
                     /locus_tag="PN96_00110"
     CDS             15607..16101
                     /locus_tag="PN96_00110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010435550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="ALR14485.1"
                     /translation="MALNLQDKKAIVAEVNEAASGALSAVVADSRGVEVGAMTSLRKQ
                     AREAGVYMKVVRNTLARRAVQGTDYECLTETFTGPTLIAFSNEHPGAAARLFKDFAKE
                     NKDFEIKAAAFEGALTDAEVLATLPTYDEAIARLMMCMKEASAGKLVRTFAAIRDQKE
                     EAAA"
     gene            16159..16527
                     /gene="rplL"
                     /locus_tag="PN96_00115"
     CDS             16159..16527
                     /gene="rplL"
                     /locus_tag="PN96_00115"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7MXF2.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="ALR14486.1"
                     /translation="MSITNEQILDAVAEMSVMQVVELIEAMEEKFGVSAAAAVVAGGA
                     AAGEAAAEQTEFDVILEAAGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGVDK
                     AEADALKAQLEEAGATVAVK"
     gene            16779..20807
                     /gene="rpoB"
                     /locus_tag="PN96_00120"
     CDS             16779..20807
                     /gene="rpoB"
                     /locus_tag="PN96_00120"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005486969.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="ALR14487.1"
                     /translation="MVYSYTEKKRIRKDFGTRPQVLDIPYLLSIQLDSFDKFIEQDPE
                     GQYGLEAAFRSVFPIQSYNGNSELQYVSYRLGEPVFDVKECQIRGVTYSKPLRVKLRL
                     VIFDKDAPAGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARVIPYRGSWLDFEFDPKDNLYVRIDRRRKLPASIILRALGKSTE
                     EILDIFFEKVNFEVKDQTLLMELVPDRLRGETASFDIEADGKVYVEQGRRVTARHIRQ
                     LEKDGVDHIEVPVEYIVGKVASKDYINEATGEIIVTANQEISLEALANLSQAGHKALE
                     VLFTNDLDHGPFMSETLRIDSTVDRISALVEIYRMMRPGEPPTKEAAEALFESLFFSE
                     ERYDLSTVGRMKFNSSIGREDAQEQGTLDETDIVEVMKKLIAIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDAVMPQDLINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRLCPIETPEG
                     PNIGLINSLSAFARCNEYGFLETPYRRVVDGVVTDEVDYLSAIEEGQFVIAQANAALT
                     EEGTFADELITARQKGESGLHPREHAQYMDVATNQVVSIAASLIPFLEHDDANRALMG
                     ANMQRQAVPTLKADKPLVGTGIERNVAVDSGVTAVAKRGGVIQSVDASRIVVKVNEEE
                     LVPGEAGIDIYNLTKYTRSNQNTCINQRPCVMPGEPVSRGDVLADGPSTDLGELALGQ
                     NMRIAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELTCVARDTKLGSEEITADIPN
                     VGESALSKLDESGIVYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DTSLRVPNSVSGTIIDVQVFTRDGVEKDKRALEIEQMQLKEAKKDLTEEFQILEGGLL
                     NRVKAVLIEGGYSEAKLESTERKKWLELTLEDDALQTQLEQLAEQWDELKADFDKKFE
                     TKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKINPVEDMPYD
                     EKGQPVDIVLNPLGVPSRMNIGQILEVHLGLAAKGIGDKINQMVKEQQELAKFREFLQ
                     KVYDLGETRQKVDVASLSDDEVRTLIKNLRGGLPIATPVFDGASEHLIKELLKLADLP
                     TSGQLTLFDGRTGDAFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKA
                     QFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGSHSMEPGMPE
                     SFNVLLKEIRSLGINIELEDEE"
     gene            20895..25097
                     /locus_tag="PN96_00125"
     CDS             20895..25097
                     /locus_tag="PN96_00125"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010444398.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="ALR14488.1"
                     /translation="MKDLLNFLKAQHKTEEFDAIKIGLSSPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRDRM
                     GHIELASPVAHIWFLKSLPSRIGLLMDIPLRDIERVLYFEMYVVTEPGMTDLEKSQML
                     TEEEYLDRLEEWGDEFTAKMGAEAIKDLLGSMDMHAEAEQMREELETTNSETKRKKVT
                     KRLKLVEAFIQSGNNPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLELAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYSKLETRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARTLMMSTNNILSPASGDPIIVPSQDVVL
                     GLYYMTREKINVKGEGMYLSGPAEAEKAYRTKQAELHARVKVRITETVVDEDGNSTTS
                     TGMVDTTIGRAMLWQIVPAGLPYSIVNQKLGKKQISNLLNEAYRKLGLKDTVIFADQI
                     MYAGFAYAALSGVSVGIDDMVVPPAKYTEIAEAEEEVREIQEQYQSGLVTAGERYNKV
                     IDIWASTNDRVAKAMMENLSSETVVNRDGEEEQQESFNSIYMMADSGARGSAAQIRQL
                     AGMRGLMARPDGSIIETPITANFKEGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDVVVTEHDCGTHEGVDMMPHIEGGDVKVALSELALGRVVAEDVLKPGTEDV
                     LIPRNTLIDEKWCQIMEENSVDSMKVRSVVTCDSDFGCCAQCYGRDLARGHLVNQGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASTAAAENSVQAKNNGSIKLHNAKSVVADDGK
                     IVITSRATELTIIDEFGRTKEKHKLPYGTLLSKGDGDTVQAGETVANWEAHTLPIITE
                     VAGRIQFVDMIDGVTVSRQTDDLTGLSSSEVTDAAARPSAGKDMRPAIKLVDEQGNDV
                     MIPGTDMPAHYFLPGKAIVNIEDGAAVGVGATLARIPQKSGGNKDITGGLPRVADLFE
                     ARKPKEPAILAEHTGTVSFGKETKGKRRLVITRDSGEAYEEMIPKHRQLNVFEGEKVE
                     RGDVIADGPESPHDILRLRGVHAVTQYIANEVQEVYRLQGVKINDKHIETIVRQMLRK
                     CTITFAGDSEFLPGEQVEYSQVKIANRNLEAEGKEPARFERELLGITKASLATESFIS
                     AASFQETTRVLTEAAVSGKRDDLRGLKENVIVGRLIPAGTGFAYHQERQAKRTEAQEG
                     PSAEQATDNLAALLNAGFSSEE"
     gene            complement(25244..25735)
                     /locus_tag="PN96_00130"
     CDS             complement(25244..25735)
                     /locus_tag="PN96_00130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RNA polymerase sigma 70 factor"
                     /protein_id="ALR14489.1"
                     /translation="MVMLKKFKQTQDQWGGSSDVIDHWLETRQSLIVEYCKLAALQPC
                     SKANVIELPTPSELQNFCQHLVDYISEGHFKIYDMVMDRWKSTGFIVTDEINQTYGKI
                     VITTEPLLNFNDKYSEVTEDDELPDFNSDMSLVGEILETRFEVEDHLIQQISDSLAMP
                     PGA"
     gene            25914..26708
                     /locus_tag="PN96_00135"
     CDS             25914..26708
                     /locus_tag="PN96_00135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="ALR14490.1"
                     /translation="MLRKGDVNRVENAHWCVVSGSEIWLVDGAVPFGSAEQFALPEAS
                     ARKIGEYQQHPVMWINLADLEQDLPMTSLRDCLHFPEALFLLLSKAIQYGHMTQSLRF
                     CPQCGGRNFINNNQLAMQCGECRTLHYPRIFPCIIVAVRKDKQILLAQHPRHRNGMYT
                     VIAGFLEVGETLEECVAREIHEETGVYVKNIRYFGSQPWAFPSSMMMAFLADYESGEL
                     SPDYTELSDAQWFNADDMPDVAPKGTIARALIEQTLQDIKANHLGK"
     gene            26960..28027
                     /gene="hemE"
                     /locus_tag="PN96_00140"
     CDS             26960..28027
                     /gene="hemE"
                     /locus_tag="PN96_00140"
                     /EC_number="4.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020198117.1"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="ALR14491.1"
                     /translation="MTELKNDRYLRALLKEPVDYTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNAELASEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLRFAAGEGPVFDNP
                     ITCKADVEKIGLPDPEGELQYVMNAVRQIRKDLKGEVPLIGFSGSPWTLATYMVEGSS
                     SKAFTKIKKMMYAEPQTLHLLLDKLADSVIEYLNAQIKAGAQSVMVFDTWGGVLTPRD
                     YNLFSLQYMHKIVDGLIRENDGRRVPVTLFTKNGGMWLEQIAATGCDAVGLDWTINIA
                     DAKARIGDKVALQGNMDPSMLYASPERIREEVADILEGFGDAGTGHVFNLGHGIHLDV
                     PPENAGVFVDAVHELSKPYHK"
     gene            complement(28247..28819)
                     /locus_tag="PN96_00145"
     CDS             complement(28247..28819)
                     /locus_tag="PN96_00145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005434882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="ALR14492.1"
                     /translation="MSLDALLKQVRACQLCASDLPLGANPVVQAAKEARLLIIGQAPG
                     TRVHNTSIPWNDPSGDRLRQWLDIDKDTFYDPTKVAIIPMGFCYPGKGRSGDLPPRKE
                     CAPAWHQKLLQQLPNIELTLLIGQYSQNYYLTNKPKTLTETVQHWQDWEPDFIPLPHP
                     SPRNTLWLKKNPWFEANVVPYLQSRIHSML"
     gene            complement(28827..29750)
                     /locus_tag="PN96_00150"
     CDS             complement(28827..29750)
                     /locus_tag="PN96_00150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-ketoacid reductase"
                     /protein_id="ALR14493.1"
                     /translation="MPQPNKIFLLSEHQSTYQTLLAEKNLPGLSLTDNPNDAQIVLAD
                     PPLLSQRLDEFSQLDWVQSTFAGVNTLMSPELRQNYTLTNVRGIFGPLIAEYVIGYCI
                     SHYRHFILYHQQQQNRQWQPHLYTSLQSKKMVILGTGSIGSYLAKTVRAMGIEAIGVN
                     RTGIPTSGGEFNQTFHINELTSALKQADIVVNTLPSTPETLYLLNSETLCHLNQAILI
                     NVGRGDVLEDKGLLLAIKNRWIEHAILDVFEQEPLPKEHPFWRLPQITLTPHIAALSF
                     PEQVVEIFAENYLNWRDGFTLNYQVDFDKGY"
     gene            29817..30404
                     /locus_tag="PN96_00155"
     CDS             29817..30404
                     /locus_tag="PN96_00155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005382520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14494.1"
                     /translation="MLKNPLQVRLEKLEPWQQITFMACLCERMYPNYAMFCENTEFAE
                     PRAYRAILDSVWEILTVKSAKVNFERQLEKLEELFPSADEFDFYGVYPAMDACQALST
                     LLHGLLDRDYLFDSMIKVSQQSVQTVADLEQAQGSEPITNDNQKENQAVCEEWDVQWA
                     IFRPLREAAERDIGLIKDLREELREEGVSNIGIAL"
     gene            complement(30478..31605)
                     /locus_tag="PN96_00160"
     CDS             complement(30478..31605)
                     /locus_tag="PN96_00160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="ALR14495.1"
                     /translation="MLLLSIYISIAIGISFICSVLEAVLLSISPSYIAQLNQQGHPAA
                     EQLSKLKSDIDRPLASILTLNTIAHTIGAATAGAQAAVVFGSEALGIFSAVLTLAILV
                     LSEIVPKTIGATYWRQLAPTTAVALRWMVWALTPFVWFSEQITKRLARNHVAPKMRDE
                     LSAMAILARESGEFAEGESKILSNLLGIQDVPVTQVMTPRPVVFRVNATKTIDQFLEK
                     HKDTPFSRPLIYSEQKDNIIGFVHRLELFKLQQSGSGQKKLGEVMRPIQVVLNNTALP
                     RVFDQMMTHRLQLALVVDEYGTVQGLVTLEDIFEHLVGEEIIDEADKSTDMQELAYQR
                     WENWKEKYGVIESRDDDEEETPLENQETKPEPTEATKPDSK"
     gene            31859..32131
                     /locus_tag="PN96_00165"
     CDS             31859..32131
                     /locus_tag="PN96_00165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004410720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="ALR14496.1"
                     /translation="MNKTQLIDFIAEKADLSKAQAKAALEATLEGVTGALKEGDQVQL
                     IGFGTFKVNHRAARTGRNPKTGDEIQIAAANVPAFVAGKALKESVN"
     gene            32171..32869
                     /locus_tag="PN96_00170"
     CDS             32171..32869
                     /locus_tag="PN96_00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="ALR14497.1"
                     /translation="MKKQLYTSLLLASLSLVGCSSVETPNLEQFTHFTGGKAEGDASS
                     LYWMTERLTRVSTAADYVTSGDYGWYQSDYRWDAGELRELTRKGDQIDAKLGMVPFQI
                     HIRFNKDGEAVYQQYRVNNKVLPLQRDQLARFKSEANDVVASVKERSRNGQSLIQGYW
                     DGESLEVCDGKEFTTLEFNQTLPKFVIDRLASVDSYIAFIGKESRNKVIVDELLLLKD
                     DEFDCVQRPKFIAE"
     gene            complement(32939..34228)
                     /locus_tag="PN96_00175"
     CDS             complement(32939..34228)
                     /locus_tag="PN96_00175"
                     /EC_number="6.3.4.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233273.1"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="ALR14498.1"
                     /translation="MNVLIIGAGGREHALGWKAAQNPNVETVFVAPGNAGTALEPKLK
                     NVNIGVEDTAALVAFAQEHAIELTIVGPEAPLVIGVVDAFNEAGLPIFGPTQAAAQLE
                     GSKAFTKDFLARHKIPTGSYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMT
                     LEEAEDAIKDMLAGNAFGDAGSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRV
                     GDKDTGPNTGGMGAYSPAPVVTPEIHNRIMEEVIYPTVRGMAAEGNPYTGFLYAGLMI
                     DQDGTPKVIEYNCRFGDPETQPIMMRMQSDLVELCLAAVDKKLDQVESKWDPRASIGI
                     VLAAGGYPAAYNKGDVISGLPQTEVEGEKVFHAGTESKDGDVVTNGGRVLCATALGHS
                     VSEAQQRAYELAKQISWDGMFHRNDIGYRAIAREQSK"
     gene            complement(34447..36039)
                     /gene="purH"
                     /locus_tag="PN96_00180"
     CDS             complement(34447..36039)
                     /gene="purH"
                     /locus_tag="PN96_00180"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005451148.1"
                     /note="involved in de novo purine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase"
                     /protein_id="ALR14499.1"
                     /translation="MNNARPIRRALISVSDKTGIVEFAQALAERGVDILSTGGTARLL
                     AEQGIAVTEVSDYTGFPEMMDGRVKTLHPKVHGGVLGRRGQDDEVMEKHGINPIDMVV
                     VNLYPFAETVAKDGCTLEDAVENIDIGGPTMVRSAAKNHKDVTIVVNASDYDRVIAEM
                     DVNDKSLTLETRFDLAIAAFEHTASYDGMIANYFGTMVPSYGENKEGDEESKFPRTFN
                     QQFEKKQDMRYGENSHQAAAFYVEANPEEASVSTARQIQGKALSYNNIADTDAALECV
                     KEFDEPACVIVKHANPCGVALGKDILEAYNRAYQTDPTSAFGGIIAFNKELDAETATA
                     IVERQFVEVIIAPSVSAEAIEVVAAKKNVRLLECGEWTTKTTGFDVKRVNGGLLVQDR
                     DQGMVSLDDLKVVSKRQPTEEELKDALFCWKVAKFVKSNAIVYAKGDMTIGVGAGQMS
                     RVYSAKIAGIKAADEGLEVAGSVMASDAFFPFRDGIDAAAEAGIKCVIQPGGSMRDDE
                     VIAAADEHGMAMIFTGMRHFRH"
     gene            36073..36321
                     /locus_tag="PN96_00185"
     CDS             36073..36321
                     /locus_tag="PN96_00185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14500.1"
                     /translation="MFAKNELVFTSWGKILASFGKDLFRRFPVRKQSPLFDGAYSNQF
                     ITKKLAQSFGISKIIAKKSIFSFKSNEIVNKDSYVSDR"
     gene            36305..36703
                     /gene="zntR"
                     /locus_tag="PN96_00190"
     CDS             36305..36703
                     /gene="zntR"
                     /locus_tag="PN96_00190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005451151.1"
                     /note="mediates expression of the zinc export protein ZntA
                     in response to high levels of zinc; member of MerR family
                     of transcriptional regulators; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-responsive transcriptional regulator"
                     /protein_id="ALR14501.1"
                     /translation="MFQIGELAKRCGVTADTLRFYEKNGLIKPAGRSESGYRLYNEEN
                     QKQVRFILKAKELGLSLGEIRDLLEIKLEATEHSCAEVKAITTAKLELVDEKINELTK
                     IRRALKKINDACCGHVDDDASHCSILAALE"
     gene            36858..38384
                     /locus_tag="PN96_00195"
     CDS             36858..38384
                     /locus_tag="PN96_00195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="ALR14502.1"
                     /translation="MVGVYFQINDWVMDVGENKLYRKGRETSVEPRLSNLLYFFAKNA
                     NQVFTRKELIQSVWDRAAVTDQVVTQSISELRKLLRDSREENPSYVITVPKRGYKLVA
                     EVTRLTAKEFMRVSREDLSTLIGEADGCYSNDAQAQLATDSDAVGGEFKQKHQGRYWR
                     KGLFSLPLIGIVVAMIVTFTFKQPEVSDNPNNDIHLIEFTLHNNASHTGISDDLADGI
                     TKKLMSDVAQVSDYRVMQKSSSLNSHAEPGKSVVVKIRQSDVARLLEIEYRTSFSDKA
                     LFRRLYTLADRDLKTVLQQASLGMMTILSVPDAKLKSTMLVAGLPMTPKALKLFIQAH
                     HYLNISAANQYQHGIELMENVLDIEPHNAYVQAELLIAYYVQKALHPEQAQKKRQTQA
                     LHDALEVGAKMAIGQIQPRIYEALALHETVAGDLAKAKQYLAQALQLRDSVLSNVIRA
                     KHAELEQDIKSASKFYRQALYIDSSLKTYVLCKSLVFKSDVKVDDTKHQAISLKVSDI
                     "
     gene            38578..38871
                     /locus_tag="PN96_00200"
     CDS             38578..38871
                     /locus_tag="PN96_00200"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14503.1"
                     /translation="MTSISRKDPIYPRKIGRIVLYLRKVFVVCSVESFFAKNACANFL
                     TPYTAHPPTRSETKVTQRVGNERKKKFEKMLDSLTVRSKIRTPNDEQLSCWVS"
     gene            39060..40621
                     /locus_tag="PN96_00205"
     rRNA            39060..40621
                     /locus_tag="PN96_00205"
                     /product="16S ribosomal RNA"
     gene            40886..43800
                     /locus_tag="PN96_00210"
     rRNA            40886..43800
                     /locus_tag="PN96_00210"
                     /product="23S ribosomal RNA"
     gene            43875..43991
                     /locus_tag="PN96_00215"
     rRNA            43875..43991
                     /locus_tag="PN96_00215"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            44310..45871
                     /locus_tag="PN96_00220"
     rRNA            44310..45871
                     /locus_tag="PN96_00220"
                     /product="16S ribosomal RNA"
     gene            45928..46004
                     /locus_tag="PN96_00225"
     tRNA            45928..46004
                     /locus_tag="PN96_00225"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:45962..45964,aa:Ile,seq:gat)
     gene            46050..46125
                     /locus_tag="PN96_00230"
     tRNA            46050..46125
                     /locus_tag="PN96_00230"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:46083..46085,aa:Ala,seq:tgc)
     gene            46380..49294
                     /locus_tag="PN96_00235"
     rRNA            46380..49294
                     /locus_tag="PN96_00235"
                     /product="23S ribosomal RNA"
     gene            49387..49503
                     /locus_tag="PN96_00240"
     rRNA            49387..49503
                     /locus_tag="PN96_00240"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            49547..49623
                     /locus_tag="PN96_00245"
     tRNA            49547..49623
                     /locus_tag="PN96_00245"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:49581..49583,aa:Asp,seq:gtc)
     gene            49873..50343
                     /locus_tag="PN96_00250"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            50357..50889
                     /locus_tag="PN96_00255"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(51213..52571)
                     /locus_tag="PN96_00260"
     CDS             complement(51213..52571)
                     /locus_tag="PN96_00260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="ALR14504.1"
                     /translation="MSVYHTLCFLSAAAMLIAFVNSKIGKMQTTIAITAGSMVLSLLI
                     LIAGQNNWFHLTEIATETVTRINFEDFLLKGILGFLLFAGGLGIKLPNLKDQKWEITV
                     LALAATLFSTFFIGFALYGICLLIGIKFDLIYCLLFGSLISPTDPIAVLAIVKKLDAP
                     KRISTQIEGESLFNDGFGLVIFVTLFTIAFGTEAPTVGSVTMLFIQEAIGGIFYGFLL
                     GLLFHYLISATNDHSMELLLTIGVPTAGYAFAEYLHVSGPLAMVVSGIMIGNWTRFIG
                     FSKESEDHLDHFWELVDEFLNGVLFLLIGMSMLLFKFHQEDWIMMAIAVPLVLASRYL
                     SVFFSYIGFKRYRTYNRWSVKILTWGGLRGGLALAMALSIPSGIWVVQDKLIDVKEII
                     LVMTYAVVVFSILIQGSTITPMIEKAKEEEKKMEEERNALAASETKEHSVVQEPKEQL
                     ES"
     gene            52764..56444
                     /locus_tag="PN96_00265"
     CDS             52764..56444
                     /locus_tag="PN96_00265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="ALR14505.1"
                     /translation="MGTNVRQQIEAQLKQRILLIDGGMGTMIQGYKLEEHDYRGERFA
                     DWHSDLKGNNDLLVLSQPQLIKEIHSAYLEAGADILETNTFNATTIAMADYDMESLSE
                     EINFAAAKLAREVADEWTAKTPEKPRYVAGVLGPTNRTCSISPDVNDPGYRNVSFDEL
                     VEAYSESTRALIKGGSDLILIETIFDTLNAKACAFAVDSVFEELGIELPVMISGTITD
                     ASGRTLSGQTTEAFYNSLRHVRPISFGLNCALGPDELRPYVEELSRISESFVSAHPNA
                     GLPNAFGEYDLSPEDMAKHVKEWAESGFLNLIGGCCGTTPEHIRQMAEAVNQVTPRQL
                     PELQVACRLSGLEPLTIEKESLFINVGERTNVTGSARFKRLIKEELYDEALDVARQQV
                     ENGAQIIDINMDEGMLDAEACMVRFLNLCASEPEISKVPIMVDSSKWEVIEAGLKCIQ
                     GKGIVNSISLKEGKEKFVEQAKLIRRYGAAVIVMAFDEAGQADTRERKIEICTNAYRI
                     LVDEVGFPPEDIIFDPNIFAVATGIDEHNNYAVDFIEAVGDIKRDLPHAMISGGVSNV
                     SFSFRGNNYVREAIHAVFLYHCFKNGMDMGIVNAGQLEIYDNVPEKLREAVEDVVLNR
                     RNDATERLLDIASEYADKGVGKEEDASALEWRTWPVEKRLEHALVKGITEFIVEDTEE
                     ARVNASKPLEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAHLEPFIDAE
                     KQVGQTNGKILLATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPCEKILKVAKEEN
                     VDIIGLSGLITPSLDEMVHVAKEMERLDFDLPLLIGGATTSKAHTAVKIEQNYKHPVV
                     YVNNASRAVGVCTSLLSDERRPDFVEKLNADYERVRDQHNRKKPRTKPVTLEDARANK
                     VAIDWEAYTPPAPKQSGIHIFDDFDVATLRKYIDWTPFFMTWSLVGKYPTIFDHEEVG
                     EEAKRLFHDANELLDRVESEGLMQARGMCGLFPAASVGDDIEVYTDESRTEVAKVLCN
                     LRQQTEKPKGFNYCLSDYVAPKDSGKHDWIGAFAVTGGIGERELADEYKAKGDDYNAI
                     MIQAVADRLAEAFAEYLHERVRKEIWGYAEDENLSNDELIREKYQGIRPAPGYPACPE
                     HTEKGPLWDLLNVEENIGMSLTSSYAMYPGASVSGWYFSHPDSRYFAIAQIQEDQLES
                     YAERKGWDRLEAEKWLGPNING"
     gene            complement(56508..57860)
                     /locus_tag="PN96_00270"
     CDS             complement(56508..57860)
                     /locus_tag="PN96_00270"
                     /EC_number="2.7.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017449453.1"
                     /note="catalyzes the formation of 4-phospho-L-aspartate
                     from L-aspartate and ATP; functions in amino acid
                     biosynthesis; lysine sensitive; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="ALR14506.1"
                     /translation="MSAFNVAKFGGTSVANFEAMSRCAAIIENNPNTRLVVSSACSGV
                     TNLLVELANGVQDQEQRAELLRKLAEIHDDILSQLRDAAEASAEVYAILDTVTSLAEA
                     ASIQASSKLTDHLVACGELMSTHILAQLMRERGINAVRFDIRDVLRTDDNFGRAEPNV
                     EAISQLAQEKLVPLCQESVVITQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGL
                     EIWTDVPGIYTTDPRIAPKASPIPEISFSEASEMANFGAKILHPSTLVPALRHDIPVF
                     VGSSKDPEAGGTWIRHQVESSPLYRALALRCNQTMVTLRSASMFHAYGFLAKVFEILA
                     KHKISVDLITTSEISVSLTLDQTDTSGGAPQLPQAVREELEELCKVEVEHDLCLVALI
                     GNNMSGSKGYAKQVFGTLEDFNLRMICYGASPHNLCFLLHKSESQQAIQKLHAELFEK
                     "
     gene            58366..59487
                     /locus_tag="PN96_00275"
     CDS             58366..59487
                     /locus_tag="PN96_00275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--glyoxylate aminotransferase"
                     /protein_id="ALR14507.1"
                     /translation="MPIQSFIPPHRTLMGPGPSDIYPQVLQALSRPTVGHLDPLFIAM
                     MDELKQLLKYAFQTENDFTIAVSAPGSAGMEACFVNLIEKGDKVIVCRNGVFGERMRE
                     NVVRAGGEVVLVDDEWGAPVSVDKVEQALQQHPDTKILAFVHAETSTGAVSDAQALGK
                     LAKQHNALSIVDAVTSLGGVPLKVDEWQLDAVYSGSQKCLSCVPGLSPLTFSQAAIDK
                     IQSRTTPVQSWFLDQSLVLGYWSGEGKRSYHHTAPVNSLYALHEALLVLQNEGLENAW
                     ARHQLMHEKLKEGLQKLGFEFVVEEAHRLPQLNAIYVPEGIDEAKVRAHLLETYNLEI
                     GAGLGALAGKAWRIGLMGYAARPENVALCLKALEESLTE"
     gene            complement(59538..61316)
                     /locus_tag="PN96_00280"
     CDS             complement(59538..61316)
                     /locus_tag="PN96_00280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligase"
                     /protein_id="ALR14508.1"
                     /translation="MATIHVSGTRLSPGKTQVPLNRKFLLSLAVLFVLAMHFFMPNPG
                     GSGLALSFNATSWIAFSFALGIGCYQIARNQALRYSKLTIGLFISVIIMTIPIFYPNA
                     NSHLAANKLIGLWSGLLFFVVLQQFHFSNKHRQRILWFIVLAVVIEAIFGLTQYLYLK
                     PDNPFGYNTVANRPYGIFQQPNVMASFLATGLVIASYLLARQPYKYDRKLSDVYLLYA
                     VPVLTIPLIVALASRTGWLASLFAVLLIIPYMYRYNTKRRFTHWVISLAAGLLLSVVV
                     MQIAFPQGNGLAAEKVNMESARAYTFPQTVDMVIEKPFTGYGYGKFESEYMIYTARQH
                     SLNEKYPAGLPAMDHPHNELLYWAVEGGLLPIIGIFLAMTLVLHRIYQAKRGTRLALL
                     ALFIPIVLHSQLEYPFYHSLVHWVIFIILIYWVDQRVARYRQGGFTKITKSLLRIVSL
                     AVPAVFTFYMVSALHTNYILTKFETTRPTNPDILSQVSNPVVWKDRFDWDVYSTFLTI
                     GLQTQDPSLIQPYIDWSLNIIKDKPRPAFYNNLILAYQGLDDGSKAEQIRAEAQFLFP
                     RVDFSKVNYQPPSQAQSASPKLSDEQ"
     gene            complement(61384..64206)
                     /locus_tag="PN96_00285"
     CDS             complement(61384..64206)
                     /locus_tag="PN96_00285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006742330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="ALR14509.1"
                     /translation="MDKIEVRGARTHNLKNINLTIPRDKLTVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EVYDYLRLLYARVGEPRCPTHHSPLAAQTISQMVDKVLELPEGSKMMLLAPIVKERKG
                     EHVKTLENLAAQGFIRARIDGETCDLSDPPTLELHKKHTIEVVVDRFKVRPDLQQRLA
                     ESFETTLELSGGIAVVAPMDGDGEEIIFSANFACPKCGYSMQELEPRLFSFNNPAGAC
                     GTCDGLGVQQYFDPSRVIQDDSLSLAQGAIRGWDQKNYYYFQMLTSIADHYGFDLHAP
                     FNSLPKKTQEIILKGSGRTEIEFKYINDRGDIRVKRHPFEGILNTLERRYRDTESNSV
                     REELAKYISTKSCSSCGGTRLRLEARNVFIADTTLPEIVELSIADALSFFQTLKLEGQ
                     RAQIAEKVMKEINDRLQFLVNVGLNYLNLSRSAETLSGGEAQRIRLASQIGAGLVGVM
                     YVLDEPSIGLHQRDNERLLKTLTHLRDLGNTVLVVEHDEDAIRCADHVIDIGPGAGVH
                     GGNVVAEGTMAEIIANPNSLTGQYLSGVKEIAIPKERTPRDPKKTVELIGATGNNLKN
                     VNLSVPVGLFSCITGVSGSGKSTLINDTFFKIAHTQLNGATTAHPSPYKSIKGLEHFD
                     KVIDIDQSPIGRTPRSNPATYTGIFTPIRELFAGTQESRSRGYKPGRFSFNVRGGRCE
                     ACQGDGVIKVEMHFLPDVYVPCDVCKGKRYNRETLEVRYKGKTIDEVLEMTVEDAREF
                     FEPVPVIARKLQTLMDVGLSYIRLGQAATTLSGGEAQRVKLARELSKRDTGKTLYILD
                     EPTTGLHFHDIQQLLSVLHRLRDHGNTVVVIEHNLDVIKTADWVIDLGPEGGQGGGEI
                     IAQGTPEDVSLIEGSHTARFLSPMLK"
     gene            complement(64355..65227)
                     /locus_tag="PN96_00290"
     CDS             complement(64355..65227)
                     /locus_tag="PN96_00290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="ALR14510.1"
                     /translation="MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAI
                     QAGMNGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIESANFTYIRQ
                     REMKGLGHAILTGRELVGDEPFAVVLADDLCVNEDEGVLAQMVALFKQFRCSIVAVQE
                     VPVEETHKYGVISGEMIKDDIFRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIEN
                     TEPGKGGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEATNYCFENLYLKDE
                     KKSELGKHATQREA"
     gene            complement(65407..66051)
                     /locus_tag="PN96_00295"
     CDS             complement(65407..66051)
                     /locus_tag="PN96_00295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005480993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="ALR14511.1"
                     /translation="MKKSAYARKLFLISMEENTPQKVAALEKYIEIGIPVISTDALME
                     AKPKHRNKILLIDFSEHKSLVQSIKNLPLVWKNFETVIFNVPKRLTTDELLSFGQLKG
                     VFYADESLERIGEGLKGIINGQNWLPRNVSSQLLHYYRNVINTHTAPATVDLTIRELQ
                     VLRCLQNGASNSRMAEELFVSEFTIKSHLYQIFKKLSVKNRVQAIAWADQNLMS"
     gene            66329..66868
                     /locus_tag="PN96_00300"
     CDS             66329..66868
                     /locus_tag="PN96_00300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="ALR14512.1"
                     /translation="MASRGINKVILVGNLGNDPEIRYMPNGGAVANITIATSDSWRDK
                     ATGEQREKTEWHRVVLFGKLAEVAGEYLRKGSQVYVEGQLQTRKWQDQSGQDRYSTEV
                     VVQGFNGVMQMLGGRAQGGAPAMGGQAPQQGGWGQPQQPAQPQYNAPQQQAPKQSAPQ
                     QPQQQYNEPPMDFDDDIPF"
     gene            67106..69115
                     /locus_tag="PN96_00305"
     CDS             67106..69115
                     /locus_tag="PN96_00305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="ALR14513.1"
                     /translation="MRYTPTLKLSTRLVAFVTMIVICAMFILFVGGTLSFKRLGQEYL
                     THYLEGIVEVVDKEMEDPDAAYSMQRWMPKMLQASNIVEMTLTTNDAVVYRFKDTSHK
                     MDASVLFEKEYPLTHNQDYVIYFKAIPPYLGYGYSMQALWSITLAVILIIFCLMRGVA
                     WLKEQLAGSEMLEERGRMILAGRVEQYAKGDKSEWPYTASEALDVLIEELQDARQERS
                     RFDTFIRTQTFLDKLTGTANRVLFDSKLESSLLESGARGAVMLVRLHDWKLAEEEQDK
                     QVTDDFIVEVGSLLSNLVQRYPDVVFSRYYDSDFALFLPHQDAKGVANLASQCIRQLE
                     KLTPPEPLEPDNWCHIGITMFKEGERHSQIIDEAETALRSAQLQNNNNWSRFKKWNHD
                     EEVRGSVRWRTLFDKALTPENLLLYAQPVFVMNDSSHKKPLYEALTCRLQDPENGIVK
                     ASRFISAVRQVGYETQMDKAVVNKFLRSFKDNFDHSKSYALSLTVVPFANREYFKWFR
                     YELLQLSREQRKCLNFEFVEAQFVRHLDFMRPVAKMLAGLGCQLMIGQAGRTIVSSHY
                     LKEVDIRYLKLHRSLVTKIDQRHENQLFIRSMLGAAANSKTKIVAVGIENRNELNTLL
                     ELGVYGGQGRYFATERQFLPRPQKMQPTRSESQVKPGRRNRWRKK"
     gene            69127..70572
                     /locus_tag="PN96_00310"
     CDS             69127..70572
                     /locus_tag="PN96_00310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshI"
                     /protein_id="ALR14514.1"
                     /translation="MDLKAVVDKFVRSSGSGRACFLVIQPDAIYLSSSLKSARPTRFE
                     VSDSNWERAVEQALSVAASSYDSLKVVLSHNYYQMYQIDKPAMPRHEWPAALPFLLKE
                     LISERAIDIVADAVELPNSSKVQAYVLSRKTLDKLVQIANHAQLSLDAIIPEDCVWGH
                     TAGELGNFILLQRSVRGHFRISAFVERTIAFHRSIRSVTPPLTGVPSTELQMDSLSLE
                     LQRSIDYLSSQLRHVQLHQMKVCCDEEDEHELVQSLNYRLSTKVSPLIHEDNELSGHV
                     LANTATAANALHVNLYPDYLKPKKELLTLKNVVISWGVAAAAIFLSYGYVTWQSEGLE
                     DEIAIVKSKGEIMKSELERAQVKLRKHQPDTSKLAAKERLERTVKAKRDSLKAVGKYD
                     DSQLTGYSGVMHSLAKLGNREISLSEIRINNNTLNLKGLAKAPSSVPSWVNRFKDEIN
                     LVGRTFDDVNIGRNEKGIVTFELKAGEEKKK"
     gene            70569..71219
                     /locus_tag="PN96_00315"
     CDS             70569..71219
                     /locus_tag="PN96_00315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshJ"
                     /protein_id="ALR14515.1"
                     /translation="MNEFWLSLEERFGEMSAREKILIALCGLVTVVMLLFTLVLEPKL
                     NQINNNEKQLSNLKQANQKTEIDILRIQAQLKKDPNSEIDLQVSGLLAESQRLSQQLS
                     EIIEHLITPSQMAGLLEQVLEQQTGIHLVSLQTLPSEPISDDKEVSQYSGYYVHPVRM
                     EVTGDYFSIANYLGKLEKLPASYYWRSFYYKVDEYPKATLVLEVYTLGSREAFIGG"
     gene            71212..71544
                     /locus_tag="PN96_00320"
     CDS             71212..71544
                     /locus_tag="PN96_00320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshK"
                     /protein_id="ALR14516.1"
                     /translation="MVKKFIISIALTVIAGGVWADQDPTAPLGWQKPAAESNAKPTKK
                     RSRLPTLNSIVCKVGSQCSAIMDNQIVEQGELFKGYRVVSITSEFVTLKQSNRQWKLE
                     LFGLNVKK"
     gene            71616..73244
                     /locus_tag="PN96_00325"
     CDS             71616..73244
                     /locus_tag="PN96_00325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshL"
                     /protein_id="ALR14517.1"
                     /translation="MGHRDPVEVKQALNESINQANSRALEELPSSVEADLMPNLDTSS
                     SSEQATSKRFRIQANAVEARSFFASLVKGTEYSAAIHPAVAGNITVNLTDVTLDEVLS
                     VVQNMYGYDVIKSGKVIQVYPAGMRTVTIPVDYLQFKRTGRSLTSISTGSVTSAGTSN
                     SGGSSDSSSSSSSSDSENSSDSSTSPTGGTRIETVTESDFWPMLQQAVANLIGSGKGQ
                     SVVVTPQASVITVRAFPDDIRQVREFLGVSQERMQRQVILEAKILEVTLSDGYQQGIN
                     WSNLSASIGSGGVSLGRPYAGGTTLPGTGVTIPTLPGLDTIGNLLGGQTNVTISDGNF
                     DAVLSFMSTQGDLNVLSSPRITAANNQKSVIKVGTDQYFVTELSSNVGNGDNSNAVPE
                     VELTPFFSGISLDVTPQIDDKGNVFLHVHPAVIEVEEETKVLNLGGDFEDVQLPLAKS
                     SIRESDSVIRAKDGDVVVIGGLMKQQNLEQVSKVPFLGDVPALGHLFRNVNNVTQKTE
                     LVILLKPTVVGVNSWQKELERSRDLLQEWFPDAE"
     gene            73289..74134
                     /locus_tag="PN96_00330"
     CDS             73289..74134
                     /locus_tag="PN96_00330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005438115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshM"
                     /protein_id="ALR14518.1"
                     /translation="MYLSHFGFRVQPFSLTPNTEMFLGLVPHYEAIQTILAAVQMGEG
                     VIKVTGEVGTGKTMVCRKLIEQLDSQVELVYLPNPVLNGEQLQFAVARELGIENNDPL
                     LIVSLIQEHLIRVHSSAKKTVLIVDEAQALSPQALEALRLLGNLETEHDKLIQIVLFG
                     QPELDERLATHELRQFRQRITFSCELRPLSLDEGVAYINNRLDIAGNGAHIFSVEQKK
                     AIWRSAMGIPRLINQICHKALLAAFNEGCTLLKNQHVYLAIHDTFDARKPKFKTPVFW
                     GWSQP"
     gene            74119..75231
                     /locus_tag="PN96_00335"
     CDS             74119..75231
                     /locus_tag="PN96_00335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshN"
                     /protein_id="ALR14519.1"
                     /translation="MESTLSAINKALSEITEKTSPSELTRAEIPHVSRSKPWLWLVAG
                     FSLSLAVGGWAVSRGPVASDEFAQYQLGEGLQVKSTLDEPAYSPTSKMTPETSRQVYT
                     TPAQQQQVIEAPVTKSEPVPKTPAPEVDSFTPRQEVRAVAQAPILLAQVASVPSESAP
                     SGFGIESSMNIEQVELTHHQLAIKALGRAEKALDANDMQTALSAYQEALRYEPTNVDT
                     RQKLAALYFGKGDTRKAYEIMQEGISLDINNQTLRLALSKLLVKAKQPQAALSPLVHM
                     PPMPNRDYLAMRAVLAQKQKQDEIALESYQLLTQRDPENARWWMGLGIQQERALQFSS
                     AINSYNKALGKVGISNQSQAFIRDRLTVLKQLENAQ"
     gene            75228..76952
                     /locus_tag="PN96_00340"
     CDS             75228..76952
                     /locus_tag="PN96_00340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshE"
                     /protein_id="ALR14520.1"
                     /translation="MKIQLRKRLGDLLVDEAIVTEEQIQQALTAQRSTGQKLGDALID
                     LGFITEKQMLNFLSQQLGLPLIDLGRAPVDPEAVQILPEVHARRLRAMVVARNGHTLR
                     VAMSDPADLFTQESLMNLLGEYSLEFIIASERQLIDSFDRYYRRTKEIASFAEQLQAE
                     HQDVQSFDYGIDETDSEEVTVVKLVNSMFEDAVQVGASDIHIEPDDKVLRLRQRIDGV
                     LHETLLNEVKIASALVLRLKLMAQLDISEKRLPQDGRFNIKVRGQSIDIRMSTMPTQY
                     GESVVMRLLNQSVGLRPLEESGLPPELLARLRRQLSRPHGMILVTGPTGSGKTTTLYG
                     ALSELNEPEKKIITAEDPVEYRLPRITQVQINSRIDLTFSRVLRTFLRQDPDIILVGE
                     MRDQETVEIGLRAALTGHLVLSTLHTNDAIDSALRMIDMGAPGYLVASAVRAVVAQRL
                     VRRVCPDCKTEESLDESRKQWLAGRFPNQVGVTFYKGSGCQNCNLTGYRGRIGVFEML
                     ELENEMMDKLRANDAVGFAQVARRSEKYKPLLASAMELALQGTVSLDEVMALGEGDAS
                     GKTDPILL"
     gene            76961..78184
                     /locus_tag="PN96_00345"
     CDS             76961..78184
                     /locus_tag="PN96_00345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshG"
                     /protein_id="ALR14521.1"
                     /translation="MPTFRYQGRTLDGSSTRGRIEAVNSESAAEALMNKGVIPLNVRL
                     EKEGMKNQFSLSQLLVPAIPLEVIILFSRQLFSLIKAGVPLLRSMRGLLQNCENKQLK
                     EALEDVVSELSNGRSLSSAMQQHRKVFSPLFVSMINVGENTGRLDQALLQLANYYEQE
                     LETRKRIKAAMRYPTFVIVFITIAMFVLNILVIPEFASMFTRFGVDLPLPTRILIGTS
                     NFFVNYWVLLIAMMIAGFIIFKSWVATADGREAFDRFRLRLPIVGDIVNRAQLSRFSR
                     TFALMLKSGVPLNQSLALSAEALGNRFLENRILEMKSAIEAGSTISVTAINSKIFTPL
                     VIQMIAVGEETGRIDELLLEVSDYYDREVDYDLKTLTARIEPLLLVIVAGMVMVLALG
                     IFLPMWGMLDIIKGG"
     gene            78188..78643
                     /locus_tag="PN96_00350"
     CDS             78188..78643
                     /locus_tag="PN96_00350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshF"
                     /protein_id="ALR14522.1"
                     /translation="MVENQNRAALILCGLVAIIFVGLVFKFQTVAKEARVTGARLAKV
                     WMLDSVQRYREAWLLQGEPKQLEMDGFLLTMTEGGLVSPFSKQGDLDCDYWLAVHYPQ
                     RKIMTIEPSEIGGAIKNGLYICSYIYKKSYKVIVTANTNDLISVEILSE"
     gene            78932..79414
                     /locus_tag="PN96_00355"
     CDS             78932..79414
                     /locus_tag="PN96_00355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshA"
                     /protein_id="ALR14523.1"
                     /translation="MKRQGGFTLIELVVVIVILGILAVTAAPRFLNLQDDARNATIDG
                     LRGAIVGAMGISYGKAAIDGIEDVQFVTGTSINEIEGVQHSYGYPTADDTNGIGAAFD
                     QSGDFVVLSTGGVIGTSGTITYGIANYTGSCVVYTEATATTPATAVVSENATTCTATP
                     "
     gene            79483..79713
                     /locus_tag="PN96_00360"
     CDS             79483..79713
                     /locus_tag="PN96_00360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshA"
                     /protein_id="ALR14524.1"
                     /translation="MRKSSGLSAIEFVVVLIILGVIGYVVLPRFISFEPKTYEAKWEQ
                     TKQTAEHVSETLSNKETYDRIEQELGRSKADK"
     gene            79838..80326
                     /locus_tag="PN96_00365"
     CDS             79838..80326
                     /locus_tag="PN96_00365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshC"
                     /protein_id="ALR14525.1"
                     /translation="MKIRSSTLGFTLTELILVIVLLSILSLFAASRFIGKSSFSAFVL
                     QEQVISVIRQVQVNRMQSNIDDSDDNFRLQVSSSCIGSVAACALGDSQQDSRSDFVAD
                     DSTQFSIKGDVERPIDFSLLGNPLNSASSGVSILIENKNGGSRCEVDINSQGYVSKGL
                     CL"
     gene            80323..80898
                     /locus_tag="PN96_00370"
     CDS             80323..80898
                     /locus_tag="PN96_00370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshD"
                     /protein_id="ALR14526.1"
                     /translation="MKKVRGMTLIEMIIAIVLMGIAMVAFTSFLVPQVRDSANPHYQT
                     RASALAQSFMSQILARGFDDNSNFDGGLVRCGENSVNCTPSEELGAETGESLPTDFND
                     VDDFIGCWSTPNTLAQCKSVSRGNITDVLANVGEDSAEQYKNFRVEVQVAYDDLGGSE
                     TSSLPKYKKVTLTIFAGTTQPLTLTALKGNY"
     gene            80898..81635
                     /locus_tag="PN96_00375"
     CDS             80898..81635
                     /locus_tag="PN96_00375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshO"
                     /protein_id="ALR14527.1"
                     /translation="MKERGFTLIEMVITIVIGSIIMLGIAGYIKLGIKGYADSIDRQR
                     VQTEAQFVIEKMSREIRHAVPNSFHEPDGTSNCLEFVPIEYSGFYAFSGSTLEFLIGN
                     DTNLKRIPSKRWLVINPSRYEDLFPKDPDNPESFQRIELKNISRDKVDEPFIVSIDES
                     GISSNSISSRHYIYQDKSEVRYCFDNGRVLRNNVIVTDSIDTSASYMRYVEPTLQRGG
                     LVHINLEFLQDGERSVYQQDVQVLNVP"
     gene            81625..82059
                     /locus_tag="PN96_00380"
     CDS             81625..82059
                     /locus_tag="PN96_00380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005396273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshP"
                     /protein_id="ALR14528.1"
                     /translation="MFRKRNQQGNVLIVVLFVIIVMGYLAASLMRISWSNQSGLTREF
                     LGTKAWFVAQSANEWALTQLYPLNGSSDSVTTICVDQVSGATPNVTQNTACRINKMSC
                     LRLGVLNEGTSEAQSLFRVQATAICGSGLSQVQRQQEVWVRE"
     gene            82064..83635
                     /locus_tag="PN96_00385"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            85918..86961
                     /locus_tag="PN96_00390"
     CDS             85918..86961
                     /locus_tag="PN96_00390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006071009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreB"
                     /protein_id="ALR14529.1"
                     /translation="MFKKLRGMFSNDLSIDLGTANTLIYVKGQGIVLDEPSVVAIRQD
                     RVGSAKSVAAVGHAAKQMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNS
                     ILKPSPRVLVCVPCGSTQVERRAIRESALGAGAREVYLIDEPMAAAIGAGLRVSEPTG
                     SMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAVINYVRRNYGSLIGEATAEKI
                     KHEIGSAYPGDEVLEIEVRGRNLAEGVPRSFSLNSNEILEALQEPLSGIVSAVMVALE
                     QCPPELASDISENGMVLTGGGALLKDLDRLLMEETGIPVVIAEDPLTCVARGGGKALE
                     MIDMHGGDLFSEE"
     gene            87111..88010
                     /locus_tag="PN96_00395"
     CDS             87111..88010
                     /locus_tag="PN96_00395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="ALR14530.1"
                     /translation="MNPIFGRGPSLQLRLFFAVIMSASLMLADSRLDTFSNVRFLLNS
                     AVAPIQYAANLPRSMFDGVFERFNTRQTLVEGNRNLKREVLRLKSELILLDQYREENQ
                     RLRKLLGSSFVRDEKKVVTEVMAVDTSPYRHQVVIDKGQIDGVYVGQPVINEKGIVGQ
                     VTFVAAHNARVLLLTDAKNAIPVQVIRNDIRVIASGNGEMDEIQLEHIPTSTDIQVGD
                     LLVTSGLGGIYPEGYPVANVTIVDHDTRQEFASIKAEPVVEFDRLRYLLLIWPNEDRQ
                     HKVLQSNVDEDSEQVEQEVTDGE"
     gene            88000..88488
                     /locus_tag="PN96_00400"
     CDS             88000..88488
                     /locus_tag="PN96_00400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005444359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="ALR14531.1"
                     /translation="MASNVFRSRMVIGVSFFVALVLQTIPWPGDLELFRPSWLFLVTC
                     YWVLALPNRVNVGSALILGLIWDILVGSTLGIRGMMMSIIIYLVALNFLLIRNMALWQ
                     QSILIAFFTVLLELLIFCGEYLNQDVVFNPLSLWTAAINCILWPWMFLLMRRVRRAWH
                     VR"
     gene            88493..89062
                     /locus_tag="PN96_00405"
     CDS             88493..89062
                     /locus_tag="PN96_00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor Maf"
                     /protein_id="ALR14532.1"
                     /translation="MKKSLSLVLASGSPRRKELLAQLGYDFDIVLPDVEEAKQAHEQA
                     QEYVLRLSLEKAQAGLALAKPDSVVLGSDTVVVCDDHVLEKPTNFEDAKRMLTRLSGR
                     RHQVMTAVSVVSSQKQHSVVVITDVWFKPLTHEEIEQYWQSGEPCDKAGSYGIQGLGG
                     RFVTRIEGSYHAVVGLPLFETDQLIQEFL"
     gene            89081..90550
                     /locus_tag="PN96_00410"
     CDS             89081..90550
                     /locus_tag="PN96_00410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017420045.1"
                     /note="involved in the processing of the 5'end of 16S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G"
                     /protein_id="ALR14533.1"
                     /translation="MSAELLLNVTPSETRVAMIEGGVLQEIHIERESRRGIVGNIYKG
                     KVSRVLPGMQAAFVDIGLDKAAFLHASDIVPHTECVAENEKQQFQVRDISELVRQGQD
                     IVVQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESERERERLKKVVNQ
                     YCDEHGGFIIRTAAEGADEKELSQDAAFLKRLWLKVMERRSKYKTRSTLYGELGLAQR
                     ILRDFVGTELDKILVDSRLEYDNLQEFTSEYVPELTDKLELYEGDKPIFDMYDTENEI
                     QRSLERKVELKSGGYLIIDQTEAMTTIDINTGAFVGRRNLEETIFNTNIEATQAIARQ
                     LRLRNLGGIIIIDFIDMASEVHRQRVLTSLEAALSKDRVKTNINGFTQLGLVEMTRKR
                     TRESIEHILCSGCPTCEGRGTVKTVETVCFEILREITRVNRAYDADNFVVYASPFVAE
                     ALLGDESHALAELEVFIGKQVRIQAEPLYIQEQFDVVMM"
     gene            90562..94440
                     /locus_tag="PN96_00415"
     CDS             90562..94440
                     /locus_tag="PN96_00415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14534.1"
                     /translation="MNFGFNRLGRFCAWSLATVLVLLAIVVTTLRVTLPQLDHFQDEI
                     KTWVKQGTGFDFSISSVAGSWQNSHPSIALLGLEANLPNNQEARFAVDELQIEFDLIQ
                     SLLQFKPVVADLTIHNLALDIRSVSLLPNAESEMPVATSEESEVKLIDQLDSLLLRQF
                     EDFTITNSRIWYKSVSGETRRLDIERLRWSNQGRRHLAEGTVSIADAKINSLLVSANF
                     KDHGSLRDVSGEFYVSAQDVSVAPWLTTYMQVESGVESGKVSLNTWLTLKHSQPNYAY
                     VELQPSELVWNENGSHELFIESGIFKLLPDKHGWKVNGHSLQIRTDEKQWPELDVAFD
                     WQPSGWALNLSEIDIESITPLIKLAPESESTSKFINQIEPKGRLEDIRLSMNGGWETL
                     RYSAELDELGLTQWKLLPGFQHVQGSVSGNVNQAKANVTVIDDVFPYGDVFQAPLNIK
                     QGEVEIVWQQDQQGWRLWADKVTAATPDLQVLGAFRLDFPKDQSPFLSFYAEADLYNA
                     GETWRYLPTLALGQDLTDYLSTAIQGGKVNTAKLLWYGELGDFPYKQHNGMFQAWVGL
                     KDAKFSFDTAWPPITDLQLDLLFENDAMYLDSKSATLNGVAAERITGRIPRLAPDGHI
                     EIEAKARAPGNEVRDYMMATPLVDSVGAALTALQVSGSVYSEFQLNIPFNQENEPRAW
                     GYADLKDNRVDIDAPPMTLENATGRINFDNDVVTTSGLAAELITQPISVDFRGESAEQ
                     GYDVTINTLGDWDVEPLKPYVGERWLNLVSGHAPWQMDIGLQLNDVGFTYQVDVLAQL
                     NRVVSKYPYPLAKKAGESGLAKLQASGNQENISARLEIPNAKYQTEIDITGEVPLLTA
                     TNLMIGQGGFKTTPVIGHDASIRLDEIDVDKWLELLNVPSNSAPSVLSNMKTPTIPLP
                     TRVDIEAQSLRLAKIEFHDVDLNASKKKENWRMRVNSQEVKGTANYLKPNDLSVSLDH
                     LHLYIPGFDEIEKERSSIFASEDQSAPLITKFDRQFHDEMPNLKLKINDFWLQGYKVG
                     KVNVDLQRSDDRLEWKKLNFSSGKNSIDMSGWWELTDERSHSNLSFKVKGDNNTDLME
                     RFGITSGIQQAPFELNANMEWDGAPWSMKTQTLQGDVSTEFGKGVISEVSGAARLLGL
                     FSLDSIIRKMQLDFTDVFDNGMAFNSITGTGKIQDGIFVTNDIVMDALAGEMQIRGMA
                     DVTKRLVDAEVKFTPDITSGLPMLTAFAVAPQTALYVLAISTVISPVVEVFTQVNYEV
                     KGPLESPTVKEISRSQGEYKLPEKLREQAQ"
     gene            94482..95303
                     /locus_tag="PN96_00420"
     CDS             94482..95303
                     /locus_tag="PN96_00420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015297325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="ALR14535.1"
                     /translation="MERVGIIQMTSGPDIEANLAFIEKQCELAASQGVKLVLTPENSV
                     LFASREEYHQHAEPLGSGVLQQRLADIAKHNQLTLIVGSMPIQTARGVTTTTVVLPPH
                     GKCIAHYDKLHMFDVEVADGHGSYRESDTFTAGNQMVVAETDIGSVGLSICYDLRFPE
                     LYKELRLAGAEMIVVPAAFTAVTGEAHWEILLRARAIETQCWILASNQTGTHPCGRKT
                     WGHSMVIDPWGRIHKQFQDQVGLLVAEIDLSQTQQVRQNMPLTQHSRFQNELRRK"
     gene            95315..96760
                     /gene="tldD"
                     /locus_tag="PN96_00425"
     CDS             95315..96760
                     /gene="tldD"
                     /locus_tag="PN96_00425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005461834.1"
                     /note="responsible for the proteolytic maturation of the
                     E. coli pMccB17 plasmid-encoded microcin B17, an exported
                     protein that targets the essential topoisomerase II DNA
                     gyrase; degrades the E. coli plasmid F-encoded CcdA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease TldD"
                     /protein_id="ALR14536.1"
                     /translation="MSTNQIEQALIAPNGLTEQDIADTLASIATRQIDYADIYFQSSW
                     HESLVLEDSIIKDGSFNIDCGVGVRAVTGEKTGFAYSDQINLDGLKQSAIAARGIAQQ
                     GQNGKVQAFKRTDNQAYYEAVNPLAGWEKQQKTELLKSLDAYIRTKEPLIKEVSISIS
                     GVHEQMLVAATDGTYAGDIRPLVRLSISVLAQKGERRERGSAGGGGRFGYDFFLSETD
                     GVKQAFHYADEAIRMALVNLEAEAAPAGMMPVVLGSGWPGVLLHEAVGHGLEGDFNRK
                     ESSVFSGKMGQQVTSSLCTIVDDGTLKDLRGSLNVDDEGVNGQYNTLIENGVLKGYMQ
                     DKLNARLMGVNPTGNGRRESYAHLPMPRMTNTYMLPGEHTPEEIISTVEKGLYAPNFG
                     GGQVDITSGKFVFSASEAYLIENGKITRPVKGATLIGSGIEAMQQVSMVGNDLSIDKG
                     VGVCGKAGQSVPVGVGQPTLKLDSLTVGGTE"
     gene            complement(96834..98210)
                     /locus_tag="PN96_00430"
     CDS             complement(96834..98210)
                     /locus_tag="PN96_00430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011079415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="ALR14537.1"
                     /translation="MGDTDRKLFVLDTNILLHEPFAIFSFKEHDVVIPMTVLEELDRI
                     KDSKRDVARDARVAIRALEDMFKDATPDEISEGIPVSKDNPDQGAISILADFELQETV
                     KAFADKAGDNRILNAVLYLQNKRAPREVVLVTKDINMRLRAKGAGVRFVEDYRTDQLI
                     DDVQYLTKGFQQREGDFWSGIDEVESYALGGKTYHKLSREPFDPTFINQYVIDEDSDF
                     AGRVETINEDKLTLLDLSRERMMHRRVWDITPKNIYQAMALDALVDPDIDLVILTGAA
                     GSGKTLLAMAAALEQTIEKKMFDKIIVTRNTPDIGESIGFLPGSEEEKMMPWLAAVTD
                     TLEALHKHDHCTEGSLKYICDKANIQFKSINFMRGRSIQNAFVLLDECQNLTASQIKT
                     IITRCGEGTKIVCSGNLAQIDSHYLTPVTSGLTYMVERFKNFEGSANIHLNGVVRSRL
                     AEFAEENL"
     gene            98778..101687
                     /locus_tag="PN96_00435"
     CDS             98778..101687
                     /locus_tag="PN96_00435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004735918.1"
                     /note="transcription regulator that activates
                     transcription by stimulating RNA polymerase (RNAP)
                     recycling in case of stress conditions such as supercoiled
                     DNA or high salt concentrations. Probably acts by
                     releasing the RNAP, when it is trapped or immobilized on
                     tightly supercoiled DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="ALR14538.1"
                     /translation="MTFALGQRWISDTESDLGLGTVVAMDARTVTLMFSASEENRVYA
                     RNDAPVTRVTFNVGDVIDCQEGWSLKVEEVLEDEGLYTYFGTREDTQETAVVLREIFL
                     SNQIRFNKPQDKLYAGQIDRMDNFVLRYRALTNQFEQHKSPMRGLCGMRAGLIPHQLY
                     IAHEVGRRHAPRVLLADEVGLGKTIEAGMIIHQQVLSGRAERILIVVPETLQHQWLVE
                     MMRRFNLHFSIFDEERCIEAFADAENPFDTQQYVLCSLDFLRKSRKRFEQALEGEWDL
                     LVVDEAHHLEWSQDKPSREYQVVEGLAERTPGVLLLTATPEQLGRESHFARLRLLDPD
                     RFYDYEAFVEEEEQYAPVADAITSLFTGEKLPNDAKNQITELLSEQDVEPLFRIIESN
                     SDEEDKASARQELIDNLMDRHGTGRVLFRNTRAAIKGFPARNVHLMPMDIPQQYTTSM
                     RVAGMIGGKMSSEARAMKNLYPEEIFQEFEGDESSWWQFDSRVNWLLEKVTEKRSEKI
                     LVIASRASTALQLEQALREREGIRATVFHEGMSILERDKAAAYFAQEEGGAQVLICSE
                     IGSEGRNFQFANQLVMFDLPFNPDLLEQRIGRLDRIGQNRDIDIHVPYLKGTSQAILA
                     RWFDEGLNAFAETCPTGRAVYDKYSDALIEILASGDTSELDDIIEESAKMNKQLKSQL
                     EQGRDRLLEMHSNGGEKAQQIVEKISSTDGDTNLVTFALSLFDTIGLNQDDKGENALV
                     VTPSEHMMVPSYPGLPYEGATITFDRETALSREDMHFISWEHPMIQGGIDLLMSEGVG
                     TSAVSLLKNKALPVGTILLELIYAVDAQAPKRSGIARFLPKTPIRLMMDARGNDLSAQ
                     VEFESFNRQLSPVNRHLGSKLVTSVQKDVHRLIEAGDGLVEQKVEEVRKQAQQDMQHS
                     LNAELERLQALKAVNPNIRDEEIETIDAQIKELTGYINQAQVQLDSLRLIVVSHN"
     gene            complement(101776..103041)
                     /locus_tag="PN96_00440"
     CDS             complement(101776..103041)
                     /locus_tag="PN96_00440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14539.1"
                     /translation="MDSAVTSPPQSKISLFFRSLGPGILMASAAVGGSHLVASTKAGA
                     IYGWQLAALILLVNFFKYPFFRAGVQYTMGTGKTLVEGYAEMGRPYLWAFLFLSAVSA
                     VINTAALLMFSASLLGYFIPFSLSMASLSIIVIATCLIILFAGHYKALDTLSKVIMSV
                     LTIATLLAAAIAFGNPVEQVANFESPSVWSIAAIGFIVVTMGWMPAPIEISCLTSAWL
                     KRQSSEQEVTARSALFDFNVGYIGTAILAIVFLSLGSLMLHGSGVELKSSGVGFSHQL
                     VGLYASTIGEWSRYLIAVIAFFCIFGSTITVIDGYSRVISDSQRLLRSQPDTNPKATS
                     AIMLVVSLLALGIVTFWASALLPMLNFAMILAFMTTPFFALLNYILVSKTDLPKALAV
                     GPKLKWLSIVGLIYLFGFLAVFVWWKWLM"
     gene            103437..104189
                     /locus_tag="PN96_00445"
     CDS             103437..104189
                     /locus_tag="PN96_00445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009698808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     A"
                     /protein_id="ALR14540.1"
                     /translation="MAMLEYTPPTDPWIDIVFEDEQILAVNKPSGLLSVPGRLAEHHD
                     SMWSRLQEQYPDIQVVHRLDMSTSGLMVLAKNKRAESALKKQFQFRLTHKIYYARVWG
                     HIDEQEGEIDLPLICDWPNRPLQKVCFEDGKPSKTLFQVAKLEEHENGVKTTIVRLLP
                     ITGRSHQLRVHMQALGHPIVGDEFYAMDEAKAFSERLELHAAELSFYHPKNHWLRSIF
                     VPCDFYPEAEEMIFDYFDPERKLPDYKTLPRP"
     gene            104222..105184
                     /locus_tag="PN96_00450"
     CDS             104222..105184
                     /locus_tag="PN96_00450"
                     /EC_number="1.1.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334492.1"
                     /note="Catalyzes the reduction of hydroxypyruvate to form
                     D-glycerate, using NADH as an electron donor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate dehydrogenase"
                     /protein_id="ALR14541.1"
                     /translation="MLLPKVVFLDRATIPDHIQVPRPSFEHEWVEYGLTSPDQVVERL
                     ADADIVISNKVILDQQVLTQLPKLRMVAVAATGFNNVDVDYCSAHNIAVANVQGYAIQ
                     TVPEHVIAMLFALRRNLFGYHQDIAAGEWQRNKQFCFFTHPIGDINGSTLGIIGSGAL
                     GQATAKLAQALGMKVLFAERKGAAECRQGYVPFEDVLKQSDAITLHCPLNEHTRNLIA
                     DAELKQMKPTAILINTGRGGLVDEQATVDALQSGEISAAGFDVFTQEPADESNPLIAN
                     MAMPNLLLTPHVAWGSDSSIQRLADILIENINAFERGESVNRVV"
     gene            complement(105251..105778)
                     /locus_tag="PN96_00455"
     CDS             complement(105251..105778)
                     /locus_tag="PN96_00455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14542.1"
                     /translation="MARKNQKAPWEPEEEIIWVSKSEMKRDMEELQKLGEELVGLKPS
                     VLEKFPLSEDLREAIADAQRFKNEARRRQLQRIGKLMRYEDPEPIQAALDKIRNKHSQ
                     LTAVFHKLEALRDRVVEEGDKAIDDVVELYPEADRQRLRQLARQAAKEKKAGKPAKAY
                     REIFQILKGLNEEEY"
     gene            105889..107232
                     /locus_tag="PN96_00460"
     CDS             105889..107232
                     /locus_tag="PN96_00460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010450446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein PmbA"
                     /protein_id="ALR14543.1"
                     /translation="MDIKQQVAEQRTELEQAVARALKLASTKSDAAEVAITKSTGLSV
                     STRMGDVENVEFNSDGALGITVYRGQRKGSASTSDLSEAAIEQTVIAALDIAHYTSED
                     PFAGPAAKEYMVDSIPDLDLFHPDSPDPDYAAEVAIAAEKEALSYDSSIKQSDGASYD
                     SHYGVKVYGNSHGLLASYASSRHSTSCCVIGVGKNGEMERDYSYTVARHRDDLWTPET
                     VGRKAAENTVNRLDAQRLKTGQYPIMFAADVATGLIGHLVMAISGGNLYRQSSFLLDH
                     LGKQILPEWFNVSERPHVLRGLASSPFDSEGVYTQDREIITDGVLATYLLTSYAARKM
                     KMDPTGHAGGIHNWYVKSTGQNFEQMLKELGTGLLVTEVMGQGVNVVTGDYSRGAAGF
                     WVENGEIQYPVSEITIAGNLKDMFNKIVAVGSDVETRSQIQTGSILLDTMKVAGE"
     gene            complement(107311..108666)
                     /locus_tag="PN96_00465"
     CDS             complement(107311..108666)
                     /locus_tag="PN96_00465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="ALR14544.1"
                     /translation="MAEQIEFDQAHQALQEVTEALENGRFVHVRRQLQDMEPEDIAHL
                     LEAAPRKSRDVLWQLTDPEDYGEILDELNEDVKDNLVSKMAPEALAEATEGMDTDDVA
                     YVLRSLPDDLSREVLSQMDSADRLRVETALSYPEDTAGGLMNTDVITIRGDVDVDVVL
                     RYLRMKGELPEATDALYVIDEESKLIGELPITMLITTQPDVKIIDIMEDADEAITVDT
                     SDSDVASLFERRNWVSAPVVDENQHLVGRITIDDVVDVIREDAEHSMMSMAGMDDDED
                     TFAPVVKSARKRSIWLGANVLAALAAASVSNMFEATLDQMAAIAVLMTIVPSMGGVAG
                     NQTVALVIRGLALGHIGDANKRELLMKEAAIGLLNGIMWALIIGGIVVAWKGNWMLGG
                     IISAAMLTNLLVAGIAGVSIPILLKKMNIDPALAGGMALTTVTDVIGLSVFLGLATIM
                     I"
     gene            complement(108911..109186)
                     /locus_tag="PN96_00470"
     CDS             complement(108911..109186)
                     /locus_tag="PN96_00470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="ALR14545.1"
                     /translation="MELSRKVLIQNRLGLHARAAVKLVELAQSFEAVITIDNEEDITA
                     TADSVMGLLMLESAQGQYVTIHAAGDQAEQALDAVCLLIEDKFEEGE"
     gene            complement(109189..110052)
                     /locus_tag="PN96_00475"
     CDS             complement(109189..110052)
                     /locus_tag="PN96_00475"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LD9.1"
                     /note="glucosamine-6-phosphate regulated; inactivates the
                     glmS upregulator glmZ; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glmZ(sRNA)-inactivating NTPase"
                     /protein_id="ALR14546.1"
                     /translation="MRLIVVSGHSGAGKSIALRVLEDLGYYCVDNLPVNLLDAFVQSV
                     ADSKQNVAVSIDIRNIPKKLKEFTGTLEKLKQELDVTMLFLDADKETLLKRYSETRRI
                     HPLSLGNESLSLDQAIEREKEILRPLKTHADLVLNSSGQSLHELSETVRMRVVARESK
                     GLVMVFESFGFKYGLPSDADYVFDVRFLPNPHWEPGLRPYTGLDAPIAAFLEQHQSVL
                     DLKHQIESFIENWLPLLEKNNRSYLTVAIGCTGGKHRSVYLTQQIGEYFAKKGHKVQI
                     RHTSLEKNAKE"
     gene            complement(110068..110514)
                     /locus_tag="PN96_00480"
     CDS             complement(110068..110514)
                     /locus_tag="PN96_00480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010450439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter"
                     /protein_id="ALR14547.1"
                     /translation="MQLSEILSLDCTKSAVHCTSKKRALEMISRIVADHTGQDSTELF
                     ECMLNREKMGSTGIGNGIAIPHARMQSSDKAVAVLLQCDEAIEFDAIDNRPVDLLFAL
                     LVPEEQCKEHLKTLSSMAERLSDKQVLKLLRNAQSDQELYDIMIHQ"
     gene            complement(110517..110804)
                     /locus_tag="PN96_00485"
     CDS             complement(110517..110804)
                     /locus_tag="PN96_00485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233080.1"
                     /note="YhbH; resting ribosome-binding protein involved in
                     ribosome stabilization and preservation in stationary
                     phase; binds specifically 100S ribosomes (an inactive
                     ribosome product of a 70S ribosome dimerization); seems to
                     be involved in modulation of the sigma(54) (RpoN) activity
                     for quorum sensing; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome hibernation promoting factor HPF"
                     /protein_id="ALR14548.1"
                     /translation="MQINIQGHHVDLTDSMQDYVQTKFQKLERFFDHINQVHVVLKVE
                     KLTQIAEATLHVNQGEIHASADDENMYAAIDSLVDKLVRQLNKHKEKLHSH"
     gene            complement(110828..112300)
                     /locus_tag="PN96_00490"
     CDS             complement(110828..112300)
                     /locus_tag="PN96_00490"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233079.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; sigma 54 factor is
                     responsible for the expression of enzymes involved in
                     nitrogen assimilation and metabolism; the rhizobia often
                     have 2 copies of this sigma factor; in Rhizobium etli
                     RpoN1 shown to be involved in the assimilation of several
                     nitrogen and carbon sources during free-living aerobic
                     growth and RpoN2 is involved in symbiotic nitrogen
                     fixation; in Bradyrhizobium both RpoN1 and N2 are
                     functional in free-living and symbiotic conditions, rpoN1
                     gene was regulated in response to oxygen; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-54"
                     /protein_id="ALR14549.1"
                     /translation="MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALDSN
                     PLLEVEDGQDEPLANGEDKSELDASENSTSANEPTEIDVPDSSDVIEKSEISSELEID
                     TTWDDVYSANTGSTGLALDDDMPVYQGETTESLYDYLMWQLDLTPFSETDRTIAMAII
                     DAVDEYGYLTLSPEEIHESFDNEDIELDEVEAVRKRIQQFDPLGVASRNLQECLLLQL
                     ATFPEDTPWLEEARMILTDHIDHLGNRDYKLVIKETKLKEADLREVLKLIQQLDPRPG
                     SRITPDDTEYVIPDVSVFKDNGKWMVSINPDSIPKLKVNQQYAQLGKGNSADSQYIRS
                     NLQEAKWLIKSLESRNETLLKVARCIVEHQQDFFEYGEEAMKPMVLNDVALAVDMHES
                     TISRVTTQKFMHTPRGIFELKYFFSSHVSTDNGGECSSTAIRALIKKLVAAENTAKPL
                     SDSKIAALLADQGIQVARRTIAKYRESLGIAPSSQRKRLL"
     gene            complement(112351..113076)
                     /locus_tag="PN96_00495"
     CDS             complement(112351..113076)
                     /locus_tag="PN96_00495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ALR14550.1"
                     /translation="MAVLSAKNLAKSYKKRKVVTDVSLEVESGQIVGLLGPNGAGKTT
                     SFYMIVGLVPRDEGVITIDNQDISILPMHSRSRLGIGYLPQEASIFRKLSVEDNIMAV
                     LETRQEMTREERQDKLEDLLEEFHIQHIRASAGMALSGGERRRVEIARALAANPQFIL
                     LDEPFAGVDPISVGDIKKIIEHLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAS
                     GTPDEVLNNEQVKQVYLGEQFRL"
     gene            complement(113078..113572)
                     /locus_tag="PN96_00500"
     CDS             complement(113078..113572)
                     /locus_tag="PN96_00500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="ALR14551.1"
                     /translation="MKPLHLSLLALVLAAPHALALKSDTQQPVYINSDTQQVDMKSNQ
                     VIFSGDVSLKQGSINIDADKIVVTRDPKTETINQIQAFGQPATFSQLMDDGKTLSGQA
                     TELDYRISTDELTMKGHAQLAQDGNTIKGSTIRYQIGQQKLVADSSENERVTTILQPN
                     QLEK"
     gene            complement(113553..114116)
                     /locus_tag="PN96_00505"
     CDS             complement(113553..114116)
                     /locus_tag="PN96_00505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide assembly protein"
                     /protein_id="ALR14552.1"
                     /translation="MSFTRLIYLILIFVIAWCAYYIVTPKSTDTIQVAPDSELPMFSG
                     TGLENITYGENGVRSYIIRSSNLDYYAKSGETIFNNPTLMVYREGSVVEWKVTATRAV
                     LDENQTLTLYDKVLMQNLLEGASFDTMATDKLVINLTNRDFKADQQVMLVGPQFETTG
                     GAMQGNLKQHTATLTDNVQGRYETVTP"
     gene            complement(114194..115165)
                     /locus_tag="PN96_00510"
     CDS             complement(114194..115165)
                     /locus_tag="PN96_00510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-arabinose 5-phosphate isomerase"
                     /protein_id="ALR14553.1"
                     /translation="MSRQFDFRAAAKQVLDIEVAALQELDKYFDDQFEQACEMILSNS
                     GKVVIMGMGKSGHIGNKIAATLASTGTSAFFVHPGEASHGDLGMISAGDIVIAISNSG
                     ESHEILSLFPVLKRLNIKIISMTGKPESNMAQLSDLHLQITVPQEACPLGLAPTSSTT
                     ATLVMGDALAVALLQARGFSAEDFALSHPGGALGRKLLLKLSDIMHFGNALPKVSPDS
                     LIRDALLEISEKGLGMTAIVDEHDAMLGIFTDGDLRRTLDKRIDIHTTAIGEVMTQSP
                     TTAHPDMLAVEGLNLMQSKNINALILCNNGKVVGALNMHDLLKAGVM"
     gene            complement(115205..116170)
                     /locus_tag="PN96_00515"
     CDS             complement(115205..116170)
                     /locus_tag="PN96_00515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381102.1"
                     /note="YrbG; inner membrane protein involved in cell
                     envelope integrity; putative sodium ion/calcium ion
                     exchanger; in E. coli it is non essential for cell
                     viability; member of the YRBG family of cation/Ca2+
                     exchangers; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium/sodium:proton antiporter"
                     /protein_id="ALR14554.1"
                     /translation="MLEAVALLIVGLVLLVWSADKLVFGSAAIARNVGISPLVIGMTI
                     LAMGSSAPEMMVSATAALDGKTDTAVGNVLGSNIANIALILGITALIKPLSISSGVIR
                     RELPLMIAVTLLAGVILWNNHLGFYEGALLFVLFGAFLFVMLQISRKEQKSGDAFLDD
                     QESEIPEGVSNSKAAIWVVLGLVLLPVSANILVDNAVIIAKHFGMSDLVIGLTIIAIG
                     TSLPELAASLAGVLKGEDDMAVGNIIGSNVFNILAVMGIPGIINPSMLSEYAMGRDFW
                     VMLGVSLLLVAMCLGRSRSINRVEGAVLFVCFIGYQVYLFANMTA"
     gene            116628..117431
                     /locus_tag="PN96_00520"
     CDS             116628..117431
                     /locus_tag="PN96_00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009707636.1"
                     /note="ABC transporter maintaining outer membrane lipid
                     asymmetry; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="ALR14555.1"
                     /translation="MSNNDLVTVNNLTFSRGNRTIFDGIDLHVPEGKVTAIMGPSGIG
                     KTTLLRLIGGQLYPEQGEIWFDGDNIPTLSRKKLYHARKKMSMLFQSGALFTDLNVFD
                     NVAFPLREHTNLSEELIRTMVLLKLEAVGLRGAAQLMPSELSGGMARRAALARAIALD
                     PDLIMYDEPFVGQDPITMGVLVELISNLNQALGLTSIVVSHDVPEVMSIADWVYLLAN
                     GKIIAFGTPDDLRKNPDPRVQQFLQGDADGPVPFSYPSQSIEKDLFDGR"
     gene            117421..118212
                     /locus_tag="PN96_00525"
     CDS             117421..118212
                     /locus_tag="PN96_00525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005455118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="ALR14556.1"
                     /translation="MVDSFIQFVASLGRRTLSICEAFGRATLMLLGALLSKPQPTKGF
                     PLLIKQLYSVGVQSLAIIVVSGLFIGMVLSLQGYVVLVDYGAEGSLGQMVALSLLREL
                     GPVVTALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLKRVIAPRFWAGAISMPL
                     LAMIFMAVGIWGAQLVGVDWKGVDHGSFWAAMQSSVELGQDIGNSMIKCFAFAITVTW
                     IALFNGYDAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
     gene            118215..118703
                     /locus_tag="PN96_00530"
     CDS             118215..118703
                     /locus_tag="PN96_00530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toluene ABC transporter substrate-binding
                     protein"
                     /protein_id="ALR14557.1"
                     /translation="MQQTRKTELWVGSFVLAGICAILVMIFQVADVKSMGSGDTYTLK
                     AEFDNIGSLKVRSPVKVGGVVIGRVSDITLNPDNLLPEVSLSINSQYNQFPETSSVQI
                     LTSGLIGEQYIGLVPGFVFDDEVMLVDGDTIEDTKSALVLEDLIGQVLYSVGGSDDSS
                     KE"
     gene            118706..119344
                     /locus_tag="PN96_00535"
     CDS             118706..119344
                     /locus_tag="PN96_00535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toluene tolerance protein"
                     /protein_id="ALR14558.1"
                     /translation="MLKRLLLSVVAVFAAFNLNAAEVDKTQPYQMMKQVSEVTFDRLK
                     AEQPKIKQDPNHLKVVVEEELMPYVNYRYAALKLLGPNLKGTKREDVLEFIDAFHGYL
                     IASYAQVLTQYSDQKIEFGPEPKLDPSDRITSVKVDIIDAPRPNIKLEFKLRKDNKTS
                     EWEAFDMIAEGISLLSSKQSEWNSKIRQDGILAVAKDLEKLAAEPIRFEAKK"
     gene            119344..119664
                     /locus_tag="PN96_00540"
     CDS             119344..119664
                     /locus_tag="PN96_00540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NTP-binding protein"
                     /protein_id="ALR14559.1"
                     /translation="MAQSHAQWNFTTNNLKLSGALDRDSVPSLWAHALQWKPSQAEIE
                     CSLEDVVRVDSAGMVMLIHLIEHAKKQNCHIMLSFVPAQLRTLFQLSNVESLVDKHIQ
                     NYQG"
     gene            119668..119922
                     /locus_tag="PN96_00545"
     CDS             119668..119922
                     /locus_tag="PN96_00545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017036126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family transcriptional regulator"
                     /protein_id="ALR14560.1"
                     /translation="MDSAKVQQLLEEALNLQEVHVKGEGSHYEVVAVDACFEGMSRVK
                     KQQLIYGPLMDYIQRNDIHALSIKAFTPEEWARDKKLMSL"
     gene            119932..121197
                     /locus_tag="PN96_00550"
     CDS             119932..121197
                     /locus_tag="PN96_00550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="ALR14561.1"
                     /translation="MEKFRVIGSDKPLVGEVTISGAKNAALPILFASILAEESVEVAN
                     VPHLRDIDTTMELLKRLGAKVDRNGSVHVDPSSINEYCAPYDLVKTMRASIWALGPLV
                     ARFGQGQVSLPGGCAIGARPVDLHITGLEQLGATITLEDGYVKAEVDGRLKGAHIVMD
                     KVSVGATITIMCAATLAEGKTTLDNAAREPEIVDTAEFLNKLGAKITGAGTDTITIEG
                     VERLGGCKHSVVADRIETGTFLVAAAVSGGKVVCRNTNAHLLEAVLSKLEEAGALVET
                     GEDWISVDMTDRELKAVTVRTAPHPGFPTDMQAQFTLLNMMAKGGGVITETIFENRFM
                     HVPELMRMGAKAEIEGNTVICGDVESLSAAQVMATDLRASASLVIAGCIAKGETIVDR
                     IYHIDRGYDKIENKLAALGANIERVSVTS"
     gene            121327..122052
                     /locus_tag="PN96_00555"
     CDS             121327..122052
                     /locus_tag="PN96_00555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-phosphate glycerol 3-phosphate
                     acyltransferase"
                     /protein_id="ALR14562.1"
                     /translation="MIALLRVFAIAIFAIVMFIGGCGYCLLSPRNPKHVFTFGRLFAK
                     MSRVFGVKLELRLPEDAYSRGQHIYIANHQNNWDMFTVSAAVTPKVVTVGKKSLAWMP
                     LFGQLYWLTGNILIDRANRSKAKGTIDQVVKSMKESDVSVWMFPEGTRSRGRGLLPFK
                     TGAFHAAIGAGVPIIPIVCSSTDKLKLNRWNNGHVIVEMMPPVSTEGCTKEGIRELAN
                     TCREQMKEKLQELDEEVKQRNAA"
     gene            complement(122128..122517)
                     /locus_tag="PN96_00560"
     CDS             complement(122128..122517)
                     /locus_tag="PN96_00560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233065.1"
                     /note="has endoribonuclease activity on mRNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="ALR14563.1"
                     /translation="MTKVLHTESAPAAIGPYVQGVDLGNMVLTSGQIPVNPATGEVSA
                     DIAEQARQSLDNVKAVVEASGLKVTDIVKMTVFVKDLNDFGTVNEVYGKFFDEHQVAN
                     YPARSCVEVARLPKDVGIEIEAIAVRK"
     gene            complement(122648..123109)
                     /locus_tag="PN96_00565"
     CDS             complement(122648..123109)
                     /locus_tag="PN96_00565"
                     /EC_number="2.1.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LF7.1"
                     /note="involved in the allosteric regulation of aspartate
                     carbamoyltransferase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase regulatory
                     subunit"
                     /protein_id="ALR14564.1"
                     /translation="MAKETQLQVEAIKNGTVIDHIPAQIGIKVLKLFDMHNSSQRVTI
                     GLNLPSSALGHKDLLKIENVFINEEQASKLALYAPHATVNQIENYEVVKKLALELPER
                     INDVFECPNTNCISHNEPVESSFKVFEKKEEIRLKCKYCEKVFSREIVTER"
     gene            complement(123125..124054)
                     /locus_tag="PN96_00570"
     CDS             complement(123125..124054)
                     /locus_tag="PN96_00570"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7MSE0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase catalytic
                     subunit"
                     /protein_id="ALR14565.1"
                     /translation="MANSLYQKHIISIPELSREELELIVATAGSLKKEPQPELIKNKV
                     VASCFFEPSTRTRLSFETAIQRVGGDVIGFDNDGNTSLAKKGETLSDSVQVISSYVDA
                     FVMRHPQEGAARLASEFSNGVPVINAGDGANQHPTQTLLDLYTIAETQGRLDNLNVAF
                     VGDLKYGRTVHSLTQALAKFNNIRFFFIAPEALAMPDYLCEELDEAGIEYTLLTDMET
                     VIPELDVLYMTRVQKERFDESEYAHIKSAYILTAAMLEGARENLKVLHPLPRVDEITT
                     DVDKTPHAYYFQQAQNGVYARQALLALVLNETL"
     gene            complement(124328..125332)
                     /locus_tag="PN96_00575"
     CDS             complement(124328..125332)
                     /locus_tag="PN96_00575"
                     /EC_number="2.1.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017032857.1"
                     /note="catalyzes the formation of ornithine and
                     carbamylphosphate from citrulline in the arginine
                     catabolic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="ALR14566.1"
                     /translation="MAFNLRNRNFLKLLDFSTKEIQFLLELSAELKKAKYAGTEQKKL
                     QGKNIALIFEKSSTRTRCAFEVAAFDQGAQVSYIGPSGSQIGHKESMKDTARVLGRMY
                     DGIEYRGFGQAIVEDLGAYAGVPVWNGLTDEFHPTQILADFLTMQEHGRGKKLHDITF
                     AYLGDARNNMGNSLMVGAAKMGMDIRLIAPKAFWPEEELVATCQEIAQQTGAKITLTE
                     SVEEGVKGCDFLYTDVWVSMGESAEAWDERVALMKPYQINMDVIKQTGNPHVKFMHCL
                     PAFHNDETTVGKEVAEKYGMKGLEVTEDVFESEYSIVFDEAENRMHTIKAVMVATLGS
                     "
     gene            complement(125483..126706)
                     /locus_tag="PN96_00580"
     CDS             complement(125483..126706)
                     /locus_tag="PN96_00580"
                     /EC_number="3.5.3.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LG0.1"
                     /note="catalyzes the degradation of arginine to citruline
                     and ammonia; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine deiminase"
                     /protein_id="ALR14567.1"
                     /translation="MSKLYVGSEVGQLRRVLLNRPERALTHLTPSNCHELLFDDVLAV
                     EAAGEEHDAFARTLRDQDVEVLLLHDLLVETLAVPEAKKWLLDTQISDFRYGPTFARD
                     LRAYFTEMDNEHLASVLLGGLAYSELPIKSSSMLPKMRRPLDFVIEPLPNHLFTRDTS
                     CWVYGGVSLNPMMMPARQRETNHLRAIYRWHPIFAGQDFIKYFGDEDLHYDNANVEGG
                     DVLVIGKGAVLVGMSERTTAQGVENLAANLFKAGQATEVIAIDLPKHRSCMHLDTVMT
                     HMDVDTFSVYPEIMRKDLDTWRLTPKGTEGEMNVEASHNYLHAIESALGLDQLKIITT
                     GGDSYEAEREQWNDANNVLTVKPGVVIGYERNVYTNEKYDKAGIQVLTVPGNELGRGR
                     GGARCMSCPIERDDI"
     gene            127265..127681
                     /locus_tag="PN96_00585"
     CDS             127265..127681
                     /locus_tag="PN96_00585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005455099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="ALR14568.1"
                     /translation="MSHEDEYLSVEELIEIQKEETRDIIAALLEDGSDPDSLYEIEHH
                     LFAEDFDTLEKAVVEAFKMGFEVLEAEETEDEDGNKLLCCDATMESALDAEAIDAQVE
                     KLVHLAEKYDIIYDGWGTYYEGEDALYSDEDDEDEE"
     gene            127828..128628
                     /locus_tag="PN96_00590"
     CDS             127828..128628
                     /locus_tag="PN96_00590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="ALR14569.1"
                     /translation="MQQSLAGLWQVSPLTDLSIPQDDITFPAPLSQVLPDELSEEVIC
                     QQEWHLMHDIEVDESMMAFPAVEMVLGGVDYHAEVRLNGVALFDCDGTQNVYKKDIRP
                     FMQMGRNRFEILFLEEEEDLLFEEDRPELCALTDQEYKKSDDRIGVWKEPYLQFIRNV
                     RLERVATEQIWHHGGGCEFKVDLYYQTFAPGLVSASVKFNGMTYHIPIDVRAEHASAL
                     FQIEAPKYADLNNPNPSDLYQLSVELDGQRQDFSVALSQDLCVTHLVL"
     gene            complement(128649..129143)
                     /locus_tag="PN96_00595"
     CDS             complement(128649..129143)
                     /locus_tag="PN96_00595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="ALR14570.1"
                     /translation="MEQIAHFTLRSLTPEDNPNIASVIRQVSAEYGLTADKGYGVADP
                     TLDDMYSVYNQQGAAYWVIEHNGVIVGGGGFAPLAGEPNVCELQKMYFLPQTRGHGLA
                     KRIVALSLQLAKQLGYQKCYLETTECLKEAIGLYEKLGFKHLDAPLGQTGHDACEVVM
                     LKSL"
     gene            complement(129189..129593)
                     /locus_tag="PN96_00600"
     CDS             complement(129189..129593)
                     /locus_tag="PN96_00600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14571.1"
                     /translation="MKKTLTFAALHFTIAFSVAYVLTGDILIGSLIAMIEPSVNTVAF
                     YFHEKAWTSVPALKARQCMTKLKTASFATVHFSVAFTVVYLLTGDAFIGGVMAMLEPS
                     INTVAYYFHEKVWLRKSANQTPSSHFGLHRHA"
     gene            complement(129799..132657)
                     /locus_tag="PN96_00605"
     CDS             complement(129799..132657)
                     /locus_tag="PN96_00605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005385530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthase"
                     /protein_id="ALR14572.1"
                     /translation="MEKTYNPTSIEQALYQTWEEKGYFKPHGDTTKESYSIMIPPPNV
                     TGSLHMGHAFQDTIMDTLIRCERMKGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTK
                     NDYGREAFIDKIWEWKGESGGTITKQLRRLGASVDWDRERFTMDDGLSNAVQEVFVRL
                     YEDDLIYRGKRLVNWDPKLHTAISDLEVENKDTKGNMWHFRYPLADGVKTADGKDYIV
                     VATTRPETVLGDTGVAVNPEDPRYKDLIGKEIILPIVDRRIPIVGDDHADMEKGTGCV
                     KITPAHDFNDYEVGKRHQLPMINILTFDANIRDAAEVFNTNGEASDAYSTELPAKYHG
                     MERFAARKAVVAEFDELGLLEEVKDHDLQVPYGDRGGVVIEPMLTDQWYVRTAPLAKT
                     AVEAVENGDIQFVPKQYENMYFSWMRDVQDWCISRQLWWGHRIPAWYDNQGNVYVGRT
                     EEEVRNNNNLESVIELHQDEDVLDTWFSSALWTFGTQGWPEQTDDLKVFHPSDVLVTG
                     FDIIFFWVARMIMMTMHFVKDEDGKPQVPFKTVYVTGLIRDENGDKMSKSKGNVLDPI
                     DMIDGIDLESLVEKRTGNMMQPQLAKKIEKNTRKTFENGIEAYGTDALRFTLAAMAST
                     GRDINWDMKRLEGYRNFCNKLWNASRYVMMNTEEQDCGFNGGDIEYSLADKWIESQFE
                     LAAKAFNNHIDNFRLDMASNTLYEFIWNQFCDWYLELTKPVLWKGTEAQQRGTRRTLI
                     TVLEKTLRLAHPVIPYITETIWQSIKPLVDGVEGETIMLQALPQFDEANFHQEALDDI
                     EWVKAFITSIRNLRAEYDINPGKPLDVMLKAASEEDATRLEANKQVLMSLAKLEAVRV
                     LEAGEETPACATALVGKSELMIPMAGLIDKDAELARLDGEIKKTHGEIKRIEGKLGNE
                     GFVAKAPEAVVAKEREKLEGYKETLAKLEEQKTTIAAL"
     gene            complement(132817..133266)
                     /locus_tag="PN96_00610"
     CDS             complement(132817..133266)
                     /locus_tag="PN96_00610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005448811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit chi"
                     /protein_id="ALR17170.1"
                     /translation="MQTATFYIIKEDSPQAQLTGFEEYVVFLAQHFARQGAKVYLNCN
                     DKMHAEQLAEAFWQIDADKFMAHNLVGEGPKYATNIEIGHHGVKPSWNRQLVINLAEN
                     ETTFANKFAQVVDFVPCEEKAKQLARERYKIYRQAGYQLQTIEIQYP"
     gene            complement(133369..134877)
                     /locus_tag="PN96_00615"
     CDS             complement(133369..134877)
                     /locus_tag="PN96_00615"
                     /EC_number="3.4.11.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010318842.1"
                     /note="catalyzes the removal of N-terminal amino acids
                     preferably from various peptides; a cyteinylglycinase,
                     transcription regulator and site-specific recombination
                     factor; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional aminopeptidase A"
                     /protein_id="ALR14573.1"
                     /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPVAEQLDKISDGYIS
                     SLLRRGDLEGKPGQMLLLHQVPGVLSERVLLVGCGKERELGERQYKEIIQKTISTLNE
                     TGSMEAVCFLTELHVKGRDTYWKVRQAVEATKDGLYTFNQFKSVKPETRRPLRKLVFN
                     VPTRRELSLGEKAITHGLAIASGVKASKDLGNMPPNVANPAYLASQARRLADDYETVT
                     TKIIGEQEMEKLGMTSYLAVGRGSKNESMMSIIEYKGNPDSDAKPIVLVGKGLTFDSG
                     GISLKPGEGMDEMKYDMCGAASVFGTMKALAKLNLPINVIGVLAGCENMPGSNAYRPG
                     DILTTMSGQTVEVLNTDAEGRLVLCDALTYVERFEPDCVVDVATLTGACVIALGHHIS
                     GVLSNHNPLAHELVNASEQASDRAWRLPMADEYHEQLKSPFADMQNIGGRPAGTITAG
                     CFLSKFAKKYNWAHLDIAGTAWKSGAAKGSTGRPVSMLVQFLLNRSGQETEE"
     gene            135078..136178
                     /locus_tag="PN96_00620"
     CDS             135078..136178
                     /locus_tag="PN96_00620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005397457.1"
                     /note="with LptBGC is involved in lipopolysaccharide
                     export; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide ABC transporter permease"
                     /protein_id="ALR14574.1"
                     /translation="MIIVRYLIRETLKSQFAIFFVLFLVFLSQKFISVLADASDGDIP
                     AGLIFSIVGLNMPAMGLLMLPLSLYIGILITFGRLYAESEIVVMNATGIGNKFLVQAA
                     LYLALITSAVAAFNALWLSPWSQERVEQLYEQVAAENSVDLLQKGQFQGTPDGSSVVF
                     IDDIKDNTLSNVFVAQMRPRDSVLPSVMFSSSGEVKELSDGRQIITMKEGTRYEGVPT
                     RVEYMITKFDQYEGVIGQREVKKKGRDWEAYPTADLIGHPDPEAQAELQWRISLFVCI
                     PLLTMLVIPLSAVNPRQGRFAKMGPAILIYLAYFLAISATKSALEDGSIPTTVGMWPI
                     NAMLLIVAILANMMDSVPARRMKEKFRKKRLA"
     gene            136182..137252
                     /locus_tag="PN96_00625"
     CDS             136182..137252
                     /locus_tag="PN96_00625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010648057.1"
                     /note="with LptABCF is involved in the transport of
                     lipopolysaccharides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide ABC transporter permease"
                     /protein_id="ALR14575.1"
                     /translation="MFKILDLYIGRTIISTTALVLATFVGLSGIIKYVEQLRKVGRGV
                     YDLMHALYFVLLSIPRDIEMFFPMAALLGALIGLGMLASSSELVVMQAAGFSKLDIGL
                     SVLKTAVPLMLIVMTLGQWGAPEAQKMARDLRSFAISGGSIVSVRAGVWARDANDFIF
                     IGKVEDDKLYALNMWRFDEDKNLQKVIFAEEVDYEQDNNWVMKDVQITDMQGETVISK
                     QSVDQMEWQTSLAPDKLAVVTVKPEELSLSGLYDYVTYLKASEQDASRYELAFWRKLT
                     QPLSIAVMMLMALSFVFGPLRSVTMGARVLSGVVAGFTFYISSEFFGPLTLVYGIPPV
                     FGALAPSLVFLAIAVSLLRRKL"
     gene            complement(137285..137764)
                     /locus_tag="PN96_00630"
     CDS             complement(137285..137764)
                     /locus_tag="PN96_00630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane protein"
                     /protein_id="ALR14576.1"
                     /translation="MTTSTTLPTAGLFRRLAALVYDSLIVIAIEMMAAGVVMAIVFAL
                     NAAGLLSYGEYVDAADMLSKHPVISPIFTLYLAVVWIYFFVFFWTRAGQTLGMRAWKL
                     QVRNAADDAPITVTQALIRIATSGFGLANLTVPIDPQKRGFHDMWAKTKVVVLPKAQ"
     gene            complement(137957..139225)
                     /locus_tag="PN96_00635"
     CDS             complement(137957..139225)
                     /locus_tag="PN96_00635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14577.1"
                     /translation="MTGSKWQWLLKQVTRKLWVRTSLFALLAVATALMSIVLNEFVVL
                     PPAINVSSELLNNILNILATSMLAVTTFSLNIMVSAYTAASAGVTPRATKLLMEDSTT
                     QNALATFLGSFLFSLVGIIALGVGAYHEQARIYLFIVTMVVIVMIILTLLRWIQHLSV
                     LGRVSETTSKVEQALISAIRKRGNEPWLGARPWSNPEHKPRGSKPIYSQEIGYLQHID
                     MHHLDSIAEDNQCTIYIERQPGNFVYSGQPIAWLCGELEEESEVSAAFTIRTERSFDQ
                     DPRFGLVVLAEIASRALSPAVNDNGTAIDVLGRAIRALSLWGELLKQRPIKTRFPRLF
                     VPSLSCQDLFDDVFLPIAHDGAAQLQVQIRLQKSLLAISSMHPKLFASPAQKLSEKAL
                     ELALSQHYTEDEKHQLSQLSHQVIDQKFHG"
     gene            139404..140069
                     /locus_tag="PN96_00640"
     CDS             139404..140069
                     /locus_tag="PN96_00640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="ALR14578.1"
                     /translation="MILITGASSGLGAELAKLYDCDGQPTYLTGRSEGKLSEITNRLS
                     NNIGYQACDLSLHQDVGQLFDQLDQPPQTVIHSAGSGYFGLLEDQEPEQIQKLINNNL
                     NSAINVLRELVKRYKDHSVNVVVIMSTASQQPKAQESTYCAVKWAVKGLIESVRLELK
                     GKPMKIIAVYPGGMATEFWETSGKSLDLSSFMQAEDAAQMIHDAVSSIGNGYVSDITV
                     NRL"
     gene            140258..140342
                     /locus_tag="PN96_00645"
     tRNA            140258..140342
                     /locus_tag="PN96_00645"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:140292..140294,aa:Leu,seq:caa)
     gene            141077..142015
                     /locus_tag="PN96_00650"
     CDS             141077..142015
                     /locus_tag="PN96_00650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="ALR14579.1"
                     /translation="MIGRLTQLFPVWAVIFALTAYFSPSLFVDLKSQIVPLLTIIMLA
                     MGISLSPSDFLNVLKHKKAVGVGVFLQFLIMPLAALLISFLLGFSTELTVGMVLVGSV
                     AGGTSSNVMVFLAKGDVALSISMTAISTLLGVILTPLLVEGLIGQSVDVPVSGMLMSL
                     VKIVLLPVSIGVIINTFIPKAVAKVNAILPLISMLAIVVIIAIVVALNAENLNTIGPL
                     VALAVILHNGLGLTAGYYCCRLLGFNESTCRTIAFEVGLQNSGLATALAMKFFSPASA
                     IAGTIFSVWHNISGSLLAGYWASKKARKAKAVTNSL"
     gene            complement(142155..142829)
                     /locus_tag="PN96_00655"
     CDS             complement(142155..142829)
                     /locus_tag="PN96_00655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="ALR14580.1"
                     /translation="MKILVTGASSGIGFELAKQLCADHHDVFATGRNKNKLTELHQLT
                     GCKFASYDLTESQQVMDMFKQATEELGGLDVLINNAGMNTRKCAIDEFSLEEFEQQYA
                     INLRAPAILCREALSLMKEQKSGYIINVTSTVAKRASETMAVYTTMKQGLAGFTGVLM
                     KEAQPHGIKVTNLFPGGTDTNFRAASRPEYMQPESVARTILGLLKLPEDVVVHEMVFR
                     PLVELE"
     gene            143131..144384
                     /locus_tag="PN96_00660"
     CDS             143131..144384
                     /locus_tag="PN96_00660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HD family phosphohydrolase"
                     /protein_id="ALR14581.1"
                     /translation="MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQGQVEMI
                     RHLGVKFVYFNPEQSDSLPLPVNQDREDKVKSDDSLDLETKALWQEKQKRIEKLSAYR
                     RRVIQCEKEFERSLARMRSVMMKIRNRPVAAVNEAKQLTEDIVDKLMCDDNVTLHLMN
                     GKNEYEDIYFHSLNVAVIAMMIGRAKGYSAEQLKELSFAALFHDMGKVKIPTAILRKQ
                     EPLTVPEENYLKLHTKYGLDLANQIEDFPETAKTVIEQHHELRDGSGYPKGLQGDEIN
                     EFAQIIIVANAFDNLCHTRITSEQKIPYTALSHLYKNCKHLYKEENLKFLIKFMGVFP
                     PGTVVQLTNNMIGLVISVNASNLLFPNVLVYDPSVPRTQAPILDLASKDLRIVNAIHP
                     SKLPENIKEYLNPRSRISYFFDTDA"
     gene            144871..146432
                     /locus_tag="PN96_00665"
     rRNA            144871..146432
                     /locus_tag="PN96_00665"
                     /product="16S ribosomal RNA"
     gene            146489..146565
                     /locus_tag="PN96_00670"
     tRNA            146489..146565
                     /locus_tag="PN96_00670"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:146523..146525,aa:Ile,seq:gat)
     gene            146611..146686
                     /locus_tag="PN96_00675"
     tRNA            146611..146686
                     /locus_tag="PN96_00675"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:146644..146646,aa:Ala,seq:tgc)
     gene            146943..149857
                     /locus_tag="PN96_00680"
     rRNA            146943..149857
                     /locus_tag="PN96_00680"
                     /product="23S ribosomal RNA"
     gene            149933..150048
                     /locus_tag="PN96_00685"
     rRNA            149933..150048
                     /locus_tag="PN96_00685"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            150110..150185
                     /locus_tag="PN96_00690"
     tRNA            150110..150185
                     /locus_tag="PN96_00690"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:150143..150145,aa:Thr,seq:ggt)
     gene            150204..150320
                     /locus_tag="PN96_00695"
     rRNA            150204..150320
                     /locus_tag="PN96_00695"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            150352..150428
                     /locus_tag="PN96_00700"
     tRNA            150352..150428
                     /locus_tag="PN96_00700"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:150386..150388,aa:Asp,seq:gtc)
     gene            complement(151641..151716)
                     /locus_tag="PN96_00705"
     tRNA            complement(151641..151716)
                     /locus_tag="PN96_00705"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(151681..151683),aa:Asn,seq:gtt)
     gene            complement(151752..151827)
                     /locus_tag="PN96_00710"
     tRNA            complement(151752..151827)
                     /locus_tag="PN96_00710"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(151792..151794),aa:Thr,seq:tgt)
     gene            complement(151867..151942)
                     /locus_tag="PN96_00715"
     tRNA            complement(151867..151942)
                     /locus_tag="PN96_00715"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(151907..151909),aa:Asn,seq:gtt)
     gene            complement(151963..152038)
                     /locus_tag="PN96_00720"
     tRNA            complement(151963..152038)
                     /locus_tag="PN96_00720"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(152003..152005),aa:Thr,seq:tgt)
     gene            complement(152093..152168)
                     /locus_tag="PN96_00725"
     tRNA            complement(152093..152168)
                     /locus_tag="PN96_00725"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(152133..152135),aa:Phe,seq:gaa)
     gene            complement(152402..154027)
                     /locus_tag="PN96_00730"
     CDS             complement(152402..154027)
                     /locus_tag="PN96_00730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005384495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ALR14582.1"
                     /translation="MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTEL
                     FKSAYSILTEVEAMAASGELPEDEAKALATRLLRNNIYKDNEYVYVADENMIFVAAPL
                     DPQLHGTSFHDFKDSNNNSVGQLILDILDNKTGQIVEYTWSQTQTDGSIEEKHSIAEK
                     TPHWGWVVGTGIGFNEVNARFWATAQWQLVLCLFIAGAILTSLIIAIRKMLNVLGGEP
                     HDVRQAVQAVSQGNIQTSFDTVAPKDSIYDAVQNMSQSLAIMVTNLDSSMLALRSELS
                     AVESRSGTIADLTLSQQESTAMIATAMTEMASSANQVATSANDTARNTDEADKQSQQT
                     QSLICSTVDNIQGLANQLSTASLAVANLDQDVNNIVKVLDVIGDIAEQTNLLALNAAI
                     EAARAGEQGRGFAVVADEVRKLAGRTQDSTKEIQNMISNLQQGSRHAIQTMEICAETS
                     QSTVTQSQSASEALQQIVTALEAITTMSQQIATAAAEQTHVSDDIAHRINLIEESGYQ
                     LNSVVTESQSSTQSLASLANDLEGWVNKFSVKH"
     gene            complement(154293..154368)
                     /locus_tag="PN96_00735"
     tRNA            complement(154293..154368)
                     /locus_tag="PN96_00735"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(154333..154335),aa:Asn,seq:gtt)
     gene            complement(154423..154498)
                     /locus_tag="PN96_00740"
     tRNA            complement(154423..154498)
                     /locus_tag="PN96_00740"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(154463..154465),aa:Phe,seq:gaa)
     gene            complement(154506..154581)
                     /locus_tag="PN96_00745"
     tRNA            complement(154506..154581)
                     /locus_tag="PN96_00745"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(154546..154548),aa:Thr,seq:tgt)
     gene            complement(154651..154726)
                     /locus_tag="PN96_00750"
     tRNA            complement(154651..154726)
                     /locus_tag="PN96_00750"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(154691..154693),aa:Asn,seq:gtt)
     gene            complement(154799..154874)
                     /locus_tag="PN96_00755"
     tRNA            complement(154799..154874)
                     /locus_tag="PN96_00755"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(154839..154841),aa:Phe,seq:gaa)
     gene            complement(154882..154957)
                     /locus_tag="PN96_00760"
     tRNA            complement(154882..154957)
                     /locus_tag="PN96_00760"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(154922..154924),aa:Thr,seq:tgt)
     gene            complement(155012..155087)
                     /locus_tag="PN96_00765"
     tRNA            complement(155012..155087)
                     /locus_tag="PN96_00765"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(155052..155054),aa:Phe,seq:gaa)
     gene            complement(155188..156330)
                     /locus_tag="PN96_00770"
     CDS             complement(155188..156330)
                     /locus_tag="PN96_00770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase"
                     /protein_id="ALR14583.1"
                     /translation="MKKIVFIVAALLLTAGCSREVVEKFYDVEYEPTNRFANNLAELP
                     GQFEKDTAALDSLINSFSGNIQKKWGKREVKLAGKSNYVKYIDNYLSRAEVDFQKGVI
                     TIETVSPTEPQKHLKNAIITTLLTPDDPANVDLFSSKDIKLEGQPFLYKQVVDQDNKP
                     IQWSWRANRFADYLLNHEIKTKDVDFKKAYYVEIPMVEDHFIQRSYQYANIVRRAAEK
                     YDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFALVKNRSGQPSPEY
                     LFNPENNIDTGTAYFYILKNRYLKDVSHPTSLEYSMISAYNGGTGGVLNTFNRSDRKR
                     AMRDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSVQTF"
     gene            complement(156423..156695)
                     /locus_tag="PN96_00775"
     CDS             complement(156423..156695)
                     /locus_tag="PN96_00775"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LI5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="ALR14584.1"
                     /translation="MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAEWQH
                     KQTMLINEKKLNMMDPEHRKLIETEMVNFLFEGKDVHIDGYTPPSE"
     gene            complement(156715..157791)
                     /locus_tag="PN96_00780"
     CDS             complement(156715..157791)
                     /locus_tag="PN96_00780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017821893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine glycosylase"
                     /protein_id="ALR14585.1"
                     /translation="MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVT
                     TVIPYYQRFLERFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAQTYNGEF
                     PLDIEQMNALPGIGRSTAAAVLSSVHKQPHAILDGNVKRTLSRCFAVEGWPGQKKVEN
                     KLWEIAEAHTPQTDVDKYNQAMMDMGAMVCTRSKPKCTLCPVADLCVAKKQGNILDYP
                     GKKPKKDKPVKQTRFVMLHHKNANGHEVWLEQRPQTGIWGGLFCFPQTEHVDVESDID
                     LLLEQRGIQTNDIKEQQTLITFRHTFSHYHLDITPILIDLSKQPDVIMEGNKGLWYNL
                     SKPEEVGLAAPVKLLLETLPHELR"
     gene            157995..158714
                     /gene="trmB"
                     /locus_tag="PN96_00785"
                     /gene_synonym="yggH"
     CDS             157995..158714
                     /gene="trmB"
                     /locus_tag="PN96_00785"
                     /gene_synonym="yggH"
                     /EC_number="2.1.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006743099.1"
                     /note="tRNA (guanine-N(7)-)-methyltransferase; catalyzes
                     the formation of N(7)-methylguanine at position 46 (m7G46)
                     in tRNA by transferring the methyl residue from
                     S-adenosyl-L-methionine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N7)-methyltransferase"
                     /protein_id="ALR14586.1"
                     /translation="MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQESAMNECWPTM
                     GIDYKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGAC
                     LADAREAGLTNLRVMCHDAVEVFEHMIPNDSLATLQLFFPDPWHKKRHHKRRIVQLEF
                     AEMVRQKLIPNEGIFHMATDWENYAEHMIEIMNQAPGFENIAEEGDFVPRPEERPLTK
                     FEARGHRLGHGVWDIKFKRTA"
     gene            158726..159754
                     /locus_tag="PN96_00790"
     CDS             158726..159754
                     /locus_tag="PN96_00790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005534930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="ALR14587.1"
                     /translation="MYHYAILANPGHNRIYFDSAMTIACSELKAMLAAEGVEVTEIGS
                     KDVGLPAALVFSCAEALNDEQSRKIAASSIYYALFEVREDGLLRPIQAPAFNTFPESM
                     SQILRYTGKTNEQFTRLMVNLGVSAANTDSAQLTLMDPMCGKGTTLFEGLIHGLNVVG
                     VEINQKWVQEIQTFVVKFMKNGRFKHKVSKEKRTSGGKKVADGFVVEAAATKEDYNQG
                     NLQTMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEA
                     LPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEDPYIGYLHRVDQSINR
                     NIIVAVKP"
     gene            159843..160763
                     /locus_tag="PN96_00795"
     CDS             159843..160763
                     /locus_tag="PN96_00795"
                     /EC_number="3.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004398319.1"
                     /note="catalyzes the formation of glutamate from
                     glutamine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaminase"
                     /protein_id="ALR14588.1"
                     /translation="MKPTVEILTDILTEVRPLIGQGKVADYIPALAKVPSNKLGIAVY
                     TNDGEVIKAGDADEPFSIQSISKALSLTLAMCLYKQEEIWARVGKEPSGQAFNSLIQL
                     EMEQGIPRNPFINAGAIVVADLLQSRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEM
                     MHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVH
                     TGKPIVSPTQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGDMTIAV
                     WSPELDPAGNSLAGTKALELLSERIGRSIF"
     gene            complement(160842..162017)
                     /locus_tag="PN96_00800"
     CDS             complement(160842..162017)
                     /locus_tag="PN96_00800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005493867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="ALR17171.1"
                     /translation="MLTPPALSLYVHIPWCVQKCPYCDFNSHELKAEIPEEQYINALL
                     EDLDTDIEKYRLNDAPRPLHSIFIGGGTPSLISAQGIERLLKGIEERIPFKTDIEITM
                     EANPGTIEAERFAGYRKAGVTRISIGVQSFEQEKLERLGRIHGKDEAVNAANLAHQIG
                     LNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDD
                     DDLWDIFELGHKKLAAAGYVQYEISGYSKPGFQCQHNLNYWRFGDYLGIGCGSHGKLS
                     FADGRIIRTTKVKHPRGYLAAYQNMVKPYLHTEQFVEDEDRPFEFFMNRFRLMEACPK
                     QDFIDTTGLPLSSIQDTIDWALELGYLSETETHWQITEKGKLFLNDLLEAFMAEEDE"
     gene            complement(162035..162637)
                     /locus_tag="PN96_00805"
     CDS             complement(162035..162637)
                     /locus_tag="PN96_00805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233038.1"
                     /note="HAM1-like protein; Rec-dependent growth; RgdB;
                     yggV; it is suspected that this protein functions to
                     remove misincorporated bases such as xanthine or
                     hypoxanthine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-triphosphate diphosphatase"
                     /protein_id="ALR14589.1"
                     /translation="MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGT
                     TFIENAIIKARHAAQETGLPAIADDSGLEVDYLNGAPGIYSARYAGEGATDQDNLEKL
                     LKAMEGVPEAERTARFHCVLVLMRHKDDPTPVVCHGKWEGRILTEAHGENGFGYDPVF
                     FVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQAAQ"
     gene            complement(162771..163202)
                     /locus_tag="PN96_00810"
     CDS             complement(162771..163202)
                     /locus_tag="PN96_00810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14590.1"
                     /translation="MNKWITALLISLLSFPTFAEQFKNMKDIEVHYVAFNSTFLTPKI
                     ARSYDIKRNGYLAIINISVLDRASLGKPALEAQVAGQAKNLIGQTQQLTFREVKEGDA
                     IYYLAELPVTHEETFTFDIDVKSGNKGSGKLQFTQKFYVEE"
     gene            complement(163277..163567)
                     /locus_tag="PN96_00815"
     CDS             complement(163277..163567)
                     /locus_tag="PN96_00815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14591.1"
                     /translation="MSAAVWRDGEDIVLRLYIQPKASRDKIVGLHGEELKIAITAPPV
                     DGKANAHLTKFLAKQFKVAKGLVHIEKGELGRHKQIRIESPTQIPTDIEAIL"
     gene            complement(163567..164124)
                     /locus_tag="PN96_00820"
     CDS             complement(163567..164124)
                     /locus_tag="PN96_00820"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P52059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14592.1"
                     /translation="MNSMSFLISTLFDLYIMVVILRIWLQAARADFYNPFSQFIVKAT
                     QPVIGPLRRFIPSVGNIDLATVLFAYLLCVLKFVALILIASSGSVSFSIEFLFLGLLS
                     LIKAAGGLLFWVLLIRAILSWVSQGRSPIEYVFHQLTEPMCAPIRRILPAFGGLDLSV
                     LVLFIGLQFANFLMGDIIGPIWFQL"
     gene            complement(164177..164995)
                     /locus_tag="PN96_00825"
     CDS             complement(164177..164995)
                     /locus_tag="PN96_00825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005384519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="ALR14593.1"
                     /translation="MEHKKIAFIGAGNMVRAIISGLVSNGYPAQNIVATAPSETRRLP
                     LEQDFGIRTTSDNILAASKADVVVLSVKPQMMAEVCKPLQSVDFSNKLVISIAAGINC
                     SRLDEMLATKLNLVRVMPNTPSQLGLGMSGLFAPKHVTEQDKDFAAQLMEAVGKVCWV
                     EQESGINNVIAAAGSAPAYFFLFMEAMQAEAIAQGFDKDTARLLVQQAALGAASMVVA
                     NPETELSTFRENVTSKGGTTAEALRTFNEHQLSDIVAKAMQAAVARAEEMEKLF"
     gene            complement(165118..165831)
                     /locus_tag="PN96_00830"
     CDS             complement(165118..165831)
                     /locus_tag="PN96_00830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14594.1"
                     /translation="MSSIQQNIEHITSQIRNDEQKCGRAPESVQLLAVSKTKPVEAIL
                     EAYQAGQTAFGENYVQEGVDKVQHFAQHYPDNCIEWHFIGPIQSNKSRLVAEHFDWVH
                     TIDRAKIAQRLNDQRPNELEPLQVLIQVNTSGEDSKSGVTDAEIFELAELISRLPNLT
                     LRGLMSIPANVSDYDAQLHEFQKLAALKQALMQQYPDIDTLSMGMSGDMEAAIEAGST
                     MVRIGTAIFGARDYNSKSE"
     gene            165860..166900
                     /locus_tag="PN96_00835"
     CDS             165860..166900
                     /locus_tag="PN96_00835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005534915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="ALR14595.1"
                     /translation="MDITELLDFSVKHNASDLHLSAGVPPMVRIDGDVRKLGIPAFTH
                     QEVHRLVFEIMNDAQRSEFEEKLEVDFSFELQNVGRFRVNAFNQSRGCAAVFRTIPSS
                     IPTLDQLEAPEIFSKIASGQKGLVLVTGPTGSGKSTTLAAIVDYINRNHNKHILTIED
                     PIEFVHTNNKCLINQREVHRDTHSFQNALRSALREDPDVILVGEMRDKETISLALTAA
                     ETGHLVFGTLHTSSAAKTIDRIIDVFPGSDKDMVRSMLSESLSSVIAQKLLKRNGGGR
                     VACHEIMMATPAIRNLIREDKVAQMYSIIQTGAAHGMQTMEQNARQLLAQGIVSHEEA
                     DSKVGLDVQQFS"
     gene            166931..168037
                     /locus_tag="PN96_00840"
     CDS             166931..168037
                     /locus_tag="PN96_00840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="ALR14596.1"
                     /translation="MDLNKFLEGMLALQASDLYITVGAPILFRVDGELRPQGDKLTEN
                     DVAQLLDNAMDPERRQEFRKSRESNFAIVRDCGRFRVSAFFQRELPGAVIRRIETDIP
                     TFEQLKLPLVLQDLAIAKRGLVLVVGATGSGKSTTMAAMTGYRNSNKTGHILTVEDPI
                     EFVHEHQRCIVTQREVGLDTESYEVALKNSLRQAPDMILIGEIRSRETMEYAMTFAET
                     GHLCMATLHANNANQALERILHLVPKDQKEQFLFDLSMNLKGVVGQQLIRDKSGQGRH
                     GVFEILLNSPRVSDLIRRGDLHELKSTMARSNEFGMLTFDQSLYKLVMQGKISEEDAL
                     HSADSANDLRLMLKTQRGEPLATGSLANVKIDMD"
     gene            complement(168103..168528)
                     /locus_tag="PN96_00845"
     CDS             complement(168103..168528)
                     /locus_tag="PN96_00845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005381017.1"
                     /note="similar to RuvC resolvase with substantial
                     differences; NMR structural information suggests this
                     protein is monomeric; unknown cellular function; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase"
                     /protein_id="ALR14597.1"
                     /translation="MSRTIMAFDFGTKSIGSAIGQEITGTASPLKAFKANDGIPNWDD
                     IEKQIKEWQPDLLVVGLPTDLHGKDLETITPRAKKFANRLQGRYGLPVELHDERLSTA
                     EARADLFEMGGYKALSKGNIDCQSAVVILESWFENLWNE"
     gene            complement(168570..169133)
                     /locus_tag="PN96_00850"
     CDS             complement(168570..169133)
                     /locus_tag="PN96_00850"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LK0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR17172.1"
                     /translation="MNLTNHFLVAMPGMKDPYFQNSVIYVCEHNEEGAMGLIINAPVD
                     ITVGNMLKQVKVQPVHPRLFEASLDRPVYNGGPISEDRGFILHKPKDYYESSIQMTDE
                     LAVTTSRDILTVLGTEAEPSDYLVALGYAGWSAGQLENELVENSWLTIEATPEIIFDT
                     PITDRWKKAVEKLGIDPSQLSSDAGHA"
     gene            complement(169513..170463)
                     /locus_tag="PN96_00855"
     CDS             complement(169513..170463)
                     /locus_tag="PN96_00855"
                     /EC_number="6.3.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LK1.1"
                     /note="catalyzes the second step in the glutathione
                     biosynthesis pathway, where it synthesizes ATP +
                     gamma-L-glutamyl-L-cysteine + glycine = ADP + phosphate +
                     glutathione; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthetase"
                     /protein_id="ALR14598.1"
                     /translation="MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLH
                     LDQGVAIADTKVVELKEDPNGWYEFKSEQTIELSELDAVLMRKDPPFDTEYIYATYIL
                     ERAEEQGTLIVNKPQSLRDCNEKLFTAWFPELTPTTIVTRKAEKIKAFREEHGDVILK
                     PLDGMGGASIFRVNENDPNVSVIIETLTNHGQHYAMAQTFVPDISNGDKRILVVDGEP
                     MPYCLARIPAKGETRGNLAAGGTGEARPLSETDIKIAQTVAPTLKEKGLIFVGLDVIG
                     DKLTEINVTSPTCIREIEAAFDISITGKLMDAIERRVKGE"
     gene            complement(170478..171209)
                     /locus_tag="PN96_00860"
     CDS             complement(170478..171209)
                     /locus_tag="PN96_00860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005384526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="ALR14599.1"
                     /translation="MRIPRIYHPETIHQLGTLALSDDAAGHIGRVLRMKEGQEVLLFD
                     GSGAEFPAVIAEVSKKNVLVDISERVENSIESPLDLHLGQVISRGDKMEFTIQKSVEL
                     GVNTITPLISERCGVKLDQKRFEKKLAQWQKIAISACEQCGRNIVPEIRPIMSLEEWS
                     KEEYDGLKLNLHPRAKYSINTLPTPVEKVRLLIGPEGGLSAEEIDMTREYQFEETLLG
                     PRVLRTETAALTAITALQVRFGDLG"
     gene            complement(171349..172044)
                     /locus_tag="PN96_00865"
     CDS             complement(171349..172044)
                     /locus_tag="PN96_00865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017189098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-specific endonuclease I"
                     /protein_id="ALR14600.1"
                     /translation="MKYLFSLFILALSSAAVAAPPSSFSAAKREAVKIYQDHPTSFYC
                     GCDIQWQGKKGLPDLSSCGYQVRKQEKRASRIEWEHVVPAWQFGHQLQCWQSGGRKNC
                     SRNDKTFRSMEADLHNLTPAIGEVNGDRSNYNFSQWNGIDGATYGRCEVQVNFKQRKV
                     MPPDRARGSIARTYLYMSKEYGFKLSKQQTQLMSAWNKTYPADKWECERDKRIAKVQG
                     NHNPFVQEACRAL"
     gene            complement(172176..172673)
                     /locus_tag="PN96_00870"
     CDS             complement(172176..172673)
                     /locus_tag="PN96_00870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sprT"
                     /protein_id="ALR14601.1"
                     /translation="MDIELSYKAKQVMAHYIALAEHAFKRSFPIPSLTFKVRGKAAGK
                     AYLQLNEIRLNPVLFKENTQAFLQEVIPHEVAHLITYQVYGRVRPHGKEWQTVMESVF
                     NVPAKTTHSFEVSSVQGKTFEYRCRCTTYPLSIRRHNKVLRKQAVYSCQKCRQPLSFT
                     GVQLS"
     gene            complement(172739..173536)
                     /locus_tag="PN96_00875"
     CDS             complement(172739..173536)
                     /locus_tag="PN96_00875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020197217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B6"
                     /protein_id="ALR14602.1"
                     /translation="MPRTVNPSDFHSKRKEVPDNEYARTIPCNTVNLSAPFHWLALGL
                     HDFVRMPLISAFYGLCFMAAAIGIVLLVQWQGTHLVVMPSLIVYMLIGPFLALGLYDA
                     SWERERGHKARLFHSMKAIGRNSSSQWAFAVLLAVCMIFWMRIAALLHALYPSVQGAP
                     LTEFLPFLVIGSLIGFVLASVVFSISAFSIPLMMERRVDMMTAVFTSFNAVKSNIPAM
                     IVWAAIICGGILIGFATYGIGMLFTMPILGYGTWHAYHATIKKKHTP"
     gene            complement(174012..175166)
                     /locus_tag="PN96_00880"
     CDS             complement(174012..175166)
                     /locus_tag="PN96_00880"
                     /EC_number="2.5.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006075173.1"
                     /note="catalyzes the formation of S-adenosylmethionine
                     from methionine and ATP; methionine adenosyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="ALR14603.1"
                     /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACET
                     YVKTGMVMVGGEITTSAWVDIEELTRETVREIGYVHSDMGFDANSCAVLNTIGKQSPD
                     INQGVDKADPKEQGAGDQGIMFGYACNETEVLMPAPITYSHRLVEKQAEVRKNGTLPW
                     LRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSISTPELREAVMEEIIKPVLPSEWIN
                     KETNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAA
                     YAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSHDIIIEAVRQFF
                     DLRPYGLQEMLNLLQPIYKKTAAYGHFGREEFPWEATDKAALLREFAGIK"
     gene            complement(175254..175484)
                     /locus_tag="PN96_00885"
     CDS             complement(175254..175484)
                     /locus_tag="PN96_00885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14604.1"
                     /translation="MSAPEYVKRNEKIGHNSLKAPQGVQTISTPKPHKYCICEFKSPE
                     TPKIINNSRKRLVVTKTKKELVIRAIKLRIAV"
     gene            175483..177477
                     /locus_tag="PN96_00890"
     CDS             175483..177477
                     /locus_tag="PN96_00890"
                     /EC_number="2.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017635202.1"
                     /note="catalyzes the formation of ribose 5-phosphate and
                     xylulose 5-phosphate from sedoheptulose 7-phosphate and
                     glyceraldehyde 3-phosphate; can transfer ketol groups
                     between several groups; in Escherichia coli there are two
                     tkt genes, tktA expressed during exponential growth and
                     the tktB during stationary phase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="ALR14605.1"
                     /translation="MSSRKHLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSH
                     LNHNPSNPEWADRDRFVLSNGHGSMLIYSLLHLTGYELSIDDLKNFRQLHSKTPGHPE
                     YGYAPGIETTTGPLGQGITNAVGMAMAEKALAAQFNKEGHDIVDHFTYAFLGDGCLME
                     GISHEACSLAGTLGLGKLIAFWDDNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDG
                     HDPDAINAAIEAAKADPRPTLICTKTIIGFGSPNKSGSHDCHGAPLGQDEVQAAREYL
                     GWEFGPFEIPADVYAEWDAKEAGAAKEAAWNEKFDAYAAAYPAEAAELKRRLNGELPA
                     QWEEKANQIIADLQSNPANIASRKASQNALEAFGQMLPEFMGGSADLAPSNLTMWSGS
                     KSLEANDFSGNYIHYGVREFGMTAIMNGIALHGGFVPYGATFLMFMEYARNAMRMAAL
                     MKVQNIQVYTHDSIGLGEDGPTHQPVEQMASLRLTPNMSTWRPCDQVESAVAWKLAIE
                     RKDAPTALIFSRQNLAQQERTAEQVADIAKGAYILKDCEGKPELILIATGSEVELAVE
                     AAAQLTAEGKQVRVVSMPSTDAFDKQDAAYREAVLPSDVTARIAIEAGIADFWYKYVG
                     FGGKIIGMTTFGESAPAGELFKMFGFTTENVVNTAKELLA"
     gene            177619..178659
                     /gene="gapA"
                     /locus_tag="PN96_00895"
     CDS             177619..178659
                     /gene="gapA"
                     /locus_tag="PN96_00895"
                     /EC_number="1.2.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233020.1"
                     /note="required for glycolysis; catalyzes the formation of
                     3-phospho-D-glyceroyl phosphate from D-glyceraldehyde
                     3-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="ALR14606.1"
                     /translation="MLKVAINGFGRIGRNVLRAVYESGKHQQIKVVAVNELAQPEAMA
                     HLLQYDTSHGRFGKKISHDQEHLYVHHNSCHQDAGEYDAIRILHLADIELLPWRDLEV
                     DIVLDCTGVYGCKADGLAHIEAGAKKVLFSHPGAADIDNTIIYGVNHETLKDEHVVVS
                     NGSCTTNCIVPIIKVLDEAFGIESGTITTIHSSMNDQQVIDAYHSDLRRTRAASQSII
                     PVDTKLHKGIERIFPKFSNKFEAISVRVPTVNVTAMDLSVTISTNVKVNDVNQTIVNA
                     SQCTLRDIVDYTESPLVSIDFNHDPHSAIVDGTQTRVSNGQLVKMLVWCDNEWGFANR
                     MLDTALAMQAAK"
     gene            178814..179974
                     /locus_tag="PN96_00900"
     CDS             178814..179974
                     /locus_tag="PN96_00900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015297285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="ALR14607.1"
                     /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIIASLPTI
                     KHCLEAGAKVMVTSHLGRPTEGEYAEEFSLQPVVNYLNDALDCEVKLAKDYLDGLELN
                     AGELVVLENVRFNKGEKKNEEELSKKYAALCDVFVMDAFGTAHRAQASTHGVGMHAPV
                     ACAGPLLANELDALGKAMDNPARPMVAIVGGSKVSTKLTVLESLSKIADQLVVGGGIA
                     NTFIAAAGHNVGKSLYEADLVDTAKKLMDECAIPVATDVACAKAFDENAEAEIKDVSE
                     VQDDDMIFDLGPDSTAALAEILKNAKTILWNGPVGVFEFKNFEAGTKGISEAIATSEG
                     FSVAGGGDTLAAIDKFGIKADVSYISTGGGAFLEFVEGKVLPAVEMLEARAK"
     gene            180129..181205
                     /locus_tag="PN96_00905"
     CDS             180129..181205
                     /locus_tag="PN96_00905"
                     /EC_number="4.1.2.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004396043.1"
                     /note="catalyzes the formation of glycerone phosphate and
                     glyceraldehyde 3-phosphate from fructose 1,6,
                     bisphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="ALR14608.1"
                     /translation="MSKIFDFVKPGVISGDDVQKVFEVAKENNFALPAVNVVGTDSVN
                     AVLEAAAKVKAPVVVQFSNGGAAFFAGKGVKLEGQGAQILGAVAGAKYVHAVAEAYGV
                     PVILHTDHAAKKLLPWIDGLLDAGEEHFAQTGKPLFSSHMIDLSEESLEENIEICAKY
                     LERMAKMNMTLEIELGCTGGEEDGVDNSDMDASELYTSPEDVAYAYEKLSAVSHRFTI
                     AASFGNVHGVYKPGNVVLTPTILRDSQAYVSEKFGLPANSLNFVFHGGSGSSQAEIQE
                     SIGYGVIKMNIDTDTQWATWDGIRKYEAENHDYLQGQIGNPTGEDAPNKKYYDPRVWL
                     RAGQASMVTRLEQAFADLNAVDVL"
     gene            181648..182514
                     /locus_tag="PN96_00910"
     CDS             181648..182514
                     /locus_tag="PN96_00910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein"
                     /protein_id="ALR14609.1"
                     /translation="MAGESVGIDNTLTDGLTKAETWLSNNSDLLVQYGVNIISALIIL
                     FIGNIIVKAVAGSVAKVLEKKNMDKAVVEFIHGLVRYLLFVIVLIAALGRVGVQTASV
                     VAVIGAAGLAVGLALQGSLSNFAAGVLIVAFRPFKSGDYVEIGGVAGSVEAIQIFQTI
                     LKTPDNKMVVVPNSSVIGGAITNYSRHATRRVDLVIGVSYKADLKLTKKVIRETLEKD
                     PRILKDPDMTIGVLALADSSVNFVVRPWVKTADYWGVYFDSMQGIKEALDANGIEIPF
                     PQMDIHLNKVEA"
     gene            complement(182630..183259)
                     /locus_tag="PN96_00915"
     CDS             complement(182630..183259)
                     /locus_tag="PN96_00915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="ALR14610.1"
                     /translation="MSFWVVLQGFGLGASMIIPIGAQNAYVLNQGIKRNHHLTTATIC
                     SILDMLFISLGIFGGGAVLSQNEMLLTAVTLGGIAFLSVYGYLSMRSAFKPENESETK
                     GEVIARGRRTVILGALAVTVLNPHLYLDTVVILGSIGGQFEGHDRIAFALGTMMASFV
                     WFFTLSLGAAKLGPTLSKPKVKKGIDIGVALMMFAIAYVLASELLAKYW"
     gene            183392..184288
                     /locus_tag="PN96_00920"
     CDS             183392..184288
                     /locus_tag="PN96_00920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009707613.1"
                     /note="specific inhibitor of chromosomal initiation of
                     replication in vitro; binds the three 13-mers in the
                     origin (oriC) to block initiation of replication; also
                     controls genes involved in arginine transport; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome replication initiation inhibitor
                     protein"
                     /protein_id="ALR14611.1"
                     /translation="MRGLDYKWIEALDAVVYQGSFERAAESLYVSQSAISQRIKQLEK
                     FLAQPVLIREQPPKPTPIGKKLLGLYRRVRMLEHEILPELKNDTTTRPVQLSLATNAD
                     SLATWLLPALQDVMKTRQVELKLAIYGESRSIEKLRSGEVAGAISLESQAIPGCRADY
                     LGRIDYVCVASPEFYQRYFSEGVNNKTLSKAPAVSYDQYDDLHKAFLTKHFNVRPDSV
                     IHHNISSSEAFLKMAMAGVAYCLIPRLQISNELEQGSLIDITPGFLMTYRIYWHHWQL
                     ETGVLQEISQAIVGYAQRHLPQ"
     gene            184540..185232
                     /locus_tag="PN96_00925"
     CDS             184540..185232
                     /locus_tag="PN96_00925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14612.1"
                     /translation="MKLYSCLLATLLSLTSVSALATTPEFAHVTTTGYGEVIATPDMA
                     TFSVKVVDTTMTAEQAKLSVDTTVDEFLQKLSDAGLSKDSITSSNLYLAPQYHYPKSG
                     KAELVGYRASRSINVTVKDLANLNQYLDMAIQAGINQVDNIQLKVSNQAEYQQKARLA
                     AIKDARESAASLASGFDKTLGDIWRVNYNNTYPTPVLMRSMAMEGKQNANSYQDSTMV
                     IRDQVEVIYKLK"
     gene            complement(185299..186531)
                     /locus_tag="PN96_00930"
     CDS             complement(185299..186531)
                     /locus_tag="PN96_00930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017821632.1"
                     /note="catalyzes the formation of 3-phosphonooxypyruvate
                     from 3-phospho-D-glycerate in serine biosynthesis; can
                     also reduce alpha ketoglutarate to form
                     2-hydroxyglutarate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="ALR14613.1"
                     /translation="MAKVSLEKDKIKILLLEGLHPSSVEVLQAAGYTNIEYHKGSLPE
                     EELIEAVKDVHFIGIRSRTNLSEEVINAANKLVAIGCFCIGTNQVDLDAAAKRGVPVF
                     NAPFSNTRSVAELVLGQILLLLRGIPEKNALAHRGIWKKSADNSYEARGKRLGIIGYG
                     HIGTQLGIIAENLGMRVYYYDIENKLSLGNATQVHTMSELLNKCDVISLHVPETPETK
                     NMMGEEEFARMKPGAIFINAARGTVVDIPALCSTLEAGHLAGAAIDVFPVEPKTNADP
                     FESPLQKFDNVILTPHVGGSTQEAQENIGVEVAGKLAKYSDNGSTLSSVNFPEVSLPE
                     HGGEVSRLLHIHKNRPGILTQINTIFAEEGINIAAQYLQTAAEIGYVVIDVETERSEE
                     ALIKLKSIEGTIRSRILH"
     gene            complement(186805..187461)
                     /locus_tag="PN96_00935"
     CDS             complement(186805..187461)
                     /locus_tag="PN96_00935"
                     /EC_number="5.3.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009843587.1"
                     /note="catalyzes D-ribose 5-phosphate --> D-ribulose
                     5-phosphate in the nonoxidative branch of the pentose
                     phosphate pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase"
                     /protein_id="ALR14614.1"
                     /translation="MTQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTIKD
                     DIKGAVSSSVASTERLKELGIEVFECNDVIKLDVYVDGADEINPTRDMIKGGGAALTR
                     EKIVAAISEKFVCIVDDTKAVDVLGQFPLPVEVIPMARSYVARELVKLGGDPAYREGV
                     VTDNGNVILDVHNMQITNPKEMEDKINSIAGVVTNGLFAHRGADVVITGTPEGAKIEE
                     "
     gene            complement(187520..188113)
                     /locus_tag="PN96_00940"
     CDS             complement(187520..188113)
                     /locus_tag="PN96_00940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="ALR14615.1"
                     /translation="MSELSRQDFRKLIREKRNALCSDTQFQAALDLVSQFSQLPEIQH
                     SQHIAIYLSADGELDTKPLIEWLWQQGKSIYLPVIHPFSKGQLLFLQYLSDDQLIYNK
                     YGILEPKLDIRHLMPVRQLDLICTPLVGFDSIGHRLGMGGGYYDRTLSHWFASGEGAT
                     PVGIAHDCQHVERLPIESWDIPLPKIVTPSRIWQWEN"
     gene            complement(188311..188619)
                     /locus_tag="PN96_00945"
     CDS             complement(188311..188619)
                     /locus_tag="PN96_00945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Z-ring-associated protein"
                     /protein_id="ALR14616.1"
                     /translation="MSNQAIDVQILGKVTRVNCPAGQEESLVAAAKDLDRRLKEMSER
                     TKVTNEIQLLTFAALNICYELQTKSYESSGQQQEITERMEQLTASLENALSKVTQGQQ
                     "
     gene            188868..189446
                     /locus_tag="PN96_00950"
     CDS             188868..189446
                     /locus_tag="PN96_00950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020196164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14617.1"
                     /translation="MSEITLPEYQSIAAELKSASLAVTPAELHGLLVGMLSGGLAIND
                     QTWQPILFDYTNDGMGWPATSLAFAQSVFKVSVSELTGSSMELSLLLPDEAGEEGLFA
                     LADGLSDFVNHFISGLGLAGIAIGKASDDVKEALADLEEIAKLGIDEDDDLGEQAQLL
                     EQVIEHVKACVLTIHAEFGARPDSSDSKPTIH"
     gene            189474..190652
                     /locus_tag="PN96_00955"
     CDS             189474..190652
                     /locus_tag="PN96_00955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233008.1"
                     /note="Oxygenase that introduces the hydroxyl group at
                     carbon four of 2-octaprenyl-6-methoxyphenol resulting in
                     the formation of 2-octaprenyl-6-methoxy-1,4-benzoquinone;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="ALR14618.1"
                     /translation="MRQYDVVIAGGAMAGATLALAIEHLSKAALRIAVVEPFKAQSDS
                     HPGFDSRSIALSYGTVNLLRHLQLWSVIEPFATPIEHIHVSDRSHAGMTDITKQEVGV
                     EALGYVVELADVGRVYQELLTSSASIDFFCPDSVTYIEREQDHTQVELSSGEKLEAKL
                     LVAADGAVSQCCQQVGLELSEHDFEQVAIIANIVTQEPHQGRAFERFTENGPVALLPM
                     SDNRMSLVWCLHPDEAESVLALSESEFLARLQQDFGWRLGALKKVGLRASYPLLLRHR
                     KQNISHRFAIVGNAAQTLHPIAGQGFNLGIRDVVSLAEEVIKQSEDVGRYQGLMRFSQ
                     RREADRRETIWLTSSLVHVFSNDLPAMRIGRNAALAAMDNLSIFKQPLLRHTLGLVKR
                     "
     gene            190695..191903
                     /locus_tag="PN96_00960"
     CDS             190695..191903
                     /locus_tag="PN96_00960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005429932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="ALR14619.1"
                     /translation="MMQSVDIAIIGGGMVGLALAAAFKDSDLRIAVIEGSVPDDKLNE
                     LPDVRVSALSRSSETILRKLGAWQGIEQRRASPYYGMEVWEQDSFAKIEFDAQSMAQP
                     DLGHIVENRVIQLALLEQVEKQDNVTLFMPARCATLAVGEQESWLTLDNGQAMTAKLV
                     VGADGANSWLRRQMDIPLTHWDYGHSALVANVKTAEPHNHIARQIFTPHGPLALLPMS
                     QPNMCSIVWSTEPDRAEHLLAMDEHEFNKALTSEFDARLGLCGVVGARAAFPLKMRYA
                     RDFVVERVALVGDAAHTIHPLAGQGVNLGLLDAASLAQEVLALWNQGQDIGSKRNLRS
                     YERWRKAESAKMIAAMQGFRDLFSGENPAKKLIRGIGLSLAGQLPGAKDEIMKRALGL
                     KGDLPELARQ"
     gene            complement(191964..192170)
                     /locus_tag="PN96_00965"
     CDS             complement(191964..192170)
                     /locus_tag="PN96_00965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004415633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14620.1"
                     /translation="MRLFKRYTPGMIAKHISRLFKGRIYIYGVGKFEFDNGKLMLPEK
                     AEQRHFRAVKEINKEIMKLRCAYA"
     gene            complement(192804..193277)
                     /locus_tag="PN96_00970"
     CDS             complement(192804..193277)
                     /locus_tag="PN96_00970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="ALR14621.1"
                     /translation="MSKLIETPLMQFLAEQNITFRLLPHQRPSTTIEDAAQQRGIRPS
                     QMVKAILLRDMGNLYALACAPGDRSIDPKKVRSLLQCRRMTCVDQADVESITGYKIGT
                     VTPLLLKRHMPIVFDPSLLNEGEVTISSGDRMAGIALSIDDLVKLCQPVVADICR"
     gene            complement(193270..194238)
                     /locus_tag="PN96_00975"
     CDS             complement(193270..194238)
                     /locus_tag="PN96_00975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-modifying protein"
                     /protein_id="ALR14622.1"
                     /translation="MEWQTRFSALPLSTQDTLPELSISLLDNLGVITMVGDDKKSYLQ
                     GQVTCDVVSLEKDQSTLGAHCDAKGKVWSVFRLFHHQDGYGLIQPKSALEIELKEIKK
                     YAVFSKVTIEESNDIILGVAGSQANSFIDGISEESGDVRAINGGTAVKVADNRWLLLL
                     TSDAAQSMIENSDATLTTHELWNRFEIEAALPFVPAAAQNEHIPQALNLQALGGISFT
                     KGCYTGQETVARAKYRGTNKRAMYIVKGATATNLNDEPVQLERSVGENWRSVGALLTH
                     YQFADNQAIGLIVLPNNLDDDTRLRLVSQPECEWTIAELPYSLDDE"
     gene            194424..194684
                     /locus_tag="PN96_00980"
     CDS             194424..194684
                     /locus_tag="PN96_00980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006075514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14623.1"
                     /translation="MYTPEEKARIKWACRRGMLELDVVIMPFFEECFDALSEQEQHDF
                     VSLLECDDPDLFTWIMGHGRSENLSHASMVDKIVAHNLSKVR"
     gene            194803..195078
                     /locus_tag="PN96_00985"
     CDS             194803..195078
                     /locus_tag="PN96_00985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005393923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR17173.1"
                     /translation="MIAKLHFGQLLVAPASQGIWHVHCDGTIRSESTQTQIKQIDLST
                     LPFNITITLQSGDSVTVWRDSCADTQYRQLSLVLRQWEMKQGADAPC"
     gene            complement(195107..196729)
                     /locus_tag="PN96_00990"
     CDS             complement(195107..196729)
                     /locus_tag="PN96_00990"
                     /EC_number="1.4.3.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233002.1"
                     /note="catalyzes the formation of oxaloacetate from
                     L-aspartate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate oxidase"
                     /protein_id="ALR14624.1"
                     /translation="MNTNREHECDVLVVGSGAAGLSLALRVANHCKVMVLSKGPRSEG
                     ATYYAQGGIAAVFDESDTIESHVEDTQIAGDGICDEETVRFIAEHSKECVQWLIDGGV
                     PFDREEDDSDEEPRYHLTREGGHSCRRILHAADATGMAMQTSLQDNAHNHPNIHVLER
                     HNALDLITEDKIGGDKNKVIGAYIWNRNEEHVETVRAKFVVLATGGSSKVYQYTSNPD
                     VSSGDGIAIAWRAGCRVANLEFNQFHPTCLYHPEARNFLLTEALRGEGAYLRRPDGSR
                     FMPDFDERKELAPRDVVARAIDFEMKRLGADCMYLDISHKPADFITKHFPTIYSRLMD
                     LGIDMTKEPIPIVPAAHYTCGGVIVDRNGSTDLKNLYAIGEVSYTGLHGANRMASNSL
                     LECVVYAWSAAKDILKHRSEVELAPQVPCWDESQVTNSDEEVIIQHNWHELRLFMWDY
                     MGIVRTDKRLERALRRIQMLQQETHEYYSNFRVSNNLLELRNLLQVAELMVRCAMQRK
                     ESRGLHYTLDYPNQLENSGPTILTPAKQLSDK"
     gene            197304..197882
                     /locus_tag="PN96_00995"
     CDS             197304..197882
                     /locus_tag="PN96_00995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005593048.1"
                     /note="Member of the extracytoplasmic function sigma
                     factors which are active under specific conditions; binds
                     with the catalytic core of RNA polymerase to produce the
                     holoenzyme and directs bacterial core RNA polymerase to
                     specific promoter elements to initiate transcription; this
                     sigma factor is involved in heat shock and oxidative
                     stress response; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoE"
                     /protein_id="ALR14625.1"
                     /translation="MNEQLTDQVLIERVQNGDKQAFNLLVTKYQNKVCNLISRYVSNP
                     GDVPDVAQEAFIKAYRAIPSFRGESAFYTWLYRIAVNTAKNHIVAQGRRPPATDVDAE
                     DAEFYETGSALKEISNPENLTLSKELQRVVFSAIEALPEDLKTAMTLRELDGLSYEEI
                     AEVMDCPVGTVRSRIFRAREAVEKKIKPLLQR"
     gene            197909..198535
                     /locus_tag="PN96_01000"
     CDS             197909..198535
                     /locus_tag="PN96_01000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014233000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma E factor"
                     /protein_id="ALR14626.1"
                     /translation="MADKEKLSALMDGELIDKALIQELGQDQESRKAWQNYHLIGDVM
                     RGEAPAKPEWNIAESVALALEDEPVHRAVDSHSANVISITDAPKESQPEPQKAKRQLP
                     SWLTQFGQVAVAACVSLVVILGVQQYGGSDSTVPQAEQLPVLQTVPFAGSAEPVSLTR
                     ESVERSMGEANMQEQRKRVHAMLRDYELQLRINSDASQQDATLTPDVE"
     gene            198532..199491
                     /locus_tag="PN96_01005"
     CDS             198532..199491
                     /locus_tag="PN96_01005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-E factor regulatory protein RseB"
                     /protein_id="ALR14627.1"
                     /translation="MNKFLISACALFSMMSSQAFAGDKPAEALLHQMSEASKNLSYEL
                     SYILIKKNSIEPLLYRHATHGEEQYAHLIYLSGPVREVILRGSEVSYIETGAEPFTIE
                     SGKMVAPTIPMLNTNIDELNRYYDYVQVGRAREAGVATQVLRIVPKDGLRYSYILWVD
                     EKSKLPLRADLVDRDGEVLEQYRTISYTVNTKIAELMSGLEDVQLPAVLTMPKGEVST
                     SDWVVGWIPDGFEANELNRYRMAVSDQMVESQMYSDGLFNFSVYVASKDEHSLKGQLV
                     RQGRRTLHSYVNGDYEISVVGDIPPATAQRIAQSVTFKVTNNQ"
     gene            199508..199978
                     /locus_tag="PN96_01010"
     CDS             199508..199978
                     /locus_tag="PN96_01010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-E factor regulatory protein"
                     /protein_id="ALR14628.1"
                     /translation="MMTALATVTGVERHGKRYEIDLSCEQQTSCSSCSSQKSCGTGVV
                     TKAIGNKSLSWHLRTEKAVQVGQVVEIGFPESSLIKSAMAVYLLPLFGLILGALFGHL
                     LFAPLIAGGEGVIILSSALFAAGGVWLAKRVSKPLEDESQRQVTLVRVLGEPIQ"
     gene            200139..201932
                     /locus_tag="PN96_01015"
     CDS             200139..201932
                     /locus_tag="PN96_01015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014204436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor 4"
                     /protein_id="ALR14629.1"
                     /translation="MKHIRNFSIIAHIDHGKSTLSDRLIQVCGGLSDREMAAQVLDSM
                     DLERERGITIKSQSVTLNYTAKDGETYQLNFIDTPGHVDFAYEVSRSLAACEGALLVV
                     DAGQGVEAQTLANCYTAIEMDLEVVPILNKIDLPAADPERVAEEIEEIVGIDAMEATR
                     CSAKTGLGVEDVLENIVSAIPAPEGDPDAPLQALIIDSWFDNYLGVVSLVRIKNGSLK
                     KNDKIKVMSTGQTWGVDRLGIFTPKQVDTEVLNTGEVGWVVCGIKDILGAPVGDTLTL
                     AKNGSDKPLPGFKKVKPQVYAGLFPVSSDDYENFRDALGKLSLNDASLFYEPENSAAL
                     GFGFRCGFLGMLHMEIIQERLEREYDLDLITTAPTVVYEVEKTDGDLLYVDSPAKLPA
                     VNDIEEIREPIARCNILVPSEYLGNVITLCVEKRGAQVDMVYHGNQVAVTYDIPMAEV
                     VLDFFDRLKSTSRGYASLDYNFQRFEASNMVRVDVLLNGDTVDALAMITHKDQSQTRG
                     RQLVEKMKEFIPRQMFDIAIQAAIGNHIIARSTVKQLRKNVIAKCYGGDVSRKKKLLK
                     KQKEGKKRMKQIGNVELPQEAFLAILHVGKD"
     gene            202037..202936
                     /locus_tag="PN96_01020"
     CDS             202037..202936
                     /locus_tag="PN96_01020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010650342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="ALR14630.1"
                     /translation="MANTFSLILVIVTLVTGVVWLLEKLVFAKKRQAKVAEIEAQTAN
                     GLDAVTLQKVERQPWWVENSVSIFPVIAFVLVLRSFIYEPFQIPSGSMMPTLLVGDFI
                     LVEKYAYGLKDPVWRTELVETGKPERGDIVVFKYPPHPSIDYIKRVVGLPGDIVRYSN
                     DKQICIQSKGESSCKPVKLSNVEESQFSSNGIPMIQLDEKLGNVEHNILVNPIVRNHV
                     EQYFPRSGTTEWVVPQGQYFVMGDNRDNSADSRYWGFVPEANLVGKAVAIWISFEFER
                     GADSVLPSWIPTGVRFNRIGGIH"
     gene            203085..203762
                     /gene="rnc"
                     /locus_tag="PN96_01025"
     CDS             203085..203762
                     /gene="rnc"
                     /locus_tag="PN96_01025"
                     /EC_number="3.1.26.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009843605.1"
                     /note="cytoplasmic enzyme involved in processing rRNA and
                     some mRNAs; substrates typically have dsRNA regions; forms
                     a homodimer; have N-terminal nuclease and C-terminal
                     RNA-binding domains; requires magnesium as preferred ion
                     for activity; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="ALR14631.1"
                     /translation="MNSPIDKLERKLGYQFKDAELINLALTHRSANSKHNERLEFLGD
                     SILSFVIADDLYHRFPKVNEGDMSRMRATLVRGHTLAELGREFDLGDYLKLGPGELKS
                     GGFRRDSILADAVEAIIGAIYLDSDIEAVRGIVLSWYKSRLEAIKPGVSQKDPKTRLQ
                     EFLQGRRKPLPVYTVTNIKGEAHNQEFTVECEVAGVDKPVIGKGTSRRKAEQAAAETA
                     LEQLTNG"
     gene            203755..204717
                     /locus_tag="PN96_01030"
     CDS             203755..204717
                     /locus_tag="PN96_01030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005449795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Era"
                     /protein_id="ALR14632.1"
                     /translation="MADNEFDIDAYFASHGETSSPENQHCGFIAIVGRPNVGKSTLLN
                     KILGQKISITSRKPQTTRHRIMGVDTDGDYQAIYVDTPGLHIEEKRAINRLMNRAANS
                     SLSDVNLVFFLVDGTHWTKDDEMVLTKLQKSNFPVVLCVNKVDNVQDRNEVMMHMADM
                     SKKMDFVDVVPISAKQGKNIDVLRKHVRDHLPVATHHFPEEYVTDRSQRFMASEIVRE
                     KLMRFTGEELPYSVTVEIERFDYNPETDGFHINALILVERSGQKKMVIGKGGEKIKTI
                     GREARLDMEELFGRKVYLETWVKVKSGWADDERALRSLGYIDDL"
     gene            204823..205554
                     /gene="recO"
                     /locus_tag="PN96_01035"
     CDS             204823..205554
                     /gene="recO"
                     /locus_tag="PN96_01035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009843607.1"
                     /note="involved in DNA repair and RecFOR pathway
                     recombination; RecFOR proteins displace ssDNA-binding
                     protein and facilitate the production of RecA-coated
                     ssDNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecO"
                     /protein_id="ALR14633.1"
                     /translation="MSNQSSEGLQRCFVLHRRPYSESSLILDVFSEEYGRITLMAKGA
                     RSKRSNLKGALQPFTPLLLKWSGKGSMKTLRQAEPISLGLPLTGINLYSAMYVNELIG
                     RVLMAEVPMPALFHDYLHALTELAQCDNPEPALRRFELALLSTMGYGVDFMHCAGTGE
                     PVEANMTYRYREQKGFIASVRRDNLTFLGNELIAISERRFVTKEQLKAAKRFTRIALK
                     PYLGGKPLKSRELFIHTPRARSNGK"
     gene            205551..206282
                     /locus_tag="PN96_01040"
     CDS             205551..206282
                     /locus_tag="PN96_01040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232992.1"
                     /note="involved in the de novo synthesis of pyridoxine
                     (Vitamin B6); Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine 5'-phosphate synthase"
                     /protein_id="ALR14634.1"
                     /translation="MSSIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITI
                     HLREDRRHILDRDVRILRETIQTRMNLEMAVTDEMVEIALKTKPEFVCLVPEKREELT
                     TEGGLDVVGQLAKVKAATEKLTEAGIKVSLFIDADRQQIDAAKQCGAPYIELHTGHYA
                     DATTEEEQQAELKKIAAGASYADDLGIIVNAGHGLTYHNVAPIAALPEIYELNIGHSI
                     IGRAVFDGLEKAVADMKALMIEARK"
     gene            206295..206675
                     /locus_tag="PN96_01045"
     CDS             206295..206675
                     /locus_tag="PN96_01045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACP synthase"
                     /protein_id="ALR14635.1"
                     /translation="MAILGLGTDIAEIERIEKALDRTGESFAQRILCEEEILKFSQLK
                     QKGRYLAKRFAAKEAASKALGTGIAKGVTFHDFCVTNDDLGKPVISLSGTAQQIAQKL
                     GVNHVHLSISDERHYAVATVILES"
     gene            complement(206759..209557)
                     /locus_tag="PN96_01050"
     CDS             complement(206759..209557)
                     /locus_tag="PN96_01050"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009707599.1"
                     /note="part of the two-component regulatory system with
                     UvrY; involved in the regulation of carbon metabolism via
                     the csrA/csrB regulatory system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ALR14636.1"
                     /translation="MTRYGLRARVITLTLAPTLIIGLLLSGFFSFNRYQDLEKQVITT
                     GNSIIEPLAIASESHLMTESREAVRRLISYAHRKNSKLVRSIAVFDAHHELFVTSNFH
                     PNFEALMFPKDKPIPQLGNSEIYDNYLILRVPILSEGHYLTDLSNKSQATKAIGYIAV
                     ELDLSSLRLQQYQEVFSAFLVLILGLGLASVFASRLMHDVTQPITHMKNVVDRIRRGH
                     LDVRIEGKMHGELDQLKNGINAMAVSLSEYHVEMQHSIDQATSDLRETLEQLEIQNVE
                     LDIAKKRAQEAARVKSEFLANMSHELRTPLNGVIGFTRQMLKTQLSNSQTDYLQTIEK
                     SANNLLNIINDILDFSKLEAGKLALENIPFDFRESLEEVVNLQATSAHEKGLEITLKV
                     DPKIPPGLVGDPLRIQQILTNLVGNSIKFTERGNIDISVEMRSQSGDSVELQFMVRDT
                     GIGISERQQAQLFQAFSQADASISRRYGGTGLGLVITQKLVSQMGGEISLTSRLHQGS
                     TFWFTLRLNSTEMPMSDLIEIELLTGKQLLLVEPNMQAASVTQQILSQEGILVTYRSS
                     LPEANEHYDYVLLNLAANQTYDEQSVEAWIEQAKQMAPSVIMGTPSTELALADQIMKE
                     HQIQCLTKPLSRRRLLQSLISEHVESPQPLKAPIKTVEEERLPLHVLAVDDNPANLKL
                     ISALLKERVETVTACSNGQQAVNLATEKKYDMIFMDIQMPHMDGVTACKHIKQIELNK
                     DTPVIAVTAHAMAGERDRLLAAGMDDYLTKPIEEHVLQQVLVHWNPNACAESFRKVTP
                     SYVDEQEGEALNATEKAHQDVIIDWQAALKQSANKEDLAKDMLRMLIDFIPEVDGVVA
                     QALEEENFAREELIHVIHKLHGSSSYCGVPRLKSLCATLEQALRSGAELNDIEPEMFE
                     LQDEMIKVTTTAKLYLEQ"
     gene            209750..211069
                     /gene="rumA"
                     /locus_tag="PN96_01055"
     CDS             209750..211069
                     /gene="rumA"
                     /locus_tag="PN96_01055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017189117.1"
                     /note="in Escherichia coli this enzyme catalyzes the
                     SAM-dependent methylation of U1939 in the 23S ribomal RNA;
                     binds an iron-sulfur cluster [4Fe-4S]; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="ALR14637.1"
                     /translation="MARIFQPKKKTQLNTRHQQVHVERLDHHGAGIAYLKKKPLFIDG
                     ALPGEEVVTQLVEEKSKFARGKLIKILQSSDTRAEPFCPHYHECGGCDLQHLEYDQQL
                     THKQQTLRQLMRKFAGSDIELDAPVLGEQLGYRRRARVSLFVDKKTRQLHFGFRKKQS
                     KQIAQVTDCPVLAPQLNVLLPEIYAELKQFKKPDQLGHVELVLGDNGPCITLRHMSNL
                     TEPEVEALVKLAERHNATLYLMPQTDQLDLISGEIPFYQENGVKVPFTPNNFIQVNQA
                     VNQKMVAQAIQWLDPQDSDRVLDLFCGLGNFSLPIAKLAKHVVGIEGVAEMVEKATNN
                     ASLNQINNAQFYHANLEQDFDGQVWAAEKFDKVLLDPARAGASGIIDQVSALGAQRVV
                     YVSCNPATLARDSQSLIEQGYKLTKLGMLDMFPHTSHLESMALFEKS"
     gene            211190..213409
                     /gene="relA"
                     /locus_tag="PN96_01060"
     CDS             211190..213409
                     /gene="relA"
                     /locus_tag="PN96_01060"
                     /EC_number="2.7.6.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004744749.1"
                     /note="(p)ppGpp synthetase; catalyzes the formation of
                     pppGpp and ppGpp from ATP and GTP or GDP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(p)ppGpp synthetase"
                     /protein_id="ALR14638.1"
                     /translation="MVAVRSAHLNQNEQFELEHWVASLGQEKNTASRLIEVYRDCQNI
                     LADHEQAELLLWRGREMIEILITLSMDKATLVAAQLFPLVSSGAFKRELLEEKYSKEI
                     IKLIDGVEEMAAIGQLNVTMEGGAASSQVDNVRRMLLAMVDDFRCVVIKLAERICNLI
                     EVKKAPDEVRRAAAKECANIYAPLANRLGIGQLKWEIEDYAFRYQQPETYKQIAKQLS
                     ERRIVREQYIKDFVEDLTEEMKACGINAEVSGRPKHIYSIWRKMQKKSLAFDELFDVR
                     AVRIIADKLQDCYAALGVVHTKYKHLPSEFDDYVANPKPNGYQSIHTVILGPEGKTIE
                     IQIRTKQMHEESELGVAAHWKYKEGASARSGYDEKITWLRKLLDWQEEMSDSGEMLDE
                     LRSQVFDDRVYAFTPRGDVVDLPMGATPLDFAYHIHSEVGHRCIGAKVGGRIVPFTHK
                     LHMGDQVEIITSKEPNPSRDWLNPSLGFVHSGRARAKINAWFRKQSREKNLEAGREIL
                     EHELVKIGATMKDAERYALKRFNVNTPDELYVGVGSGDLRINQIINHINALVNKPTAE
                     EEDQQALEKLQEAEHKAPAQSRPKKDAVVVEGVDNLMTHLARCCQPIPGDDICGYITQ
                     GRGISVHRSDCEQLEELRHHAPERIIDTVWGSGFVGSYILTVRVEAMERGGLLKDITT
                     LFANEKIKVTSMKSRVDYRRQLAIMDFDLEVTNIEALSRVSKRVEQIRDVMSVKRLG"
     gene            213682..214473
                     /gene="mazG"
                     /locus_tag="PN96_01065"
     CDS             213682..214473
                     /gene="mazG"
                     /locus_tag="PN96_01065"
                     /EC_number="3.6.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005393894.1"
                     /note="functions in degradation of stringent response
                     intracellular messenger ppGpp; in Escherichia coli this
                     gene is co-transcribed with the toxin/antitoxin genes
                     mazEF; activity of MazG is inhibited by MazEF in vitro;
                     ppGpp inhibits mazEF expression; MazG thus works in
                     limiting the toxic activity of the MazF toxin induced
                     during starvation; MazG also interacts with the GTPase
                     protein Era; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate hydrolase"
                     /protein_id="ALR14639.1"
                     /translation="MSHPIEQLEAIMAKLRDPEGGCPWDLKQSFDTIVPHTIEETYEV
                     VDAIQNRDWPNLKEELGDLLFQVIFYSQLAKEQDLFDFSDVVETVNEKLTRRHPHVFS
                     DVEFESDADINANWEAEKAKEKAQVGKQEESILDSIPNSLPALSRATKIQKKCAKYGF
                     DWDSLGPVVEKVQEEIDEVMEEAIQVDPDDEKVELELGDLLFATVNLARHLGKDPEVA
                     LGKANLKFARRFKQVEVKVAQSGRGLKDCSLTELDKFWDEVKKEE"
     gene            214688..216328
                     /gene="pyrG"
                     /locus_tag="PN96_01070"
     CDS             214688..216328
                     /gene="pyrG"
                     /locus_tag="PN96_01070"
                     /EC_number="6.3.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009707596.1"
                     /note="CTP synthase; cytidine triphosphate synthetase;
                     catalyzes the ATP-dependent amination of UTP to CTP with
                     either L-glutamine or ammonia as the source of nitrogen;
                     in Escherichia coli this enzyme forms a homotetramer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthetase"
                     /protein_id="ALR14640.1"
                     /translation="MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPY
                     INVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRK
                     ERRGDYLGATIQVIPHITNAIKDRVIAGSEGHDVAIVEVGGTVGDIESLPFMEAIRQL
                     AIEVGRENAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPA
                     NERKKIALFCNVPEKAVISMKDVDSIYKIPQLIKAQGLDDLVCSRFGITAPEADLSEW
                     EQVIYEEANPTGEVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLNVTIKYVDSQDIE
                     TRGVELLEGLDAILVPGGFGDRGVEGKIRAAQYARENKVPYLGICLGMQVALIEYARN
                     VAGMEGAHSTEFNKETKYPVVGLITEWVDESGNVEERTEKSDLGGTMRLGSQLCHLQK
                     GTKAYELYGSATIHERHRHRYEVNNVLRPQIEKAGLKVSGLSADKKLVEMIENPEHPW
                     FVAAQFHPEFTSTPRDGHPLFAGFVKAAGQFSRGEFEK"
     gene            216410..217711
                     /gene="eno"
                     /locus_tag="PN96_01075"
     CDS             216410..217711
                     /gene="eno"
                     /locus_tag="PN96_01075"
                     /EC_number="4.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017063215.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     2-phospho-D-glycerate in glycolysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="ALR14641.1"
                     /translation="MSKIVKVLGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTG
                     SREALELRDGDKARFLGKGVLKAVEAVNGAIAEALVGKDAKDQAAIDAVMIELDGTEN
                     KSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGQFSMPLPMMNIINGGEHA
                     DNNVDIQEFMIQPVGAKTLKEGLRIGAEVFHNLAKVLKSKGYSTAVGDEGGFAPNLKS
                     NAEALEVIAEAVAAAGYELGKDVTLAMDCAASEFFDKEAGIYNMKGEGKTFTSEEFNH
                     YLAELANQFPIVSIEDGLDESDWTGFKHQTELLGDKLQLVGDDLFVTNTKILAEGIEK
                     GVANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQ
                     IKTGSMSRSDRVAKYNQLIRIEEALGERAPFNGLKEVKGQA"
     gene            218170..218451
                     /locus_tag="PN96_01080"
     CDS             218170..218451
                     /locus_tag="PN96_01080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsB"
                     /protein_id="ALR14642.1"
                     /translation="MRIFVIALTLLFGLLQYTLWFGKNGVSDYYAVEDEIEVQQQVNS
                     KLQARNNEMFAEIDDLRQGIDAIEERARHELGLVRDGETFYRIVGEENQ"
     gene            218453..219160
                     /locus_tag="PN96_01085"
     CDS             218453..219160
                     /locus_tag="PN96_01085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="ALR14643.1"
                     /translation="MLDTVPSHIAIVPAAGVGSRMKADRPKQYLLIDGKAVLEHTVEK
                     LLSHSKIAKVVVAVTEGDPYYPELSIANHPDVIRVDGGKERADSVLSGLNYVSTELAS
                     EWVLVHDAARPCVTLTDIDRLIDVCIDHPTGGILASPVRDTMKRANSVQNIDHTVDRE
                     ALWHALTPQMFKTQPLKNALSDALQQGIAITDEASALEWKGEAPALVQGNASNIKITQ
                     PEDLALAEFYLSRERGE"
     gene            219174..219653
                     /gene="ispF"
                     /locus_tag="PN96_01090"
     CDS             219174..219653
                     /gene="ispF"
                     /locus_tag="PN96_01090"
                     /EC_number="4.6.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232982.1"
                     /note="catalyzes the conversion of
                     4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate
                     into 2-C-methyl-D-erythritol 2,4-cyclodiphosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="ALR14644.1"
                     /translation="MIRIGHGFDVHKFGGEGPVIIGGVSVPYEQGLIAHSDGDVALHA
                     LSDALLGAIAAGDIGRHFPDTDDKWKGADSRELLKDVYRRVKEQGYRLGNADITIMAQ
                     APKMAPHIEAMCAVIAQDLETDISNINVKATTTERLGFTGRKEGIATEAVVLLFKQQ"
     gene            219696..220739
                     /locus_tag="PN96_01095"
     CDS             219696..220739
                     /locus_tag="PN96_01095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="ALR14645.1"
                     /translation="MSDILSSLAYLTGKPVASAKIKAQPEHFQVSEDLGFAFTGEGEH
                     LMVRIRKTGENTSFVANELAKACGVKSKDVSWAGLKDRHAVTEQWLSVHLPKGETPDF
                     SAFLAQYPNIEILATDRHNKKLRPGDLVGNGFVVTLSEVTDIADVERRLEKIKQVGVP
                     NYFGAQRFGNDGNNLEEARRWGRENVRTRNQNKRSMYLSAARSWIFNRIVSARLEQGM
                     FDKFVEGDVAQTSAGNVTVDASNIAAMQAQFIDGDAAITAALAGDNALPTQADALALE
                     QPFLDEEPDLMALIRGNRMRHDRRNVALKPQDLAWSVEGNNITLTFSLDAGSFATSIV
                     RELVNEVKVEREY"
     gene            220739..221515
                     /locus_tag="PN96_01100"
     CDS             220739..221515
                     /locus_tag="PN96_01100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005393882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stationary phase survival protein SurE"
                     /protein_id="ALR14646.1"
                     /translation="MEQDSPNAKSLRILISNDDGVYAQGIHALADELRDIAEVTIVAP
                     DRNRSGASNSLTLEQPLRVTQIAPNTYSVQGTPTDCVHFALNELMKDDLPDLVLTGIN
                     HGANLGDDVLYSGTVAAAMEGHFLGVQSVAFSLVGKRHFESAAKIARKLVQQHLAMPI
                     PTNRLLNVNVPDLPLEQLGQIEVTRLGARHHAENMIKQKDPRGHDIYWLGPPGKEQDA
                     GEGTDFYAIERGRVSITPLQVDLTAHESLRAMDSWLKEEK"
     gene            221515..222141
                     /locus_tag="PN96_01105"
     CDS             221515..222141
                     /locus_tag="PN96_01105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005380892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="ALR14647.1"
                     /translation="MSNPHADRLIEYLVASGIKDQRVLDAIHHLPRERFVSQAMMHQA
                     YDNNALPIGQGQTISQPYIVARMTELLELEPSSNVLEIGTGSGYQTAVLAQLVERVYS
                     VERIKSLQWEAKRRLKQLDIYNISTKHGDGWLGWETKGPFDAIIVTAAAEVIPQALLA
                     QLKDGGRMVIPVGETEQQLLKIERKGDEYLSTVVEMVRFVPLVAGDLA"
     gene            222152..223078
                     /locus_tag="PN96_01110"
     CDS             222152..223078
                     /locus_tag="PN96_01110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14648.1"
                     /translation="MVSKLLRRTSISFMLAAGLLGCAAHSPAPVSSLKKDYSNVERGS
                     YRGSYYEVKKGDTLYFIAYVTDKDVNDLVRYNELAQPYTIYPGQRLKLWAPKYIAPKF
                     GQKVEPVVAPIVAKTPAPVTKISTVSKPVDSSKSSTPKVQPTTPKVVQKQPPKKVEQS
                     KTKEYVGSKDNQNVKKNPSTTTTKNANVSKWLWPTKGRVIKNFSAGEQGNKGIDIAGQ
                     RGQPIVSTAAGTVVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVSEGQSVNSGQK
                     IATMGSSGSKSVKLHFEIRYQGKSVNPKRYLP"
     gene            223159..224145
                     /locus_tag="PN96_01115"
     CDS             223159..224145
                     /locus_tag="PN96_01115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232977.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; this sigma factor controls a
                     regulon of genes required for protection against external
                     stresses; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoS"
                     /protein_id="ALR14649.1"
                     /translation="MSISNTVTKVEEFDFDDESVKTVASQLGKSSSTESKTAAREEFD
                     ASSKSLDATQLYLGEIGFSPLLTAEEEVLYARRALRGDEAARKRMIESNLRLVVKISR
                     RYSNRGLALLDLIEEGNLGLNRAVEKFDPERGFRFSTYATWWIRQTIERALMNQTRTI
                     RLPIHVVKELNIYLRTARELSQKLDHEPTAEEIAAQLDIPVEDVSKMLRLNERISSVD
                     TPIGGDGEKALLDIIPDGNNSDPEVSTQDDDIKSSLIHWLEELNPKQKEVLARRFGLL
                     GYEPSTLEEVGREIGLTRERVRQIQVEGLRRLREVLIKQGLNMENLFNVEDD"
     gene            complement(224220..226781)
                     /locus_tag="PN96_01120"
     CDS             complement(224220..226781)
                     /locus_tag="PN96_01120"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LQ9.1"
                     /note="This protein performs the mismatch recognition step
                     during the DNA repair process; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="ALR14650.1"
                     /translation="MKAEQKHTPMMQQYLKLKAENPDILLFYRMGDFYELFYDDAKRA
                     SQLLDISLTKRGASAGEPIPMAGVPFHAVEGYLAKLVQLGESVAICEQIGDPATSKGP
                     VERKVVRIVTPGTVTDEALLSERLDNLIAAIYHHNGKFGYATLDVTSGRFQLTEPETE
                     EAMAAELQRTAPRELLFPEDFEPVHLMSSRNGNRRRPVWEFELDTAKQQLNQQFGTKD
                     LIGFGVEHASLGLCAAGCLIQYVKDTQRTALPHIRSLTFDRQDHSVILDAATRRNLEI
                     TQNLAGSTDNTLAAVLDHCATPMGSRMLKRWLHQPMRCIDTLNNRLDAIGEIKDQSLF
                     ADLQPTLKQIGDIERILARLALRSARPRDMARLRHAMQQLPELEAITASLTHPYLVKL
                     AQFAAPIDDVCELLERAIKENPPVVIRDGGVIAEGYNEELDEWRKLADGATEYLEKLE
                     SDERERHGIDTLKVGYNNVHGFYIQVSRGQSHLVPPHYVRRQTLKNAERYIIPELKEH
                     EDKVLNSKSKALALEKQLWEGLFDLLMPNLEQLQNLASAVSQLDVLQNLAERADSLDY
                     CRPTLVKEPGIQIQSGRHPVVEQVTSDPFIANPIELNPQRKMLIITGPNMGGKSTYMR
                     QTALIALMAHIGSYVPAESAQIGSLDRIFTRIGASDDLASGRSTFMVEMTETANILHN
                     ATKNSLVLMDEIGRGTSTYDGLSLAWASAEWLATQIGAMTLFATHYFELTELPSQLPN
                     LANVHLDAVEHGDSIAFMHAVQEGAASKSYGLAVAGLAGVPKTVIKNARAKLSQLEQL
                     SHGNDSPRPGAVDVANQLSLIPEPSEVEQALSNIDPDEMTPRQALEELYRLKKML"
     gene            226866..227357
                     /locus_tag="PN96_01125"
     CDS             226866..227357
                     /locus_tag="PN96_01125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="damage-inducible protein CinA"
                     /protein_id="ALR14651.1"
                     /translation="MERTTKLSADLGVLLEQHGHVMTTAESCTGGGVAAAITDIAGSS
                     GWLDRAFVTYSNEAKMEMLGVKQKTLEMHGAVSEPVVIEMVQGALEHSNATIGVSISG
                     IAGPGGGSEEKPVGTVCFAFADNQQWLLVETMHFDGDRAAVREQAVFHALTRIYQHLD
                     EKI"
     gene            227548..228594
                     /gene="recA"
                     /locus_tag="PN96_01130"
     CDS             227548..228594
                     /gene="recA"
                     /locus_tag="PN96_01130"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6XZ07.1"
                     /note="catalyzes the hydrolysis of ATP in the presence of
                     single-stranded DNA, the ATP-dependent uptake of
                     single-stranded DNA by duplex DNA, and the ATP-dependent
                     hybridization of homologous single-stranded DNAs; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase A"
                     /protein_id="ALR14652.1"
                     /translation="MDENKQKALAAALGQIEKQFGKGSIMRLGDNRAMDVETISTGSL
                     SLDIALGAGGLPMGRIVEVYGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVY
                     AKKLGVDIDALLVSQPDTGEQALEICDALARSGAIDVMVVDSVAALTPKAEIEGEMGD
                     SHMGLQARMLSQAMRKLTGNLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYA
                     SVRLDIRRTGAIKEGDEVVGNETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELVDL
                     GVKHKLVEKAGAWYSYNGDKIGQGKANACNYLREHTEVAQTIDKKLREMLLSPAVAEG
                     PEAGEMPEKKEEEF"
     gene            228709..229176
                     /locus_tag="PN96_01135"
     CDS             228709..229176
                     /locus_tag="PN96_01135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecX"
                     /protein_id="ALR14653.1"
                     /translation="MYQKRQAPTLSSKEAAIQLLSRRDHGQYELYQKLALKGYEEADI
                     EAAINFCLDHNYLDDLRYAKSQIRQHVYKGHGERRIRQELAQKRVAESVVEEAMMEEP
                     QDWFELARMAAEKKFKGIKAKDQKEYAKQVRFMQYRGYSFDQISYALSFDEHD"
     gene            229319..231901
                     /locus_tag="PN96_01140"
     CDS             229319..231901
                     /locus_tag="PN96_01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017449169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="ALR14654.1"
                     /translation="MYMSTDEVRNSFLKFFESKGHQIVESSSLVPHNDPTLLFTNAGM
                     NQFKDCFLGLEKRAYTRATTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDY
                     FKEDAISFAWEFLTQVLKLPQERLLVTIYETDDEAFDIWNQKVGVPADRIIRIGDKKG
                     GKPYESDNFWQMGDTGPCGPCTEIFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQF
                     NRHADGTMEPLPKPSVDTGMGIERISAIMQGVHSNYEIDVFQTLIKAAAEVVGYEDLS
                     NQSLRVIADHIRSCSFLIVDGVMPSNEGRGYVLRRIIRRAVRHGNKLGAQGVFFYKLV
                     GVLAEVMGTAGEELKRQQAVVEKVLRIEEENFGRTLDRGMSILNEALDNLDGKELDGE
                     TVFKLYDTYGFPADLTNDVAREREFTIDEEGFEKAMEEQRQRAREAGQFGTDYNATIK
                     VDAETEFCGYTGTKGSSSVEAMFVEGNEVESLSAGDKAIIVLGETPFYAESGGQCGDA
                     GEIRTESGVFRVEDTQKLGNAIAHYGVMAEGVLAKGDDVATIVDAERRAATSLNHSAT
                     HLLHEALRRVLGEHVLQKGSLVRPENLRFDFSHLEAVTAAELKEVERLVNAQIRRNHA
                     IETNIMDIESAKQKGAMALFGEKYDDEVRVLSMGDFSTELCGGIHASSTGDIGLFKIT
                     SESGIAAGIRRIEAVTGEAALDVIEAQTAKYEEKLAESAQKSKALEKEIQKLKDKMAA
                     AESANIMGKAVEVNGTKVLVAALEGADSKNLRTMVDDIKNQMGSGVVLLANITGDKVG
                     LIAGVTKDLVGKVKAGDLVKMVAEQVGGKGGGRPDMAQAGGTDVAALPEAIKTVQPWL
                     EERL"
     gene            232098..233285
                     /locus_tag="PN96_01145"
     CDS             232098..233285
                     /locus_tag="PN96_01145"
                     /EC_number="2.7.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333960.1"
                     /note="catalyzes the formation of 4-phospho-L-aspartate
                     from L-aspartate and ATP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="ALR14655.1"
                     /translation="MKKPLIVQKFGGTSVGSIERIHQVAEHIIKAKNDGNQVVVVVSA
                     MSGETNRLMDLAKQVDSVPTARELDVLLSAGEQVSMALLAMTLNKMGHPARSLTGAQA
                     NIVTDNQHNDATIKHIDTTRVMALLEQEHVVIVAGFQGVNENGDITTLGRGGSDTSAV
                     TLAGALRADECQIFTDVDGIYTCDPRVVKTAQKMAVIDFPSMEAMASRGAKVLHLPSV
                     QYAWKNNVPLRVLSTFDVNEGSLVKGEIGTQAISGIAIQRDLAIIEVDKEHLSSATKQ
                     CQMLGIDVWNVIEETERTGIMIKQDACAKFDLVFSDKIRNSEMVSLLTAVGLEANGMV
                     EHACDLLAEQDIAINFCATNALTMMLVLSPDCVDMAANILHDAYITSSEALSIQQKHA
                     LIG"
     gene            233377..233574
                     /locus_tag="PN96_01150"
     CDS             233377..233574
                     /locus_tag="PN96_01150"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B7VK42.1"
                     /note="affects carbohydrate metabolism; has regulatory
                     role in many processes; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator"
                     /protein_id="ALR14656.1"
                     /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHR
                     EEIYMRIQAEKGNGNVASGNY"
     gene            233818..233910
                     /locus_tag="PN96_01155"
     tRNA            233818..233910
                     /locus_tag="PN96_01155"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:233852..233854,aa:Ser,seq:gct)
     gene            233954..234030
                     /locus_tag="PN96_01160"
     tRNA            233954..234030
                     /locus_tag="PN96_01160"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:233988..233990,aa:Arg,seq:acg)
     gene            234079..234171
                     /locus_tag="PN96_01165"
     tRNA            234079..234171
                     /locus_tag="PN96_01165"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234113..234115,aa:Ser,seq:gct)
     gene            234239..234315
                     /locus_tag="PN96_01170"
     tRNA            234239..234315
                     /locus_tag="PN96_01170"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234273..234275,aa:Arg,seq:acg)
     gene            234396..234472
                     /locus_tag="PN96_01175"
     tRNA            234396..234472
                     /locus_tag="PN96_01175"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234430..234432,aa:Arg,seq:acg)
     gene            234536..234612
                     /locus_tag="PN96_01180"
     tRNA            234536..234612
                     /locus_tag="PN96_01180"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234570..234572,aa:Arg,seq:acg)
     gene            234675..234751
                     /locus_tag="PN96_01185"
     tRNA            234675..234751
                     /locus_tag="PN96_01185"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234709..234711,aa:Arg,seq:acg)
     gene            234814..234890
                     /locus_tag="PN96_01190"
     tRNA            234814..234890
                     /locus_tag="PN96_01190"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234848..234850,aa:Arg,seq:acg)
     gene            234953..235029
                     /locus_tag="PN96_01195"
     tRNA            234953..235029
                     /locus_tag="PN96_01195"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234987..234989,aa:Arg,seq:acg)
     gene            235092..235168
                     /locus_tag="PN96_01200"
     tRNA            235092..235168
                     /locus_tag="PN96_01200"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:235126..235128,aa:Arg,seq:acg)
     gene            235724..235981
                     /locus_tag="PN96_01205"
     CDS             235724..235981
                     /locus_tag="PN96_01205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxaloacetate decarboxylase subunit gamma"
                     /protein_id="ALR14657.1"
                     /translation="MTNIGSLLVDAATLMITGMAVVFIFLTILVYLVRLMSRLIPEEV
                     LEPIAAPKIKNNNQSTSSAVSPQVVAAISAAIHKHRTSVAK"
     gene            236014..237801
                     /locus_tag="PN96_01210"
     CDS             236014..237801
                     /locus_tag="PN96_01210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012841413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxaloacetate decarboxylase"
                     /protein_id="ALR14658.1"
                     /translation="MSKPLAITDVVLRDAHQSLFATRMRIDDMLPIAAELDKIGYWSL
                     ETWGGATFDSCIRFLGEDPWERLRELKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKF
                     VERAHANGMDVFRIFDAMNDVRNFQKAVKATVDVGAHAQGTLSYTTSPVHNADTWVDL
                     AKRLEDLGCHSLCIKDMSGLLKPYEAEELITRIKASCDVPLALHCHATTGLSTATAIK
                     AVEAGIDILDTAISSMSSTYGHTPTETVVAMLQGTERDTNLKLEEIEPIAAYFREVRK
                     KYAKWEGQLKGVDSRILIAQVPGGMLTNMEGQLKEQGAADRLDEVLEEIPRVREDLGF
                     IPLVTPTSQIVGTQAVINVLTGERYKSITKETAGLLKGEYGQAPAPINAELQAKVLEG
                     KEPITCRPADLLEPEMEALTVELMDKAKSEGIKLASERVDDVLTYALFPQVGLKFLKN
                     RGNPEAFEPAPTLESAKPAPAPVAQASVGGVETYSVRVDGQVYEVEVGPQGELTSVTP
                     SAASAKAAAPAVPANTSAESVPAPLAGNIFKVNVQPGAEVAEGDVLLILEAMKMETEV
                     RAARGGIVQELNVKEGDAVTVGAPLLSLA"
     gene            237811..238941
                     /locus_tag="PN96_01215"
     CDS             237811..238941
                     /locus_tag="PN96_01215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaconyl-CoA decarboxylase subunit beta"
                     /protein_id="ALR14659.1"
                     /translation="MDGLMTLWLETGIANFEFGQICMMLVGCTLLFLAIRKGFEPLLL
                     LPIGFGAILANIPNAGFTEPGGLLYYVYHIGIESGVFPLLIFMGVGAMTDFGALIANP
                     KTLWLGAAAQFGIFATLFGAILLNYVPGMEFSMADASSIAIIGGADGPTAIFLASKLS
                     PDLLGAIAVAAYSYMALVPIIQPPIMKALTTKEERQVKMAQLRHVGKWEKVIFPLAVL
                     LMTILFLPSATPLVGMFCLGNLMREAGVVDRLSKTAQNELINIVTIFLGLGVGSKLQA
                     DKFLNLETLGILALGAVAFSIGTAAGVLMAKLLNKFSKEDINPLIGAAGVSAVPMAAR
                     VVNKVGLDANPQNFLLMHAMGPNVAGVLGSAVAAGILLALVG"
     gene            239079..240029
                     /locus_tag="PN96_01220"
     CDS             239079..240029
                     /locus_tag="PN96_01220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="ALR14660.1"
                     /translation="MEHKQIVITEFGEASVLAVQHAPTPSPQSGEVLVKVSFSGINPI
                     DVKTRAGLGWAAAQNKDNLPWVPGYDISGEVVSCGEQTSRFAVGDKVAGFIGFPVRGG
                     GYSQYVSVPESELSRVPSNVPLESAAVLPLAGQTAAQALEKANVTESDRVLVLAGAGG
                     VGHIAVQLAVASKAEVFTTCSERNVDYLTSLGAHAVNYQLGPVSERVEDIDVLIDLVG
                     GDAALDALKCLKPNARIVTIPTITAEKICEQAKQLGLEANGMLVEPKPEQLDSLLYMA
                     DVGLLKTEVQHVYPMDEVVAAHEQVESGRTRGKVLLDMTC"
     gene            240023..240484
                     /locus_tag="PN96_01225"
     CDS             240023..240484
                     /locus_tag="PN96_01225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14661.1"
                     /translation="MLEAFNAGFENIALWFSGSALWVLFMTGFLSATLLPGGSEAGLI
                     ATLSLNQYSVFSIITVATIGNTLGGLTNYWLGLWIPNKTQDEKHGHTALKWLSKYGYW
                     ALFFSWLPIVGDPLCLAAGWLRMKFLPCVMLIFFGKAARYSLLAAIYLGLF"
     gene            240494..243337
                     /locus_tag="PN96_01230"
     CDS             240494..243337
                     /locus_tag="PN96_01230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015297258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="ALR14662.1"
                     /translation="MRMFWVGACSLLVITGCASQSPVSSLPEGITFVESSQAEEGKVK
                     IPYQKYKLDNGLTVILAPEDSDPLVHVDMTYHVGSAREEIGKSGFAHFFEHMMFQGSE
                     NVGDQEHFKIITEAGGTLNGTTNRDRTNYFETVPANQLEKMLWLESDRMGFLLDAVSQ
                     HKFEIQRSTVKNERAQRYDNRPYGLIWERMSEALYPEGHPYSWQTIGYVEDLDRVDVN
                     DLKAFFLRWYGPNNATLTIGGDLDVEKTLAWVNKYFGSIPRGPEVENAAKQPATLTES
                     KYITLEDRIQQPMVMIAWPTTYDGEASQASLDTLSEVLGGGTNSLLYQDLVKTQKAVD
                     AGSFHDCAELACTFFVYAMGDSGDKGDLSKLYDDVMQSLNKFADTGVTEQRLEQLTGK
                     AEADAIFALESVKGKVTQLASNETFFGQPDLIEKQLEQIRAVTPDSVDKVYRDFIQGK
                     SKVTLSVVPTGKTDLAVKPATFVTPERTLPEYKKITDDQLAYRRATDNFDRSVQPPIG
                     DPVQATMPDLYDVHFDNGSELLGAVSNETPTVMMQFSLPAGTRFVEKGKEGLAQLTAS
                     MLQEGTTKRSMEEIQAELDKLGSVISVDATGYTTNISVSALEKNLAPTLKIVEEMLLS
                     PAFKQEDFERVKQQALEGLVYEHQSPSWMASQASRQVLFGDSIFARPKDGTQAGMEAL
                     TLNDIREFYATHYTPQGAQITVVGDVSKQDIEQQLAFWANWQDDAAPLYAPQSIPALG
                     TQKVHLVDKPGAPQSVVMMVRQGVPYDATGEFFLGQLANFNLAGNFNSRINQNLREDK
                     GYTYGAYGYFSGNPETGSVVFTAQVRADATIASIMEMKNELNEFSQAGMTDDELTFMR
                     QAVGQKDALKYETPTQKAELISDIFKYNLDKDYLQQRNAIVETVDKQTLNTLAQKWFD
                     PNDYQIIVVGDAKSLRPQLEKLGKDVEELEIIR"
     gene            243494..245062
                     /locus_tag="PN96_01235"
     CDS             243494..245062
                     /locus_tag="PN96_01235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005379941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="ALR14663.1"
                     /translation="MTDFAARLEKVASNPEVFKQFGRGVERETLRYRQDGQLATTPHP
                     EGLGSAFTNQWITTDFSESLLEFITPVSHDVPELMAQLKDIHHFTQTKMGEEKMWPLS
                     MPCYVASEDNINLAQYGSSNAARMKTLYREGLKRRYGSLMQIISGVHFNFSFPESFWD
                     ALYGEQDEEARQETKSDAYFALIRNYYRFGWMIPYFFGASPALCGSFIQGRETSLPFE
                     SLGGTLFLPKSTSLRLSDLGYTNNAQSSLKIGFNSIDQYLEGLSDAIRRPSEEFAKIG
                     VKVDGEYRQLNSNVLQIENELYAPIRPKRVAKSGEKPSEALKRAGVEYIEVRSLDVNP
                     FSPVGITEEQVRFLDLFLTWAALSDSEPMDNCELECWRDNWNKVIVSGREKGLMLQIG
                     CQGERLPLQEWAHRVFADLRQIAVMMDEVNGDNAYQEVCDKLTGWIDEPELTTSGQLL
                     ELTKELGGLGKVGCSLGMKHREDNLNHGYQHYSQEVMEQEALASVEKQKQAELSDTMS
                     FDDFLEDYFSYLKQ"
     gene            245093..245692
                     /locus_tag="PN96_01240"
     CDS             245093..245692
                     /locus_tag="PN96_01240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005493961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR17174.1"
                     /translation="MKPLVVSVLGSVLLAGCATAPPQQQDNLCEIFREKSGWYDDAKD
                     MEEEWGTPIHVAMAIIKQESGYRHDAKPPKDYVLGFIPWGRVSSAYGYAQAQDPAWDD
                     FQDSTGQGGSRTNFDDAMMFVGWYTHETRRQLGISLWDPYNQYLAYHEGRGGYQRGTY
                     KRKPSLVKVARRVEQTAKNYGWQLKQCRQELEDNSSWFF"
     gene            245762..246280
                     /locus_tag="PN96_01245"
     CDS             245762..246280
                     /locus_tag="PN96_01245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010450211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteinase"
                     /protein_id="ALR14664.1"
                     /translation="MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPN
                     KDILSEKGIHTLEHLYAGFMRSHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVAD
                     AWIASMEDVLKVESQNKIPELNEYQCGTAAMHSLDEAKQIAKNILDAGVSVNKNDELA
                     LPESMLKELRID"
     gene            complement(246365..247642)
                     /locus_tag="PN96_01250"
     CDS             complement(246365..247642)
                     /locus_tag="PN96_01250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14665.1"
                     /translation="MDDISTGILFALLACLIVISGYFSGSETGMMSLNRYRLKHLAKN
                     GHKGAKRVEKLLDRPDRLIGLILIGNNLVNILASAIATIIGMRLYGDMGVAIATGALT
                     MVVLVFAEVTPKTIAALYPERVSYTSSILLTILMKLLSPLVLLVNFITNGFIRLLGVK
                     ADHSVEDHLSSEELRTVVNEAGGLIPRRHQDMLVSILDLEHVTVNDIMVPRNEITGID
                     INDDWKSIVRQLTHSPHGRIVFYRDQIDEVVGMLRLREAYRLMLEKNEFTKETLLRAA
                     DEVYYIPEGTPLNVQMLKFQRNKQRIGLIVDEYGDIIGLVTLEDILEEIIGEFTTSIS
                     PSLSDEISPQGDGSFLIEGSTNIRDINKGLKWHLPTDGPRTLNGLILEHLEDIPESHL
                     SVQVSGHPMEIVEIEENRIKLVRVYPKRKKGSN"
     gene            complement(247761..248555)
                     /locus_tag="PN96_01255"
     CDS             complement(247761..248555)
                     /locus_tag="PN96_01255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005446240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="ALR14666.1"
                     /translation="MDSVIAIAAAILYVLAIATIIPGLSQQSVIKAKTVFASAACALV
                     FHAWLLSDLILDGSGQNFSILNVASLISFIISLVMSVAMLKNRLWFLLPVVYSFAAIN
                     LSAAAFLPSTFIKHLENDPKLLIHISFALFSYATLSIGALYALQLAWLDHKLKTKKSL
                     AINPNLPPLLMVERQLFKIILIGNLLLTATLITGYVFVQDMFAEGKAHKAILSFIAWV
                     VYSVLLWGHYQKGWRGRKVTWFAVAGATLLTLAYFGSRFVKEIILN"
     gene            248780..250162
                     /locus_tag="PN96_01260"
     CDS             248780..250162
                     /locus_tag="PN96_01260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle"
                     /protein_id="ALR14667.1"
                     /translation="MFENLTDRLSKTLKNISGKGRLTEDNIKETLREVRMALLEADVA
                     LPVVREFVNRVKEKAVGVEVSKSLTPGQEFIKIVQGELEAVMGESNEALNLAAQPPAV
                     LLMAGLQGAGKTTSVGKLSKLLKERDKKKVLVVSADVYRPAAIKQLETLASDIGVDFF
                     PSSPDQKPIDIANAAIDHAKKKFYDVLIVDTAGRLAIDEQMMGEIKDLHSAINPVETL
                     FVVDAMTGQDAANTAKAFGDALPLTGVILTKVDGDARGGAALSVRHITGKPIKFLGVG
                     EKTDALEPFHPDRVASRILGMGDVLSLIEDLQRNVDQEKAEKLAKKFKEKKGFDLEDF
                     REQLGQMQNMGGMMGMMDKLPGMSQLPDNVKDKVDDKMFKQMEAIISSMTMKERQRPE
                     IIKGSRKKRIAAGSGVQVQDVNRLLKQFTQMQKMMKKMQKGGMKGMMRNMQGMMGGMG
                     GGGGFNPFGR"
     gene            250371..250619
                     /locus_tag="PN96_01265"
     CDS             250371..250619
                     /locus_tag="PN96_01265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017036646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="ALR14668.1"
                     /translation="MVTIRLARHGAKKRPFYQIVVADSRNAATGRFIEKVGFFNPTAK
                     GQEEGLRLDLDRVNHWVGQGASVSDRVAKLVKDAQKAA"
     gene            250650..251198
                     /gene="rimM"
                     /locus_tag="PN96_01270"
     CDS             250650..251198
                     /gene="rimM"
                     /locus_tag="PN96_01270"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LS9.1"
                     /note="Essential for efficient processing of 16S rRNA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA-processing protein RimM"
                     /protein_id="ALR14669.1"
                     /translation="MSMKGKETMSNEKIVVGKFGATYGIRGWLKVFSYTDNAESIFDY
                     SPWYINQKGTWVEYKVESWKRHNKGMVAKLEGMDVREDAHLMTNFEIAIDPAVLPELS
                     EDEFYWRELFGMQVVTTKGYDLGVVTDMLETGSNDVLVVKANLKDAFGQKERLIPFLE
                     EQVIIKVDREAQRIEVDWDPGF"
     gene            251226..251987
                     /gene="trmD"
                     /locus_tag="PN96_01275"
     CDS             251226..251987
                     /gene="trmD"
                     /locus_tag="PN96_01275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232957.1"
                     /note="methylates guanosine-37 in various tRNAs; uses
                     S-adenosyl-L-methionine to transfer methyl group to tRNA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N1)-methyltransferase"
                     /protein_id="ALR14670.1"
                     /translation="MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHD
                     KHRTVDDRPYGGGPGMLMMVQPLRDAIHTAKQASPGKTKVIYLSPQGRKLDQQGVEEL
                     ATNENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGEIPAMTLIDSVSRFIPGVL
                     GDFSSAEEDSFANGLLDCPHYTRPEVLDGKEVPAVLMSGNHKDIRQWRLKQSLGRTWL
                     RRPELLENLALTDEQEQLLAEFVNEHKAVNEQNAK"
     gene            252028..252381
                     /locus_tag="PN96_01280"
     CDS             252028..252381
                     /locus_tag="PN96_01280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017056604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="ALR14671.1"
                     /translation="MSNIIKALEEEQMKSDLPKFAPGDTVVVQVKVKEGDRERLQAFE
                     GVVIAIRNRGLHSAFTVRKISNGEGVERTFQTHSPIVDSIEVKRRGAVRRAKLYYLRE
                     RSGKSARIKEKLAKK"
     gene            complement(252706..252900)
                     /locus_tag="PN96_01285"
     CDS             complement(252706..252900)
                     /locus_tag="PN96_01285"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87LT2.1"
                     /note="inhibits supercoiling by DNA gyrase by binding to
                     the GyrB subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase inhibitor"
                     /protein_id="ALR14672.1"
                     /translation="MSKITIVQCPQCGADVEWGEQSPHRPFCSKKCQMIDFGEWADEE
                     NAIAGAPDMSDSDGWSEDQY"
     gene            complement(252974..253714)
                     /locus_tag="PN96_01290"
     CDS             complement(252974..253714)
                     /locus_tag="PN96_01290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005462563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapD"
                     /protein_id="ALR14673.1"
                     /translation="MTTHKFEHPLNEKTRIYLRVESLLRQAHLASGFAENHQYQLFFR
                     ALFDMVEIFEQLQLKSELAKDLEKQRLSYRHWLHVEGVDQEALTSLLNDIDVVHKQLM
                     RAERFGQALKDDRFLSSIRQRFNLPGGSCCFDLPALHYWLHLPLERKKQDAQKWLDSL
                     KPLSDALNLWLKLTRETGQFKAQIGRAGFFQSDADEANILRLHIPMEHGVYPMISGHK
                     NRFAIKFMSFESGQACTQDVEFELAVCS"
     gene            complement(253741..254355)
                     /gene="coaE"
                     /locus_tag="PN96_01295"
     CDS             complement(253741..254355)
                     /gene="coaE"
                     /locus_tag="PN96_01295"
                     /EC_number="2.7.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333951.1"
                     /note="catalyzes the phosphorylation of the 3'-hydroxyl
                     group of dephosphocoenzyme A to form coenzyme A; involved
                     in coenzyme A biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="ALR14674.1"
                     /translation="MTLVIGLTGGIASGKTTVANLFKQQFKIDIVDADIVAREVVEPG
                     TPGLTAIIEHFGSDIVRDDQMLDRAKLREKIFSNQDEKDWLNKLLHPIIREKMVEDLQ
                     QVTSDYALLVVPLLVENQLESLCDRVLVVDVDPETQISRTMKRDNVSEEQARAILVSQ
                     ASRQQRLDMADDVVNNNPDDQDLLLQITDLHEKYLAMCKKNLQN"
     gene            complement(254356..255225)
                     /locus_tag="PN96_01300"
     CDS             complement(254356..255225)
                     /locus_tag="PN96_01300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="ALR14675.1"
                     /translation="MEVFQYYPWLFVIFAVVFGLIVGSFLNVVIYRLPKIMELEWRRE
                     CAESFPEYNIESPKEVLTLSVPRSSCQQCGTPIRIRDNIPVISWLLLKGKCHNCSAAI
                     SARYPLVEILTAACSGYVAFHFGFSYFTIALIFFTFILIAATFIDLDTMLLPDQLTLP
                     LTWAGIALALFEVSPVSLQDAVIGAIAGYLCLWSVYWGFKLLTGKEGMGYGDFKLLAA
                     LGAWLGWQALPMIILLSSIVGVIFGIIQLRLQKKGIEKAFPFGPYLAIAGWVSLLWGD
                     QILNWYFTSILGA"
     gene            complement(255293..256516)
                     /locus_tag="PN96_01305"
     CDS             complement(255293..256516)
                     /locus_tag="PN96_01305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006743173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein F"
                     /protein_id="ALR14676.1"
                     /translation="MKTTTPQLKNFRWKGINSSGKKTSGQTLAMSEVEVRERLSAQHI
                     KIKKLKKSSISFITKLSHRVKGKDITVFTRQISTMLVTGVPLVQALKLVSNNHKKAEM
                     KSILMSVTRAVEAGTPMSKAMRTASAHFDALYTDLISTGELSGNLAEVFERLATYREK
                     SEELRAKVIKALIYPAMVMLVALGVSYLMLTQVIPEFEKMFSGFGADLPWFTRQVLDL
                     SAWMQNWGSFIALGALSLIISARILVKRSDSFRLMMDRAILRIPVLGAVLSKAAIAKF
                     SRTLATSFSAGIPILTSLKTTSKTSGNLHYQLAVEEVYRDTAAGMPMYVAMRNCDVFP
                     ELVLQMVMIGEESGRLDEMLNKVATIYEFEVDNTVDNLSKILEPLIIVFLGVVVGGLV
                     TAMYLPIFNLMSVLG"
     gene            complement(256547..258232)
                     /locus_tag="PN96_01310"
     CDS             complement(256547..258232)
                     /locus_tag="PN96_01310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein GspE"
                     /protein_id="ALR14677.1"
                     /translation="MLFNLIGTLRNANLIIQHQEESLIEQVNASGISIPEALVNSGIF
                     TSRELATHLSSIFGLPYEPLSNYDYSALCQKLGLRELITSHHALPLERTPSTLTLAIA
                     DPTNQQAEDDFRFATGLQIDLVITDFSELDAAIRRLYGRALGQERSGLKEINQEELAN
                     LVDVGADEIDNIEDLSQDQSPVSRYINQILLDAVRKGASDIHFEPYEKMYRVRLRCDG
                     ILIETQQPPSHLSRRLSARIKILSKLDIAERRMPQDGRIKLKLNQDTAIDMRVSTLPT
                     LFGEKIVLRLLDSSSASLDIDKLGYSDQQKQLYLDALRRPQGMILMTGPTGSGKTVSL
                     YTGLSILNKPEINISTAEDPVEINLSGINQVQVQPKIGFGFAEALRSFLRQDPDVVMV
                     GEIRDLDTAEIAIKAAQTGHLVLSTLHTNSAAETVIRLTNMGVESYNLASSLSLVIAQ
                     RLARKLCSHCKQPQEVTAALQHIGIQATDQIYQANPNGCNHCTHGYSGRTGIYEVMRF
                     DETLSEALIKGASVNQLEKLAIRNGMSTLQMSGIEKLKQGVTSFSELQRVLYF"
     gene            complement(258233..258691)
                     /locus_tag="PN96_01315"
     CDS             complement(258233..258691)
                     /locus_tag="PN96_01315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="ALR14678.1"
                     /translation="MKSNKQKKQQGFTLIELMIVVAVIGVLAAIAIPQYQNYVKKSAL
                     GVGLANITALKTNIEDYIATEGSFPSTTSGTKADFTRLGTVEDMGDGNVLITPTSDGS
                     LDGTVKFTFDAGVVNTQKIQLVRSGGLWICETTAASEISPKGCAAGSTIK"
     gene            complement(258958..259845)
                     /locus_tag="PN96_01320"
     CDS             complement(258958..259845)
                     /locus_tag="PN96_01320"
                     /EC_number="2.4.2.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009844077.1"
                     /note="catalyzes the formation of
                     pyridine-2,3-dicarboxylate and 5-phospho-alpha-D-ribose
                     1-diphosphate from nictinate D-ribonucleotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide pyrophosphorylase"
                     /protein_id="ALR14679.1"
                     /translation="MKNTHNSQERLEYLKQQLPLEITRSVADTLKEDLGGTVDINNDI
                     TASLIPEDAVNTATIITREHGVFCGQAWADEVFKQLGGKVTIEWYVQDGDKVEPNQTL
                     CTLSGPARDLLTGERNAMNFIQTLSGCATTTSVYAEKIAHTECRLLDTRKTIPGLRSA
                     LKYAVACGGGFNHRIGVFDAYLIKENHIIACGGITQAITTAKELNPGKPVEVETESLD
                     ELKEAIEAGADIIMLDNFTKEMMREAVEINAGRAALENSGNITLDTIAEYAETGVDYI
                     SVGALTKHLKAMDLSMRFK"
     gene            259938..260483
                     /locus_tag="PN96_01325"
     CDS             259938..260483
                     /locus_tag="PN96_01325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
                     /protein_id="ALR14680.1"
                     /translation="MPPIIENGWLTQAKHVPSPFFDARSDSTDISLLVVHNISLPPGQ
                     FGGPYIEDFFCGKLDPKVHPFFEVIHKMGVSAHCLIKRNGEIVQFVSFLDRAWHAGQS
                     SFAGRAGCNDYSIGVELEGTEFVAYTDEQYQSLAGLSQAIMSQYPNITPQRITGHQYI
                     APLRKSDPGLSFDWVKYRRLI"
     gene            260893..261660
                     /gene="pdhR"
                     /locus_tag="PN96_01330"
     CDS             260893..261660
                     /gene="pdhR"
                     /locus_tag="PN96_01330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005462576.1"
                     /note="activates lctPRD operon; autoregulates itself
                     through repression of pdhR-aceEF-lpdA operon; regulates
                     pyruvate dehydrogenase complex; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator PdhR"
                     /protein_id="ALR14681.1"
                     /translation="MAYQRIRQPKLSDVIEQELERLIVEGTLSPGQQLPPERELAKQF
                     DVSRPSIREAIQRLEAKRLLTRRQGGGTFVSENIWKSFSDPLLNLLSSHSETQLDLLE
                     TRHAMEGIAAYFAAVRGTEEDFARIQACLERISQAQSNDDVAAESAEVMQFLIALTEA
                     AHNVVLLHIVRSLAPLLEQNILQNFKLLHRRPEAVEKVSKHRANIVDAIVSGQPEKAR
                     EMSHSHLAYIEETLLDLTREESRRERSLRRMQQGNDS"
     gene            261710..264370
                     /gene="aceE"
                     /locus_tag="PN96_01335"
     CDS             261710..264370
                     /gene="aceE"
                     /locus_tag="PN96_01335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007464445.1"
                     /note="E1 component; part of pyruvate dehydrogenase; forms
                     a complex with DlaT and LpdC; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase"
                     /protein_id="ALR14682.1"
                     /translation="MSDMKHDVDALETQEWLQALESVVREEGVERAQFLLEQVLDKAR
                     LDGVDMPTGITTNYINTIPADQEPAYPGDTTLERRIRSIIRWNAIMIVLRASKKDLEL
                     GGHMASFQSSAAFYETCFNHFFRAPNEKDGGDLVYYQGHISPGIYSRAFVEGRLTEEQ
                     LDNFRQEVDGKGIPSYPHPKLMPEFWQFPTVSMGLGPISAIYQARFLKYLEGRGMKDT
                     SEQRVYAFLGDGEMDEPESRGAISFAAREKLDNLCFLINCNLQRLDGPVMGNGKIIQE
                     LEGLFKGAGWNVVKVIWGNNWDSLLAKDTTGKLLQLMNETIDGDYQTFKAKDGAYVRE
                     HFFGKYPETAALVADMTDDEIFALKRGGHESSKLYAAYKNAADTKGRPTVILAKTVKG
                     YGMGEAAEGKNIAHQVKKMDMTHVLHLRDRLGLQDLLTDEAVKELPYLKLEEGSKEYE
                     YLHARRKALHGYTPQRLPNFTQELIVPELEEFKPLLEEQKRDISSTMAFVRSLNVLLK
                     NKNIGKNIVPIIADEARTFGMEGLFRQIGIYNPHGQTYTPEDRGVVSYYKEATSGQVL
                     QEGINELGAMSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFL
                     LGATAGRTTLNGEGLQHEDGHSHIMAGTVPNCISYDPTFAYEVAVIMQDGIRRMYGEQ
                     ENVFYYLTLMNENYAMPAMPEGAEEGIRKGIYKLETYTGSKGKVQLMSSGTIMNEVRK
                     AAQILSDEYGVASDVYSVTSFNEVTRDGQAAERYNMLHPEAEAQVPYIQTVMGTEPAI
                     AATDYMKNYAEQVRAFIPAESFKVLGTDGFGRSDSRENLRRHFEVNAGYVVVAALTEL
                     AKRGEVEKSVIAEAIKKFDIDTEKTNPLYA"
     gene            264390..266279
                     /gene="aceF"
                     /locus_tag="PN96_01340"
     CDS             264390..266279
                     /gene="aceF"
                     /locus_tag="PN96_01340"
                     /EC_number="2.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333942.1"
                     /note="E2 component of pyruvate dehydrogenase multienzyme
                     complex; in Escherichia coli AceF contains three
                     N-terminal lipoyl domains; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase"
                     /protein_id="ALR14683.1"
                     /translation="MAIEINVPDIGTDEVEVTEILVSVGDKVEEEQSLITVEGDKASM
                     EVPASQAGIVKEIKVAEGDKVSTGSLIMIFEAEGAAEAAPAPAAEAAPAAAPAPAAAA
                     ELKEVHVPDIGGDEVEVTEIMVAIGDSIEEEQSLITVEGDKASMEVPAPFAGTLKEIK
                     VAAGDKVSTGSLIMVFEVAGSGAPAAAPAAVEAPAAAAPAASAAKEVNVPDIGGDEVE
                     VTEIMVAVGDTVEEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMVF
                     EVAGAAPAPAAAPAQAAAPAAAAPKAEAPAAAAPAATGDFKENDEYAHASPVVRRLAR
                     EFGVNLSKVKGSGRKSRILKEDVQNYVKEALKRLESGAAASGKGDGAALGLLPWPKVD
                     FSKFGETEVQPLSRIKKISGANLHRNWVMIPHVTQWDNADITALEAFRKEQNAIEAKK
                     DTGMKITPLVFIMKAVAKALEAFPAFNSSLSEDGESLILKKYVNVGIAVDTPNGLVVP
                     VFKDVNKKGIYELSEELMAVSKKARAGKLTAADMQGGCFTISSLGGIGGTAFTPIVNA
                     PEVGILGVSKSEMKPVWNGKEFEPRLQLPLSLSYDHRVIDGAEGARFITYLNSCLSDI
                     RRLVL"
     gene            266546..267973
                     /locus_tag="PN96_01345"
     CDS             266546..267973
                     /locus_tag="PN96_01345"
                     /EC_number="1.8.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O50286.2"
                     /note="E3 component of pyruvate and 2-oxoglutarate
                     dehydrogenase complex; catalyzes the oxidation of
                     dihydrolipoamide to lipoamide; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="ALR14684.1"
                     /translation="MSKEIKAQVVVLGSGPAGYSAAFRCADLGLETVLVERYSTLGGV
                     CLNVGCIPSKALLHVSKVIEEAKAMADHGVVFGEPQTDINKIRIWKEKVVNQLTGGLG
                     GMAKMRNVTVVNGYGKFTGPNSILVEGEGESTVVNFDNAIVAAGSRPIKLPFIPHEDP
                     RIWDSTDALELKEVPEKLLIMGGGIIGLEMGTVYHSLGSKVEVVEMFDQVIPAADKDI
                     VKVYTKRIKDKFKLMLETKVTAVEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPN
                     GKLIDGEKAGLEIDERGFINVDKQMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEV
                     ISGKKHYFDPKVIPSIAYTEPEVAWVGKTEKEAKDEGIKYEVATFPWAASGRAIASDC
                     SDGMTKLIFDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHE
                     SVGLAAEVFEGSITDLPNKKAVKKK"
     gene            complement(268098..268712)
                     /locus_tag="PN96_01350"
     CDS             complement(268098..268712)
                     /locus_tag="PN96_01350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="ALR14685.1"
                     /translation="MDSIAKRARTRLSPIKRKQQLMEIALEVFARRGIGRGGHADIAE
                     IAQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHARDNIANITSAMIE
                     LVNQDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLVQNMFIKAIERGEICNTHQPE
                     HLTNLFHGICYSLFVQANRFKGEDELKNLVSSYLDMLCIYDRNQ"
     gene            269030..269560
                     /locus_tag="PN96_01355"
     CDS             269030..269560
                     /locus_tag="PN96_01355"
                     /EC_number="2.4.2.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005386603.1"
                     /note="catalyzes the formation of inosine monophosphate
                     from hypoxanthine and 5-phospho-alpha-D-ribose
                     1-diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="ALR14686.1"
                     /translation="MKHTVEVMISEEVVQDRVREIGKQITERYQGSEDLVLVGLLRGS
                     FVFMADLARAIDLTHQVDFMTASSYGNTMESSRDVRILKDLDDDIKGKDVLLVEDIID
                     TGNTLNKIREILSLREPKSIAICTLLDKPSRREVNVPVDWIGFEIPDEFVVGVGIDYA
                     QKYRHLPFIGKVVPQE"
     gene            complement(269649..270317)
                     /locus_tag="PN96_01360"
     CDS             complement(269649..270317)
                     /locus_tag="PN96_01360"
                     /EC_number="4.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005396710.1"
                     /note="catalyzes the interconversion of bicarbonate and
                     carbon dioxide; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="ALR14687.1"
                     /translation="MPEIKQLFENNSKWSEEIKSDRPEYFAKLAEGQKPDFLWIGCSD
                     SRVPAERLTGLYSGELFVHRNVANQVIHTDLNCLSVVQYAVDVLKVKHIIVCGHYGCG
                     GVNAAIDNPQLGLINNWLLHIRDIYFKHRTYLDQMPLEDRADKLGELNVAEQVYNLGN
                     STIMQNAWERGQDVEIHGFVYGIEDGRLEYLGIRSNSKETVEESYKTALSTILNSENK
                     LLCR"
     gene            270597..272267
                     /locus_tag="PN96_01365"
     CDS             270597..272267
                     /locus_tag="PN96_01365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Bicarbonate transporter BicA"
                     /protein_id="ALR17175.1"
                     /translation="MFGNRFEDINFKGDIFGGVTTAIISLPLALAFGVASGAGAEAGL
                     WGAIMVGLFASLFGGSNTLISEPTGPMTVIMTAVLTSMMVKYPETGMAMTFTVVMMAG
                     AFQILLGTLKLGKYVTLMPYSVISGFMSGIGVILIILQLSPLLGHAAPSGGVLGTLSA
                     LPETISNLKFSELFLGLLTLGILFFFPKQYRKYVPAQLVALVAVTLLSVMLFDTDDIR
                     RIGEIPAGLPSLVAPHINPDMFVEMVIDALVLGTLGCIDTLLTAVIGDSLTRKEHDSD
                     KELRGQGLANMISGLFGALPGAGATMGTVTNIQVGARSPLSGVVRALMLALVVLVAGG
                     LTEPIPMAVLAGIAVYVGFNILDWSFIQRAHKVSFSGMAVMYGVMLLTVFVDLIVAVG
                     LGVFISNIIIIERLSREQARQVKAISDADEDDVPLTDSERGLLDRANGTVLFFYLSGP
                     MIFSVSKAISRQHSSIADYEVMILDLTDVPMIDVTVGLALENAIKDALDANCEVYLLC
                     PNQRTREQLEKFHVIDLVPAANIYRFRYEALNAAVAHVEEAQYQRITA"
     gene            272574..273485
                     /locus_tag="PN96_01370"
     CDS             272574..273485
                     /locus_tag="PN96_01370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="ALR17176.1"
                     /translation="MYALEIEQLRKTYAGGFEALKGISLQVKQGDFYALLGPNGAGKS
                     TTIGIIASLVNKTSGTTKVFGYDIDTDLELAKQNLGLVPQEFNFNQFESVEQIVIQQA
                     GYYGVPKAVAKERAQKYLTQLDLWDKRSEAARNLSGGMKRRLMIARALMHEPKLLILD
                     EPTAGVDIELRRSMWEFLKKINAQGITIILTTHYLEEAEMLCRNIGIINRGELIENTT
                     MKGLLSKLQVETFVLDVENESCLQPLDGVISQTLREGSLEIELEKSEGLNHVFTQLTE
                     QGVRVLSMRNKANRLEELFVRIVREQS"
     gene            273495..274265
                     /locus_tag="PN96_01375"
     CDS             273495..274265
                     /locus_tag="PN96_01375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="ALR14688.1"
                     /translation="MYHIYWTAFVSLLGKEINRFTRIWVQTLVPPVITMCLYFIIFGN
                     LIGSRIGQMNGFSYMEYIVPGLIMMSVITNSYSNVASSFFSAKMQKNIEELLVAPVPN
                     YVIIAGYVMGGVTRGLLVGTFVTFVSLFFVDLNVDHWGIIFLTVFMTSVVFALGGLIN
                     AVFAKTFDDISIVPTFVLTPLTYLGGVFYSISLLPEFWQGVSKINPIVYMVNAFRYGF
                     LGVSDVGIVTSFSVLGVFVVLLYAVAHYLVTKGKGLRT"
     gene            complement(274334..275236)
                     /gene="panC"
                     /locus_tag="PN96_01380"
     CDS             complement(274334..275236)
                     /gene="panC"
                     /locus_tag="PN96_01380"
                     /EC_number="6.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333938.1"
                     /note="catalyzes the formation of (R)-pantothenate from
                     pantoate and beta-alanine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="ALR14689.1"
                     /translation="MQTFAEISAVREQVKTYKREGRKIAFVPTMGNLHDGHLTLVRKA
                     REYADVVVVSIFVNPMQFERADDLSNYPRTLDEDLSKLSAEGVELVFTPTPEIIYPEG
                     LDKQTFVDVPGLSTTLEGASRPGHFRGVTTIVNKLFNIVQPDLACFGEKDFQQLAVIR
                     KMVDDLAMDIEIVGVPTVREMDGLAMSSRNGLLTLDQRQRAPVLARTMRWISSAMRGG
                     RDDYASIIEDASDQLRAAGLHPDEIFIRDARTLDVITADTTQAVILMSAFLGNVRLID
                     NQTVDMVIDAKDNSESSDGKSNDA"
     gene            complement(275248..276042)
                     /locus_tag="PN96_01385"
     CDS             complement(275248..276042)
                     /locus_tag="PN96_01385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005428654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="ALR14690.1"
                     /translation="MKKMTINDLIKCKQEGRKFATSTAYDASFAQLFESQEMPVLLVG
                     DSLGMVLQGENDTLPVTVEDIVYHTRCVRAGSPNCLLMSDMPFMSYATPEQACENAAK
                     IMRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLTPQSVNIFGGYKVQGREQENA
                     DRMVKDALALQEAGAQIILLECVPAALAERITQLLDVPVIGIGAGNATDGQILVMHDM
                     FGISANYMPKFSKNFLAETGDMRKAVAKYMEDVANGVFPDDAHTIA"
     gene            complement(276067..276552)
                     /locus_tag="PN96_01390"
     CDS             complement(276067..276552)
                     /locus_tag="PN96_01390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="ALR14691.1"
                     /translation="MITAYIAVGSNLADPVSQAKQAIEALKTLPESKFVKASQLYSST
                     PMGPQNQPDYINAVVAIQTNLTPLQLLDCTQAIEQEQGRVRKDERWGPRTLDLDIVLY
                     GNEVINSERLTIPHYGMKEREFVLYPLAEIAPSLQLPDGTEVSSLLNQVDRNGLNIWQ
                     S"
     gene            complement(276549..277913)
                     /locus_tag="PN96_01395"
     CDS             complement(276549..277913)
                     /locus_tag="PN96_01395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="poly(A) polymerase"
                     /protein_id="ALR14692.1"
                     /translation="MHMNTNDYTPSEPATIPELALNVITREEHNISRKQISDNALKVL
                     YRLNGAGFDAFLVGGGVRDLLLGQRPKDFDIATNATPEQIKQLFRNCRLIGRRFRLAH
                     IMFGRDIIEVATFRGHHQEQKNKSISQQSKEGMLLRDNVYGTIDEDAERRDFTINSMY
                     YNIADYSIHDYARGIEDLEDRLIRLIGDPETRYREDPVRMLRAIRFAVKLDFDIEEDT
                     AAPIEEMSTLLRDIPSARLFEESLKLLQSGQGLETYHLLREYNLFQQLFPTISEHFTE
                     DYSSHTEQMLDLVLDSTDMRIEEGKRINPAFMFAAMLWYPLCAVAEKLMEQRHLGYYD
                     AIMEASNIILDEQVRTIAIPRRHTATIREIWQLQLRLPRRNGKRASRLMELNKFRAGY
                     DFLEMRGEIEGGETEKLAKWWETFQNASREMRQAMAGDLDDQAPKGQRRRKTYRKKKS
                     KPKS"
     gene            complement(278014..278877)
                     /locus_tag="PN96_01400"
     CDS             complement(278014..278877)
                     /locus_tag="PN96_01400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="ALR14693.1"
                     /translation="MTSYVGRFAPSPSGPLHFGSLVAALGSYFQAKANHGAWLVRIED
                     LDPPREMPGATQAILEALQAYQLHWDGEVVYQSQRHHLYQAQIDTWLENGDAYYCQCT
                     RKQIKQHGGFYPGTCRDKNLKEGAIRLKMTKPIASFFDLKHGTIQIPEQLVNEDFIIK
                     RRDGLFAYNLAVVLDDIDQGVTEVVRGADLIEPTGRQISLYQILGQPEVSYLHLPLAI
                     DNNGNKLSKQNHATAIDIDNPKPALLKAMTFLGFDIPEEIRASDITNILRWGSENWQL
                     EQLPTEIEITA"
     gene            complement(278954..279400)
                     /gene="dksA"
                     /locus_tag="PN96_01405"
     CDS             complement(278954..279400)
                     /gene="dksA"
                     /locus_tag="PN96_01405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004729038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-binding transcription factor"
                     /protein_id="ALR14694.1"
                     /translation="MPESKKKTIGILAIAGVEPYQEKPGEEYMSPEQVEHFTKILTAW
                     RDQLRSEVDRTVHHMQDEAANFPDPVDRASQEEEFSLELRNRDRERRLIKKIEKTLDK
                     IEEDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIKEKQMQG"
     gene            complement(279525..280253)
                     /locus_tag="PN96_01410"
     CDS             complement(279525..280253)
                     /locus_tag="PN96_01410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ALR14695.1"
                     /translation="MHFEPALESATLLKRYKRFLADIELDNGEIRTIHCANTGAMTGC
                     ATPGNKVWYSTSDNPKRKYPNSWELSETKLGHRICINTARANQLAVEAIENNVISELC
                     GYDTLQTEVKYGNENSRIDILLSASDKPKCYIEVKSVTLLDETHSDGQGYFPDAVTTR
                     GQKHLRELTEMAQNGSRAILLFTVLHSGIEKVSAAHHIDAKYSQLLKQAQDAGVEVLC
                     YKAELSSTDISLISAVDFINLEKK"
     gene            280321..282789
                     /locus_tag="PN96_01415"
     CDS             280321..282789
                     /locus_tag="PN96_01415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333933.1"
                     /note="similar in sequence to the ATP-dependent RNA
                     helicase HrpA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpB"
                     /protein_id="ALR17177.1"
                     /translation="MSQLPIEAVMPQLLAAVKNQHQVILKAAPGAGKSTYFPLQLIKH
                     QLVTGKIIMLEPRRLAARNIARYLSEQLGEQVGQSVGYRVRGETKVSAATQLEIVTEG
                     IMTRMIQNDPELDGVDLLIFDEFHERSIHADTALAFSLEVQEALRDDLKLVVMSATLD
                     QDALQVLLPEASFIESEGRSFDVETRYVPLAANDHLPVVMAKTIESLMNKESGSLLAF
                     LPGVAAIKQVEERLSHLPTEVEVCPLYGQLSFAEQQKAISPAVKGKRKVVLATNIAET
                     SLTIEGIRLVVDSGLERIARFDLKNGLTRLEQVRIAQSSAIQRLGRAGRIEEGICVRL
                     YSESQFKQQPTVPQPEILHSDLASLVMELAFWGASDIQDLKWLNIPSQAALSQAKQLL
                     VSLGLLTEQGQLTANGRQAHELGVEPRAAAMLIKSSQHSEKMLNTALAAVALIEEPER
                     NVTNIAHSLHRWVTGTHPKRSLLLKRAQSLSHKLDGAFSVADVDESALPLVLSLAFPD
                     RIAQQRSNQYGRFTLSNGHGAECRPDDTLGASEYLVAVDLMRSHSNSSQIHLACELDV
                     NLLQTTFKSLFSSEELVDWDEKRGRLIAQRQQKLGQLVIESESLPSPGKEKMTQALLT
                     YVRRQGLSSLNWSPTAESLIERIRCAIDWLPEQPWPSFDNESLLESLEEWLEPYMASV
                     SSVKDLNKVNLTEALNARLGWPLNQNIDEWLPEHYQLPTGTKKCIRYQYGHEPVLSVR
                     MQEVFGESTSPTVALGRKPLVLELLSPAQRPLQVTTDLAAFWKGSYKDVQKEMKGRYP
                     KHVWPDDPASHVATTKTKRQLNND"
     gene            282782..285154
                     /locus_tag="PN96_01420"
     CDS             282782..285154
                     /locus_tag="PN96_01420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="ALR14696.1"
                     /translation="MTDTKKPSTKKAPAKKKTAAKSTATRNKRSPGKKPDNGKRSWLK
                     TLWSFGWKAGVALAAVLLFVGIYLDSVVKERFDGQLFELPTVVYARILNLSPGENITI
                     KELRNELDVLNYRKVSTPRYPGEYSSSSTRIELIRRPFEFADGPEPDRHVMLHFSDGG
                     LQRIQSLESKGDLGYLRLEPKMLGMLEKDQDEQRLFLRRDQFPEILVDALLATEDRNF
                     YQHDGVSPLAIGRALVANIKAGRTVQGGSTLTQQLAKNLFLTRDKTLWRKLREAYIAL
                     ILDYRYSKDRILEAYLNEVYLGQSGGEAIHGFGLASRYYFGQPISELRVDQLAMLVGM
                     VKGPSYYNPIRYPERTKDRRDLVLRLLMQQNLLTAQEYDQAASRPLDTQSNPRIASRQ
                     PAYFQQLNIELKEKVGERFKAETGLRVFTSLDPVSQSKMEKAIAKKIPELAKRGGKDL
                     EAAAVAVDRHSGEIRAMVGGKRAGYDGFNRALNASRPIGSLVKPAIYLTALEQPEKYN
                     LGTTLHDTPLSLKGSEGTVWTPRNYDRKYRGDVPLYLALAKSLNVPTVRLGMELGIPE
                     VTNTLERLGVSKNEIRPVPSMFLGAFSLTPLEVAQMYQTLTNSGKRARLTALRSVIDM
                     EGNVLYQSLPRSSREVDEQAAWLTTYAMKQGVAQGTGRYLQNQFSWAALAGKTGTSND
                     TRDSWFVGVDGREVTTIWLGRDDNKPTNLTGASGALRVYAEYLSQRIPERLALPWPRE
                     VTTLGFKQTAEGGLEMNCRSEYKLPVWDKTGLVKQQCEKKSNWINDLFNW"
     gene            285292..287610
                     /locus_tag="PN96_01425"
     CDS             285292..287610
                     /locus_tag="PN96_01425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="ALR14697.1"
                     /translation="MFKKLSCSPLTRHFALWVSFFLIAAPSVGRAQEETSASRPKIAV
                     VLAGGGAKGAAHIGVLKALEEMNIPVDIITGTSMGAYVGGLYATGMSADEIESFIYTV
                     DWNGGYRDRVDRSQRRVRDKEYEDRYQIYTDLGLRLTEVRAPTGVVLGQNMLRILRES
                     TGNLGRFDSFDELAIPYRSVATDILELEEVVIGNGYLVDAMMASMSVPGALPPYQLNG
                     HMLVDGGVVNNMPVDVARAMGADVVIAVDISTDYKTKEDFTGLFTVADQLSNYLVRRS
                     TQEQVEALQEQDIYIRPNVGQMETVEFDKMPSAFQSGYEITKTLAPKLEGLSLSSADY
                     QRYIDHKQEARKTLVHGDERVVDEVVIINNTHYSDVLLTNRLHLETGRKIPTQEIEKA
                     VENLYALDRFELITYQFEEEEGVTQLVFNVNEKSWGPNYLNFRFFLEDDFDTDSQYGI
                     GLSTNFTNLNSHGAELAFNVEMGTDKLIEAELYSPVMSSQQLFVSGRLTYSNESRNLP
                     LSDFQNPDIGAVDDFLPVSYSDFTSELSIGLQPTLWQELRLGARYSTGSIELSTLASA
                     GNLDFDRLGAFASYRLDTLDDFAFPTRGLLVDLEYFVSHDKSPEGDNFLESESSVEDT
                     VYEISARFKGAVSHQRHTLVGHAEYSFVESKNSTIPLDPRELGGFLNLSGIPRNSLIG
                     QDLFFSSLVYRYKWFDNDFGLFEAPVYIGASLEYGGVWSDNDLHLDEAPLYNAGSVFF
                     GVDSPIGPIMLAYGRTEQNLEAVYLIVGTSFN"
     gene            287878..290475
                     /locus_tag="PN96_01430"
     CDS             287878..290475
                     /locus_tag="PN96_01430"
                     /EC_number="4.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017447693.1"
                     /note="catalyzes the conversion of citrate to isocitrate
                     and the conversion of 2-methylaconitate to
                     2-methylisocitrate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aconitate hydratase
                     2/2-methylisocitrate dehydratase"
                     /protein_id="ALR14698.1"
                     /translation="MLEAYRKHVEERAAEGVVPKPLDAEQVAGLVELLKNPPQGEEEV
                     LLDLLENRIPPGVDEAAYVKAGFLTAVAKGEVSSPLVSREKAAQLLGTMQGGYNIEPL
                     VDLLEDDALAPIAAKALSHTLLMFDAFYDVEEKAKAGNAHAQQVLQSWADAEWFQSKP
                     ALQEKITLTVFKVTGETNTDDLSPAPDAWSRPDIPVHALAMLKNEREGINPDQPGSIG
                     PIKQIEELQSKGHQLVYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRAGGYVLGG
                     KIAPIFFNTMEDAGALPIEVDVSKLNMGDVIDVYPFEGKVCNHETGETLAEFKLKTDV
                     LIDEVRAGGRIPLIIGRGLTDKARQSLGLAPADFFRKPGDVADTGKGYSLAQKMVGKA
                     CGVEGVRPGTYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTSAYPK
                     PVDVNTHHTLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPLGISF
                     PAGSGLVAFAAATGVMPLDMPESILVRFKGEMQPGITLRDLVHAIPYYGIKQGLLTVE
                     KAGKINEFSGRVLEIEGVEHLTVEQAFELSDASAERSAAGCTVKLSQESIEEYLNSNI
                     TMLKWMISEGYGDRRTIERRITAMQEWLDNPELMEADADAEYAHVIEIDLAEINEPIL
                     CAPNDPDDARLLSEVQGTQIDEVFIGSCMTNIGHFRAAGKLLEQWGGQLDTRLWVAPP
                     TKMDRDQLTEEGYYGIYGRAGVRIETPGCSLCMGNQARVADKATVMSTSTRNFPNRLG
                     TGANVYLSSAELAAVGAILGRIPTKEEYLEYAAKINATAADTYRYLNFHKMDQYTKKA
                     DTVIFQEPA"
     gene            complement(290553..291686)
                     /locus_tag="PN96_01435"
     CDS             complement(290553..291686)
                     /locus_tag="PN96_01435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="ALR14699.1"
                     /translation="MKIVIAPDSYKESLSAMEVAIAIEQGFKHVLPNAEYIKLPMADG
                     GEGTVQSLVDATGGEIVEHSVTGPLGEPVSGFYGLLGDGKTAIIEMAAASGLHLVDPD
                     KRNPMITTTFGTGELIKAVLDKGVEHIIVGIGGSATNDGGLGMAQALGIRLLDENHEP
                     LGFGGGELSKLHRINMRGLDPRLAQVRLEVACDVDNPLCGPQGASQVFGPQKGATPDM
                     VEQLDRNLAHYASVIKAQLGQDVLTRPGAGAAGGLGAALMGLLNAELRPGIEIVMDAV
                     NLDEIVEGADLVITGEGRIDSQTIHGKTPIGVARVANKHFVPVIGIAGSLSHDCGVVH
                     KHGIDAVFSIVNRSVDLPTAFAEAAQNIELTARNVAAMLQLKL"
     gene            complement(291704..292969)
                     /locus_tag="PN96_01440"
     CDS             complement(291704..292969)
                     /locus_tag="PN96_01440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011079576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate:proton symporter"
                     /protein_id="ALR14700.1"
                     /translation="MIEVSTLGALAALIVAISLILKKVPPAYGMIIGALIGGVVGGVS
                     LTDTVSLMIGGAQGIVTAVLRILAAGVLAGVLIESGAATSIAETIVKKVGETRALLAL
                     ALATLILTSVGVFVDVAVITVSPIALAIAQRACISKTAILLAMVGGGKAGNVMSPNPN
                     AIAAADAFDVPLTSVMLAGVVPGLFGLALAYFLAKRLSNKGSMVQASEVVSVDRKKLP
                     TFGAAIVAPLVAIALLALRPIAGINVDPLIALPLGGLIGTVVMGRFNDTNHFAVSGLT
                     RMAPVAVMLLGTGTLAGIIANSGLKGGLIEVLTASGLPSYLLAPISGAMMSLATASTT
                     AGTAVAASVFSHTILELGVPALAGAAMIHSGATVLDHMPHGSFFHATGGALNMDIRER
                     LKLIPYESAVGLMIAFVSTMMFGVFGLFV"
     gene            complement(293072..294247)
                     /locus_tag="PN96_01445"
     CDS             complement(293072..294247)
                     /locus_tag="PN96_01445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="ALR14701.1"
                     /translation="MQLNENIARQIVERTMTIISHSVNVMDEKGRIIGSGDSTRLQQK
                     HEGAVLAINERRIVEINQAAVNNLKGVKPGINLPIIYRNQVIGAIGISGAPEEVHHYG
                     ELVKMTAELIIEQAALMSQIEWNKRHREELVLQLIQGSTLNDNQLTSIAERLDLDLSQ
                     PRIAAVVKVIPSNDKPMLLEHLQQLVHLLEYPERDNLVGIISVSELEVVVLKPITLTV
                     NGWSKENEIKSANQLLRRVKTQGKFKIRITLGDYFPSLQGLAQSYQTAKRTMELTQNQ
                     PGQLFFCQDYRIPVLLSAVKNEPWQLQQLCQPYKLLQLSDSKGTLIKTLKVYFEQNCD
                     AHQTCCTLHIHRNTLRYRLDKISQITSLDINSLDSIIQLYLGSSFSHLENEKYADAQ"
     gene            294367..294735
                     /locus_tag="PN96_01450"
     CDS             294367..294735
                     /locus_tag="PN96_01450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14702.1"
                     /translation="MDYEFKKNTLDGSYYCHCSMEHEIIGRWLQEEIGKERHHIAEVD
                     ALISSAISKPTQEYSLLGREISLMICGDEVTVQDNALLHHYEQDKDSEFELYDCESTA
                     SCGLEDFMTLIEQWKEFLNI"
     gene            294925..295263
                     /locus_tag="PN96_01455"
     CDS             294925..295263
                     /locus_tag="PN96_01455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017026289.1"
                     /note="indirectly regulates nitrogen metabolism; at high
                     nitrogen levels P-II prevents the phosphorylation of NR-I,
                     the transcriptional activator of the glutamine synthetase
                     gene (glnA); at low nitrogen levels P-II is uridylylated
                     to form PII-UMP and interacts with an adenylyltransferase
                     (GlnE) that activates GlnA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II 1"
                     /protein_id="ALR14703.1"
                     /translation="MKIINAIIKPFKLDDVREALADVGIEGMTVSEVKGFGRQKGHTE
                     LYRGAEYQVDFLPKVKIEIATHADNVDRVVEAITKAAQTGKIGDGKIFVYDLNQAVRI
                     RTGEMDAEAL"
     gene            295292..296521
                     /locus_tag="PN96_01460"
     CDS             295292..296521
                     /locus_tag="PN96_01460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="ALR14704.1"
                     /translation="MELATTVTELRYALDTFFFLISGALVMWMAAGFAMLEAGLVRSK
                     NTTEILTKNFCLYAIACTTYLVVGYNIMYVDNGEGGWLPSLGALIGSQGEGADHSLES
                     DFFFQVVFVATAMSVVSGAVAERMKLWSFLIFSAILTAFIYPMEGYWTWGGGFLSEAG
                     FSDFAGSGIVHMAGASAALAGVLLLGARKGKYGKNGEIHPIPGSNMPLATLGTFILWF
                     GWFGFNGGSQLMVSDFENATAVGQIFLNTNAAAAAGSIAALFVCKTTWGKADLTMILN
                     GALAGLVAITADPLSPSPLYAVAIGAVAGAIVVFSIIGLDKLKIDDPVGAISVHGVCG
                     FFGLMVVPLSNGDATFGAQLLGAAVIFAWVFGASLVVWAILKATVGIRVSEEEEMEGM
                     DMHDCGVGAYPEFVTAK"
     gene            296676..297689
                     /locus_tag="PN96_01465"
     CDS             296676..297689
                     /locus_tag="PN96_01465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004742635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="ALR14705.1"
                     /translation="MKKVLTLSALACATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFT
                     KETGIKVNVKFAKTGIAEKLVQEGEYSPADVLLTVDIARLAELTQKGVVQPVDSPVLE
                     KNIPAQYQDSANEWFALTTRTRSVYSSRDRVGKLGKDFTYADLAKPEFKGKICTRSGK
                     HPYNVSLVSSMIAHQGEAATKEWLEGVKANLARKPQGNDRGQVKAIKEGLCDVSLGNS
                     YYLGKMVNDKEQKAWADSVYINFPNQETTGTHVNISGMAMAKYAPNKENALKLMEFLA
                     GDKAQSMYAEVNFEYPVKADVKPSELVASWGEFKADTLSLDEIADHHEAAIKLLDEVK
                     FDL"
     gene            297881..299506
                     /locus_tag="PN96_01470"
     CDS             297881..299506
                     /locus_tag="PN96_01470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="ALR14706.1"
                     /translation="MKEKNYIWKTSSGALALLLVLPILAIFYTAVGDTDELFAHLMAT
                     VMPTYIYNTITLTIGVMVLSLVFGIPCAWFMAMCKLPTEKWLQWALVLPLAMPGYIIG
                     YIFTDWFDFAGPIQIFLRDLTGWGPKEYWFPDIRTLSGATFVLALVLYPYIYLLCRAA
                     FMEQNVSLLQSARLLKCSPWESFRRISLPLARPSMAVGLSLVAMETIGDFGTVSYFAV
                     NTLTTAVYDTWLGYSNLNAAAKISAIMLVIVVLLLSTERYSRRKQKLFQSQFNSHEDF
                     RYELKGWKKWAALIWCWGLVLIAFILPLMQLVDYSITYFAQSWTPQFREYAWNSLVVS
                     VIAAIIGVVVALVVNFTYRVNGKRTTLTFIRLSSMGYAVPGTVLAIGVMVAVLFMDHR
                     INDVAKAMEWGRPGLIFSGSMFAIIFAMVVRFSAVAIGSIESNLNKISPSLDMASRTM
                     GCTPNSMLWRVHFPLVKRGALIVALLVFIESMKELNAALLLRPFNFETLATYVYNFAS
                     DEHLELAALPAVLLVFVGLIPLVVVNRSLEQNH"
     gene            299506..300537
                     /locus_tag="PN96_01475"
     CDS             299506..300537
                     /locus_tag="PN96_01475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010649786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="ALR14707.1"
                     /translation="MSCALSIKNLTCHYDDQTVLESLSLEVEQGQIVCLLGASGCGKT
                     TLLKAVAGLLPLSSGQMSLNSLIIDDGENWLPPEQRNIGMIFQDYALFPHLTVAENIA
                     FGLKNETAQQKLLKVEEMLGLVHLKGYGDRYPHQLSGGQQQRVAIARSLAYKPDLLLL
                     DEPFSNIDTQVRHELIREIRKIFKQQGVTAIFVTHSREEAFAFSDKMAVMNNGIIEQY
                     GTASELYYQPSSKFVADFLGGGSYLAATRVSQGEFETHLGVIEASAQQDIQLQEECAL
                     LLRPQHVQVQADEESAVKVLEQHFMGDHCRYVIDVNGDRLLATSVQALNVGDSVAVKI
                     DTQGVLAFA"
     gene            complement(300643..302055)
                     /locus_tag="PN96_01480"
     CDS             complement(300643..302055)
                     /locus_tag="PN96_01480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005494030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomutase"
                     /protein_id="ALR14708.1"
                     /translation="MIKFGTGGWRAFIGEEFTKENVRLVAQAVANITNAESVAERGFV
                     IGYDRRFLSDKAGRWFAEVLAANGIVVSFIDKFVPTPIVMFKAKEMNCAYSACITASH
                     NPADYNGIKVFIEGGRDADEIITQKIEDQIATLTASDVKSVDFEQAIDDHLIEVINPM
                     NEFVDSIINFIDIEAIKKANLRVLVDPMFGVAKNALQTVLINGRCDVDVINDGKNPDF
                     GGLMPSPSAATLYRLMHLVEEQGYDIGIGTDGDADRLGIIDEKGNFIHPNEVLILLYY
                     YLLEYKDWKGSVVRNIATTHLLDKIAQDHGEKCFEVPVGFKHISSQMEADDSLIGGES
                     SGGLTIRGHIKGKDGVFASSLLVEMISVTGKKLSELLDEIYSKYGYAYMAEGDCKFKP
                     GQKEALFNKIYVDKQLPEFKFEIEKVSYEDGAKVYFKNGGWIIARFSGTEPLLRIFAE
                     MEDKDTAERVLQQFKDFLSL"
     gene            complement(302177..304585)
                     /locus_tag="PN96_01485"
     CDS             complement(302177..304585)
                     /locus_tag="PN96_01485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005396734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N,N'-diacetylchitobiose phosphorylase"
                     /protein_id="ALR14709.1"
                     /translation="MKYGYFDNENREYVITRPDVPAPWTNYLGTEKFCTVISHNAGGY
                     SFYNSPEYNRVTKFRPNATFDRPGHYVYLRDDETGDYWSISWQPVAKSLDEASYEVRH
                     GLSYSKFKCEYSGITATKTLFVPKGEDAEIWDVVIKNTSDKPRTISAFSFVEFSFSHI
                     QSDNQNHQMSLYSAGTEYKQGVIEYDLFYNTNDFEGFYYLASTFDPDSYDGQRDSFLG
                     LYRDEANPLAVEQGKCFNTAQTCYNHCGSLHKQFTIQPGEEVRFAYILGIGKGNGERL
                     RTKYQDLAEVDNAFSGIKAHWDERCGKFQVKSPNEGLDTMINAWTLYQAETCVVWSRF
                     ASFIEVGGRTGLGYRDTAQDAISVPHANPQMTRKRIVDLLRGQVKAGYGLHLFDPDWF
                     DPEKADVKPSKSPTVVPTPSDEDKIHGIEDTCSDDHLWLVPTICKYVMETGEHSFFDE
                     VIPYADGGDASVYEHMKAALDFSAEYVGQTGICKGLRADWNDCLNLGGGESSMVSFLH
                     FWALQEFIDLAKFLDKDADVEKYTEMAANVREACETHLWDEEGGWYIRGLTKNGDKIG
                     TAQQKEGRVHLESNTLAVLSGAVSQERGEKAMDAVDENLFSEYGLHLNSPSFATPNDD
                     IGFVTRVYQGVKENGAIFSHPNPWAWVAEAKLGRGDRAMKFYDALNPYNQNDIIEKRV
                     AEPYSYVQFIMGRDHQDHGRANHPWLTGTSGWAYFAVTNFILGVRTGFDGLTIDPCIP
                     TNWPGFEVTRQWLGATYNIKVVNPDTVSKGVKSITLNGETVNGTSVPVQPEGSVNEVI
                     VTLG"
     gene            complement(304669..306588)
                     /locus_tag="PN96_01490"
     CDS             complement(304669..306588)
                     /locus_tag="PN96_01490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-hexosaminidase"
                     /protein_id="ALR14710.1"
                     /translation="MEYRVDLVVLSELKQNCRFGLTFHNLSDQDLHDWHLTFAFDRFI
                     LPDSVSNGVLNQIGSFCTLKPESMVLAANHNFYCEFSIGSNPFRYHSDGLNEALVDFV
                     VNGNTQRAEVDVTPIVLASPYRERSDIPPSLIHAQPLLPKPNHIEVHESYFSLHNRVG
                     ISTYSDLANSAKDWLLDELKRIHQFELTASNNSQVIFKSNPTLDKGAYRLKVTEESIK
                     IEAGSKSGFTYASATLLQLIRRNGEDTSMEVVCCSIKDRPRFKYRGMMLDCARHFHSV
                     EQVKRLINQLAHYKFNTFHWHLTDDEGWRIEIKSLPELTNIGAWRGLDESIEPQYTHL
                     SQRYGGFYTQEEIKEVVAYAAQRSITVIPEIDVPGHCRAAIKSLPHMLVEAEDTTEYR
                     SIQHYNDNVINPALPGSYEFIDKVLEEVATLFPAPYIHIGADEVPHGVWSQSPACQAL
                     MEQQGYSDYKELQGHFLRHAEDKLRGLGKRMLGWEEAQHGNKVSKDTVIYSWLSEEAA
                     LNCARQGFDVVLQPAQTTYLDMTQDYAPEEPGVDWANPIPLETAYSYEPLAQVADDDP
                     VRKRIRGIQAALWCEIINNQPRMDYMIFPRLTALAEACWTDKQHRNWTDYLSRLKGHL
                     PLLDLQGVNYRQPWK"
     gene            complement(306591..307487)
                     /locus_tag="PN96_01495"
     CDS             complement(306591..307487)
                     /locus_tag="PN96_01495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine kinase"
                     /protein_id="ALR14711.1"
                     /translation="MAFYFVGIDGGGTSCRARIKDAQGNFLGEAKTGSANIMLGAEVA
                     MTSIIEAISLAAKQGGLSEQDFSSMHVGLALAGAEHKASWNAFMSLAHPFASMTLNTD
                     AYGACIGAHNGQDGAIMIAGTGSCGIYLKGLQQHVVGGREFPISDQGSGAVMGLRLIQ
                     QVLLAEDGIREKTPLSQHVMAHFKNDVDNVVAWSKQALPRDYGQFSPAIFQHAQQGDT
                     LAIEMLKQTAADIETFLMALNKRGATRICLMGSIAERILHWLSPPVQKWIVEPQFDAI
                     EGALMFAGKPEHNLYSLSVEQE"
     gene            complement(307492..309213)
                     /locus_tag="PN96_01500"
     CDS             complement(307492..309213)
                     /locus_tag="PN96_01500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitobiase"
                     /protein_id="ALR14712.1"
                     /translation="MLLLTNHIGYERLGPKKAVIQTEQSHLSSDTATLVCAKSEQIVA
                     TFSVQEQGKVANWHQGYFYLIDFSSFEIPGHYYLRFGNVSSSQLEIAEQLLLDRTLSD
                     VIYYFKSQRCGGIFDHADRQAALLNSEQTTDVHGGWYDASGDVSKYLSHLSYANYLNP
                     QQTPMVVWNMLKGLSLHQSSDSIAAFTRTRLIEEALYGADFLVRMQNEKGFFYMTVFD
                     KWSKDTAQREICAFETQLGHKFDDYQAGFRQGGGVAIAALAAASRLAVHGEFNQQEYI
                     NTAENGYWHLKEHNKQYLNDGEENIIDEYCALLASVELFKTTKESRYLDESRLWASRL
                     ADRQMSDDKFKHFWSANQDGSRPYFHAAEAGLPVIALCEYLSIEDDSELAASIKQTVN
                     QACEFELDLTSRVTNPFGYPRQYVKGVEESKRDAFFVAHNNESGYWWQGENARLGSLA
                     SMSYLAQPYIESHETQQQLIRLGQDALNWIVGLNPYDMCMLDGHGRNNPDYLPQYGFF
                     NAKGGICNGITGGFEDENDIAFNPPAQKDDILQNWRWGEQWIPHGAWYLLAIMSQAHH
                     LSVDVKE"
     gene            complement(309276..310271)
                     /locus_tag="PN96_01505"
     CDS             complement(309276..310271)
                     /locus_tag="PN96_01505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005461254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ALR14713.1"
                     /translation="MSKQLGELLIEGKNVVKDFPLNSNSIKQSKMRAINDVSFKMYKS
                     RGLSVVGESGSGKSTTAKMIAKMYAPSEGIIEYKGRDIQDIQSRQDLMSYREGVQMVW
                     QDPFGSLNPTHNIFHHIARPLLIHKKVSPGNKKELEERVYDLLEQVGLIPPKETAQKF
                     PHQLSGGQRQRVNLARNIAVGAEVVLADEPTSMLDVSIRAGVLNLMEEMKFEKQMSLL
                     YITHDIATARYIAEDLAVMYVGHMVEWGDTEEIIHDPQHPYTQLLVSAVPDPSKSIHE
                     KLKGNKGEIPLWTPESVGCPFAGRCVHATDKCRQQLPGVTQLSENHFVRCYLFEN"
     gene            complement(310320..311303)
                     /locus_tag="PN96_01510"
     CDS             complement(310320..311303)
                     /locus_tag="PN96_01510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017817691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="ALR14714.1"
                     /translation="MTAPLISIRNLCVDYITDAGDVRACNNVSFDIAPGEVFGLAGES
                     GCGKSTVAFSLMRLHKPPAFITGGEVIFNGEDILQYSDSRMQSFRWSEMSMVFQSAMN
                     ALNPVLTMEEQFCDVIMRHTNMTREQAKKRAEGLLEIVDIHPSRLSDYPHQFSGGMRQ
                     RLVIAIALALNPKMIIMDEPTTALDVVVQREILQKIYALKEEFGFSILFITHDLSLMV
                     EFSDRIGIMYSGELIEVAPSKQILESPYHPYTKGLGSSFPPLTGPKTKLTGIPGNPLN
                     LLEIPQGCRFQARCDRVHEACTKIPTQLRQIEPSRFSNCHLYGETIAQAKV"
     gene            complement(311306..312331)
                     /locus_tag="PN96_01515"
     CDS             complement(311306..312331)
                     /locus_tag="PN96_01515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005461261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ALR14715.1"
                     /translation="MKELFKLILGNSFARIGLAIVTIFIFIAVAAPLITKHAPDKRTG
                     NPHEYPGFVVKQAQSNPDGWVAQNLADDRRTLIMSKKADHVLGTSRMGRDIWSQVAYG
                     ARVSLGVGFGAGIIVCFLATVIGISAGYFGGKVDDILSAAMNIMLVIPQYPLLFVLAA
                     FIGEAGPLTIALIIAGTSWAWGARVVRSQTMALREKEFVKAAEVLGESSFRIIFVEIL
                     PNLIPIVGASFIGSVMLAINTEAVISFLGLGDANTISWGIMLYNVQTSSAMLIGAWWE
                     VLAPCIALTVLVTGLALLNFAVDEIANPQLRSHKGMKRWKKLAAKDKKEREPELAPQN
                     ALWSGDK"
     gene            complement(312334..313320)
                     /locus_tag="PN96_01520"
     CDS             complement(312334..313320)
                     /locus_tag="PN96_01520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005394705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="ALR14716.1"
                     /translation="MGYFLRRLSFYLVALLVAATLNFIIPRAMPGDPVTMMFANASVQ
                     VTPERIAAMKELMGFVDGPIYIQYLSYIKNILSWELGTSIQFYPLSVNSLLGSAFGWS
                     LFLAGTAVVLSFSIASVLGIFAAWKRGSKYDAFVTPGTLIIQAIPQMVIAMIALFTFS
                     IGLKWFPSGYAYTPGTIPDWTSWDFIKNVGYHAILPLFCATIVQIGGFLVNMRNNMIN
                     LLAEDYITMAKGKGLSENRVVFNYAARNALLPSVTALSMSLGMAIGGQLIIEMIFNYP
                     GLGTVLLNAIHARDYQVLQGQLIIMTMFMLCFNLMADMLYMILDPRLRTGGK"
     gene            complement(313492..315174)
                     /locus_tag="PN96_01525"
     CDS             complement(313492..315174)
                     /locus_tag="PN96_01525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009843983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="ALR14717.1"
                     /translation="MLANIKKTALATAIIATATTGFASVATAAERSELTIHPKELTTF
                     VRNFNPFLGATNLHTTTDFIYEPLVVFNEMHGNTPVFRLAENFQMADDLMSVTFDIRK
                     GVKWSDGQAFTADDVVYSFNLVKEKPELDQSGINSWITGVEKVNDYQVKFRLTEANSN
                     VPYEIVKVPVVPEHVWSKVKDPSTFTNENPVGSGPFTVIDTFTPQLYIQCQNPNYWDA
                     DNLDVDCLRVPQIANNDQFLGKIVNSEMDWTSSFVPDIDRTYAAASPSHHYWYPPSGT
                     QAFVVNFKNPDAAKSEALTNVDFRRAFSMALDRQTIIDIAFYGGGTVNDFASGLGYAF
                     EAWSDEATHNKYKGYNTYNVEGAKELLAKAGFKDVNKDGFVDTPSGKSFELLIQSPNG
                     WTDFNNTVQLAVEQLAEVGIKARARTPDFSVYNQAMLEGTYDVAYTNYFHGADPHLYW
                     DSGYNSKLQSGDGMPRFAMHFYKNEELDKLLNSFYKTADKQEQLEIAHGIQKIIAEDQ
                     VTIPVLSGAYMYQYNTKRFTGWWNEENPKGRPNIWAGIPERLLHVLDLKPVK"
     gene            complement(316050..319436)
                     /locus_tag="PN96_01530"
     CDS             complement(316050..319436)
                     /locus_tag="PN96_01530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009698734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ALR14718.1"
                     /translation="MFKFYKKQKFKRLQSTLMTAFLVLSLTPLTITALFFLQSHSQDL
                     QEQSTSHLLSVRDTKQQQIIDYFEARETEVMGFVRSELAYASGGRFYGLVNAFSRLGN
                     DIEESRQNAQQRYIEGSGDQTKTSILPESSNFVGSERYRLLHKRYHWAYSELLKRSDF
                     NDILLVDINGNVTYSIKKDDNYGTNLLTGRYKDAALGRAFQRLANDVSERRKVNEDYT
                     PILISDFELENGKQVAWLGAPIVQQGYLHSYAMFRLPNNGITKLVADKNRESSIETLL
                     VGGDQQPRTINTKLDDIQNSMEVITQALSGQTSVGTYTNGLDEAIIAAYAPVKTRGVN
                     WALVVQLPEKDAFSRIHQLEKLFVIAMLTAIILVVIASHYLSNFITSPLLKLTWAAER
                     VSAGDLDENTFDTVRKDEIGRLAISFERMQRSIREKIQTIKKQNEELESNIRLIQKQN
                     DELQLADKLKDEFLATTSHELRTPLHGMVGIAETLISGANGTIPANQKYQLDIIIKSG
                     QRLANLVDDLLDYHKMRYGSMDIQKSAVNLASSTRLVLELSGHLLGNKTIRIINQVPN
                     DLKAVSADPQRLEQVLYNLIGNAIKYTSEGKIVISAGVVDDLVRVQVVDTGQGIPAEH
                     LEHIFEPLIQAGQDESRYRQGAGLGLSISRQLIELMGGSLYVSSQPMVGTTFSFTLPL
                     ASEEEILATQTQAACGHFQVPEINLENTDDLSLPENPEGPLLYVADDEPVNLRVLESF
                     LRLEGYRVRTVSDGPETLALVEQEKPELLLLDIMMPGMSGYQVCNELRQTFDHAELPI
                     IMLTALSQTEDRVRGFEAGANDYLSKPFNKQELAARIRAHLTASKAEMRHIENKVLES
                     ELRQRAEVEASLLETQGRLLEQLESAPEAIICLREDQRVRFANEAACKLFKRSLEQIK
                     RSSADELIAPKFLTVKQPHYCGKIDIYIGDIRQNIEADILKLPEGSGLDVMYIFNVGG
                     GANTARIHNLETAVEVLSRYAFDGDKEQLQKLKELGGEFTRLADKALGNKKDKQEVMR
                     EVLVEAMTHALEYWESVTGESKFTFAEQSGLWRVYLDRSTLQTRTLDKYMRIETLPKT
                     PRWRTVLSSIEFILEHCKEQSPERAYIEAQRDKLQRLLTS"
     gene            319435..319689
                     /locus_tag="PN96_01535"
     CDS             319435..319689
                     /locus_tag="PN96_01535"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14719.1"
                     /translation="MDKIATHKGQQKVYLLLPRFSLKTDKTLNSIEITKLTSFFSLTR
                     KLIAKRAESRSFFMFDEFLAGNRAGCRLRGGELRLFSVIN"
     gene            complement(319663..320688)
                     /locus_tag="PN96_01540"
     CDS             complement(319663..320688)
                     /locus_tag="PN96_01540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005386543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="ALR14720.1"
                     /translation="MSAYIAPSQIAQRQLEYFNGKHVLVAGEVEDLFPLELASYCESV
                     EVFTSNYSYYRQIRTSDKIKSHFGSEYNVDTQADMVLLYWPKAKAEAEYLLAMLMAKL
                     GVDTEIVVVGENRSGVKSIEQMFKDYGPINKYDSARRCSFYWGQCVNEPAPFNQIDWF
                     KSYTVSLGNQSLLVKSLPGVFSHGEFDLGSQLLLETLPPLSGKVLDFGCGAGVLGAFM
                     AKANPEIEIEMCDINAYAITSSQATLQANELEGKVFASDIYSDTANDYRFIISNPPFH
                     SGLDTNYNAAESLLGDAPRYLQRQGEMIIVANSFLKYPPIIESAFNNCETLNKTKKFS
                     IYYAKKS"
     gene            complement(320765..321850)
                     /locus_tag="PN96_01545"
     CDS             complement(320765..321850)
                     /locus_tag="PN96_01545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006743285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="ALR14721.1"
                     /translation="MPNNVKITSSHRVLMVALLAAAFACYLLVEPYINSIVMAFIISL
                     LMFPIHEWFEQKIPKHRNMASLLSCVVLTFIIVIPLLFVFAAIVQQGSLFSQNTYKWV
                     TNGGIQDIFQHPLVVKALALVNEYLPFDKVEPKAIAEKIAQFATSFGSNLVTISAKIL
                     GDATNFLMDFFLMLFVLFFLLRDHDKIISAIRHILPLSRSQEDKILTEIEQVSKSAVM
                     GSFLTAIAQGMAGGIGMWLAGFPGLFWGTMMGFASFIPVVGTALIWIPAAGYLFLTGD
                     TTWAIFLTAWSVVIVGSIDNLLRPLLMQGSSGMNTLMIFFSLLGGLQLFGLIGLIYGP
                     LIFAITMVLFNIYEEEFKDFLNDQDNS"
     gene            complement(322190..323485)
                     /locus_tag="PN96_01550"
     CDS             complement(322190..323485)
                     /locus_tag="PN96_01550"
                     /EC_number="5.4.3.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232904.1"
                     /note="Converts (S)-4-amino-5-oxopentanoate to
                     5-aminolevulinate during the porphyrin biosynthesis
                     pathway; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde aminotransferase"
                     /protein_id="ALR14722.1"
                     /translation="MTKSSELYDKAQKTIPGGVNSPVRAFNGVGGSPLFIERADGALI
                     FDADGKAYIDYVGSWGPMILGHNHAVIREAVIDAAQRGLSFGAPTELEISMAELVSEL
                     VPSMEQLRMVSSGTEATMSAIRLARGFTGRDKIMKFEGCYHGHADSLLVKAGSGALTL
                     GQPSSPGVPADFAKHTLTATFNDLDSVRELFAANKGEIACIIVEPVAGNMNCIPPVEG
                     FHEGLREICDQEGALLIFDEVMTGFRVALGGAQAHYNIKPDLTTLGKVIGGGMPVGAF
                     GGRKEVMQYVAPTGPVYQAGTLSGNPVAMAAGFACLSLLKEEGNEKRLASKTKQLADG
                     FKSLAEKHGIPLVVNQVGGMFGFFFTDQDSVTCYEDVTKCDVERFKRFFHLMLDHGVY
                     LAPSAFEASFTSLAHGSKEIDATLEAADRCFATLAAEAQ"
     gene            323728..324069
                     /locus_tag="PN96_01555"
     CDS             323728..324069
                     /locus_tag="PN96_01555"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9KU96.1"
                     /note="essential respiratory protein A; may be involved in
                     the transfer of iron-sulfur clusters; essential for growth
                     using oxygen or alternate electron acceptors; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster insertion protein ErpA"
                     /protein_id="ALR14723.1"
                     /translation="MSEVNVPLSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGF
                     QYGFTFDENVNDGDTTIVNSGVTLVVDPMSLQYLIGGIVDYTEGLEGARFFVNNPNAT
                     TTCGCGASFSV"
     gene            324276..325358
                     /locus_tag="PN96_01560"
     CDS             324276..325358
                     /locus_tag="PN96_01560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="ALR14724.1"
                     /translation="MASFPFTRFFAERPYIVSLLIILVMSAWLGLGSLQADDVSPQRA
                     SQDIPLAKVSYQTFTAQNTYKTIELYGRTAPDRQANLGAEIAGKIIALKVEKGESVKQ
                     GQVIAQIDKGDLDIQLERAHALLKVREKEFNAAKSLKNKGLQGEVAFSNAEASLVEAR
                     AQVTNAKIALRNTNVIAPFSGILDHLFIEVGDFVGVGDPVATIIDLTHLVIEADVSER
                     HIQDLSLNQPAKVKFISGDTVEGTVSYVSRVSSPATNTFPIEIRLPNPQQLIPAGIST
                     EVDLNLKQQLAIKLTPAMLALDEAGILGVKVLENKKVKFIPIQLVKAEQDGVWLTGLG
                     DRVDIITTGQGFVRDGDDVIAVKQEL"
     gene            325370..328486
                     /locus_tag="PN96_01565"
     CDS             325370..328486
                     /locus_tag="PN96_01565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="ALR14725.1"
                     /translation="MLRLIDASLSRARTMMVLLVFVLISGVLTYLTIPKESSPDITIP
                     IIYVSVSHQGISPTDAERLLVRPIEQELRSIEGVKDMTATASEGHASVVLEFSVGVDL
                     DRAMAEVRDAVDLAKPKLPADSDEPTVNEVTLASEEAALSVVLYGTVPERTIVHLARQ
                     LRDKLESYRQILEVDIAGDREDIVEIIVDPLLMESYGLDQASIYNLIALNNRVVAAGF
                     VDTGYGRFSVKVPSVFETLKDVLELPVKVDGKQVITFGDVATVRRAFRDPESYARLDG
                     KSAIVLDVKKRAGENIIETVDLIKAVMAEAQNQEQWPDNLLVKYTRDQSDDVKMMLND
                     LQNNILSAIILVVIVIIAILGVRTALLVGISIPGSFLTGLLVLSVFGLTVNIIVLFSL
                     IMAVGMLVDGAIVVTEFADRRMQEGAPRKEAYRDAAKRMAWPITASTATTLAAFAPLL
                     FWPDVTGEFMKYLPLTLIATLAASLAMALLFVPVLGSLIGKPQNVSPIQHEKMLALHE
                     GDYDKATGITKLYYQTLNVALRHPLKILLSAILLSVGVGFTYVKAGLGAEFFPEVDPP
                     FFTVKVRSYGDLSIDEKDQIMRDVESVMLGHDEFESVYTKTGGDDEIGLIQITPVDWQ
                     YRRKVKAIIDELKQTTDQYAGVEIEYKFPEAGPPTEHDLVIEMSGSTLSGLDEGAKIV
                     RHWADAYPAFTNISDNSSKDGIDWQIDIRRDDAARFLADATLVGNTVQFVTNGLKLGD
                     YLPDDSSEEVDILVRYPEDKRDIGRFDQLRVKTAAGLVPITNFASIIPEHKQDTIRRV
                     DGHRVISVFADIREGYNLALELPKVEEALKELTLPEGVEFKIRGQNEEQENSSAFLLN
                     AFIVALVGMALILITQFNSFYQAFLILSAVLFSTVGVFAGLLIFQKPFGVIMSGIGVI
                     ALAGIVVNNNIVLIDTYNQLRKRGLDKRDAILRTGVQRLRPVLLTTITTILGLLPMVL
                     EMNIDLINQKIEFGAPSTQWWSQLATAVSGGLAFATLLTLVLTPCLLMLGKEHSSDEM
                     IGSEKEVI"
     gene            complement(328513..329802)
                     /locus_tag="PN96_01570"
     CDS             complement(328513..329802)
                     /locus_tag="PN96_01570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="ALR17178.1"
                     /translation="MHSIFVRLPLLHKVLIGFFSALIIFALFFLPDPQELNPQQSRLK
                     VGQYYPVPISMELTTLNGTSSTSSVLRWETYKVKNGESAAILFSRVGLSARILHELVS
                     SDKEVEQQLTRLRPGDRLQFGFDENNNLVQLRRTLSAFETFRIKLQDGKYVSEIDKKE
                     VDYQYNFAEATIKSNFWNAGISSGLNANQIMELAGIFGWDIDFALDIRKNDTFRVLYQ
                     EEVVEGEVIGRGKIIAAVFKNQGDTFTAILDEKSGKYYDENGRAMKKAFLRAPLDFRR
                     VSSNFNPRRLHPVTGKVRPHRGTDYAAPVGTPIWAAGDGVVQKSSYNKFNGNYVFIKH
                     SNTYITKYLHLTKRTVKTGQRVKQGQTIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTV
                     NLPQSKSLTGQARQTFLANAKINMAKLDRYSELLTMK"
     gene            329932..331119
                     /locus_tag="PN96_01575"
     CDS             329932..331119
                     /locus_tag="PN96_01575"
                     /EC_number="6.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017820416.1"
                     /note="catalyzes the formation of tyrosyl-tRNA(Tyr) from
                     tyrosine and tRNA(Tyr); Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="ALR14726.1"
                     /translation="MASIEAALAEIKRGVEELIPEEELIAKLKEGRPLRIKLGADPTA
                     PDIHLGHTVIFNKLRLFQELGHEVTFLIGDFTAMVGDPTGKNSTRPPLSREDVLRNAE
                     TYKEQVFKILDPAKTKIQFNSEWLSELGAEGMIRLAANQTVARMLERDDFKKRYTGGQ
                     PIAIHEFMYPLLQGWDSVAMETDVELGGTDQKFNLLMGRELQKSHGQKPQVVLMMPLL
                     VGLDGEKKMSKSANNYIGISEAPSEMFGKIMSISDDLMWSYYELLSFRPLEEVAQFKA
                     DVEAGKNPRDIKVLLAKEIIARFHSEADADAAEQEFVNRFAKNQIPDEMPEFEFEAGR
                     PVSNLLKEAGLCPSSSDAMRMVKQGAAKIDGEKVADSKFTPEAGTYVFQVGKRKFARI
                     TIQ"
     gene            331542..332387
                     /locus_tag="PN96_01580"
     CDS             331542..332387
                     /locus_tag="PN96_01580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mg2+ transporter mgtE"
                     /protein_id="ALR14727.1"
                     /translation="MTVMNNTFIETTPNFSAVEIGAARNAFLQYERDKQLQLLSIMPI
                     DEAVGILQHCSVAYVNSLIAQLEQAGHDKRARHYAHQLGLHISEVDTPDGYLSAGVFE
                     HVKQRIGWIIALALLGIVSGLIIAQYEDTLSQLVLLAVYMPVIAAAGGNTGTQAATLV
                     IRALATGELKKRQWLAVLWKESRVALCLALAIAIVMVGRILLFSGGQPNGGFDLVDIA
                     LAIAVALFIQVTISTTLGGLLPIIARACNLDPAVLVSPVLASIVDISGMWIYFTVVNY
                     FLGIA"
     gene            complement(332366..333787)
                     /locus_tag="PN96_01585"
     CDS             complement(332366..333787)
                     /locus_tag="PN96_01585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="ALR14728.1"
                     /translation="MRLRWSLFFLSLLCPLATQAYPHQEVLPEGARISLVAEKLTDNA
                     ELSGIHPTEQLFPPASTLKIVTALAAKLELGDSFRFRTKLEASKSDAVITFVGDPTLQ
                     TKDLKDLLTLAKKNGLKRIEGDLWLDNSVFTGYNRAVGWPWDILGVCYSAPASAITLN
                     KNCVQASIYTQKDGGTRVFVPEHQPIHVKSSVETVTRAVQKSRHCDLDLLPNPDNRYE
                     LNGCLVAREKPLPLKFAVQDPEMYTSKKIATLLAQLNIELKGRIKVGSAPKKQRKLFA
                     LHQSQPLSVLLDQMLKRSDNLIADTLTKTLGAKFFVQPGSFVNGTEAIKQIIFANTGV
                     DIRQARLEDGSGLSRNNRISATKMAEILRYIWKNEKQLNLIAIMPKSGESGTLQYRQS
                     MRNAPIKGQLIAKSGSLYGTYNMAGYGLDKNGKPNTIFVQFVSDYFPEKRDGSKPAVA
                     PITSFEKLFYSDVVNFSQAMPKK"
     gene            complement(333982..335001)
                     /locus_tag="PN96_01590"
     CDS             complement(333982..335001)
                     /locus_tag="PN96_01590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14729.1"
                     /translation="MKKTLIALSVSAAAMATGVNAAELYNQDGTSLEMGGRAEARLSM
                     KDGDAQDNSRIRLNFLGKQQVSDNLYGVGFWEGEFTTADFDENGKDISGEDSLDTRLA
                     YAGLGGAWGEFSYGKNEGALGVITDFTDIMAYHGNSAADKLAVADRADNMMSYKGQFE
                     NLSVKASYRFADRVENANGDFSDNDQDGYSLSAIYAVANTGLELGAGYADQDEANEYM
                     LAASYTMGDLYFAGVFTDGEKMTDDFAGTVDYTGYELAGAYTVGQTVFTTSYNNAETN
                     DETSADNIAIDASYYFKPNFRGYVSYNFNLIDSGDKFGSTGTKTTATKIDAEDELALG
                     LRYDF"
     gene            335537..336010
                     /gene="greA"
                     /locus_tag="PN96_01595"
     CDS             335537..336010
                     /gene="greA"
                     /locus_tag="PN96_01595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333910.1"
                     /note="necessary for efficient RNA polymerase
                     transcription elongation past template-encoded arresting
                     sites; arresting sites in DNA have the property of
                     trapping a certain fraction of elongating RNA polymerases
                     that pass through, resulting in locked ternary complexes.
                     Cleavage of the nascent transcript by cleavage factors
                     such as GreA or GreB allows the resumption of elongation
                     from the new 3'terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="ALR14730.1"
                     /translation="MEKVPMTLRGEQMLREELDRLLKLRPQISAAIAEARELGDLKEN
                     AEYHAAREEQGICEAQIRDIEYKLSVAQVIDVTKMENTGKVIFGTTVTLIDVDTDEEK
                     TYQIVGDDEADIKAGRISVSSPIARGLIGKMEGDEVVIETPGGAKDFEIDRVEYL"
     gene            complement(336087..336383)
                     /locus_tag="PN96_01600"
     CDS             complement(336087..336383)
                     /locus_tag="PN96_01600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004738252.1"
                     /note="RNA binding protein found associated to pre-50S
                     subunit of the ribosome; putative role in ribosome
                     assembly; necessary for optimal growth but not cell
                     viability; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein YhbY"
                     /protein_id="ALR14731.1"
                     /translation="MNLSTKQKQHLKGLAHSLKPVVLMGANGLTEAVLAEIEIALNHH
                     ELIKVKVASEDRETKQLIIDAIVRETGAEKVQTIGKVLVLYRQSEERKIEIPRK"
     gene            336522..337151
                     /gene="rrmJ"
                     /locus_tag="PN96_01605"
     CDS             336522..337151
                     /gene="rrmJ"
                     /locus_tag="PN96_01605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006958070.1"
                     /note="Specifically methylates the uridine in position
                     2552 of 23S rRNA in the fully assembled 50S ribosomal
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="ALR14732.1"
                     /translation="MSKQKHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKIDEIQT
                     KDKLLKPGMTVVDLGAAPGGWSQYAAKIVGDSGQIIACDLLPMDPIAGVSFLQGDFRD
                     DAVLDALLERIQPSMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLAPNGS
                     FVVKVFQGEGFDQYVKEVRDMFKVVKVRKPDSSRARSREVFVVATGYKG"
     gene            337260..339239
                     /gene="hflB"
                     /locus_tag="PN96_01610"
                     /gene_synonym="ftsH"
     CDS             337260..339239
                     /gene="hflB"
                     /locus_tag="PN96_01610"
                     /gene_synonym="ftsH"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015297226.1"
                     /note="inner membrane metalloprotease; may be involved in
                     degradation of aberrant cytoplasmic and membrane proteins;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metalloprotease"
                     /protein_id="ALR14733.1"
                     /translation="MAKNLILWLVIAVVLMSVFQSFGPGESNGRTVDYTTFVQEVGQG
                     QIQEATFKDGEISFVRRGGGAKMVTYMPVYDQKLLDDLINQNVKVQGTPPEEQSLLGT
                     IFISWFPMILLIGVWIFFMRQMQGGGGKGAMSFGKSKARMMSEEQIKTTFADVAGCDE
                     AKEDVKELVDYLRDPSRFQKLGGKIPTGVLMVGPPGTGKTLLAKAIAGEAKVPFFTIS
                     GSDFVEMFVGVGASRVRDMFEQAKKASPCIIFIDEIDAVGRQRGAGVGGGHDEREQTL
                     NQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKV
                     HMRKVPLAGDVEPSLIARGTPGFSGADLANLVNEAALFAARGNKRNVSMVEFELAKDK
                     IMMGAERRSMVMSEETKASTAYHEAGHAIVGRLVPEHDPVYKVSIIPRGRALGVTMYL
                     PEQDRVSMSRQHLESMISSLYGGRLAEELIYGAEKVSTGASNDIERATDIARKMVTQW
                     GFSEKLGPLLYAEDEGEVFLGRSVTQTKHMSDDTAKLIDDEVRQIIDRNYDRAKKILQ
                     DNMDIMHAMKDALMKYETIDAHQIDDLMERKAEIREPAGWGDNPSNKPQVDDKPQAAP
                     AAKEEEKKADADNDAEQSTSQEAASADAPEKKDSE"
     gene            339292..340125
                     /gene="folP"
                     /locus_tag="PN96_01615"
     CDS             339292..340125
                     /gene="folP"
                     /locus_tag="PN96_01615"
                     /EC_number="2.5.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232891.1"
                     /note="catalyzes the formation of dihydropteroate from
                     2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine
                     diphosphate and 4-aminobenzoate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="ALR14734.1"
                     /translation="MIIKVKNKSLDLSRPHVMAILNVTPDSFSDGGKFNSLDLALERV
                     EKMIKAGVSIIDVGGESTRPGAPEVTLEDELERVIPVVRAIRAHYPDVWISVDTSKAE
                     VIRQSVEAGADLINDIRSLTEPGALEVAAKANVPVCIMHMKGQPKTMQQNPQYDDLMQ
                     EVEQFLVERMAVCEAAGIARENIILDPGFGFGKTIEHNYHMLAHLEKFHKFGLPILAG
                     LSRKSMIFKLLDKPAAECTNASVVCATIAAMKGAQIIRVHDFEETLEAMKVVEMTKNN
                     I"
     gene            340146..341486
                     /gene="glmM"
                     /locus_tag="PN96_01620"
     CDS             340146..341486
                     /gene="glmM"
                     /locus_tag="PN96_01620"
                     /EC_number="5.4.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010649835.1"
                     /note="catalyzes the conversion of glucosamine-6-phosphate
                     to glucosamine-1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="ALR14735.1"
                     /translation="MSDKRRYFGTDGVRGKVGQYPITPDFVLKLGWAAGRVLAKRGTK
                     KVIIGKDTRISGYMLESALEAGLAAAGLKATFTGPMPTPAVAYLTQTFRAEAGIVISA
                     SHNPYYDNGIKFFSSEGTKLPDDIELAIEAELDKEIECVESAELGKATRLNDAAGRYI
                     EFCKSTFPSTLSLASLKIVVDCAHGATYHIAPNVFKELGAEVIAMGVEPNGTNINDQV
                     GATDVRALQKRVVEEQAHLGLAFDGDGDRIIMVDHLGNKVDGDQIAYIIARDALRRGE
                     LKGGVVGTLMTNLGMENGLKQLGIPFVRAAVGDRYVMEQLLAKGWKIGAENSGHIILL
                     DKVTTGDAIVAALQVLASIVGNDMSLHDLSQGMTLYPQVLENVRFSGDANPLEAKAVL
                     DSVAEVEAELGDKGRVLLRKSGTEPLIRVMVEGEDAELVQSSALKIADAVKASF"
     gene            341713..342051
                     /locus_tag="PN96_01625"
     CDS             341713..342051
                     /locus_tag="PN96_01625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="ALR14736.1"
                     /translation="MFTVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFG
                     ASGSGNFLTRTTAILATVFFVISLLLGRMSTHKTESQWVDPTLGQPVVEQVKDAASEV
                     PAPAGDEIPQ"
     gene            342068..342151
                     /locus_tag="PN96_01630"
     tRNA            342068..342151
                     /locus_tag="PN96_01630"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:342102..342104,aa:Leu,seq:gag)
     gene            342208..342284
                     /locus_tag="PN96_01635"
     tRNA            342208..342284
                     /locus_tag="PN96_01635"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:342242..342244,aa:Met,seq:cat)
     gene            342511..342966
                     /locus_tag="PN96_01640"
     CDS             342511..342966
                     /locus_tag="PN96_01640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005380082.1"
                     /note="required for the maturation of the 30S ribosomal
                     subunits; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation protein RimP"
                     /protein_id="ALR14737.1"
                     /translation="MTGLERQLTEMLEAPVEASGYELVGLEFIRAGAHSTLRIYIDHE
                     NGINVDDCAEVSHQVSAVLDVEDPISVAYSLEVSSPGLERPLFKAAHYEQFIGHEVSI
                     VLKMAVANRRKWKGIIHSVDGETVTVTVEGQQEEFALSNISKANLIPKF"
     gene            343003..344490
                     /gene="nusA"
                     /locus_tag="PN96_01645"
     CDS             343003..344490
                     /gene="nusA"
                     /locus_tag="PN96_01645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017419789.1"
                     /note="modifies transcription through interactions with
                     RNA polymerase affecting elongation, readthrough,
                     termination, and antitermination; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor NusA"
                     /protein_id="ALR14738.1"
                     /translation="MSKEILAVAEAVSNEKAVPRERIFEALEIALATSTKKKYEIEID
                     VRVAIDRKTGEFVTYRRWLVVDNVENPTKEISLEAAQYDDESVELGDYVEDEIQSVTF
                     DRITTQTAKQVIVQKVREAERAQIVEQFIDNEGDLITGVVKKVNRDTIVLDLGNNAEA
                     VILRDDQLPRENFRPGDRVRGLLYKVAPEARGFQLFITRSKPEMLAELFRVEVPEIAE
                     DIIELKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLW
                     DDNPAQFVINAMAPADVASIIVDEDAHAMDIAVEADNLAQAIGRNGQNVRLASQLTGW
                     ELNVMTVADLQKKHAEESQASIENFMKYLDIEEDFAQLLVEEGFSTLEEVAYVPVNEL
                     LEVDGLNEELIEELRGRAKDALTTIALAQEESFEGLEPAEDLLGLEGLEREMAFKLAA
                     KGVATLEDLADQGIDDLEGIEGLTEERAGELIMAARNICWFGEEA"
     gene            344511..347225
                     /locus_tag="PN96_01650"
     CDS             344511..347225
                     /locus_tag="PN96_01650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="ALR14739.1"
                     /translation="MTQLTVKALSDEIGTPVDRLIEQLADAGIKKASSDNVTDEEKQQ
                     LLSHLKKEHGDKSGDSEPTRLTLQRKTRSTLSVNAGGGKSKNVQVEVRKKRTYVKRST
                     IEDEAKRDAEEAAKREAEEAAKRAAEEAAKREAEEAAKREAEEAAKRDAEEKAKREAE
                     EKAKRDVDTNAQREAEEKAKRDAEEKIKQEAARKEADELKRRQEEEAKRKAEEESQRK
                     LEEARELAEKNKERWSAAEEKKGDMEDTDYHVTTSRYAREAEDEADRKEEAGRRKKKK
                     KPSQKDDQARNGGRTQRGGKGGRKGKLAKPTSMQHGFDKSATVAKQDVVIGETIVLSE
                     LANKMSVKATEVIKVMMKMGAMATINQVIDQETAQLVAEEMGHKVVLRKENELEEAVL
                     SDRDTNAEAVPRAPVVTIMGHVDHGKTSTLDYIRRTHVASGEAGGITQHIGAYHVETE
                     NGMITFLDTPGHAAFTAMRARGAQATDIVVLVVAADDGVMPQTVEAIQHAKAAGVPLI
                     VAVNKIDKEDANPDNVKNELAQYDVIPEEWGGENMFVHISAKQGTNIDGLLEAILLQS
                     EVLELTAVKEGMASGVVVESRLDKGRGPVATVLVQSGTLNKGDIVLCGQEYGRVRAMR
                     DELGQEITEAGPSIPVEILGLSGVPASGDEATVVRDERKAREVANYRAGKFREVKLAR
                     QQKSKLENMFSNMTAGEVAELNVVLKADVQGSVEAIADSLLKLSTDEVKVNIVGSGVG
                     GITETDVVLAEASNAIILGFNVRADASARRAVEAAAVDLRYYSIIYQLIDEVKQAMGG
                     MLAPEFKQEIIGLAEVRDVFKSPKLGAIAGCMVTEGLIKRNNPIRVLRDNVVIYEGEL
                     ESLRRFKDDVQEVKNGYECGIGVKNYNDVRVGDQIEVFEIVEIKRTLD"
     gene            347340..347735
                     /gene="rbfA"
                     /locus_tag="PN96_01655"
     CDS             347340..347735
                     /gene="rbfA"
                     /locus_tag="PN96_01655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005394657.1"
                     /note="associates with free 30S ribosomal subunits;
                     essential for efficient processing of 16S rRNA; in
                     Escherichia coli rbfA is induced by cold shock; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="ALR14740.1"
                     /translation="MSKEFSRTQRVSQQLQKELAMILQREVRDSRLGMVTISDVEVSR
                     DLAYAKVFVTFLCVGEQTPESCLAALREHEVHIRMMLGKRIRLRLTPEIRFHYDNTLV
                     EGMRMSNLVSEVVSADKQKQKDSGREDEE"
     gene            347735..348679
                     /gene="truB"
                     /locus_tag="PN96_01660"
     CDS             347735..348679
                     /gene="truB"
                     /locus_tag="PN96_01660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017820421.1"
                     /note="catalyzes isomerization of specific uridines in RNA
                     to pseudouridine; responsible for residues in T loops of
                     many tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="ALR14741.1"
                     /translation="MARRRKGRPINGVILLDKPTGISSNDALQKVKRIYFAEKAGHTG
                     ALDPLATGMLPICLGEATKFSQFLLDSDKRYRVIAKLGERTNTSDSDGEVVETRPVDV
                     DLEKLEACIDKFRGESDQVPSMFSALKYQGKPLYEYARKGIEVPRESRKITVYEIILH
                     RFEGDEVEMEVHCSKGTYIRTIVDDLGEMLGCGAHVTMLRRTGVAKYPYEKMVTLEQL
                     NELLEQAHRQEVAPRELLDPLLMPMDTAVEDLPEVNLIPELADMVQHGQPVQVSGAPT
                     EGSLRLTMGEERLFIGVGEMNNDGKIAPKRLVVFRDEE"
     misc_feature    348765..348884
                     /note="ribosomal protein S15 leader; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
     gene            348828..349097
                     /locus_tag="PN96_01665"
     CDS             348828..349097
                     /locus_tag="PN96_01665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010318921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="ALR14742.1"
                     /translation="MSLNAETKAAIVAEYAQSEGDTGSPEVQVALLTASINHLQGHFK
                     AHKGDHHSRRGLLRMVSRRRKLLDYLKGKNLARYQDLIKRLGLRR"
     gene            349431..351566
                     /locus_tag="PN96_01670"
     CDS             349431..351566
                     /locus_tag="PN96_01670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005494068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide phosphorylase/polyadenylase"
                     /protein_id="ALR14743.1"
                     /translation="MFEKPVVKTFQYGNHTVTLETGVIARQATAAVMVTMDDTAVFVS
                     VVGKKEAVAGQDFFPLTVNYQERTYAAGKIPGGFFKREGRPSEGETLTARLIDRPIRP
                     LFPDAFKNEVQVIATVVSVNPDVQPDIPTMIGTSAALAISGIPFNGPIGAARVGHIDG
                     QLVLNPSQTELDASRLDLVVAGTESAVLMVESEADNLTEEEMLAAVVYGHDQQQVVIN
                     AINEFKAEVATPAWDWVAPEENTVLKNKIAELAEAKLVEAYQITEKMARYERIHAIAA
                     EVNEVLLAEDPEADTKEIHTIFHDLEKTVVRRSIIAGNPRIDGREKDMVRALDVRTGI
                     LPRTHGSALFTRGETQAIVTATLGTQRDAQIIDELTGERKDHFLLHYNFPPYCVGETG
                     FVGSPKRREIGHGKLAKRGIAAVMPSVDEFPYTVRVVSEITESNGSSSMASVCGTSLA
                     LMDAGVPIKSSVAGIAMGLVKEGDDFVVLSDILGDEDHLGDMDFKVAGTNTGVTALQM
                     DIKIEGITKEIMQIALNQAQGARKHILSVMDEAISGARDDISEFAPRIHTMKISAEKI
                     KDVIGKGGAVIRALTEETGTTIEIEDDGTIKIAATEGAAAKEAIRRIEEITAEVEVGR
                     IYTGKVARLADFGAFVTVLPGKDGLVHISQIAEKRVEKVSDYLTEGQEVQVKVLEIDR
                     QGRVRLSMKEAVEKPAEEAAAEAPAAKDE"
     gene            351765..352682
                     /locus_tag="PN96_01675"
     CDS             351765..352682
                     /locus_tag="PN96_01675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232880.1"
                     /note="lipoprotein that appears to be involved in cell
                     division; interacts with the periplasmic protease Prc and
                     may be activated by protease processing; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein NlpI"
                     /protein_id="ALR14744.1"
                     /translation="MKWFQTASLCVAIALTGCANTSQQSAMQWVYPPMAVPLQPSVQQ
                     EVQIARLSQLLQRPDLSDEVRAKMHYERGNYYDSVGLRDLARLDFNQSLQLNPAQPDI
                     FNLLGVYFTQVGEFDAAYEAFDSTLELAPDNTYAERNRAIALYYGGRIELALEDMNKH
                     YEEMPSDPFRALWLYIIEAEQDPEQAKANLKKHYKRDRSEEWGWVLVAIMLRDVSDEQ
                     ALKLIMDGTRENYRLAERLTETYFYLGKRHQLQGDLASAISLYKLAISFNVYDYVEHR
                     YSFLELAQIYERLQQDRMAKLKAEQQPDN"
     gene            352898..354244
                     /gene="vmrA"
                     /locus_tag="PN96_01680"
     CDS             352898..354244
                     /gene="vmrA"
                     /locus_tag="PN96_01680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333901.1"
                     /note="sodium/drug antiporter; functions as a Na(+)-driven
                     Na(+)/drug antiporter; member of multidrug and toxic
                     compound extrusion (MATE) family; extrudes acriflavines
                     and other compounds by utilizing the sodium gradient;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="ALR14745.1"
                     /translation="MQGSIYRQFWKYTIPTVAAMLVNGLYQVIDGIFIGRYVGADGLA
                     GINVAWPVIGTILGVGMMVGVGTGALVSIKRGEQDQYGAKRILSTGLLLLAALMPVVA
                     AVLFYFADDFIRWQGAQGQVYELGLQYLQILIVSCIFTLGSIAAPFLLRNDDSPNLAT
                     ILMVTGAAINISLDYVFIAWLGWELTGAAIATALAQMVVTVLGIGYFFSSKAKLRLHF
                     SDLQVQLDIVPKVVMIGSSSFFMYAYGSIMVALHNSLFAQYGSALLIGAYAILGYIVT
                     VYFLVAEGIANGMQPLVSYNHGARNPQNIRKLLKIAMGTAVLGGFAFVSLLNVFPYEV
                     VSVFNSSDQQLIESAVMGIRFHMFALFLDGFLMVSAAYYQSMNKGSKAMFITVGNIMV
                     QLPFLFIMPKIFGVVGIWIAFPLSNIALSLVVMSMLWRDVKKLLSESPVEPSMQSS"
     gene            complement(354299..355177)
                     /locus_tag="PN96_01685"
     CDS             complement(354299..355177)
                     /locus_tag="PN96_01685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015297223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="ALR14746.1"
                     /translation="MKYALGPLLYFWPKQDVEAFYQEAKESTADIIYLGETVCSKRRE
                     MKPAHWFDIAKELSAAGKQVVLSTMALLEAPSEVNIMKKYIDNGDFAIEANDVSAVQL
                     ASEHRVPFVVGPAINTYNAHTLNLFLKQGMTRWCMPVELSRDWLRDTLAQCESLGIRN
                     KFEVEVFSHGYLPLAYSARCFTARAENRAKDDCETCCIKYPTGIQVSSQEGQEVFNLN
                     GIQTQSGYCYNLINDLPGMQGLVDVVRLSPLGISTLSELDQFRANEQGEKPQKLEDRQ
                     CNGYWHQLAGLDVKNI"
     gene            complement(355198..356211)
                     /locus_tag="PN96_01690"
     CDS             complement(355198..356211)
                     /locus_tag="PN96_01690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004407202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="ALR14747.1"
                     /translation="MELLCPAGNLPALKTAIDCGADAVYIGFKDDTNARHFAGLNFHG
                     KKLEKAVQYVHDRNKKIHVALNTFAHPNGFERWTNAVDNAASLGVDALIVADIAVLEY
                     AARKYPELELHLSVQASATNVAAIEFYKQNFNVKRVVLPRVLSIHQVKQLSRNITSDV
                     ELEVFAFGSLCIMSEGRCYLSSYMTGESPNTVGACSPAKYVRWQETEQGLESRLNNIL
                     IDRYSEGENAGYPTLCKGRFEAEIEGEKKRYHALEEPTSLNTLSMLPELFAANVASVK
                     IEGRQRSPAYVEQVTRTWRAAIDRYQANPAAYQVEEAWNATLANVSEGTQTTLGAYHR
                     QWQ"
     gene            complement(356330..358369)
                     /locus_tag="PN96_01695"
     CDS             complement(356330..358369)
                     /locus_tag="PN96_01695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="c-di-GMP phosphodiesterase"
                     /protein_id="ALR14748.1"
                     /translation="MPSQQLQHWFATLTSNSPFFFAILDKKHNYRMVSDRYCDIAGLS
                     NAEIIGLNDVHVLGEQFYKKLAPYYQRAFDGTHIEAEITLDETDLETSLHFSLSPVYE
                     GNEIRHVVFHAVDTSEKQILVRSLEESESKFAKLTQLLPDGLLLIEEDVIISANPASA
                     RLLGINSPHDLLGEKLSRLFIDENTKKVFGHPLSTLISDKPFICLTSARCGFERKVQL
                     HADSTAILGSASQIILIQDADNAPKNLSASLGEDANIDSLTKLYNRFGFTKRLEQLIK
                     KQTPLLLFYLDIDNFKNINDSLGHHIGDKVIQEVSARLKRLLPSQAILGHLGSDEFGI
                     LLPEPENARMAEILSDRIISLINQPFDLHHFSKRLACSIGSVRYPEDGQDARILLQNA
                     DTAMYEAKDRGRNRLIKFNDQMNKEARMRLWLEIELQKALQQNGLEVWYQPKVNARDF
                     SINGAEALVRWKHPVEGYISPGAFIPVAERAGLIEHLGRVVMRDVFNTVKRWKQQSVL
                     PGRVAINLSPEQFGNPQLIDFMEKLLRTTELDPSCITFELTESAVMSDSEHTLQMLNA
                     IKKLGFALSIDDFGTGYSSLSYLARFPIDELKIDRAFISDIDTLPKQVTVIENIINLG
                     KSLDLSVVAEGVETHQQATLLSNLQCHSIQGFHFYRPQPKHEIEELFVQNRRHKN"
     gene            358722..359249
                     /locus_tag="PN96_01700"
     CDS             358722..359249
                     /locus_tag="PN96_01700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sterol-binding protein"
                     /protein_id="ALR17179.1"
                     /translation="MLNKIRSQLVKNAANILRSPVQLLPQTVQKKALLEGLKMIFKEA
                     LEDGDFEFLEDKWLKVAIKDLNLAWYISYQDENLLVAEKPVQEDVSFSGNLNDLVLIA
                     GRKEDPDTLFFQRRLSIEGDTELGLEVKNLMDSVDLEQLPKAMQVALNQLADFVQKGV
                     QEPAQQPGVANAYSN"
     gene            359233..359736
                     /locus_tag="PN96_01705"
     CDS             359233..359736
                     /locus_tag="PN96_01705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="ALR14749.1"
                     /translation="MLIRTEAPADILTIDRLLKHAFPTDAEANLVMRLRENGKLTLSL
                     VVCTDEGEVIGHALFSPVTLNGEDLSWQGLAPLAVHEDYRRQGIGAELIKEGFDSLRD
                     FGYPVCVVLGSPDYYARQGFKACDEMGFECAWEVPQGAFRIAEVVEGQCAGRSGRIDY
                     SPEFDDL"
     gene            359958..360356
                     /locus_tag="PN96_01710"
     CDS             359958..360356
                     /locus_tag="PN96_01710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232873.1"
                     /note="with the chi subunit binds to single-strand binding
                     (SSB) protein and acts as a bridge between the DnaX clamp
                     loader complex and the SSB; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit psi"
                     /protein_id="ALR14750.1"
                     /translation="MSINEKQYLHEMGISTWELIHPDRLAGYQSPMIDLPSACKLLLV
                     SPVCPVNESAILFEKILKSMKLTLDQAMHLEPERFSLLGEHQLEWVWFAGCDVNGDSN
                     IKQLTSPLLQDIDGNNEQKRALWQQICSYS"
     gene            360429..360884
                     /locus_tag="PN96_01715"
     CDS             360429..360884
                     /locus_tag="PN96_01715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="ALR14751.1"
                     /translation="MTIEIIPMCDAHLEQVWQIEQQAHSHPWAESLVRDLSSRGACHH
                     VMVEGDSVLGYFYAQNIVGEVTLLNIAVDPSQQGKGHGQKLLDAFLYHCEQVKAESAW
                     LEVRENNHAAIHIYEQAGFNELDRRYNYYPAKTGNGKEDAIIMSYIFFH"
     gene            361051..362640
                     /gene="prfC"
                     /locus_tag="PN96_01720"
     CDS             361051..362640
                     /gene="prfC"
                     /locus_tag="PN96_01720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006742375.1"
                     /note="stimulates the release of release factors 1 and 2
                     from the ribosome after hydrolysis of the ester bond in
                     peptidyl-tRNA has occurred; GDP/GTP-binding protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="ALR14752.1"
                     /translation="MSNTPFLGEVSKRRTFAIISHPDAGKTTITEKVLLFGNAIQKAG
                     TVKGRGNAQHAKSDWMEMEKERGISVTTSVMQFPYNDCLVNLLDTPGHEDFSEDTYRT
                     LTAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDRDVRDPMEVLDEVEN
                     ELGMMCAPITWPIGCGKEFKGVYHIHRDETILYESGHGHEIQEVRIIKGLDNPELDEK
                     VGADLAESVREEIELVMGACPEFELESFLTGELTPVYFGTALGNFGVDHMLDGLTEWA
                     PAPKTRQAVEREVEATEEKFSGFVFKIQANMDPKHRDRIAFMRIVSGTYTQGMKMNHV
                     RLGKQVSISDAVTFMAGDRSRAEHAYAGDIIGLHNHGTIQIGDTFTQGESLKFSGIPN
                     FAPELFRRIRLKDPLKQKQLLKGLVQLSEEGAVQVFRPLQNNDLIVGAVGVLQFDVVV
                     ARLKSEYNVEAIYEGVNVATARWVECGDAKKLDEFQRKNQSNLALDGGDNLTYIAPTM
                     VNLNLAKERFPDVDFRATREH"
     gene            362794..362976
                     /locus_tag="PN96_01725"
     CDS             362794..362976
                     /locus_tag="PN96_01725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14753.1"
                     /translation="MNWLKRGIKRYDDWCKEMGLTPDQKRSCVPYRKDPAHQSEEPNA
                     APKSAESNRKSQDEAL"
     gene            362963..363736
                     /locus_tag="PN96_01730"
     CDS             362963..363736
                     /locus_tag="PN96_01730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020333893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonuclease"
                     /protein_id="ALR14754.1"
                     /translation="MKLFDTHCHFDFDVFQDDFEHNLALAQEQGVSRILIPSVGPSNW
                     LRIQTLAEKYSHLYYALGFHPYFLEENFEQHLAELELYLKQKTPQCIAIGECGLDFAI
                     DVDPQLQEKVLETQFELARRFDLPVILHSRKAHNRLIQMVKAAKLPKGGVVHAFAGSY
                     QQAMEWVRLGFFIGVGGTITYPRAQKTRDAIQKLALENLLIETDAPDMPILGYQGQPN
                     HPAKLIHVLNVLVELRRGEKQSIASQLWKNSNFAFSICE"
     gene            363941..365224
                     /locus_tag="PN96_01735"
     CDS             363941..365224
                     /locus_tag="PN96_01735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005386432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside transporter NupC"
                     /protein_id="ALR14755.1"
                     /translation="MSLFMSLVGMVVLLAIALAFSSNRKAINFRTVGGAFAIQFALGA
                     FVLYVPWGRDLLNGFSSGVSNVINYGNDGSSFLFGGLVSNKMFEVFGGGGFIFAFRVL
                     PTLIFFSALISVLYYIGVMQWVIKILGGALQKALGTSRAESMSAAANIFVGQTEAPLV
                     VRPFVPKMTQSELFAVMCGGLASVAGGVLAGYASMGVPLEYLVAASFMAAPGGLLFAK
                     ILHPETDQPHESIEEAMDGGDDKPVNVIDAAAGGAASGLQLALNVGAMLIAFVGLIAL
                     VNGMLGGIGGWFGMPELTLELILGYAFSPLAFLIGVPWAEAVTAGSFIGQKIVVNEFV
                     AYLNFTPYIGENAQVIAATGEVMSEKTTAIISFALCGFANLSSIAILLGGLGGLAPSR
                     RPDIARMGVKAVLAGTLSNLMAATIAGFCLSLAAL"
     gene            365775..366551
                     /locus_tag="PN96_01740"
     CDS             365775..366551
                     /locus_tag="PN96_01740"
                     /EC_number="4.1.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010450021.1"
                     /note="catalyzes the formation of D-glyceraldehyde
                     3-phosphate and acetaldehyde from
                     2-deoxy-D-ribose-5-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="ALR14756.1"
                     /translation="MSDLKAAALRALKLMDLTTLNDDDTDAKVISLCHDAKTAVGNTA
                     AICIYPRFIPIAKKTLREQGTPEVRIATVTNFPHGNDDIEIAVAETKAAVAYGADEVD
                     VVFPYRALMAGDEKVGFELVKQCKEACGDILLKVIIETGELKEEALIKKASQICIEAG
                     ADFIKTSTGKVPVNATPEYARMMLEVIRDMGVAETVGFKPAGGVRTAEDAAAYLAMAD
                     EILGDNWVDARHYRFGASSLLTNLLNTLEVTDETADPTAY"
     gene            366804..368132
                     /locus_tag="PN96_01745"
     CDS             366804..368132
                     /locus_tag="PN96_01745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017820429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine phosphorylase"
                     /protein_id="ALR14757.1"
                     /translation="MYLPQEIIRKKRDGEVLSADEINFFIQGVANNTVSEGQIAAFAM
                     TIFFNEMTMDERIALTCAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMV
                     AACGGFVPMISGRGLGHTGGTLDKLESIPGYNITPTNDVFGQVTKDAGVAIIGQTGDL
                     APADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASE
                     ELAKSIVAVANGAGTKTTAILTDMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVT
                     MASCAEMLVLGKLAENTDDARAKLMEVLDNGKAAECFGKMIAGLGGPADFVANYENYL
                     EKAEIIKPVYATETGIVSAMDTRAIGMAVVAMGGGRRVATDEIDYAVGFDEFIRLGEV
                     ADSDKPLAVIHARTEEQWEEAAKALRSAIKVGGEYTPTPEVYRQIRAEDI"
     gene            368216..369436
                     /locus_tag="PN96_01750"
     CDS             368216..369436
                     /locus_tag="PN96_01750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009387942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="ALR14758.1"
                     /translation="MKRAFILVLDSFGIGETADAKEFGDVGSDTLGHIADQCEKGLAD
                     NDKRQGALRLPNLSKLGLAMAHKESTGRFAPGLDADAEIIGAYGHAAELSSGKDTPSG
                     HWEIAGVPVLFDWGYFSDKTNSFPEELTNRILERAGLDGYLGNCHASGTQVLDDLGEE
                     HMKTGLPIFYTSADSVFQIACHEETFGLDRLLDLCQIAREELADYNIGRVIARPFIGP
                     GKGQFERTGNRRDLSVEPPSATVLQKLVEEKQGNVVSIGKIADIYANCGITKKVKATG
                     IPALFEATLEQIKEAGDNTIVFTNFVDFDSAYGHRRDVAGYASALEYFDGRINEVLEL
                     MDEDDVLILTADHGCDPTWPGTDHTREHIPVLVYGQKVPAGSLGRRETFADIGQTLAS
                     YFGTSPMEYGKNFL"
     gene            369575..370294
                     /gene="deoD"
                     /locus_tag="PN96_01755"
     CDS             369575..370294
                     /gene="deoD"
                     /locus_tag="PN96_01755"
                     /EC_number="2.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232864.1"
                     /note="catalyzes the reversible phosphorolysis of
                     ribonucleosides and 2'- deoxyribonucleosides to the free
                     base and (2'-deoxy)ribose-1- phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine nucleoside phosphorylase"
                     /protein_id="ALR14759.1"
                     /translation="MATPHINAEMGAFADVVLMPGDPLRAKYIAETFLEDVVQVCDVR
                     NMFGYTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVNEDIKVR
                     DVVIGMGACTDSKVNRIRFKGHDFAAIADYKMVRAAEDAAKARGIDVKVGNLFSAELF
                     YTPDPEMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSDER
                     QTTFNDMMLIALDSVLLGDKE"
     gene            complement(370378..370983)
                     /locus_tag="PN96_01760"
     CDS             complement(370378..370983)
                     /locus_tag="PN96_01760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005439517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMP protein"
                     /protein_id="ALR14760.1"
                     /translation="MSESLFSVRNALRILALILLCVMLFITIKNSVVISKGNEKIQAH
                     QLETLTKVLISQASLSASEMIVNNDQERLLQLTNQLAQDRLVFDATIYDAQGVRLASS
                     EEALSVREVLGLDTPLATASIGRQQLVEPVIADGSVVGFVRVTFETGRVTAISDHHYR
                     KSDRYMYMMVLMSFVCGMLFIMILRRQPIRRKKAENLLLTK"
     gene            371075..372055
                     /locus_tag="PN96_01765"
     CDS             371075..372055
                     /locus_tag="PN96_01765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="ALR14761.1"
                     /translation="MDASKSLPIRKHTTLLNRLPETRFASQLDRAKANWIIFSTYLSP
                     RHFEDIDFYTGFYNPVLETWKVGQYEVALMSGELTSQHETILKSLNLDYASLNEVPDL
                     STTGLIVFDMDSTAIQIECIDEIAKLAGVGEEVAEVTERAMQGELDFEQSLRQRVGKL
                     KGADESILEQVRSQLPFMQDFEALIATMKALGWKTAIASGGFDYFSDYIKDKVGLDFA
                     RSNKLEIINGKLTGKVLGDVVNAQVKSDILVELADEYEIEQHNTVAVGDGANDLVMMS
                     AAGLGIAYHAKPKVEAQAQSAIRYSGLGGVLCILSGALVKQQKISWKSKP"
     gene            complement(372120..374468)
                     /locus_tag="PN96_01770"
     CDS             complement(372120..374468)
                     /locus_tag="PN96_01770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilZ"
                     /protein_id="ALR14762.1"
                     /translation="MLQSEILSLAERLIPVYGSVDFDFVLGQLTEDAPPSAKILVKIE
                     LNRLMAPCKKSIDLRGRVNGECRKYIFDGIPHWLDDVAFNAYHKSTRKYGGYTEGVWE
                     TLISTRNNFRVMGKQAVEEHHSSLSETQSPFSAVPIQLGFDLKRQEKRLKVQSQVEIH
                     RSKGQLLHGVSIDLSSSGAKFKVPSAFKYNLGEIIEVTFTDFASKSQLAGIEKPLTYR
                     ILAVEDCYENDAIRYLRTILLTETNVIDRVIDEVLNSDAKRTRHDNQDKIIRARTRGY
                     EHLALKHTSNLPLFFQGSELKLAMLTPNNQKLWQYWHDERNQQVFGSLFHEERMTSLI
                     TPGVKGTTNVLYSFTHEHDNKTYFYSMLRPEATREQRQLFWHLGAKRKSWRVFRVSIF
                     ELSEQEKEELASFSSELAETSNLLTHVGILQEISDEASGQDYLLTEKPRLPSNTLNAF
                     RHPRRITGQPKGMYFDAQSRRKEPRYRFKTPLALMSGQLNSSGYSVDISKRGLGIQLE
                     TPASLRAGQEIAINFRELQLYDSNLPLSDVPYRVVRVSPDGHRVQLVIGQSSKARRVI
                     AFLNKVIEHNKNKLVQQADVLPSHELLERLHSTILSRSLSSPIFISKTSTGSFKTPVI
                     GVNLPLPKHVEIFAQIGHDNKFILDPIFKGRTSTLIADLIKRIEGVQEKHEDIYISAS
                     KIGNKVTGIESKLHQDFSSLKERIQFIKKARMMGDFYVLRLSTAPIFEPMTSLLQRDL
                     SELTQFSVHQASKLEKELTALIGYSEFEDITEEVLVRLELTE"
     gene            374590..375969
                     /locus_tag="PN96_01775"
     CDS             374590..375969
                     /locus_tag="PN96_01775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017072747.1"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="ALR14763.1"
                     /translation="MAKAKRAYVCNDCGADFPRWQGQCNACGAWNTITEVRIAASPTV
                     ARNERLSGYAGSATESQVQTLSEINLQEVPRFTSGFKELDRVLGGGVVPGAAILIGGN
                     PGAGKSTLLLQTMCSLSGQMPTLYVTGEESLQQVAMRASRLGLPKDHLKMLSETNVDK
                     ICQIAEKEQPRIMVIDSIQVMHVSDVQSSPGSVAQVRESATALTRYAKQNNVAVFIVG
                     HVTKDGTLAGPKVLEHIIDCSVLLDGGTDSRFRTLRSHKNRFGAVNELGVFAMTGQGL
                     KEVSNPSAIFLSRGEEETSGSSVMVVWEGTRPLLVEIQALVDYSQLANPRRVAVGLEQ
                     NRLSLLLAVLHKHGGLQMADQDVFVNVVGGVKVTETSADLALVMALLSSFRDRALPKD
                     VVIFGEVGLAGEIRPVPSGQERLNEAFKHGFKKAIVPAANMPKGGIPGMQIHGVKKLS
                     EAIEAFDEL"
     gene            376175..378265
                     /locus_tag="PN96_01780"
     CDS             376175..378265
                     /locus_tag="PN96_01780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017189168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="ALR14764.1"
                     /translation="MTDLSKYRNIGIFAHVDAGKTTSTERILKLTGKIHKIGDTHDGS
                     TTTDFMEQEAERGITIQSAATTCFWNDHRLNIIDTPGHVDFTIEVYRSLKVLDGGIGV
                     FCGSGGVEPQSETNWRYADESHVSRLIFVNKLDRMGADFYKVVDQVQNVLGATPLVMT
                     LPIGIEEDFVGVVDVLSQKAYVWDESGQPENYEVQDIPADMVDKAAEYREMLIETALE
                     QDEDLMMAYLEEGEEPSLEDIQRCIRKGTRDLAFFPTYCGSAYKNKGIQLILDAVVDY
                     LPAPTEVDPQPLTDSETGEPTGEVATVSADEPLKALAFKIMDDRFGALTFIRIYSGKM
                     KKGDTILNSATGKTERIGRMVEMHADERNEIDSAQAGDIIAVVGMKNVQTGHTLCDPK
                     HECTLEPMIFPDPVISIAVKPKDKGGSEKMGIAIGKMVAEDPSFQVETDEESGETILR
                     GMGELHLDIKVDILKRTYGVELEVGAPQVAYRETITQAIEDSYTHKKQSGGSGQFAKI
                     DYRIKPGEPNSGFAFKSTVVGGNVPKEFWPAVEKGFAGMMQTGVLAGFPTLDVEVELF
                     DGGFHAVDSSAIAYEIAAKGAFRQSMPKAGAQLLEPIMKVDVFTPEDHVGDVIGDLNR
                     RRGMIKDQQAGTTGVRIKGDVPLSEMFGYIGTLRTMTSGRGQFSMEFSHYAPCPNNVA
                     EQVISDVKERNAKK"
     gene            complement(378358..379284)
                     /locus_tag="PN96_01785"
     CDS             complement(378358..379284)
                     /locus_tag="PN96_01785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system regulatory protein"
                     /protein_id="ALR14765.1"
                     /translation="MKDRMPPLQGLYYFFIAAKEGSFKSAAKNLFVTPAAISQQIRQL
                     EEFLGTDLFVRQHRKILLTPQGELLFAQAERGFSHIQQGVRLINQDPNPNQLSISTLP
                     SFAHHWLVPKITAFRQRHPELSLLLEPTNELVSFQDSQIDLCVRYGSGNYPNLESQWL
                     MDEAFYPACHPVYQKEHSIYNIEDLSKAELIEDLWPDLDWNMWLERLGQHAAKPALKY
                     SGSHLVLEAALSLQGVALVKHSLAYQYFRTGKLVRIGDIAIKPKFAYYLCAPKGYLQR
                     PKAQQFAKWLKAEIDSFEKSVNRDFKTIALSD"
     gene            379382..379591
                     /locus_tag="PN96_01790"
     CDS             379382..379591
                     /locus_tag="PN96_01790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14766.1"
                     /translation="MENITKNCERALLTTQQNWIQLIFSKLYLWKRNHRTRRHLRELP
                     EHLWNDIGLEKHEVLKESHKPFWRP"
     gene            complement(379647..381341)
                     /locus_tag="PN96_01795"
     CDS             complement(379647..381341)
                     /locus_tag="PN96_01795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase"
                     /protein_id="ALR17180.1"
                     /translation="MQQPNVANSSAGCALPPPNEMILKWAEERPNEVYLKQIINREFV
                     EFTYAEVADQALKLVSALRNLGVNPGDKVALISKNCAEWFICDLAMMLGDYVSVPIFP
                     TAGADTIEYCLTHSESKVLIGGKLDDSKATQQVINEMGDLISIALPYNTAPMCQHQYA
                     ELIANEVPSVERPQHYDDKLMSLVYTSGTSGLPKGAMLTYGAFSWSVQQLINHIGIQP
                     NDRLFSYLPLAHITERVYIFGSSIMGGVPTAFPESLDTFIEDVKMHRPTLFISVPRLW
                     TLFQQRIQDKLPQKSLNILLKIPFVNSLIKKKLAVGLGLDQARVLGCGSAPVSPALLE
                     WYHSVGLNITEAWGMTESFAYSTINYPFRADKIGTVGNAGPGIELKIADDCEIMVRGK
                     GLFSGYYKNDIATQESFDSEGWLHTGDIGAIDADGYLTIQGRKKDTFKTAKGKFVSPV
                     PIEKKLFEYSRIEMMCLIGLGLPGPILLVVPHDFPHFDKERYERSTRKVIERMNKELA
                     SHEQIKGVLMIKEPWNIENGVLTPTLKIKRHVLEQKYHELGHNWPKGQLVLWEEDL"
     gene            complement(381490..382218)
                     /locus_tag="PN96_01800"
     CDS             complement(381490..382218)
                     /locus_tag="PN96_01800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="ALR14767.1"
                     /translation="MERLVKACWIGGGLPSLPEQFRWVFTQYFELLDHGNDISVISDK
                     EFSYFFYYVTDRPFDLLQSVVTLCENLDKKLIVVYTKGIEANKLPPQHITAEYYALDD
                     NYLSHWLSQIKLKYFFNHSVESSLSLPNKSCSKNGKANFSEVVDYISNNIHRELREED
                     AAALCHYSTTYFSKVFRRKVGMCFRDYVTAKRIALAKKMLTEDNSMKIAYIAYQCGYH
                     DVSYFSRIFKKKTGFSPASYRQQF"
     gene            382621..382794
                     /locus_tag="PN96_01805"
     CDS             382621..382794
                     /locus_tag="PN96_01805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="ALR14768.1"
                     /translation="MDKFTQVLKDFWNDEEGLTLLEYILGAALIVAAMLQLGFWKTLA
                     NAFTNVSTDIDNL"
     gene            382875..383363
                     /locus_tag="PN96_01810"
     CDS             382875..383363
                     /locus_tag="PN96_01810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase A24"
                     /protein_id="ALR14769.1"
                     /translation="MVINLVIWGLIFAIGVSDAQRHRIPNQFVGLLLLAVISDILLDP
                     NAMLWLHVKGMLLTFIVGFALYLGRLMAGGDVKLLTVLGLWLGAETMWSVTPFIIVAG
                     GVIGIFYLALYLASSSYSITEHARAYAVQKVTPGWKSKQPLVIPFAPAIVIGLAYYFY
                     AY"
     gene            383474..384781
                     /locus_tag="PN96_01815"
     CDS             383474..384781
                     /locus_tag="PN96_01815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="ALR14770.1"
                     /translation="MSTIPKTNLVPQISPPPTPTSEDDLGIPSAVIEHLLIKHISAYP
                     KSNLVELSSRMCVVSSIVEHSLAQLRARSWVEVYQPLNATSSYSNVRYGLTELGMAEA
                     ELAFRREAYIGPVPVSLEQYWDVVERQNLRNQPIARADVERALDDVYGAERLIPVLGP
                     AINSGRALLLYGHAGTGKSYVAARVLNALNTSVFIPHAVYADGNIIKLFSEHHHKRVD
                     NSESKTFVKLGDHYDKRWVLCERPNIQVGGELTMDMLEVNHTEHNRVWNAPLQMMANN
                     GIFVIDDLGRQSMPVAAVLNRWIVPMEYFVDHLGLPNGQQISVPFLLTLAFSSNLPPS
                     SIADPAFLRRLGYKIEFNPLELEEYLQLWMDLSEAYQLVLEQGFFDRLKQLHDDSGTG
                     YFPCLPKDILGISRDILKFEEIGEQVSPEILTRAWGLYFTVDE"
     gene            384797..385534
                     /locus_tag="PN96_01820"
     CDS             384797..385534
                     /locus_tag="PN96_01820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaB"
                     /protein_id="ALR14771.1"
                     /translation="MSRTQIVMLLLLSIAFGLGAVMIAKQWLDSQTQPTVKLEEVERH
                     PVLVAAMEIEPGVIIEEKHLKTRLMEVDWIDETTLTEPSQAVGKVASNSIYEGELVSP
                     NRIAVLGEGVTLAAMIPEDKRALTIRVNDVIGVAGFLLPGNKVDVLNTKGNGTTTVLK
                     NIKVLAVDQTARTKDNKPVIVRAVTLEVSPKEAEKLLTENSKGSIQLALRNPLTVDKV
                     PPKRTYTPRPSVTVIKGSQTSNVRVSN"
     gene            385542..387014
                     /locus_tag="PN96_01825"
     CDS             385542..387014
                     /locus_tag="PN96_01825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaC"
                     /protein_id="ALR14772.1"
                     /translation="MKITILLLSHLIMVLASVNVYAAAQSGRVVAVPHHQSTQLMISG
                     SAKKVTLGDPSILDILVLRSNELYLIGKKLGTTNVSVWDRSGRIIESFNVEVTHDLNT
                     LKSKLHQFLPDENIEVHSTQDKIVLRGLVSSQQNMDVAIKVAETFAAGKPADESDDDE
                     EVNESSIINLLSIGGAQQVTLEVTVAEVQRSLVRTFDSNFHFFQQSGDITWGATTIGS
                     AIDDIGPILSGNAGVNEFGFLGSFLDSNTLFTFALDIAKQNGVAKVLAEPSLTALSGT
                     KAEFVAGGEFPIPVPNEDGITIDYKEYGVTLDFIPYILSDKKINLKLNVSVSELATSG
                     VVTYSVGDTNAAYYIPPLTKRSAGSTLELADGQTIGIAGLLSENARNTEEGLPGVSDL
                     PVLGRLFKSEQFTSGETELVILVTPRLAKPVDRRRFTLPTDGFVSPNDVEFYLLGKGA
                     SLDFDKYKLDDNSNASVQDQTEYQFTTGDGGTEGQFGHSL"
     gene            387027..387248
                     /locus_tag="PN96_01830"
     CDS             387027..387248
                     /locus_tag="PN96_01830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14773.1"
                     /translation="MKKAIGLTVCFVALTLVGCATEPELGVALNQLQQEQTLNSNAWY
                     ENIDYLPEGSGERTQTSLEVYNNNGEKKD"
     gene            387275..388615
                     /locus_tag="PN96_01835"
     CDS             387275..388615
                     /locus_tag="PN96_01835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14774.1"
                     /translation="MRRTTPIAMKRSQQGITLVLISLIMLILIGMGALAMDLNHQVLN
                     KARLQNAVDSAALASAVVADETSDVVLAEAAANEALLSFVTASGNNELADNEVVKGNV
                     SITFSNTKQVGSFVNADDFELVTTDGDDDIYVRVVVSDVSLTQYLSSVFGIGKNVSAS
                     AVAGRSAPIVGTCNVSPIAMCGDMNMTDEEGDATVWGYVPNSNYNAKTDRLGSTVHIV
                     KPADNKSGELGPGNFQLLDLGLNGADGIRDAFAGDTNICIAKGEVVDTQTGKATGPVA
                     QGVNTRFDQFNGPTEEDEVVKSDLYTRESDVNADNYESIYDDSPENTELQDDKAFYYA
                     DYHSELTNCSEGGTGDNCTQYYHSNGSEGRRVLRVPIIDCSTATEGKSQVEVIGLGCF
                     FLTQKVKQQGNDSEVFGQFLEDCYVENAFTDIEPDNSKGLYKIQLYKDPEGGAS"
     gene            388617..389087
                     /locus_tag="PN96_01840"
     CDS             388617..389087
                     /locus_tag="PN96_01840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadE"
                     /protein_id="ALR14775.1"
                     /translation="MNIRNQSSLLRRGKYSQAGLAALEFIICLPVLLMLTVLLIDVSR
                     AFIQYTEINKALQNGVRYAVVATYGSLDFGSIANKDSIRNMVVYGKPSPTADDSKILK
                     YLETTDVVIDDTTVPKEVTISASYKYEPIFSRLPFTDSSLEFEIGASSMMRTAP"
     gene            389084..389599
                     /locus_tag="PN96_01845"
     CDS             389084..389599
                     /locus_tag="PN96_01845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadE"
                     /protein_id="ALR14776.1"
                     /translation="MSRWIFRQKGVTQVEFMLIALAVLLVIFSIIEFALYFYSIQMAN
                     EVTRRAARLATVCYIADRDDIKTLPSVEGLYPPGFTADNLTISYLDENGDDVNVDAFS
                     SASSDSDTLNAIFANIRFVKAEADYTFKFFVLSLLLDAVGVSPEFQTILPAESLGVLR
                     PEPGGEVHEDC"
     gene            389610..390833
                     /locus_tag="PN96_01850"
     CDS             389610..390833
                     /locus_tag="PN96_01850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion protein"
                     /protein_id="ALR14777.1"
                     /translation="MLKPVELNKEIKTNSIHSLKTNITVWVIYETSEFKINMESELSK
                     CVNINIEWLDLGKITVTSLGERRTPDVIYIEAGSSWAQKLSHIYSSEGNLQRNQTALV
                     VFGDEHDTTSLKLALKLGASDYLHREVGFYELLPLLEDIANEKASSSEIGELSLFINT
                     KGGSGATTVALNTAIALSEYSKGKVLLIDLGMQFSDAADYLNSKPKYSINDVIDAMND
                     LDDLSLDGLVYKHSSGVNYLCFSADNIKDNYDRATKVSALIPLLRQYYKHIIVDMSHG
                     VEHVFQHIVAPASYVYLVMQQNVTSIKHAANYLKSLQLDHGLTGGQVRLIINRYEKKT
                     SITIKDIEQAFPNQDLLLVPNNFSIAMECSNLGKPIVQSKKNSAIKSSLIDISHQLEE
                     PADKQTQSWLGKLFS"
     gene            390846..392285
                     /locus_tag="PN96_01855"
     CDS             390846..392285
                     /locus_tag="PN96_01855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaF"
                     /protein_id="ALR14778.1"
                     /translation="MFFKRKNVGSNFSQAELLNTKLETHTKPVSKPNSSSAVHSSVIE
                     EKVRKMEAERKQLEHDQTIKHYYHSKLLDTLDLGLLSHLQEDRAKEELREAVVHLIAE
                     DQTHPLSSEARNRMIRQIEDEIFGLGPLEPLLADSTVSDILVNGPKSIFVERFGKLEK
                     TPHTFLDDRHLRSIIDRIVSQVGRRIDESSPMVDARLKDGSRFNAIIPPLAIDGASVS
                     IRRFAVERLNMDNLLHLNSLSEEMAKFLNAAVVGELNILISGGTGSGKTTTLNILSGF
                     IPSDQRIVTIEDSAELQLQQPHVVRLETRPANIEGKGEISQRELVKNSLRMRPDRIVV
                     GEVRGSEAVDMLSAMNTGHDGSLATIHANTPRDALSRVENMFSMAGWNVSTKNLRSQI
                     ASAINLVVQMDRQEDGKRRMVSIQEINGMEGEVITMSEIFKFQRQGVDEEGNVIGDYI
                     ATGIVPDCHDQLIKRGLDVPFEIFNEKVR"
     gene            392294..393262
                     /locus_tag="PN96_01860"
     CDS             392294..393262
                     /locus_tag="PN96_01860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadB"
                     /protein_id="ALR14779.1"
                     /translation="MEGQLSIFLLLLFLSVFFISQALIMPSAGKKVKHRHLIQRIKES
                     HKHIDQESISLLKENSLKNLSGIERFLVQFSLFEVFKKKLELAGIDTTFGKFLFLSLI
                     SGVIAGLVLIFFDQPWYIGVGVAVSIWLVEYFMIQKRIGDRLMKFEEQLPEALDIIKR
                     VLQAGQPINQAFGEVGSEMPAPIGPEFKNTFSLLNYGYDMRLAIMQMSERVPTVSMMA
                     FSSAVLLQKETGGNLIENIEKLSRVLRDRFKLARKIKTVSAESRMSAWVLVLAPFAMY
                     IIITIIEPEYISTLHNHPTGIKMIIGGMISLFIGSMWIRKIVNFEV"
     gene            393265..394212
                     /locus_tag="PN96_01865"
     CDS             393265..394212
                     /locus_tag="PN96_01865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadC"
                     /protein_id="ALR14780.1"
                     /translation="MDMINNFLVNFNISQDMFFMLFILITTVLFVLTVGYIIIGVKSP
                     VKRKLSEIASGGQAQTTSSRNEKVMNTLESLAPLTASGNEKDRQSNRMLLMNAGFHQK
                     NALSLFYSIKSLTTIVGLLISLGLYLSLTESTNLYIYIAACAFIGLVLPDFILKRMVK
                     QRQNRIRSGVADMLDLLVVCTESGLGFNASLRRVADEMVISHPELADEIDTVCMKIQA
                     GKSMPDSLREFVIRTGLDEFMGLVSMLSHASRVGGSLVDSLREYTEDYRDKRQQAAEE
                     IAAKIPVKMMFPMVLFIWPCFFIVAIGPSLIQLAEAFKQ"
     gene            394256..395272
                     /locus_tag="PN96_01870"
     CDS             394256..395272
                     /locus_tag="PN96_01870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat protein"
                     /protein_id="ALR14781.1"
                     /translation="MWKVYSLTLCILLISGCASNETKKTDFDKSLYSGKPVEALTNDE
                     PPANEEEAISRGDAALTSNNTDLALYEYIRSLSFDDGVHKDKTLYTIGRIHESRNDFE
                     LADRSYRASLAENPNNIGSLEELGKLNTKQGRKDVGLSYYLRALNADQLRLGAQGNIT
                     VNNISRENISSLRYDEKSPVNAYIGLGVLYDINNNHEIAHAFLHKALEIKPYNERALV
                     SLGYSYYMVGAYGKATYFTNAALNLNNSNEKAINNLGLIAIAQGEPRKALGIFGQHMS
                     TSEALNSVGYFLILRGEPGEAIPYLQEAIDQSPSYYAKANENLERALAMVRADRDTSK
                     AVLQ"
     gene            complement(395409..396350)
                     /locus_tag="PN96_01875"
     CDS             complement(395409..396350)
                     /locus_tag="PN96_01875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bactoprenol glucosyl transferase"
                     /protein_id="ALR14782.1"
                     /translation="MDISLIVPVFNEESTIDFFFNEVKNNQFLSKKDIEIIFINDGST
                     DNTEIEISKIIKKDPNITLINLSRNFGKESALFAGLEASKGKFVVPIDVDLQDPIYMI
                     EVMFDKINNGYDVVLAKRIDRSSDSYIKRNTANLFYKVHNLISDIKIEPNVGDFRMMS
                     RTVVDSIISLSETQLFMKGVLSWIGYNTTIVTYRREKRSAGNTKFRVLKLWNLAIEGI
                     TSFSTVPLKLWTYLGLAISLSSFLYAINLILDKLIFGNDVAGYPSIMVSILFLGGIQL
                     IGIGVIGEYLGRVYMETKRRPRYIIRDILHSKVDNNQ"
     gene            complement(396355..396705)
                     /locus_tag="PN96_01880"
     CDS             complement(396355..396705)
                     /locus_tag="PN96_01880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014167692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14783.1"
                     /translation="MIINFSIYALIGVLNTTIHWVVFYIFYSLNFEQSYCNLVAFVCA
                     ASFSYILNSKYNFKIELKTNKYIYFVIIMGVINYLIGLNSENIELSPLLTLVISSFLS
                     LFLGFIVSNFFIFR"
     gene            397171..398367
                     /locus_tag="PN96_01885"
     CDS             397171..398367
                     /locus_tag="PN96_01885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010932130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14784.1"
                     /translation="MFLQAKTSKFILIVGMLVGFLGSFKFVYSDNQDFFKGELSRGQV
                     LGRDFLNWWTVANLAAESKYNDIYNPELLVSHTSNDIKKSGVVFNFAYPPQTLFPVSV
                     LSNFSYIKALILWSFIGVFIFSIPAFIFQKSKLFSLLVVFSPTTFLNLTTGQNGLFTG
                     ALLICGLMLLESKPILSGLLFGLLTIKPHLGLLIPIALIAGGYRKAFIWAVISTVSLI
                     IVSVIFFGVGVWDAWFNNSPWDYSKNFIESGVGLAIFMQPSPFVSIRMLFDNINLAWF
                     FQALSSIFTVGCVIYAFKKCKLLELKVSVLIVATYLVTPYIHSYDMTAFSMVIIWQLS
                     RGIQRGFIYGEQTLLMVAWLMPISMMPLGYLGFPVFPLVTLTLLIFLMYKIKDYERFN
                     DDLIFK"
     gene            complement(398371..399099)
                     /locus_tag="PN96_01890"
     CDS             complement(398371..399099)
                     /locus_tag="PN96_01890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015117226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14785.1"
                     /translation="MERESYNDMYIYEDVHWWFTARRSILQKVLNQHCRYNNPKNILE
                     VGCGSGGNLQMLKAYGDLFAMELDDNTREIANRRNICDVKKGILPNDIPFDDRFDLIC
                     IFDVLEHIDDDLETLKSLRKKLTHKGKLVITVPAYMFLWSAHDEANHHKRRYTRKQLK
                     DIVSASGLSIIYTSYFNTILFPIIAAVRIINNILNKNTESDVNLPSKPVNNLLKKIFS
                     FEKTFLPTISFPFGVSIILIAKNE"
     gene            complement(399300..400475)
                     /locus_tag="PN96_01895"
     CDS             complement(399300..400475)
                     /locus_tag="PN96_01895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichol-P-glucose synthetase"
                     /protein_id="ALR14786.1"
                     /translation="MAEKMDLNNCELTILMPCLNEAETLNTCIVKAQNFIKNNNINGE
                     ILIADNGSTDGSQDIAKENGAIVINVKEKGYGSALLGGINKANGKYIIMGDADDSYDF
                     LKLEEFLSKLRQGFDVVMGNRFKGGIAPKAMPWLHKYIGNPILSYLGRLFFNIPCKDF
                     HCGLRGFNREKIIQLNLRTTGMEFASEMVVRSALSHLKITEVPTTLSPDGRTRPPHLR
                     TWRDGWRHLCFLLMYSPKWLFLYPSTLLFIIGLTTIINLFTGPLTINNVTFENKTFFA
                     GCLCMLISIQCFSIGLFVRRYASERNLLPDSKYKSWLNKITLESGSFIGLSLSGVGLT
                     GFIWCVIQWSEVSFGDLKSDIVSRVMILSMTLLASGIQTFCISFLGSIISIKNLDHN"
     gene            complement(400486..402210)
                     /locus_tag="PN96_01900"
     CDS             complement(400486..402210)
                     /locus_tag="PN96_01900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005555944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14787.1"
                     /translation="MNQQSNQRFDTKPYVPLILSITLAVAIFFVRYTGVAEWDLGDND
                     NFMRLHQVMTFIESPSWYVQPLRDFNPQDGQIIHWSRIPDLPILALYYVSRLFVDHTN
                     ALQFSIAIVPLIYLVFFILILCQISREILGIDRHILTIIYTFFSISAIKFYPGYIDHH
                     NLQVLLYSIFILLTFSPNYKEKLYVYGCAISITVSLLIGLEVLPFFIITLALLTIYAL
                     YSDLKKLKFIRDISLLTVVSGVIGIMIFQPVSIWFNPQYDILSLPLLCFFLAAAISIS
                     LTLLNPRLTVLLLSSFACIGLTWLIFPNVLKSPYSDYPEPLVTYWLSHVLEARPLTTV
                     IKDASELSQIWLYFVTIVPAALSIFLLKNNIKKLYYLLFIISLIPAIFWQVRTIIYSS
                     MLAIPLNLTVGLYLFNIINIPVLRILPPFLIAPALSTIIVLQIEILLGVDDTEKDVKT
                     MSTHEYIKKLDIEGKKILAPMDNGAEIVTLTDNYIIAAPYHRNIRGNLLYVNTLLSDN
                     YHTAYKLLREEGVDLFVFNNNDSQTKYILSGANDKSLVKLLSNNKQPEWLTPISKSYN
                     GIFIYSIN"
     gene            complement(402567..403709)
                     /locus_tag="PN96_01905"
     CDS             complement(402567..403709)
                     /locus_tag="PN96_01905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate-binding protein"
                     /protein_id="ALR14788.1"
                     /translation="MFTIFKTFFWLGWFSFGGPAAHIGYFRQTFVEKLKWLDDSEYAQ
                     IVALSQFLPGPGSSQVGFALGYKRGGLGGACAAFIGFTLPSVLIMLVLAMVSSQVTDT
                     ALFQNIVHGLKLLAVVVVADATWGMYKNFCQTKLTAGLCVATTIALLLVPGITTQMLV
                     LIIAGMVGVLYLKKESAIPAQPFKPNLTPLVIFAVLLFGLPLIAHTTPMVSLLNDFFQ
                     AGSLVFGGGHVVLPLLENILGDQISQDAFLTGYAAAQAVPGPMFTFATYLGYQLTETP
                     ALSALVATLTIFLPGFLLLLGVLKNWQRLAAKPAISGAVSGVNAAVVGLLLAALYQPV
                     FTSAVADPIDIALVIAGFYLLKKLNVSILWMIMFFVGVGVVNGLNN"
     gene            403824..404741
                     /locus_tag="PN96_01910"
     CDS             403824..404741
                     /locus_tag="PN96_01910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="ALR14789.1"
                     /translation="MKDDVQWRNIDLNLLVTFSYLYRYRSVSLAAENSYVSQSAMSHS
                     LSRLRLLFDDPLFERKGHKMEPTEHAHNIAPIVHNLLDSITKDLLTKSEFQPQSYSGV
                     CRIGLTDYAEFIFAPAIYDEIHRQASDAKISFINVDRSNYMQRTERDKLDLVIGSIPA
                     PEEDYCSQYLYTEKHVCLCDKKVLNGKSALSVVEFANIKQALVSPDGSLKTQVDQKLA
                     EHGLSRQVTVASRNFLTIRHLLKQRDLIAIVPEKMALAEGFSDDLVTIQPTISVADFE
                     ISMIWHTSRENDEKGIWLRKLVAETITSQ"
     gene            complement(404748..405740)
                     /locus_tag="PN96_01915"
     CDS             complement(404748..405740)
                     /locus_tag="PN96_01915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ALR17181.1"
                     /translation="MAKLKDVANEAGVSLATVSRVLNNDPTLNVKQETKRRILEIADK
                     LEYRTKSSKGSTGKSTQRHHFLALYNYRQELESSDPYYLSIRHGIESQCEKLGITLTN
                     CYNNELETDTQKVTGILLVGDIEQKIINKLPKRLENFICCIDVSEQDNPYDCVSADLE
                     RISKQVVDFYANQDYRRIGFIGGQSQTDSTDNRKTAFVEYASLRGLVSESDIYYGDGS
                     SQSGYDLGTEMLAKGDIPTAIFVTSDTIAIGVLRAIHECGLHIPNDIAMISMNDIPTA
                     SFTFPPLSTVRIHSEMMGAQGVNLLVEKHRDDRKLPLKVYVPSELILRNTTKIG"
     gene            complement(406385..407383)
                     /locus_tag="PN96_01920"
     CDS             complement(406385..407383)
                     /locus_tag="PN96_01920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334325.1"
                     /note="controls transcription of galETKM; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ALR14790.1"
                     /translation="MATIKDVAKEAGVSVATVSRVINKSPKASQNSIDAVTQAMSKLG
                     YRPNAAARALVSQSTNTIGVLVSDVSDPFFGTLVKSVDNVARENGKHILIGNGYHNAD
                     DERRALDLLANSRCDALVIHAKGLSDEELIAYAKEVKGLVLINRHIPVLAERCISLDN
                     RKGAFLATEYLIRHGHRKIACIASSHDIEDTDERLQGYQSALKEHGIELSKSYVEYGE
                     PNSDGGEVAMTNLLTKSLEITGVVAYNDYMAAGALATLEQNGIDVPQQVSMVGFDDGL
                     IARFVHPGLTTIRYPIEIMAERATRLALALSRNEKVEDETIIFSPTLVRRDSVAKV"
     gene            407844..408440
                     /locus_tag="PN96_01925"
     CDS             407844..408440
                     /locus_tag="PN96_01925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="ALR14791.1"
                     /translation="MKKVMPLLVLGAVVASASVQANDNWYVGVDVLNSDLEVEGISSD
                     DSVTGLGIVLGSEVQYSENFKLALEAEYVSYGSFEKKESSMGDWVKVSIDGYAFNLNA
                     KPKYQFSESGFYIGALAGLGVIGVDFEVASNILDANGKTDGSDVGFNYGAEVGYEFDS
                     GFIVSGGYRASSVTIDVEGGGELDFDFDSVYVGVDYKF"
     gene            complement(408473..409024)
                     /locus_tag="PN96_01930"
     CDS             complement(408473..409024)
                     /locus_tag="PN96_01930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14792.1"
                     /translation="MYIFGYGSLINSASRKLTGQTGAAIPVIAHGLVRYWGKIDESYT
                     LSPLVVNEGQGQVNGVLLEVNDEALAEFDRRERGYHRIQLRPDQIETDQPFNPDHAIW
                     VYVKDEPLPPCSNSPIMQSYVDTVLAGCLEVSHSFAEHFVRHTVGWQHAKENDRHQPK
                     YGNLAGVHDHHYELIDALIEKGA"
     gene            409238..410422
                     /locus_tag="PN96_01935"
     CDS             409238..410422
                     /locus_tag="PN96_01935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="ALR17182.1"
                     /translation="MLNITDKKVEEKIPAWLRLGFRPFFLFGAIYAIVAIAMWVWMFQ
                     TGQPSALRVPALWWHVHEMLFGFSMAIVAGFVLTAVQNWTGINGTKHYTLLAIFALWL
                     APRILLWTPIPLWLTSTIEALFLLFVAYEVGIRVYRSKGWRNLFFVPLFLLAIFANFA
                     SYATVKGMPPFSSSAVWHAMLWWFTLLLSVMGARVIPFFTARRFNFEKAQPLVWLDWL
                     ANLPLVMLFILSFFPVTFSQLGQPLMVFAGIAQLVRFLRWKPWLTLSEPLVWSLHAAY
                     LCLPLSLLLRGAWGDAFASHNLIHLFAIGALGGLILAMISRVTMGHTGRMIYKGPNMS
                     IAFAAVIAAAVVRSFAVIFDPARMMLWIDISGGLWIFAFGMFVWRFGFMLVTPRADGH
                     PG"
     gene            complement(410479..411426)
                     /locus_tag="PN96_01940"
     CDS             complement(410479..411426)
                     /locus_tag="PN96_01940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="ALR14793.1"
                     /translation="MGFMIEHWDFSTPIATQEATTSQEIKAKHWYHCERLHPDIRGWL
                     EHNQVPKATVDHLLADESRPSFHPLDDENFMLILRGINMNENASPEDMLSIRILYFQG
                     ALISTRKIPSRAIMEIRQALAEQKGPKSLASLLNQIIEGLNGKIDLYLDTIEETLNHF
                     DVNDESTYKHISAQKALISIKRFIRPQQYAIRDLLESSSDLVVSRPHQYRFAHNNITR
                     INETIDFYLGEVALFQEEIKHNRDEKTNKNSYLFTLVATIFLPTSFLTGLLGINIGGM
                     PGVDSATAFTWFCVALIIIFALEWLLLKRFGLTNKSDDE"
     gene            complement(411569..413128)
                     /gene="glpD"
                     /locus_tag="PN96_01945"
     CDS             complement(411569..413128)
                     /gene="glpD"
                     /locus_tag="PN96_01945"
                     /EC_number="1.1.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005386491.1"
                     /note="in Escherichia coli this homodimeric enzyme is
                     expressed under aerobic conditions; anaerobic expression
                     is repressed by the arcAB system; converts
                     sn-glycerol-3-phosphate and ubiquinone-8 to dihydroxy
                     acetone phosphate and ubiquinol-8; associates with the
                     cytoplasmic membrane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="ALR14794.1"
                     /translation="MSIQKNASTTDSSTPLDLIIIGGGINGAGIAADAAGRGLSVGLY
                     EANDFASATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVILRKAPHVALPMRFRLP
                     HRPFLRPAWMIRCGLFLYDNLGKRTTLPGSKTVNLAKSGLLKPEIKTGFEYSDCWVDD
                     ARLVLLNVLAARENHAEVRNYCRVEKAHRESGIWHVTIHDTMTDQRFERKAKALVNAA
                     GPWVKQFFDEGLEQASPRNIRLIKGSHIVVPRIHNEPQAYILQNKDNRIVFMIPYLDK
                     FSIVGTTDVEYKGDPREVAISDDEVDYLIDIVNQHFVHQLSREDVVWTYSGVRPLCDD
                     ESDSPQAITRDYTLELDAEFDQAPLLSVFGGKLTTYRKLGEAAMKKLAPFLPQMGGNW
                     TANQALPGGNFSCSREQLAKQIHAKYAWAPKALILRYVTQFGTQTWELMKGATSEADL
                     GQAFSTQAGGVYQREIDYLMNHEMALTDEDILWRRTKIGLYMSDEEKLSLAEYLKEKL
                     QQKVVNLSQVG"
     gene            complement(413304..414098)
                     /locus_tag="PN96_01950"
     CDS             complement(413304..414098)
                     /locus_tag="PN96_01950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232827.1"
                     /note="represses the glpD, glpFK, glpTQ, and glpACB
                     operons involved in glycerol-3-phosphate metabolism;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ALR14795.1"
                     /translation="MKQIPRHQQIVELVKKQGYVSTDELVERFNVSPQTIRRDLNELA
                     DDNRIRRYHGGATIPLSSENTSYNTRKALNFNEKDVIAEEVVKHIPDGATLFIDIGTT
                     PEAVARALNKNHKQLRVVTNNINVATILYPNPEIKVILAGGEVRNRDGGIVGEATLDF
                     VKQFRLDFGILGISGIDFDGSLLDFDYHEVRVKQVIIDNSRSVFLAVDHTKFGRNAMV
                     KLGNIAQLNMIFTNKQPPEEILSILKEASIPLEVVDANGATDEENK"
     gene            complement(414278..415795)
                     /gene="glpK"
                     /locus_tag="PN96_01955"
     CDS             complement(414278..415795)
                     /gene="glpK"
                     /locus_tag="PN96_01955"
                     /EC_number="2.7.1.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232826.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="ALR14796.1"
                     /translation="MTEQKYIVALDQGTTSSRAVILDHDANIVSVAQREFTQIYPQAG
                     WVEHDPMEIWATQSSTLVEALAKSGIRSDQLAAIGITNQRETTIVWNKETGKPVYNAI
                     VWQCRRTAEICEDLKRRGLEDYVRDNTGLVLDPYFSGTKVKWILDNVEGAREDAEAGK
                     LLFGTVDTWLVWKMTQGRVHVTDYTNASRTMLFNINDLCWDQKLLDELGIPASMMPEV
                     KRSSEIYGKTNIGGKGGTRIPIAGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMNT
                     GQEKVTSTHGLLTTLACGPKGEPAYALEGAVFMGGASIQWLRDELKILNGAEDSEYFA
                     TKVDTSNGVYVVPAFTGLGAPYWDAYARGTIVGLTRGVNSNHIIRATLEGIAYQTRDV
                     LDAMQADSGIQLANLRVDGGAVANNFLMQFQSDVLNTQVLRPEVTEVTALGAAYLAGL
                     AVGYWDSLDELQGKAVIDRTFEPHDDEEKRNRRYKGWKRAVKCAQTWSELHDEDD"
     gene            complement(415855..416706)
                     /locus_tag="PN96_01960"
     CDS             complement(415855..416706)
                     /locus_tag="PN96_01960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232825.1"
                     /note="involved in the transport of glycerol into the
                     cell; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator GlpF"
                     /protein_id="ALR14797.1"
                     /translation="MTTNKHPSLFGECLAEFIGTGLLIFFGVGCVAALVLTGASFGQW
                     EISIVWGLGVTIAIYCTAGVSGAHINPAVTIALAMFHGFDKAKVLPYIIAQLLGAFCS
                     AALVYSLYANLFTDYEIAHNFVRSSQEALATAGIFSTYPNASLSFMGAFAVEFVITAV
                     LMFAILALGDESNGASRGAMNPLLIGILIAVIGGSLGPLTGFAMNPARDFGPKLFAYF
                     AGWDYALTGAKDIPYFIVPILAPIAGACFGGWLYPKAIAAYLPKQGHGCTIPNQCDTE
                     ETEQARA"
     gene            417456..418820
                     /gene="glpT"
                     /locus_tag="PN96_01965"
     CDS             417456..418820
                     /gene="glpT"
                     /locus_tag="PN96_01965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334317.1"
                     /note="catalyzes the uptake of glycerol-3-phosphate into
                     the cell with the simultaneous export of inorganic
                     phosphate from the cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate transporter"
                     /protein_id="ALR14798.1"
                     /translation="MFGIFKPKAHIDRLSPDSIDSTYSRLRWQLFIGIFVGYAGYYLV
                     RKNFSLAMPYLIEQGFSRGDLGVALAAVSIAYGLSKFLMGSVSDRSNPRYFLSGGLLM
                     SALVMFCFGFMPWATGSVTAMFILLFLNGWFQGMGWPACGRTMVHWWSRKERGEIVSV
                     WNVAHNVGGGLIGPLFILGLWAFNDDWRTAFYVPAFFATLVAVFIWMTVRDTPQSCGL
                     PSIEEYKDDYPDDYDKSHEQEMTAKEIFFKYVFNNKLLWSIAIANAFVYLIRYGVLDW
                     APVYLKEAKDFSVDKSSWAYFLYEWAGIPGTLLCGWISDKIFKGRRAPAGILFMALVT
                     VAVLVYWFNPAGNPTVDMLALIAIGFLIYGPVMLIGLYALELAPKKAAGTAAGLTGLF
                     GYLGGAVAANAILGYTVDHFGWDGGFIILIGSCITSIVCLTYAFLGERAHHDQKAREK
                     EAVA"
     gene            418877..419932
                     /locus_tag="PN96_01970"
     CDS             418877..419932
                     /locus_tag="PN96_01970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005524061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="ALR14799.1"
                     /translation="MKTTSVCLTFLALSLSAGAIAKPLVIAHRGASGYLPEHTLEAKA
                     LAYAMKPDYIEQDVVMTKDDQLVVLHDHYLDRVTDVAERFPDRARKDGRYYAIDFTLA
                     EIKSLRVTEGFNIDDNGNKVAGYPTRFPMWKSDFTVPTFAEEIELIHGLNKTLGYDIG
                     IYPEIKAPWFHRHEGKDISKAVLKVLKQYGYDSQDDNVYLQCFDANELQRINSELMPE
                     MGMDLKLVQLMAYTDWNETMVYKGDTATPYDYDWMFEAGGMKKVASYAEGIGPWKPML
                     VDDKSTQNNIIIKPLMKAAKDAGLQVHPYTFRADPGRIPAYTDSFEGMMDVFYNQVKV
                     DGLFTDFPDKAVSFLNK"
     gene            complement(420012..421043)
                     /locus_tag="PN96_01975"
     CDS             complement(420012..421043)
                     /locus_tag="PN96_01975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019274127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase"
                     /protein_id="ALR14800.1"
                     /translation="MAFFSLAFGTATKNRDGKIIEAFFPNPVLNPSDELVNALAAVAG
                     YEQGNQAIEISAAQSAELAAAFEANGDAANASFATKAAESAQPLVLVILASDEQPQSV
                     AEGFLKLQLISNRLVKPHGTVLDGIFGLLHNIAWTNEGPIDLPELADRQIEARLAGRT
                     LSVDCVDKFPKMVDYVVPTGIRIADTSRVRLGAHVGEGTTVMHEGFINFNAGTTGVSM
                     VEGRISAGVVVGNGSDIGGGASIMGTLSGGGTVVVSIGENSLLGANAGLGFPLGDRCT
                     LESGLYVTAGTKVRMLDKEGNEVEIVKARDLAGVSDLLFRRNSQTGQVECLANKSAVE
                     LNSELHSNN"
     gene            complement(421506..423260)
                     /locus_tag="PN96_01980"
     CDS             complement(421506..423260)
                     /locus_tag="PN96_01980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PKD domain-containing protein"
                     /protein_id="ALR14801.1"
                     /translation="MYKFSSLVITLFLVGCGGGGGGSDSSGNIRVFSPQPTVDIVGHT
                     MLPLTAHIAFDSKGVTAQQIHVGVASESPLVKNAEIVFTSETGGILKIDLEPGYKAGN
                     GTTQHQISMLACFDEYCNEHVPGSPINATINYSVELNEQAILLEDETIHYHAATNALV
                     DNNLKQRTIRLRGNHGDQLKLSRSDGEVRVNQLSLTPKSYDEYAALIDLKLPHNLAVG
                     DYSGDLELNVCYDEQCDYPVAGSPLQVPMDFVIEAPTQALSNALAVNERLKFGYEVLQ
                     AAYVPGLNLLVMTSKSPASQLHVYDLATGKTHSFSLSNQPVSLTVDTLAKQGRVVVAT
                     EYQAEVFDFNSADLATPTRQQISTSYNSPSIAVRRDDLFAAGSNLEVIDISTKSSEIS
                     EGVYWYSPDIKLGSNGDVLLGLEANLSPQSFTGVFVESGQWNLQNTEDEYHGDHSHGG
                     IFWFDKAGEYYIDGNGNYYTLKDGTHLDLKWAGQLPLSELSDTYKPSITAFIDTGSEY
                     VIAEGEQSRQLRVIDKASNTVIETFAATNREGSWGADEEHIQFAFVADGGEIYMIKSL
                     NDYTTSWEYAQPELVRVK"
     gene            complement(423589..423885)
                     /locus_tag="PN96_01985"
     CDS             complement(423589..423885)
                     /locus_tag="PN96_01985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug DMT transporter permease"
                     /protein_id="ALR14802.1"
                     /translation="MAVIVKYVVERNGEEKMTFTSKAEADAYDKMLDMADELFSLLGK
                     SELLEEEDKQEDLAMFLAQNKEEVLYALGAKRRPAPKKAKKLEAVEEDKNEDAA"
     gene            complement(424014..424919)
                     /locus_tag="PN96_01990"
     CDS             complement(424014..424919)
                     /locus_tag="PN96_01990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="ALR14803.1"
                     /translation="MASHISLKQLKVFTTITQHKTLTAASESLFLSKAAVSMALSELE
                     KQIGHHLFDRVNNRLILNQEGQKLLPLADELLNRAKDIESIFEGDHALTGQLRIGASD
                     TIGNQVAPFLLSAFRQHTNHRSQSLFISNSAQICDKLTDYELDIALIEGKTLHPELQS
                     SQFSEDEMCVICSPEYPAAHEGMMNLAELENSEWILREAGSGSREFFLRVIAPRLEHW
                     HEAFQLNTTEALINSVSAGLGLGCLSRLSADPAIREGRVKVLEMPLDMKRRFWLLVHK
                     EKYQSPLLKTFIEFCQSWQSPVNNK"
     gene            425029..426003
                     /locus_tag="PN96_01995"
     CDS             425029..426003
                     /locus_tag="PN96_01995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005386508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="ALR14804.1"
                     /translation="MIQKTKAKLIDAPTPMAGLALGIASLGWSWENFAELHGYGQWVS
                     AGIASVLLTILAIKFILHHQLLRQDLAHPVVGSVVPTFAMGTMVVSNSLGQWLPLAGD
                     ALWLVAVVLHIVFLVSFVYHRAKEFELHHMVPSWFVPPVGIIVADVSFSGNPVLAPVA
                     QGALMFGMVAYAIMLPMMIYRFMFTHEIPDAAKPTMAIMAAPASLSLAGYLTVTATPS
                     PVIIAMLFGIAVLMTAIIYLAFFKLLRLPFSPGYAAFTFPMVIGATALFKMANWMEAQ
                     GLASDYVQQVRGLAGLELIVATFVVSYVALQYINNLLIQPRLIQAHHA"
     gene            complement(426079..427902)
                     /locus_tag="PN96_02000"
     CDS             complement(426079..427902)
                     /locus_tag="PN96_02000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ALR14805.1"
                     /translation="MIRKPSSNSAWLIAFFACFAVYLSITCYPFVLSSNQNEPLTLLQ
                     GYYLASTQFGWLGLVVLPFMLLSLLLSFLPTRLFKGIVIAISICLLIIFKVDILVFQQ
                     YKFHINALLIRMFFEGGSDVFDISWMSWLIFGSEVTVLVLGLACTVWLSNKLAESRAK
                     FLLISVWFAMLLSTQMIHAYKNALYDDEVSQYSNNWPLYYPLTARKFIYKHNLVDESI
                     ASKNRVELSNVESSSLNYPLEPVQVQSKTTLPNVLFILVDAWRYSDATPEVMPNVSEF
                     AKQTLNFTQHMSGGNSTQAGIFSLFYSLPATYWESFYASQRSPLFMDTLQQEGYRMGI
                     FGSAPLTSPPLSRTVFKKVPDLTLKQTGETAVERDQQITDKFIEFQKQDSEQPYFGFL
                     FYDSAHGTLFPEPEFAKFKPYWERVDHILLNNDFDASLYHNRYKNSLYYIDNLIGEVL
                     KIVDLDNTIVVLSSDHGEEFNDHKMNYWGHTGNYSDVQVHVPLYVSIPNHQPEKIDYR
                     TTHFDVVPTMMNMLFDVQGKTSAYSVGHNLLDNSAPRDWYIAGSYYNYALIGKDLILV
                     VNPGGHSQQLDNQLNVEKEHHIPVNIIRHFLDEMSRFYKKG"
     gene            428153..431644
                     /gene="recC"
                     /locus_tag="PN96_02005"
     CDS             428153..431644
                     /gene="recC"
                     /locus_tag="PN96_02005"
                     /EC_number="3.1.11.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232816.1"
                     /note="catalyzes ATP-dependent exonucleolytic cleavage in
                     either 5'- to 3'- or 3'- to 5'-direction to yield
                     5'-phosphooligonucleotides; component of the RecBCD (Exo
                     V) helicase/nuclease complex that is essential for
                     recombination; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease V subunit gamma"
                     /protein_id="ALR14806.1"
                     /translation="MFTVYHSNQVDVLKSLLVELIRISPLENPFEKEQILVQSPGMSQ
                     WLKMELAKEFGVAANIDFPLPATFIWEMFTQVLPDVPKRSAFNKEAMTWKLMHLLPGL
                     LNQETFSPLAQYLKDDSDNSKLYQLAEKIADIFDGYLVYRPEWIASWEAGQSVPELED
                     EHPWQPILWQALYDHTVSLGQSPYHRANLYEHFIDTLENFNGNFDHLPKRLFVFGISS
                     LPPRYMDALKAIGEHIDVHLMFTNPCRYYWGEVRDRKYLARLAAKHRQHVVWQDDHSE
                     VQGETEQLKGSVEDNVLDELHTDVVGNSLLASMGKLGRDNMYLLSQLESHEIEAFVDV
                     ERDSLLHQLQGDILNLEEHQDDQQIEHSGHKQVVSLGDKSLSLHACHSPMREVEVLHD
                     QLLAMFDADPSLKPRDIIVMVADINAYSPAIQAVFGNAPGERFIPYSISDRTADQESP
                     ILAAFMQLVNLPNTRCLASELLELLETPAILKRFELSEDDFLQAKQWVEASGIRWGLD
                     ANTGREFELPETRQNTWQFGIQRMLLGYAMPESAGLFETEQGSLSPYNEVQGMGAELA
                     GKLAHFIQQVSTYRRKISHVQTIDGWRETLVTLLDDFFSVELEGEMALKSIRDTLSQL
                     KEQLADAAFEEVLSPAIIRQYLQDKLSGTRVSQRFLAGQVNFCTLMPMRSIPFRTVCL
                     LGMNDGVYPRSMPPEGFDLMTGRTKPGDRSRRDDDRYLFLEAMLSAQQTLYISYVGRS
                     IQDNTERVPSVLVSELMEYCHQNYCLGGDEGLPVDESGDNLLKALVNTHAMVPFSPSA
                     FQGIHSSYAKEWVPAALTQSSQSQGYVRHDFNRALDDYLLGATFPLELDLVELQRFWR
                     LPVQYFFNRRLKVVFEPPLPVMEDDEPFVLGGLESYQMRDELLETLLETTLTQPEKKT
                     DVLKHFMSQQRAQGKLPVGAFGDIEFETNRVQAEELVDKLAFLSGAPQDDLEIDLTFD
                     SLFEGNEGDEKKVRLTGWLTQCYQSGLIRYRSGRVRSQDYLAAWIDHLAMSASGHAKK
                     THIIGYDRKEGAVHLIYPEIADAQYAKQLLTELVRLFFEGMTKPLPYFPQTALACVEA
                     GFSRGHWADDEEKSLKKMADTFNDGYMSSGEGNNAYIARIWPAWNDDLAKEVRLLTAL
                     VLQGARLAVQDADDIKA"
     gene            431951..435634
                     /locus_tag="PN96_02010"
     CDS             431951..435634
                     /locus_tag="PN96_02010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit beta"
                     /protein_id="ALR14807.1"
                     /translation="MDQMSGAELPNHDLEATGQPQPTPLEAMTFPLHGARLIEASAGT
                     GKTFTIAGLYLRLLLGHGSAETKHRVPLTVDQILVVTFTEAATAELRDRIRARIHDAR
                     IAFARGQSSDPVIQPLLSEFDDHKQAAEILLQAERQMDEAAVYTIHGFCQRMLTQNAF
                     ESGSRFNNEFVTDESHLKAQVVADYWRRNFYPLPFTLAGEIRQLWGSPSALLSDISNY
                     LTGAPLSLSVPAMKGSLADVHTENLKKIDELKAQWRGSQDDFLALISDSDINKRSYTK
                     KSLPTWLEAVNAWAATETTGYDYPDKLEKFAQNVLSEKTPKGSAPQHYVFEAIEAFLA
                     NPISLKAPLLAHAIEHCRVMLASAKNQKQWLSFDDLLTQLSASIDTDESELLAERIRT
                     LYPVAMIDEFQDTDPLQYSIFSRIYLNNPECGLFMIGDPKQAIYGFRGADIFTYIKAR
                     NQVSAHYTLGTNWRSSADMVQAVNQVFALPDSPFIYDSDIPFLPVNYSPNAEKRIWTM
                     GGQKQPALTYWLQNAEEKPLPKGEYLTRMAEATASQIQTILTQAQLGQACLVNGEKKK
                     AVQAGDIAVLVRTGSEGRMIKQALADQGIASVYLSNRDSVFTSSVAQDLQRLLQAVLT
                     PENDRALRASLASELFALDAASLDALNNDEIVWENAVNEFKEYRKLWVQRGVLPMLRA
                     VISKRHIAERLLEEGASSQGENGERVLTDLMHIGELLQQASNELDSDHGLLRWLAQSI
                     SDAENGLGGSDDQIQRLESERNLVQIVTIHKSKGLEYDLVFLPFVFSYREASEAKYYD
                     AATDRTVLDITGNDASMMQADKERLAEDLRLIYVALTRAVYACFIGASPLRNGRSTKE
                     PTGVHRSAIGYLVQNGQEGGINDLYQGLKQQQDKLDCVALGEPPQQLEEMYVAPQEEV
                     CDLTAKELQNPIDRNWRITSYSGLVKQGSHQTEHDATIEITGFDIDSSDEQDEEDLVE
                     PERSIFTFPRGARPGTFLHSLFEEIEFTQPATTEENTQIILGLMESEQLDEEWLPILQ
                     QLIDTVLATPLDGKSLLLNQKAPSQRLVEMEFLLPIEVLSAPALNRVIQRHDPLSAKA
                     GDLGFQTVQGMLKGFIDLVFEHQGKYYVLDWKSNHLGDDVTHYHGEALKSAMADHRYD
                     LQYQIYALALHRFLRSRLANYQYDQHFGGVYYLFLRGMDGQSDHGIFSAKPTLEFLQE
                     MDRLIDGQTLETRSTQAGQMELL"
     gene            435634..437793
                     /locus_tag="PN96_02015"
     CDS             435634..437793
                     /locus_tag="PN96_02015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020334310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit alpha"
                     /protein_id="ALR14808.1"
                     /translation="MTTYNNLPSNQESLLGTLERLAHKGAIRQLDYQFARFLYAQTDG
                     AQSESQSDGQALAFIAGVVSSELGKGHICLPLFDAQGQPTDLASKLGLFGEAALTLNT
                     QLQGNNWPQLLENSSLVGAQGEALPLMFDGERLYLHRYWHYEVTLAEKLNQLGAAVSL
                     QPQEFTRLSELLNHLFARQYHFLFNAIAKATEAGNNNQVLRQQLVCDHLDVVASDALD
                     WPAIDALLSHANKVQDLQPLDDLVPLSACVNWQKVAAAVALTRRFAVISGGPGTGKTT
                     TVTKLLAALIEQAAQEKNLTIKLVAPTGKAAARLTESIGKAVQELPVSPELKAKIPTE
                     SSTLHRLLGAIPNSAEFRHNKQNPLHLDILVIDEASMVDLPMMYKVVDALPKHARLIL
                     LGDKDQLASVEAGAVLGDICSFHALGYGKEQASAIAKLTGFDSLAHSSNSASSIADSL
                     CMLQKSYRFDARSGIGQLAKAVNLGSAASVDNVWARDFLDIEHFALSSQNYNQMMQTL
                     VQEYGRYLKRIGQQEQDPNTGEPETLTRKAKAVLDTFNQCRLLCAIREGDFGVAGLNQ
                     RIEKALAARKLIKVQDEIWYHGRPVMVTRNDHGLGLYNGDIGICMRDDSEEEQRLKVF
                     FELPDGSVKSVLPSRVPEHETAYAMTIHKSQGSEFDYTLMILPPDFSPILTRELIYTG
                     ITRAKKRLALYAELNVLKRGIKVKTNRASGLVQRLAN"
     gene            complement(437833..439170)
                     /locus_tag="PN96_02020"
     CDS             complement(437833..439170)
                     /locus_tag="PN96_02020"
                     /EC_number="2.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017820779.1"
                     /note="catalyzes the formation of N-acetyl-L-glutamate
                     from L-glutamate and acetyl-CoA in arginine biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="ALR14809.1"
                     /translation="MKIRSTALVKGFRQSTPYVNAHRGKTMVIMLGGEAVAHNNFGNI
                     INDIALMHSLGIKVVVVYGARPQINQLLVKQNLTTPYHKDIRITDEEALSVVMQAAGQ
                     LQLAITARLSMSLNNTPMAGTELSVVSGNYIIAQPLGVDDGVDYCHSGRIRRIDTDAI
                     NRTLDQGSIVLLGPIASSVTGECFNLLSEEVATQLAIKLGADKLIGFCSEQGVIDDNG
                     NAVAELLPIEAEHVIKTLTEKSSPDSDYYTGTLRFLKGSIAACRAGVPRSHLISYKVD
                     GALIQELFSFDGIGTQVVMASAEQVRQANIDDIGGILDLIRPLEEQGILVRRSREQLE
                     QEIGKFTIIEKDGLIIGCAALYPYAEERKAEMACVAIHPDYRDGNRGLLLLNYMKHRS
                     KSENINQIFVLTTHSLHWFREQGFYEVGVDYLPGAKQGLYNFQRKSKILALDL"
     gene            439327..439791
                     /locus_tag="PN96_02025"
     CDS             439327..439791
                     /locus_tag="PN96_02025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017447747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="ALR14810.1"
                     /translation="MVITSSAPERNATITTQPQSDSSKKSQLRKGVERFLMLIAVVGT
                     IIAGMLYSDWISRYINPPVEKSIIYGKWVEQEVAPYAREVFELSERGVTVNGSTVATD
                     FDFDGDALSYKFGSSVRRFRFIGQQHTEMKLDANVHYLPIFRLERSFDSTLR"
     gene            440029..441132
                     /locus_tag="PN96_02030"
     CDS             440029..441132
                     /locus_tag="PN96_02030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase"
                     /protein_id="ALR14811.1"
                     /translation="MLKQLLPIVTLGLLFGCAQKNDLAHQYIDGEFPQILNKVDVVES
                     NKPRDFTEFNKQVEQVLIKSPSMAKMYQPLYHRLSEWAQQSGDTSVLSAYGIQAAQLG
                     GGDKKGNVLFTGYFSPVMELRHQPNNIFRYPVYGKPNCSSDCPTRAEIYDGALDGQGL
                     VLGYAPNRIDPFMMEVQGSGYVHFEDDDTLEYFAYAGKNNKAYVSIGRILIERGEVPR
                     EEMSMKAIKDWVMANDEATVRELLEQNPSYVFFAPKSEAPVTGAAGIPLLPMAAVAGD
                     RSILPMGTPVLAEVPLLNADGTWSGAHQLRILLVLDTGGAVKRNHLDLYHGIGARAGI
                     EAGHYKHFGRVWKLGLENTPTQAPWALSPEKIQ"
     gene            441235..442044
                     /locus_tag="PN96_02035"
     CDS             441235..442044
                     /locus_tag="PN96_02035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005380241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur acceptor protein CsdL"
                     /protein_id="ALR14812.1"
                     /translation="MRELDTPASDNYNQRFGGTRRLYGNSEVEILRAAHVCVIGIGGV
                     GSWAVEALARTGIGELTLIDMDDVCVTNINRQIHAMSGTVGQSKIEVMAERVKLINPE
                     CKVNLIDDFITPDNQHEYLSKEFDYVLDAIDSVKAKASLLAYCRSNKIKVITTGGAGG
                     QVDPTQIMVADLTKTIQDPLAKKIKDTLRRHHNFPKNPARKFGIDCVFSTEQLKYPQA
                     DGSVCGVKSTAEGPKRMDCASGFGAATVVTATFGFVAVSRIVEKLIQKYKK"
     gene            442066..442494
                     /locus_tag="PN96_02040"
     CDS             442066..442494
                     /locus_tag="PN96_02040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S metabolism protein SufE"
                     /protein_id="ALR14813.1"
                     /translation="MTDFPVSPFGSEITSDDIVATMQQFKGWEDRYRQVIQWGKKLPQ
                     MPEALKSEQVTVSGCESLVWLVSQEQGGVWHFCADSDARIVRGLIALVMAAFDGKTAE
                     QIQAFDIDAYFEQLGLIAHLSPSRGNGLKAIVEQIKQTAK"
     gene            442795..443712
                     /locus_tag="PN96_02045"
     CDS             442795..443712
                     /locus_tag="PN96_02045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="ALR14814.1"
                     /translation="MRFSLEHAQDVLSGMPDPTFILSEDGLYIDVFGGIDRNAYHDGS
                     SLIGETLHSVLEKEQADWFIKQINRCLTEDSIITIEYKMSADNVQGIDPTTGPNGLLY
                     YEGKVCPLGITYQGRRVVLILTRNISNRHQVETILRHQSQIDALTNIYNRRVFFEKVS
                     EEITKCEAQSYQAALLFFDLDFFKSINDERGHDAGDYVLETLAELVSSLLTKDETFSR
                     VGGEEFAIILPDVSLSSATEIGEEIRSNIEKNQFEFEDVQIPVTVSVGVVNIIGYEST
                     KRLYARADKALYAAKRNGRNCVITTESES"
     gene            complement(443747..444958)
                     /locus_tag="PN96_02050"
     CDS             complement(443747..444958)
                     /locus_tag="PN96_02050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005427320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine sulfinate desulfinase"
                     /protein_id="ALR14815.1"
                     /translation="MFDVNAVRKQFPALNQSINDTPLVYLDSAATTQKPQCVIDVISH
                     YYSAQNANVHRGSHSLTANATSQFEAARETVTRFIGAACSKEIIWTRGATEALNLIAQ
                     TYARSNLQAGDEILISEMEHHANIVPWQIVAEQTGAKVVKVPMTSNCQFDLEAFKSLL
                     SERCKIVACAQITNVTGSRQPIEEITTLAHQFGAVVVVDGAQGIVHEPLNLAELDIDF
                     YVFSGHKLYAPAGIGVLYGKLALLEAMPPWHGGGKMVEKVSFEKTTFSALPGKFEAGT
                     PNVAGAIALAKAIDWYQGFDHQEVEAHLHTLQNKAYQALRQLDDIHILGYQPNASVLT
                     FVMDGVHHQDIATLLDQQGIAVRAGHHCAHPLMDALKVKGTVRVSFGIYNTLEDVDRL
                     IAAVEKAVDML"
     gene            complement(444958..445557)
                     /locus_tag="PN96_02055"
     CDS             complement(444958..445557)
                     /locus_tag="PN96_02055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidative-stress-resistance chaperone"
                     /protein_id="ALR14816.1"
                     /translation="MSVKILVPIAPGTEEMEAVTIIDMMVRAGYDVTVASAAFDGALT
                     MKASRGVTLTADCKLVDIADDEFDVIALPGGVGGSEVFRDSTVMIEILKQHIYEGKLV
                     AAICAAPALVLQHHDLFPNALMTCHPSFQSHIPEANWRSKRVTIDINHNLITSQGPGT
                     ALEFAMEVIIKLSGKKHAWTIAEPMVTIPTLHYHKIGEE"
     gene            complement(445554..446444)
                     /locus_tag="PN96_02060"
     CDS             complement(445554..446444)
                     /locus_tag="PN96_02060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="ALR14817.1"
                     /translation="MNIVILGPGAIGSLWAIKLKQAGHHVSLWSRSSETQLSLQLDDS
                     VGDTFLNNHLLSVKSADLIVVTVKAWQVEEAISPLLGHIHPDTIVMLMHNGMGTAQRV
                     SESLKNNPIVLATTTHGAYKPCEQKVLHTGHGNTQLGGFNNLGEQCQFLQEVMHHALP
                     EVGWNPNINAALWTKLAINCAINPLTAIHQCKNGALAQQEFQDTLRNITRELVEVMNK
                     EGLDTEFDNLFGVIMQVVNATAENYSSMRQDVYHQRRTEIDFITGYLLQTAEKHHIET
                     PENLSLYQRIKQIEKSWTEQ"
     gene            complement(446554..447372)
                     /locus_tag="PN96_02065"
     CDS             complement(446554..447372)
                     /locus_tag="PN96_02065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005456639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14818.1"
                     /translation="MRKSLLALGLLAATSAPVMAADYSDGDIHKNDYKWMQFNLMGAF
                     NEKGYAESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDPGSDKAGGEKIFMKFAPRMS
                     LDALTGKDLSFGPVQELYVASLIEWGGNSDVNSQKIGLGSDVMVPWFGKVGLNLYGTY
                     AGNEKDWNGFQVSTNWFKPFFFFENGSFISYQGYIDYQFGMDDDEGNKFNTTASNGGA
                     MFNGIYWHSDRFAVGYGLKLYKDVYGFKDGEALPWGHKPESSGAGHYVAVTYKF"
     gene            447696..448292
                     /locus_tag="PN96_02070"
     CDS             447696..448292
                     /locus_tag="PN96_02070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="ALR14819.1"
                     /translation="MNEVMLFPLTSVVLPEGKMNLRIFEPRYIRMVKECSSKNMGFGV
                     CLVGNDGDPKEVGNVSSIGSLVRIVDFETLSDGLLGITVVGEKRFKVLRVRADSDGLR
                     HAEVEWMDNWAVPKGLYSFDYLSQQLAYVYEEFPQLGSLYEHRFYDDPSWVTQRWLEL
                     LPLECHLFDRLAGAEDCLPALHFLHQALEAPKNKEARL"
     gene            448289..449647
                     /locus_tag="PN96_02075"
     CDS             448289..449647
                     /locus_tag="PN96_02075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="ALR14820.1"
                     /translation="MKLTSKAFLVLMGSLGLAACGSDSDTIEFSNVQAVHASADAPLA
                     NVWINDKATLTGVDYGVGSGYMMVREGSNAVQVDVQLPGSEVATVVPRTLLDLDSDLK
                     YTVFVVGDADGNPNPVEPLIVTRHAESMADESSLDVQVVHAASGVPAVDVYVTDPGAD
                     LSTVMPLTNLAYKAATDTLNIQAGDYQVRLAVGDDVVFDSGTLSLAGNANLTIAAIKT
                     GDSSSSSPVKLLVLDGSGSSIIQDMGSQAEVRVGHVVDGAPAVDVNVNDAPFAPLADL
                     AFKEIRGYLDLDPQSYDIDVFVDGTTTDPIFSIDDLSVEAGMDYSFYAVGVVSPSVAV
                     EPLIVEDMRRAVATSATLNITHAAANPVAENVDIYLTTSAGIDGSDPTVSDFTYKESL
                     KGLYVEEGTYFVTVTAAGEPNTVAIDSAPVDLMNGVVYQVVAIDDGNSGGFNLLVNDI
                     TD"
     gene            449691..450275
                     /locus_tag="PN96_02080"
     CDS             449691..450275
                     /locus_tag="PN96_02080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005482287.1"
                     /note="Bacteria have multiple sigma factors which are
                     active under specific conditions; the sigma factor binds
                     with the catalytic core of RNA polymerase to produce the
                     holoenzyme and directs bacterial core RNA polymerase to
                     specific promoter elements to initiate transcription;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="ALR14821.1"
                     /translation="MMSDSRQKLGRHEWNAYMDKVKARDQDAFAFVFQFYAPKLKQFA
                     YKHVGNEQVAMEMVQETMATVWHKAHLYDGKKSALSTWIYTIIRNLCFDLLRKQKGKE
                     LHIHADDIWPSEYYPPDLVDHYSPEQDMLKEQVVKFLDTLPKNQRDVLQAVYLEELPH
                     QQVAELFDIPLGTVKSRLRLAVEKLRHSMHTEQL"
     gene            450272..450931
                     /locus_tag="PN96_02085"
     CDS             450272..450931
                     /locus_tag="PN96_02085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ALR14822.1"
                     /translation="MNNHPDNKLLEAYALGSIDAVSGLVVATHLETCSKCRDYVNRVE
                     AEQANVVSNVPCVYVPEFDDMFNAIVTAPPMRDSVIIRDSAKVSVAGKSFELPKTLSR
                     FSDLVGSWRSYGGKVYSAQIDLGEDARVNLMYISEDVQIPQHTHKGIESTLVLHGGFS
                     DEDGEYEEGDLMIRDASVKHSPYTKAGEDCLCLTVLTEPMIFTQGVARIFNMFGKGLY
                     P"
     gene            complement(451005..452357)
                     /locus_tag="PN96_02090"
     CDS             complement(451005..452357)
                     /locus_tag="PN96_02090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="ALR14823.1"
                     /translation="MSSLPSITWLETVKSYLDKRLLWVFMLGCSSGFPWVLIGSNMSG
                     WLKDAGLTLSAIGYFGSVFAVYAINFLWAPLVDRLKLPLLHRLLGQRRSWIFFCQSIV
                     LVATILIADVNPAQNLAFASVLALCIATASATQDIAIDAFRIDTFPKSEASKLPQASA
                     MAVIGWWTGYSLPGYLAFINADSIGWNGVYYGMAFIVVVLMVFTLLVGEPKTQREQLQ
                     SEAEQRHKEVVGSRIVAWFTVTVVEPFLDFFNRNGVRVAITLLLFVFLFKIGEAFLGR
                     MSIAFYKDIGFSNEQIGYYSKLIGWGATIFFTLVGSMFNVRFGLVRGLMIGGIAMSAS
                     NLMFAWIASVGPNEHLYLATIIVDNFTTAFSTVAFVSFLTLLTGQAFSATQYALLASL
                     GNFGRTTLASFSGELVDYLNDWSTFFILTAVMVIPSLIMLYSLRHYFDDLLEKARHKH
                     "
     gene            complement(452426..452971)
                     /locus_tag="PN96_02095"
     CDS             complement(452426..452971)
                     /locus_tag="PN96_02095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012532986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="ALR14824.1"
                     /translation="MIRKAILSLALLSCSVWAGPKVSFETTLGSFTVELNEEKAPITV
                     ANFLKYVEDGSYEGTIFHRVIPGFMAQGGGFNQEMQMVDTYEPIKNEGNNGLNNDQAT
                     IAMARTNAPDSATRQFYINLVDNDFLNYGARPPGYAVFGQVTEGFDVIQNMAKQPTSS
                     SGRMRDVPETQIVITKATLLK"
     gene            complement(452971..453540)
                     /locus_tag="PN96_02100"
     CDS             complement(452971..453540)
                     /locus_tag="PN96_02100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005380259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="ALR14825.1"
                     /translation="MKKLVIAASVALLAACSAPQQVQLNLMPESTLSTNPIVQGKTYS
                     LISKDVRAAQYVALVDNGRSNILPLHAKQNLRIALEQALEKQFSSQGFHSDLNSNNVI
                     ELKVQEALVNVKHSVMEKEMSAKVVLEITAENPQGRLVKTYTGSANRSGTFSASDSDI
                     EQTLNDVVDLTLKEIANDPELRQYMQERF"
     gene            complement(453583..454737)
                     /locus_tag="PN96_02105"
     CDS             complement(453583..454737)
                     /locus_tag="PN96_02105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S rRNA methyltransferase"
                     /protein_id="ALR14826.1"
                     /translation="MKTELNLHGRSLTLHRFPKRSNETLQAWDAGDEYLINHVEELAL
                     NDNQHIVVINDSFGALACWFSEKHRVTFMSDSFISHKGTQVNLEANQCKDVTFLSTMD
                     DIPADADLVLLQLPKSNRHLTWILSQLRNALPESCPVIGVNKVKEIHTSTLKLFEKHL
                     GETKTSLAWKKHRLVFSQANAQPIVEVDPITAWSVDGENIQLKNLPNVYSGESLDLGA
                     RFMLQHIPQDASITHIVDLGCGNGVLSVKAGQLNPNARLTCVDESFMALESAKQNLLD
                     NLGEEREIQCIANNCLDGFDHDSCSLIMCNPPFHQQQAITDHIAWQMFCDSKQVLNKG
                     GRLLVIGNRHLGYDAKLKRLFGANNVNLVASNNKFVILQATKNPAKLNAK"
     gene            455005..455313
                     /locus_tag="PN96_02110"
     CDS             455005..455313
                     /locus_tag="PN96_02110"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q56585.1"
                     /note="positive transcriptional regulator of morphogenetic
                     pathway; controlling several genes involved in oxidative
                     stress, acid stress, heat shock, osmotic shock, and
                     carbon-starvation stress; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator BolA"
                     /protein_id="ALR14827.1"
                     /translation="MIQEIIEKKLHSELQPSYLKVINESYMHNVPPGSESHFKVIVVS
                     DSFAGHRLIGRHRQVHQILADELDNHIHALAIHTYTDEEWKSEQNGAPDSPMCVGGGR
                     "
     gene            455785..457125
                     /locus_tag="PN96_02115"
     CDS             455785..457125
                     /locus_tag="PN96_02115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015297175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:ubiquinone oxidoreductase"
                     /protein_id="ALR17183.1"
                     /translation="MITIKKGLDLPIAGTPSQVINDGKTIKKVALLGEEYVGMRPTMH
                     VRVGDEVKKAQVLFEDKKNPGVKFTAPAAGKVIEVNRGAKRVLQSVVIEVAGEEQVTF
                     DKFEASQLSGLDREVIKTQLVESGLWTALRTRPFSKVPAIESSTKAIFVTAMDTNPLA
                     ANPELIINEQQEAFVAGLDILSALTEGKVYVCKSGTSLPRSSQSNIEEHVFDGPHPAG
                     LAGTHMHFLYPVNAENVAWSINYQDVIAFGKLFLTGELYTDRVISLAGPVVNNPRLVR
                     TTLGASLDDVTDNELMPGEVRVISGSVLTGTHATGPHAYLGRYNLQVSVLREGYEKEL
                     FGWAMPGKNKFSVTRSFLGHLFKGQLFNMTTTTNGSDRSMVPIGNYERVMPLDMEPTL
                     LLRDLCAGDTDSAAALGALELDEEDVALCTFVCPGKYEYGQLLRECLDKIEKEG"
     gene            457131..458375
                     /locus_tag="PN96_02120"
     CDS             457131..458375
                     /locus_tag="PN96_02120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232793.1"
                     /note="uses the energy from reduction of ubiquinone-1 to
                     ubiquinol to move Na(+) ions from the cytoplasm to the
                     periplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)-translocating NADH-quinone reductase
                     subunit B"
                     /protein_id="ALR14828.1"
                     /translation="MSLKKFIEDIEHHFEPGGKHEKWFALYEAAATLFYTPGLVTKRS
                     SHVRDSVDLKRIMIMVWFAVFPAMFWGMYNAGGQAIAALTHMHAGDQLATVVAGNWHY
                     WLTEMFGGTISADAGVGSKMLLGATYFLPIYATVFIVGGFWEVLFCMVRKHEVNEGFF
                     VTSILFALIVPPTLPLWQAALGITFGVVVAKEIFGGTGRNFLNPALAGRAFLFFAYPA
                     QISGDVVWTAADGFSGATALSQWAQGGNGALVNTVSGAPITWMDAFIGNIPGSIGEVS
                     TLALMIGAAMIVYMRIASWRIIAGVMIGMIATATLFNVIGSDTNPMFNMPWHWHLVLG
                     GFAFGMFFMATDPVSASFTNKGKWWYGALIGVMCVLIRVVNPAYPEGMMLAILFANLF
                     APLFDHLVIEKNIKRRQARYGK"
     gene            458365..459135
                     /locus_tag="PN96_02125"
     CDS             458365..459135
                     /locus_tag="PN96_02125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017788883.1"
                     /note="uses the energy from reduction of ubiquinone-1 to
                     ubiquinol to move Na(+) ions from the cytoplasm to the
                     periplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)-translocating NADH-quinone reductase
                     subunit C"
                     /protein_id="ALR14829.1"
                     /translation="MASNNDSIKKTLGVVVGLSLVCSIIVSTAAVGLRDKQKANAVLD
                     KQSKIVEVAGIDASGKKVPELFAQYIEPRLVDFNTGDFVEGNAATYDQRKAAKDPAES
                     IKLSAEDDKAKIIRRANTGVVYLVKDGDAVSKVIIPVHGNGLWSMMYAFVAVETDGNT
                     VSGITYYEQGETPGLGGEVENPSWRAQFVGKKLFDENHKPAIKVVKGGAPAGSEHGVD
                     GLSGATLTSNGVQHTFDFWLGDMGFGPFLAKVRDGGLN"
     gene            459135..459767
                     /locus_tag="PN96_02130"
     CDS             459135..459767
                     /locus_tag="PN96_02130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004403027.1"
                     /note="Part of the NQR complex which catalyzes the
                     reduction of ubiquinone-1 to ubiquinol by two successive
                     reactions, coupled with the transport of Na(+) ions from
                     the cytoplasm to the periplasm; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)-translocating NADH-quinone reductase
                     subunit D"
                     /protein_id="ALR14830.1"
                     /translation="MSSAQNVKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVM
                     TLAVTFVTALSNFSVSLIRNHIPNSVRIIVQMAIIASLVIVVDQVLKAYLYDISKQLS
                     VFVGLIITNCIVMGRAEAFAMKSAPIPSLIDGIGNGLGYGFVLITVGFFRELFGSGKL
                     FGMEILPLVSNGGWYQPNGLMLLAPSAFFLIGFLIWAIRILKPEQVEAKE"
     gene            459775..460371
                     /locus_tag="PN96_02135"
     CDS             459775..460371
                     /locus_tag="PN96_02135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006711714.1"
                     /note="Part of the NQR complex which consists of NqrA,
                     NqrB, NqrC, NqrD, NqrE and NqrF; NQR complex catalyzes the
                     reduction of ubiquinone-1 to ubiquinol by two successive
                     reactions, coupled with the transport of Na(+) ions from
                     the cytoplasm to the periplasm; NqrE is probably involved
                     in the second step, the conversion of ubisemiquinone to
                     ubiquinol; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)-translocating NADH-quinone reductase
                     subunit E"
                     /protein_id="ALR14831.1"
                     /translation="MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVA
                     VVVVLTIAVPVNNLVYNLVLRENALVEGVDLSFLNFITFIGVIAALVQILEMVLDRFF
                     PPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGSGVGWMLAIVALAGI
                     REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL"
     gene            460405..461628
                     /locus_tag="PN96_02140"
     CDS             460405..461628
                     /locus_tag="PN96_02140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232789.1"
                     /note="uses the energy from reduction of ubiquinone-1 to
                     ubiquinol to move Na(+) ions from the cytoplasm to the
                     periplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)-translocating NADH-quinone reductase
                     subunit F"
                     /protein_id="ALR14832.1"
                     /translation="MDIILGVVMFTLIVLALVLVILFAKSKLVPTGDITISVNDDPNL
                     AIVTQPGGKLLGALAGAGVFVSSACGGGGSCGQCRVKIKSGGGDILPTELDHITKGEA
                     REGERLACQVAMKTDMDIELPEEIFGVKKWECTVISNDNKATFIKELKLQIPDGESVP
                     FRAGGYIQIEAPAHHVKYADFDVPDEYREDWDKFNLFRYESKVNEETIRAYSMANYPE
                     EEGIIMLNVRIATPPPNNPDVPPGIMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMV
                     FIGGGAGMAPMRSHIFDQLKRLNSTRKMSFWYGARSKREMFYVEDFDGLQAENDNFVW
                     HCALSDPMPEDNWDGYTGFIHNVLYENYLKDHEAPEDCEYYMCGPPMMNAAVIGMLKD
                     LGVEDENILLDDFGG"
     gene            461772..462776
                     /locus_tag="PN96_02145"
     CDS             461772..462776
                     /locus_tag="PN96_02145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis lipoprotein"
                     /protein_id="ALR14833.1"
                     /translation="MKKWLVAFASLLVLAGCEQPAEQVHLTGPTMGTTYNIKYIAAEG
                     IPAAAELQKEVDRLLEEVNDQMSTYRKDSELSRFNQYTESDAFEVSPQTATVVKEAIR
                     LNKLTMGALDVTVGPLVNLWGFGPEARPEVVPSDEELAARRAMTGIEHLEVAGNTLKK
                     DIPNLYVDLSTIAKGWGVDVVADYIQSQGIMNYMVEVGGEMRVKGINREGVSWRIAIE
                     KPSVEERAIQEIIEPGEMAIATSGDYRNYFERDGIRYSHIINPETGKPINHKVVSVTV
                     LDKSSMTADGLATGLMVMGEVKGMQVAQENNIPVLMIVKTEDGFKELASDAYKPYVSQ
                     "
     gene            462799..463032
                     /locus_tag="PN96_02150"
     CDS             462799..463032
                     /locus_tag="PN96_02150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exported or periplasmic protein in ApbE locus"
                     /protein_id="ALR14834.1"
                     /translation="MSTFLITFAVFVAVIAAMSIGYIIQKKVVKGSCGGLGAVGIEKV
                     CNCPEPCDARKKREAREAARAEKLAAWEKDRIA"
     gene            463149..463382
                     /locus_tag="PN96_02155"
     CDS             463149..463382
                     /locus_tag="PN96_02155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14835.1"
                     /translation="MEMHQHGMTELFEQLGLGSSPREIKDFVNNHRHKRDSAPIYEAS
                     FWTRSQSAFLKQAIEQDADWAELVDQLDVMLRD"
     gene            463515..464579
                     /locus_tag="PN96_02160"
     CDS             463515..464579
                     /locus_tag="PN96_02160"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335165.1"
                     /note="involved in translesion DNA polymerization with
                     beta clamp of polymerase III; belongs to Y family of
                     polymerases; does not contain proofreading function;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="ALR14836.1"
                     /translation="MSERIKKIIHVDMDCFYAAVEMRDNPNYRDIALAVGGHEKQRGV
                     ISTCNYEARKYGVRSAMPTARALQLCPNLVVVSGRMHVYKQVSQQIRAIFERYTPIIE
                     PLSLDEAYLDVTDATACHGSATLIAEAIRKDIWNELGLTASAGVAPIKFLAKVASDMN
                     KPNGQFVIPPDKVQQVVDKLPLEKIPGVGKVSLEKLHQAGFYLCEDIKNSDYRELLRQ
                     FGRQGASLWKRSQGIDDREVVVERERKSVGVERTFSQNISTYDECWQVIESKLYPELE
                     KRLERASPDKSIIKQGIKVKFADFQLTTIEHIHPQLELNDFKTLLKDILKRQQGREIR
                     LLGLSVMLKPETQARQLSFF"
     gene            complement(464606..466531)
                     /locus_tag="PN96_02165"
     CDS             complement(464606..466531)
                     /locus_tag="PN96_02165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="ALR14837.1"
                     /translation="MQSIPLQQTLQSVFGFDSLRSGQQPVIEAVMNGNSAAAIFPTGS
                     GKSLCYQLPATQLPNLTLVISPLLALMKDQLSFLQSRGIAAASIDSSQSREESQKVMA
                     GVKNGQIKILMISVERLKNERFREFIRQIPISLMVVDEAHCISEWGHNFRPDYLKLPQ
                     YQRELNISQSLLLTATATPAVIDDMQQKFNIASEHITVTGFYRPNLDISVVPCQESEK
                     QTQLNTIVAAQPTLPTIVYVTQQQTAEQVAKSLIHIGINAHAYHAGMKSDVREKIQQQ
                     FMDSQIDCIVATIAFGMGVDKSDIRRVIHFDLPKSIENYAQEIGRAGRDGQRSECILL
                     GNTSGLTVLENFVYGDTPERTSISYVLEQAREHTPQWEVVPLRLSRDSNIRQLPLKTL
                     LVYLELEKVIEAKYSYFAEYRFKFLQDQQFILNQFQGERRQFVEAIFTCSTKAKVWCQ
                     VDLDALWMHYQSERSRVVAALDYFHQNGWIELESKQLTDVYAVLPTQQSSETLEQHLY
                     DLFQSKERKDIERIHTMLGLFQSSECLSYQLAHYFADHNAPTECGHCSVCRGQVAVFP
                     AQSNEPPENEQVVSWVKEFVQLSPTTISNGAVARFLCGISTPLISQLKATKKSGYGAM
                     ANVSFDKVIELVNEARA"
     gene            466608..467087
                     /locus_tag="PN96_02170"
     CDS             466608..467087
                     /locus_tag="PN96_02170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor"
                     /protein_id="ALR14838.1"
                     /translation="MNKAELVQIIIQKLEEKLQVAHASTQRAIDAATDEETVPEHKYD
                     TLALEASYLAHGQAMRVQDSEEELRQYRSLVVKDFTDAPIGVGAVVLLEDDDLTEKCF
                     FIGPCSGGLTVEWQGKQVFVLTAKSPLGRALMGKEEGDDVNVKIADKTTGYDVVTVF"
     gene            467149..467892
                     /locus_tag="PN96_02175"
     CDS             467149..467892
                     /locus_tag="PN96_02175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="ALR14839.1"
                     /translation="MKKLLTFSLLVVSASGYTAQCRVDINNEVRLDGQSLEIHQTTGD
                     SAVVDEDNNLFIKGEQVELDSDQKAALEGYREKMNAYIPQAKQLASDGLELANAIIDD
                     VAASLDAPDAFDNVKASVKTFFEDVESRYYKDGDFILPAESFESMTQSWTDDFAKAQE
                     IFNKEFLASAFEALSKKMQEEDGLNLTALSESMTELSAKVEQRINEHSQGIEQKAEEL
                     CDSLDDMAAQEDNVLKKIPELKDYRVFTI"
     gene            468166..469530
                     /locus_tag="PN96_02180"
     CDS             468166..469530
                     /locus_tag="PN96_02180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="ALR14840.1"
                     /translation="MTQQNSSQPREHFGSRLGFILAAAGAAVGLGNIWGFPTQAASNG
                     GGAFLLVYLVMILIVAFPMLVVEMAIGRHGQANPVDSMRALTHNPVAKKFGGLVGWIG
                     LSVPSAVLAFYSIVGGWLICFLLGAITDIMGLAEVTAWFKGFSVERNLFGTITFYVLT
                     VLIVQGGVKEGIEKWSTRLMPALFVLFGLLFVYIMTQNGAMEGLKHYLVPDFEKVWDR
                     KLILAAMGQGFFSLTIGGCSMLIYGSYLSKKENLPKMAMNVTLVDTAVAFIAGLVVMP
                     AMFVAMQKGVQIYADDGSLLSSDTLVFTVLPLMFDSLGLLGQLFSIVFFLLLTIAALT
                     SSISMLECPVALVSERFNTKRSGTSWVLGGLIALFSVVIVYNFGAMFGLVATVATQYL
                     QPTAALLFCLFGGWVWSRNSKIKELEQGFPEFTLGWFGKVWPAYVKFVCPVLVATVIW
                     ASFG"
     gene            complement(469612..469803)
                     /locus_tag="PN96_02185"
     CDS             complement(469612..469803)
                     /locus_tag="PN96_02185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005380289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14841.1"
                     /translation="MNLANFESMDPVMLMSIVNMKLRDDFGGDLDKLVAFFDIDRAAL
                     EAKLATAGFDFLPEAGQFR"
     gene            complement(469803..470009)
                     /locus_tag="PN96_02190"
     CDS             complement(469803..470009)
                     /locus_tag="PN96_02190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017636026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14842.1"
                     /translation="MQVYGCCELVRELYAQIGSGDQAYVPQAISCAVKALNDVAANES
                     LPQETREAAAFAAANLLISDFEDK"
     gene            complement(470206..471921)
                     /locus_tag="PN96_02195"
     CDS             complement(470206..471921)
                     /locus_tag="PN96_02195"
                     /EC_number="6.1.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006742543.1"
                     /note="catalyzes the formation of prolyl-tRNA(Pro) from
                     proline and tRNA(Pro); Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="ALR14843.1"
                     /translation="MRTSNYLLSTLKETPNDAEVVSHQLMLRAGMIRKLASGLYTWLP
                     TGLRVMRKVENIVRQEIDNAGAIETLMPVVQPFELWEETGRSEKMGPELLRFTDRHER
                     PFVLSPTAEEVITSLVRNEVSSYKQLPLNLYQIQTKFRDERRPRFGVMRSREFSMMDA
                     YSFDIDKEGLQKSYDAMHDAYCKAFDRMGLDYRPVLADSGAIGGSGSQEFHVLAESGE
                     DLIAFSTESDYAANLEKAEALAPADSAPAPTQEMTLVDTPNAKTIAQLVEQHGLAIEK
                     TIKTLFVKASDEVDAPIIALLVRGDHELNEVKAENLPQVAAPLEMATEEEIRALVGAG
                     PGSLGPVGLKLPFIVDRSVAVMSDFAGGANIDDKHYFGINWGRDVELGQVEDLRNVVE
                     GDPSPCGKGTLQLKRGIEVGHIFQLGKNYSEKMNCGVLGPDGKNVILEMGCYGIGVTR
                     VVAAAIEQNHDKYGIIWPDALAPFQVAIVPMNMHKSEEVKEAAEKLYAELTAMGVEVL
                     FDDRKERPGVMFSDMELLGVPHTIIIGDRSMKEGNFEYKNRRSGEKTAVAMADIVEHI
                     KAQLQ"
     gene            complement(472033..472743)
                     /locus_tag="PN96_02200"
     CDS             complement(472033..472743)
                     /locus_tag="PN96_02200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (adenine(37)-N6)-methyltransferase"
                     /protein_id="ALR14844.1"
                     /translation="MYSIEPIGIIETPYKEKFAVPRQPRLVPAAKARVKLLGEANSPE
                     AVRGLEQFSHVWLLFLFDQNLEAGWKPTVRPPRLGGNERVGVFASRSTFRPNGIGMSA
                     VEVKGVIKQGDQIYLELGSVDLVDGTPIIDIKPYIPYSDSIPDAQGGYAGEEPEKLPV
                     TFSSQALSSQALAMVKKQSNTDNVLSVIEQVLAQDPRPAYKKNKPDSKEYAVNLFDLN
                     VKFTVKDNLITVTAIESF"
     gene            472880..473134
                     /locus_tag="PN96_02205"
     CDS             472880..473134
                     /locus_tag="PN96_02205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="ALR14845.1"
                     /translation="MKPGIHPEYRPVVFHDTSVDKYFVVGSTLKTDRTIEWEDGKTYP
                     YMTLDVSSASHPYYTGKQRVVQAEGRIANFNRRFGQFTKE"
     gene            473500..475086
                     /locus_tag="PN96_02210"
     CDS             473500..475086
                     /locus_tag="PN96_02210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017817743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminobenzoyl-glutamate transporter"
                     /protein_id="ALR14846.1"
                     /translation="MSSSASIKQNTPKKPLFTRFLDTVEYLGNLLPHPITLFAIFCLA
                     ILVMSGIAGYFEVSVMDPRPEGASGRSADGMIHVVSLLNADGLQLIVTNLVKNFVGFA
                     PLGTVLVAMLGVAIAEYSGLLSAAMRGLVMGASQRMVTVTVVFAGIISNTASELGYVV
                     LIPLAAMLFHSLGRHPLAGLAAAFAGVSGGYSANLLIGTVDPLLSGITETAAQMIDPN
                     YTVGPEVNWYFMFVSTFFIAGMGAFVTEKIVEPKLGKYNEEEASEDLSKDKMGGLTDL
                     EKKGLKLAGIAILAVSALLAWTIVPEDGVLRSDAGTIAGSPFLKSIVAFIFVFFAIPG
                     FVYGKVVGTMKTDRDVIDAMSKSMSSMGMYIVLVFFAAQFVAFFKWTNFGQVFAVAGA
                     DFLQSIGLTGPMLFFAFILMCGFINLMIGSASAQWAVTAPIFVPMLMLVGYAPETIQA
                     AYRIGDSTTNIITPMMSYFGLILAVATRYMKNLGIGTLIATMLPYSICFIVGWSVLFY
                     LWVFVFGLPVGPGAATYYTP"
     gene            complement(475157..475600)
                     /locus_tag="PN96_02215"
     CDS             complement(475157..475600)
                     /locus_tag="PN96_02215"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7N1X1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14847.1"
                     /translation="MKLWVDADACPKVIRETIVRAAERTGVECTFVANHIVPVPKRAN
                     IHSLQVPAGFDIADNEIVRRVEANDLVITSDIPLADEVITKGALALSSRGELYTKDTI
                     KARLNIRDFMDTMRSSGIQTGGPASLSQTERREFANHLDRILAKR"
     gene            complement(475597..475890)
                     /locus_tag="PN96_02220"
     CDS             complement(475597..475890)
                     /locus_tag="PN96_02220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14848.1"
                     /translation="MLTQDVTKELETVMEQLQQEGKEPSVALVKARMKTPVPMPALIT
                     ALKSWKSANRVPKIEIVAQKTSEQDRLAMLENTIAQLTARIEELEKKLSEKKS"
     gene            476915..477421
                     /locus_tag="PN96_02225"
     CDS             476915..477421
                     /locus_tag="PN96_02225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005494256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="ALR14849.1"
                     /translation="MAIVTRRMLLLPYDESLQLEFVMLNCCAKNRAEMNGPHTVASAK
                     QLFEKILDDRNIYSLAVLESSSRDYMGHIFISQLDSEPELGFIFDKAYWGKGLATEAL
                     KAFFPKACRELGLHKVTANVNSGHHASLAVLEKLGFVVTRESKDLYGPYFEMTFTSDE
                     AVGESSAA"
     gene            complement(477694..478731)
                     /locus_tag="PN96_02230"
     CDS             complement(477694..478731)
                     /locus_tag="PN96_02230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005446188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14850.1"
                     /translation="MENIQTLTQLLHNSNCDYQIFDLGRRIKAIEPQVFADVEKGQCP
                     YPFPMQRKAHLAIAYWNEQKQPWIWFLKFELDERGLLKQSDIGNFIKYVVEAMGTRLS
                     DDISEEQQQKLSNNPYTFKPSEDKMAVFHSLIRSSLDLPTSQYYEHTQHYFSGGLGWE
                     NWQTVGLQGITDMAARLGKEQNAVTLRKAIHHLPNEPLYALLGALEHVDLQERLAERI
                     AEKAHKEIESNEPDLFLLSALIRALAGAPTNIALPVLKAILQSPRLSHQEVLIGIAGR
                     TWHLLADAEIAEQFLLRLAQTGNQTLFNQLFADLVMLPELRMVFLPLLHSSPSEELAR
                     ALVNLQQATKG"
     gene            478811..479125
                     /locus_tag="PN96_02235"
     CDS             478811..479125
                     /locus_tag="PN96_02235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005456758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14851.1"
                     /translation="MTTSTKLAELLHQLEGQLHKHQLWQQTMPSPQALQSVEPFAIDT
                     LHPHEWLQWIFIARMRVLVESNQPLPRGFSIEPYFSEVWKQEPQYAELLVTIRTIDEL
                     CK"
     gene            479131..479907
                     /locus_tag="PN96_02240"
     CDS             479131..479907
                     /locus_tag="PN96_02240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="ALR14852.1"
                     /translation="MSEQETSQAVSPVELEIVYQDEYFVAVNKPAGMLVHRSWLDKHE
                     TQFVMQTLRDQIGQHVFPLHRLDRPTSGVLVFALSSEVASQVMPMFAEHKMEKTYHAI
                     VRGWIEEEGVLDYALKVELDKIADKFASQEKEAQEAVTAYKPLAKVEVPYSTGKFPTT
                     RYCLVEMKPKTGRKHQLRRHMAHLRHPIVGDTSHGDGKHNKLYRTEFDSHRLLLHASE
                     LRFVHPFTNEEIVMKANIDETWQQLFARFEWDQALVSKMS"
     gene            complement(479991..480374)
                     /locus_tag="PN96_02245"
     CDS             complement(479991..480374)
                     /locus_tag="PN96_02245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008077494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14853.1"
                     /translation="MFPHLTGLGIQDPKQIERYSLRQEAHKDVLKIYFQKQKGELFAK
                     SVKFKYPRQIKNVLVDSGSHQYKEVTEINRNLTLVIDELNKITKPTKVAEVDVKEKIL
                     SDLRHLEKVVSSKIAEIEADLEKLK"
     gene            complement(480516..483140)
                     /locus_tag="PN96_02250"
     CDS             complement(480516..483140)
                     /locus_tag="PN96_02250"
                     /EC_number="2.7.7.59"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335150.1"
                     /note="catalyzes the uridylylation or deuridylylation of
                     the PII nitrogen regulatory protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-PII uridylyltransferase"
                     /protein_id="ALR14854.1"
                     /translation="MSLQSPLTFTDEQINIGELKQELERFGSEQKQEFLNHHPVTSLV
                     LARAEYMDLLLKRLWQHFGFNDIYNISLVAVGGYGRGELHPLSDIDILILSNKKLPTS
                     LEAKISEFITLLWDLKLEVGHSVRTVSECAEIGRHDLTVATNLQEARLLCGSEDTFQA
                     LKKVVLSDSFWPSETFYRAKIQEQRERHARYHDTTYNLEPDIKSTPGGLRDIHTLSWV
                     ARRHFGATSLLEMSRYGFLTDAEYRELVECQDFLWRVRFALHLELRRYDNRLTFAHQA
                     QVAESLGYVGEGNRGVEMMMKEFYRTLRRVAELNKMLLKLFDQAIINGGITENAEILD
                     GDFQRRGSLIEARKPALFQARPETILDMFLHIANDSTIEGVSPPTLRQLRTARRRLNK
                     FLHTIPAAREKFIALCRHPNALHKAFSLMHRLGVMAAYLPQWSQIVGQMQFDLFHAYT
                     VDEHSIRLLKHIHTFNDPANHEKHPICCDIYPRMQKKELLIIAAIFHDIGKGRGGDHS
                     VIGEGEAYDFCIEHGLSKPEAKLVSWLVRHHLLMSVTAQRRDIYDPDVITEFAKKVRD
                     EESLEYLVCLTVADISATNPELWNAWKRTLLAELFYSTQRALRRGLENPVDVRERIRH
                     NQQMASAMLRKEGFSAREIEVLWQRFKADYFLRHTHTQIAWHCAHLLRMDDLTKPLVL
                     ISKKATRGGTEVFVYSKDQPALFATVVAELDRRNFNVHDAQIMTSKDGHVIDTFIVLD
                     QHGEAIDESRHAAVIKHLTHVLEDGRPTKIKTRRTPHKLQHFNVKTKVDFLPTRGKKH
                     TLMEFVALDTPGLLAKVGRTFADLNINIHGAKITTIGERAEDLFILTSGTGGRLSEEQ
                     QNALREQLIETLSEAVTD"
     gene            complement(483240..484118)
                     /locus_tag="PN96_02255"
     CDS             complement(483240..484118)
                     /locus_tag="PN96_02255"
                     /EC_number="3.4.11.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232765.1"
                     /note="catalyzes the removal of N-terminal amino acids
                     from peptides and arylamides; generally Co(II) however
                     activity has been shown for some methionine
                     aminopeptidases with Zn, Fe, or Mn; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="ALR14855.1"
                     /translation="MSIKIKTAEEIERMRIAGKLAADVLEMIEPHIKVGVTTEELNKI
                     CHEYALEKGAYSAPLDYHGFPKSICTSINHIVCHGIPAEQDEVGSNGQLKPAVLKDGD
                     IINVDITVIVPNDENADLSVRPQGYHGDTSKMFLVGEVSPANKRLCMVTQEALYVGMR
                     QVKPGATVGDIGTAIEKYIKENNKNNPRNKFSIVKDFCGHGIGDEFHEEPQVVHYKNK
                     DRRVLKEGMCFTIEPMINAGKFGCSVDAQDDWTVYTGDGKNSAQYEHTIVVTKEGCEV
                     LTLRSDDTIPRLMKNA"
     gene            484514..485242
                     /locus_tag="PN96_02260"
     CDS             484514..485242
                     /locus_tag="PN96_02260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009842458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S2"
                     /protein_id="ALR14856.1"
                     /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNRVHIINLE
                     KTVPMFNDALAEIAKVGEKKGKVLFVGTKRAASEAVKEAAIASNQYYVNNRWLGGMLT
                     NYKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTREMEKLEKSLGGIKDMGGLPDA
                     LFVIDADHEHIAIKEANNLGIPVYAVVDTNSNPDGVDYVIPGNDDAIRAVQLYLNAAA
                     SAVTEGRNKDVAVVAEKDGFVEAE"
     gene            485374..486219
                     /gene="tsf"
                     /locus_tag="PN96_02265"
     CDS             485374..486219
                     /gene="tsf"
                     /locus_tag="PN96_02265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005529365.1"
                     /note="EF-Ts; functions during elongation stage of protein
                     translation; forms a dimer; associates with EF-Tu-GDP
                     complex and promotes exchange of GDP to GTP resulting in
                     regeneration of the active form of EF-Tu; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Ts"
                     /protein_id="ALR14857.1"
                     /translation="MATVTAALVKELRERTGAGMMECKKALVEANADIELAIENMRKS
                     GAAKAAKKAGNVAAEGAIIIKEENGVAVLLEVNCQTDFVAKDGNFTAFADEVAAAALA
                     SKATVEELQAQFEETRVALVAKIGENINIRRVQYVEGAAIASYRHGEKIGVVVAGEGD
                     AETLKHVAMHVAASKPEYVNPEDVPADVVAKEKEVQVEIAMNEGKPAEIAEKMVVGRM
                     KKFTGEISLTGQAFIMEPKKTVGEILKEKGASVATFVRLEVGEGIEKAAEMSFAEEVA
                     AAQKG"
     gene            486367..487098
                     /locus_tag="PN96_02270"
     CDS             486367..487098
                     /locus_tag="PN96_02270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005494271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridylate kinase"
                     /protein_id="ALR14858.1"
                     /translation="MTTNPKPAYQRILLKLSGEALQGEDGFGIDPAILDRMAQEVKEL
                     VELGVQVGVVIGGGNLFRGAGLAEAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNA
                     RVMSAIPLKGVCDDYNWADAIRELRQGRVVIFSAGTGNPFFTTDSAACLRGIEIEADV
                     VLKATKVDGVFTADPVANPDAELYDKLSYAEVLDKELKVMDLAAFTLARDHKMPIRVF
                     NMNKPGALRRVVMGEEEGTLINSDA"
     gene            487194..487751
                     /gene="frr"
                     /locus_tag="PN96_02275"
     CDS             487194..487751
                     /gene="frr"
                     /locus_tag="PN96_02275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013856206.1"
                     /note="Rrf; Frr; ribosome-recycling factor; release factor
                     4; RF4; recycles ribosomes upon translation termination
                     along with release factor RF-3 and elongation factor EF-G;
                     A GTPase-dependent process results in release of 50S from
                     70S; inhibited by release factor RF-1; essential for
                     viability; structurally similar to tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome recycling factor"
                     /protein_id="ALR14859.1"
                     /translation="MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEY
                     YGAATPLNQIANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPL
                     PPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQDEI
                     QKLTDVAVKKIDEVLAAKEKELMEV"
     gene            487848..488603
                     /locus_tag="PN96_02280"
     CDS             487848..488603
                     /locus_tag="PN96_02280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005456725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP pyrophosphate synthase"
                     /protein_id="ALR14860.1"
                     /translation="MQNSQAFSDSLPKHIAIIMDGNGRWAKSKGKPRVFGHKKGVSAV
                     RKTVAAASRLGIKSMTLFAFSSENWRRPEEEVGLLMELFISVLSSEVKKLHKNNLQLR
                     VIGDTSRFSERLQKKIIEAEKLTAENTGMVINIAANYGGKWDITQATKALAQKARNGE
                     IRVEDINEQLITEHLTMADLPEVDLLIRTSGECRISNFMLWQMAYAEMYFTPEYWPEF
                     DEDSLVEAVTWFINRERRFGCTGEQVKALMAAQ"
     gene            488616..489458
                     /locus_tag="PN96_02285"
     CDS             488616..489458
                     /locus_tag="PN96_02285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005385351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diglyceride synthetase"
                     /protein_id="ALR14861.1"
                     /translation="MKQRIITALILAPLVILGIFKLPLMGFIIALTAITLLGFWEWTQ
                     FTGSRSRIAALIPAAIVTGLSFFYISPEANSLNHLSTPHYAMLGLGFVWWIIASLMAI
                     TYPKTTKTWQSSLVLRHIFGFLTLIPFLWSVIILRASDITVDPYHGAKLVLFVCFLVW
                     AADSGAYFAGKSMGKRKMAPNVSPNKTIEGLIGGIIAALLVGWLFADWFDIHFTSSVH
                     MVIITLITVVISVLGDLVESMFKRVSGIKDSSNIIPGHGGVLDRIDSLTAAFPVFALL
                     YYVF"
     gene            489509..490714
                     /locus_tag="PN96_02290"
     CDS             489509..490714
                     /locus_tag="PN96_02290"
                     /EC_number="1.1.1.267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232759.1"
                     /note="catalyzes the formation of 2-C-methyl-D-erythritol
                     4-phosphate from 1-deoxy-D-xylulose-5-phosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="ALR14862.1"
                     /translation="MQKLTILGATGSIGASTLKVVEQNPELFSVVALAAGTNVEKMVA
                     LCRKWQPKYAVMADKSAATALKSELDSLAPGTEVLGGVDALCHVASLDEVDSVMAAIV
                     GAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVEQYGAELLPVDSEHNAIFQCL
                     PEQVQTSLGRCHLDEHGISHILLTGSGGPFRYTDIAELEKVTPAQAIAHPNWSMGPKI
                     SVDSATMMNKGLEYIEAKWLFNASREQLKVIIHPQSVIHSMVQYRDGSVLAQMGEPDM
                     ATPIALTMSYPSRVHAGVKPLDFTQVGELTFLQPDFARYPCLKLAIDACYEGQHATTA
                     LNAANEVAVDAFLNNRLGFTDIARINGAVLNKISASCKAENVNSLESLLELDRMARTI
                     ALELIRERG"
     gene            490714..492072
                     /locus_tag="PN96_02295"
     CDS             490714..492072
                     /locus_tag="PN96_02295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005380334.1"
                     /note="catalyzes the cleavage of RseA which activates the
                     sigmaE-mediated stress response; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc metallopeptidase RseP"
                     /protein_id="ALR14863.1"
                     /translation="MTGILWNLVSFIVALGILVAVHEFGHFWVARRCGVKVEKFSIGF
                     GKSIWKKMGEDGTEYSISMIPLGGYVKMVDSRVDDVPQHEKHLAFDQKPLWKRTSIVA
                     AGPIFNFLFAIFAYWLVFLIGVPAVKPVVGDVTPNSIVAEAGIESGMELKAISGIKTP
                     DWESVNMGLISHIGDDLMTVTVEANDEIGSEVTKTLDLRDWQFDPETESAMHSLGFEP
                     YTPEIYTTIQQVTEGGAAELAGVMPGDEIVSIAGKTVAVWDDVVEAVRSNPNTPIELT
                     VLRDGYHQTLTLTPGSRELANKDVIGFAGIAPEVAEWPESYRFDLQFGVFESIGKAID
                     KTGQVVGLTVSMLKKLIVGDVGLNNLSGPISIAKGAGATADYGLVYFLGFLALISVNL
                     GIINLVPLPMLDGGHLLFFAIEAVIRRPVPERIQEMGYRIGGAIIFSLMALALFNDFT
                     RL"
     gene            492116..494530
                     /locus_tag="PN96_02300"
     CDS             492116..494530
                     /locus_tag="PN96_02300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005529356.1"
                     /note="part of a complex with YfgL, YfiO, and NlpB
                     involved in outer membrane protein biosynthesis; involved
                     in the assembly of outer membrane proteins; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly protein YaeT"
                     /protein_id="ALR14864.1"
                     /translation="MAIKRILFASLLATSVSANGAENFVVQDIEIDGLQRVALGAALL
                     KMPVRVGDTIGQGDVAEIIRALYASGNFEDVRVLRDGEVLVVQVKERPTIASISFSGN
                     KAIKDEQLQENLNASGIREGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPR
                     NRSDLKFVFTEGVSAKIQQINFIGNEVFSDEELLSRFNLNVDVPWWNFLADEKYQKQV
                     LAGDIEALKSFYLDRGYLKFNVDSTQVAISPDKKGVYITLGLEEGEVYTVKDVKFRGD
                     LVGEQDAFESMVPFDSNETYNGSLVTSMEEGVKRVLGESGYAYPQVNTIPEFDDENKE
                     VSLVVNVDPGNRIYVRDIRFTGNNATKDEVLRREMRQMEGSWLNSKSIETGKTRLNRL
                     GYFENVEVQTVRVPGSDDQVDLVYSVKEANSGSVNFGVGYGTESGVSFQVGLQQDNFL
                     GSGNRVGVNAMMNDYQKNISLDYRDPYWNLDGVSLGGKIFYDEFEASEAGIVDYTNQS
                     YGGSLTWGFPFDELNRFEFGVGYTHNKIGNLSPYLQVEQFLRAQADNIDSDGSLNTND
                     FDINISWTRNNLNRGYFPTAGNHQRAFYKMTVPGSDVQYFKMQYDVRQYMPLTEKHEF
                     TLLFRGRLGYGNGYGETNGNDNLFPFYENYYAGGFTSLRGFGSNSVGPKAVYRDYSGS
                     NNGADTATDDAVGGNAVALASLELIVPTPFASDEVRNQIRTSIFFDMASVWDTEFDYR
                     DSGAEYGDKYYYDYSDPTNYRSSYGAALQWMSPMGPLVFSLAKPIKKYDGDDEEFFTF
                     TIGRTF"
     gene            494544..495053
                     /locus_tag="PN96_02305"
     CDS             494544..495053
                     /locus_tag="PN96_02305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="ALR17184.1"
                     /translation="MNKMIKAAGIGLLVLSSSMFANAAEAAQKIAYVNTAQVFQALPQ
                     REVVLQKMQKDFKGKADELKKIQSQAKTKIEKLQRDGELLGQDEIEKLRIDIAKLDSE
                     YKVKAQALDKASARREAEEKAKLFKTIQDAVTKVAKNKGYDLVIDISALQYGKPEYNI
                     SEDVIKALK"
     gene            495060..496091
                     /locus_tag="PN96_02310"
     CDS             495060..496091
                     /locus_tag="PN96_02310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005436787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
                     N-acyltransferase"
                     /protein_id="ALR14865.1"
                     /translation="MKTLTLAELATITGGELFGDDTLVVSRVAPMDKAQEGDVTFLSN
                     PKYAKHLSECQATVVMVKAEHKDKCSGNALVVADPYVAFAHVVQAMDTTPQPAQDIAP
                     SAVIASDVKMGDNVAIGANAVIETGAELGDNVIVGAGCFIGKNAKLGSNTKLWANVTI
                     YHEVSLGDDCLVQSGTVIGSDGFGYANDKGEWIKIPQLGSVRIGNRVEIGACTTIDRG
                     ALEDTVIEDNVILDNQLQIAHNVHIGYGTVMPGGTIVAGSTTIGKYCQIGGASVLNGH
                     ITIADGVAITGMSMVMRSIEEKGLYSSGIPLQTNKEWRKTATRVHRIDEMNKRLKAVE
                     KLLEPKEES"
     gene            496345..496797
                     /locus_tag="PN96_02315"
     CDS             496345..496797
                     /locus_tag="PN96_02315"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q5E3F0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-ACP dehydratase"
                     /protein_id="ALR14866.1"
                     /translation="MTTEKKTMNISEIQELLPHRYPFLLIDRVTDFQEEKYLHALKNV
                     SVNEPQFTGHFPQLPVFPGVLILEAMAQATGLLAFKSFGAPTENELYYFASVDGAKFR
                     KPVVPGDQLVIEVEFLKERRGIAAFRGVAKVDGEVVCSAELKCARREF"
     gene            496799..497587
                     /locus_tag="PN96_02320"
     CDS             496799..497587
                     /locus_tag="PN96_02320"
                     /EC_number="2.3.1.129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017025894.1"
                     /note="catalyzes the addition of
                     (R)-3-hydroxytetradecanoyl to the glucosamine disaccharide
                     in lipid A biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine acyltransferase"
                     /protein_id="ALR14867.1"
                     /translation="MIHETAKIHPAAVVEEGAKIGANVTVGPFTYITSTVEIGDGTEV
                     MSHVVIKGHTKIGKDNRIFPHAVIGEENQDKKYGGEETTVVIGDRNVIREAVQVHRGT
                     VQDKATTVIGDDNLLCVNAHIAHDVVVGNHTHIGNNSILGGHVTVDDYAGVMALSAIH
                     PFCTVGAYAYVGGCSAVVQDVPAYVLAQGNHATPFGLNLVGLKRNGFEKPEIRALQKA
                     YKEIYRSGKTLEEVKPVLAEMAQEFPAVKRFSDILETTERGIIR"
     gene            497700..498839
                     /gene="lpxB"
                     /locus_tag="PN96_02325"
     CDS             497700..498839
                     /gene="lpxB"
                     /locus_tag="PN96_02325"
                     /EC_number="2.4.1.182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232752.1"
                     /note="catalyzes the formation of lipid A disaccharide
                     from UDP-2,3-diacylglucosamine and
                     2,3-diacylglucosamine-1-phosphate, lipid A disaccharide is
                     a precursor of lipid A that anchors LPS to the OM; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="ALR14868.1"
                     /translation="MEKPLRIGIIAGELSGDTLGEGFIKAVKAQYPNAEFVGIGGPKM
                     IAQGCESLFDMEELAVMGLVEVLGRLPHLLKVKAELVKYFTENPPDVFIGIDAPDFNL
                     RLELDLKQAGIKTVHYVSPSVWAWRQKRIFKIEAATNLVLAFLPFEKAFYDKFNVPCE
                     FIGHTLADAIPLRSEQAPARELLGLEQDKKWLAVLPGSRGSELKMLSQPFIETCKLLH
                     QKYPNLGFVVALVNQKRREQFEQAWKEHAPELNFTLVDDTARNVITASDAVMLASGTV
                     ALECMLLKRPMVVGYRVNALTAFLAKRLLKTKYVSLPNILADDELVKEYLQDECTPEN
                     LFKEVSRLLESDNREMIDKFTEMHHWIRKDADQQAASAVLELIKK"
     gene            498848..499501
                     /locus_tag="PN96_02330"
     CDS             498848..499501
                     /locus_tag="PN96_02330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="ALR14869.1"
                     /translation="MVAKAKSTKTKTTKTKVELPPFETPQGYQLIAGVDEVGRGPLVG
                     DVVTAAVILDPSNPIEGLNDSKKLSEKKRLALLPEIKEKALAWAVGRCSPQEIDELNI
                     LQATMVAMQRAIAGLNVQPDLVLIDGNRCPELPMDAQAVVKGDLRVAEISAASIIAKV
                     VRDTEMEELDKQYPQFGFAKHKGYPTKAHFDAIEQHGVIDEHRKSFKPVKRALGIEC"
     gene            499581..503060
                     /gene="dnaE"
                     /locus_tag="PN96_02335"
     CDS             499581..503060
                     /gene="dnaE"
                     /locus_tag="PN96_02335"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017047313.1"
                     /note="catalyzes DNA-template-directed extension of the
                     3'- end of a DNA strand by one nucleotide at a time; main
                     replicative polymerase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="ALR14870.1"
                     /translation="MSDPKFIHLRVHSDFSMVDGISKVPPIVKKVAELGMPAMALTDF
                     TNLCGLVKFYGTAHGCGVKPIIGADFKMQSDEFGEELTQLTVLAADNVGYKNLTLLIS
                     KAYLRGHIQHQPVIDKSWLAEMSEGLIVLSGGKNGDIGKALLKGNRNLVQSCVEFYKQ
                     HFPDRYYLELLRTGRPDEETYLHFAVELAEQVDLPVVATNEVVFLSSDLFDAHEIRVA
                     IHDGYTLEDPRRPKNYSPQQYLRSEEEMCELFADIPEALENSVEIAKRCNVTVRLGEY
                     FLPAFPTEGMKETEFLVMKSREGLEERLEFLFPDEEERKKRRPEYDERLQIELDVINQ
                     MGFPGYFLIVMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFL
                     NPERVSMPDFDVDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLG
                     HPFGFVDRISKLIPPDPGMTLDKAFKAEPALPELYEADEEVKELIDMCHILEGCTRNA
                     GKHAGGVVISPTTITDFAPIYADSEGHFPVTQFDKNDVETAGLVKFDFLGLRTLTIID
                     WALGLINPRLEREGKAPVRIESIPLDDQASFRLLQNSETTAVFQLESRGMKELIKRLQ
                     PDCFEDIIALVALFRPGPLQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILDPTYG
                     IILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEMAKQRATFEEGAVKNGVDGEL
                     AMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKMHYPAEFMAAVMTADMDNTEKVV
                     GLVDECFRMKLTVLPPDINSGLYRFNVDENGAIVYGIGAIKGVGEGPIDAILEARNKG
                     GHFKDLFDFCARIDLKRVNKRVIEKLIYAGALDRLGPHRAAMMASLNDAVKAASQHHQ
                     AEAFGQADMFGVLTDAPEEVEHKYTQVPPWPEKVWLEGERETLGLYLTGHPINAYLKE
                     LNKYTSCRLKDATPTRRDQSVTVAGLVIAARVMTTKRGTRIGIMTLDDRSGRMEVMLF
                     SDALDRYAELLEKDRILVVSGQVSFDDFNGGLKMSAREVMDLGSAREKYARGLSVSID
                     ANQINDQFFEQFSRILEPHKAGTVPVNVYYQRADARARLTLGTEWRVTPSDTLIDDLK
                     QLLGTNQVELEFN"
     gene            503108..504067
                     /locus_tag="PN96_02340"
     CDS             503108..504067
                     /locus_tag="PN96_02340"
                     /EC_number="6.4.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335136.1"
                     /note="catalyzes the carboxylation of acetyl-CoA to
                     malonyl-CoA; forms a tetramer composed of two alpha (AccA)
                     and two beta (AccD) subunits; one of the two catalytic
                     subunits that can form the acetyl CoA carboxylase enzyme
                     together with a carrier protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase subunit alpha"
                     /protein_id="ALR14871.1"
                     /translation="MSLNFLEFEKPIAELEAKIEALRDVSRHGGDAAVDLDKEIEQLE
                     KKSLELKKKTFSNLGAWETAQLARHPLRPYTLDYIQHAFEEFDELAGDRAFADDKAIV
                     GGIARLEGRPVMIIGHQKGRETKEKVKRNFGMPKPEGYRKALRLMEMAERFNMPIITF
                     IDTAGAYPGVGAEERGQSEAIAKNLKVMSGLKVPVICNVVGEGGSGGALAIGVGDYVN
                     MLQYSTYSVISPEGCASILWRDSDKAPQAAEAMGLTAPRLKELELIDEIIEEPLGGAH
                     RNHVEMAANMKATLLRQLEDLEQLDEESLRERRYQRLMSYGYC"
     gene            504144..505460
                     /locus_tag="PN96_02345"
     CDS             504144..505460
                     /locus_tag="PN96_02345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="ALR14872.1"
                     /translation="MESLYQHFTQLLTAHYQPQTKVVLAFSGGVDSRLLLALMSRYQR
                     DHSIPCQTVYVHHGLSSNADDWAEKCKAWAKQAGVSHSTEYVHLDINSGESIELLARE
                     ARYQALAKYIESGDLLLTGQHADDQLETFLLALKRGSGPKGLSCMAESAPFSAGTLIR
                     PLLTTRREQIEQIAHSLNLEWVEDESNQDTRYDRNFLRHHVVPELSQRWPSIHQAVQR
                     SASLCAQQETLLDELLNDVFYRALQADLSLDIAELASHSELARARLIRMWLAKQNAQM
                     PTQVQLSLIWKEVALAQQDANPKLKLKQGEVRRFQNKLYWVCDKAEVSGWQVHIQVDC
                     ALVLPEGLGQLMLSTTSEQATIALPPQPELLSVTFNPEGLTAHPVTRNHSRKLKKLFQ
                     EYHVPSWLRRQIPILMYQDQVVAVADLFVDKAFSGQDCELIWRKPL"
     gene            505520..505831
                     /locus_tag="PN96_02350"
     CDS             505520..505831
                     /locus_tag="PN96_02350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcsB"
                     /protein_id="ALR14873.1"
                     /translation="MKKTVIGAVMALTMLSGQAFAAGDVAAGQTKSAVCAACHGADGM
                     ATIPGYPNLKGQNAQYIMSSIKAYKNKERTGGLAPVMQAQASLLSDDDIANLAAYYSS
                     L"
     gene            506007..506345
                     /locus_tag="PN96_02355"
     CDS             506007..506345
                     /locus_tag="PN96_02355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013571272.1"
                     /note="indirectly regulates nitrogen metabolism; at high
                     nitrogen levels P-II prevents the phosphorylation of NR-I,
                     the transcriptional activator of the glutamine synthetase
                     gene (glnA); at low nitrogen levels P-II is uridylylated
                     to form PII-UMP and interacts with an adenylyltransferase
                     (GlnE) that activates GlnA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II 1"
                     /protein_id="ALR14874.1"
                     /translation="MKKIEAIIKPFKLDDVREALAEVGITGMTVSEVKGFGRQKGHTE
                     LYRGAEYMVDFLPKVKLEIVVTEDVADKCVETIIETAQTGKIGDGKIFVTDVERVIRI
                     RTGEEDEDAI"
     gene            506452..507297
                     /locus_tag="PN96_02360"
     CDS             506452..507297
                     /locus_tag="PN96_02360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14875.1"
                     /translation="MLKRFVLAVVFFFMAVVLGFQVIFTVPDHPQIITQTGDEITEDI
                     QCIEFNDSQVLDEQGELNVLIWNIYKQSKDNWQSALNALSTDKQLLLLQEASMTEPFK
                     QWLVDGNWMSNQVSAFKALGSGAGVINIAQRLPQKACAYTSTEPWLRLPKSALYSQYR
                     LSNGNTLAVVNIHAINFTVGTEEYHSQIAALEELLTQHSGPIIFAGDFNSWNEYRLEA
                     MKQALQKANLQEVSFSPDHRTQFITGQRLDHVFYRGLVLKNAKAPQSDASDHNPLLVS
                     FTLDD"
     gene            complement(507294..507980)
                     /locus_tag="PN96_02365"
     CDS             complement(507294..507980)
                     /locus_tag="PN96_02365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ALR14876.1"
                     /translation="MKPSSNPLVMLLDVFRSPTSCFLALYQRGGWGWQLFIILMVSPF
                     LFWGAYFSNVDFTWLSEQLTPQLQQINPQQIDLLEPNTLMASAIINDVVNRFATLLLL
                     AFWFFLATKASKQQYGYWKWFAAACAILFPAVLGDVASYASLILNHGEVMTYAADLNS
                     LNGLLKLPLTNEWSHFASSLPLLLPWYIVLGYGVVLTWTEFERGQALVIASLPWVMFY
                     VIWALYIVVS"
     gene            complement(507977..509557)
                     /locus_tag="PN96_02370"
     CDS             complement(507977..509557)
                     /locus_tag="PN96_02370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase"
                     /protein_id="ALR14877.1"
                     /translation="MRLKYSLALALLLSGCQMTSPDSTTSTPETNKSELAAKQKAAKE
                     QAKSKQSLTDAVKETPKVLSPQEQEDVWQRIAMQLEMDIPHNKKVDYYRTWYLKHPNH
                     LKTVSQRAEPFLYMIAEQIEKRGLPMELALLPVVESSFDAFAYSHGSAAGLWQFVPGT
                     GKMMGLEQNYWYDGRRDVAASTEAALDYLVQLNKQFDGNWEHAIAAYNSGGGRVSRAI
                     RKNKSLGKPIDFFSLDLPKETSSYLPKLLALADVVANQDKYGLNIPAIPNKPVLALVD
                     PKEQLDLAIAADYAGIGVKELQSYNPAYNQWSTSPNGPQKLLIPIEKKDAFLAQVAEN
                     RGKGVKVARYKVKSGDSLGVLARKYGTTTKVIRRANGLSSDNIRIGQHLLIPTSTKDD
                     SKYALSASNRLSKTQSTARGQLKLTHVVQSGESLWSIARDNNVSYKSLAKWNGMGPKD
                     TLRKGQKIVIWKKSADDSVIRTVFYNVRSGDTISGIASKFKVKSTDIVKWNSLQQKKY
                     LQPGQKLKLYVDVTKVSV"
     gene            complement(509810..510568)
                     /locus_tag="PN96_02375"
     CDS             complement(509810..510568)
                     /locus_tag="PN96_02375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005529333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="ALR14878.1"
                     /translation="MLEIKSIPAFNDNYIWLIQNSDKRCAVVDPGDAKPVLEYLQANE
                     LTLEAIMITHHHNDHIGGVPDLVRAFPDVTVVGPKAEPIPTLTVPMEEGDKLELFGEI
                     FMVMGLPGHTLGHIGYVGDGKLFCGDVLFSAGCGRIFEGTAEQMFDSLSKIAALPDET
                     QVYCAHEYTASNVAFALAVEPDNEKLRQYRDDVNRLRALNIPTLPTTLRQEKWINPFL
                     RTNHPEVIKSVTNRIKNDDPCSVFTALRVWKNEF"
     gene            510606..511361
                     /locus_tag="PN96_02380"
     CDS             510606..511361
                     /locus_tag="PN96_02380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="ALR14879.1"
                     /translation="MKPALSNKTIPHPSTWSDLNNGPWVLESIQTRFDEWCPKLFGYH
                     MLKLGGLSCELTSSNCNIQHQVNVDIQNPLHNVVADGYELPFLEKSFDVAILAHQLDY
                     ARDPHRLLREVDRVMMDDGYLIITGFNPFSFTGLASLFPWRKNNLPWSGRMFSSNRVQ
                     DWLGLLNYQVIHRDRYALFPMTRYRTMWTWFENSLGEWASPAGSLYYIVARKRTYPLK
                     PIKPHWRLKKKLTPLGVMNREGAGVKKMSSDKR"
     gene            complement(511358..511822)
                     /locus_tag="PN96_02385"
     CDS             complement(511358..511822)
                     /locus_tag="PN96_02385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005446139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease H"
                     /protein_id="ALR14880.1"
                     /translation="MTKHVEIFTDGSCLGNPGPGGYGVVLRYKDVEKTLSKGYTLTTN
                     NRMEMLAAVVALQTLKEPCKVSLTTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNAD
                     LWQALDKETARHEVEWHWVKGHAGHRENEICDELARTAAENPTEEDTGYQAS"
     gene            511882..512604
                     /locus_tag="PN96_02390"
     CDS             511882..512604
                     /locus_tag="PN96_02390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232739.1"
                     /note="3'-5' exonuclease of DNA polymerase III; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="ALR14881.1"
                     /translation="MNTSSNSEYNRIVVLDTETTGMNQEGGPHYMGHRIIEIGAVEII
                     NRKLTGRHFHVYLKPDREIQAEAVGVHGITDEFLVDKPEYASVHQEFIDFIKGAELVA
                     HNAPFDTGFMDYEFEMLDPNIGKTDDFCKVTDTLAMAKKIFPGKRNNLDILCERYGID
                     NSHRTLHGALLDAEILADVYLLMTGGQTSLEFNANKQEGGVESVRRVEGRKALKVLRA
                     SADEIDAHQKRLELVNDSIWLQ"
     gene            512613..513863
                     /locus_tag="PN96_02395"
     CDS             512613..513863
                     /locus_tag="PN96_02395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="ALR14882.1"
                     /translation="MLRALSVAILAIWSCLASAASESTMSLLDNRFRVDPSIEQITFL
                     VHREQSSQPVVLVRPDGKKYYAWGSYDNIRWYQEPALDIVSIDQPMPGPWQAVGKVTP
                     KNNIRLISHLKLSTDAFPNHLYHGEALKFTSRLTSDDKPLVLRDFLDRVNLQVTFTKF
                     VENEDELINEERPVPLVIGDFQDDGRDLDEQAGDGVFTVQLPIEVQPGKYRARIVSGN
                     GVFLRAEEQVVLVYPNPISRTFIQSREQNQPHQLVVSGEQGMIAPGSLLVSVEKSAPD
                     GFKSYGQGQVSQDGLKATLNLDNDPELGKYSWQGVIFATDFATQRPLIFPIQEQTFSV
                     VDDVDLEAARKAKEAELAEQHRIETEKRILAEREAERKRSLLMIAVGNVVMLIIGILV
                     WLIWRKLKAKREAIPEMQLQMPKN"
     gene            complement(513955..515718)
                     /locus_tag="PN96_02400"
     CDS             complement(513955..515718)
                     /locus_tag="PN96_02400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate permease"
                     /protein_id="ALR14883.1"
                     /translation="MAKKLFSQWFPGLVQLKHYQREWFTNDFRAAFSVVAVALPVAIA
                     YAQLTGVSAVVGLYSCVLPMLVYALMGTSRQLIVGPDAATCAVIAAVVTPLAAGDPTK
                     HWQLVMTMTAMTGIWCVVASRFKLGIFADFLSRPILLGLLNGVALTIIVSQFAKVVGW
                     RYEQRYLLERLWEAPQRLTEVHWPTVSLSIATVVVYLVTKRFRPAWPAAMLAILVTTG
                     SVWLLHLQDMGVSVVGITQGGFPQFQAPKFELGEVRELVVPALNLAIVSFVSMMLTAR
                     SFAAKNGYDIDANKEFRALGFANIASAFSQGFAISGADSRTAVNDANGGKSQLVSIIA
                     ALTIAVIAIFIYEPLQFIPIASLGVVLIIASLSLLDLKAIWTLRQRDKDAFNLAGITF
                     VSVLVIGVIPGITLAVLLGLFQFLRIVMRPSDQILGLDEKGTIRTVDGTGKATPIPGM
                     VIYRFNSPLTYFNAPYFKRRVLEQAEHTKDVSCVVVDAVSSFTHLDLSVMATLSDLHE
                     MLKKRGIRLILAGRKRRLRQWCDLTGISTSDGGILLRADMYLAIKLSGCYISAVGEGQ
                     VPAVQKEPDLEQTPKPIPEVA"
     gene            complement(515903..518347)
                     /gene="fadE"
                     /locus_tag="PN96_02405"
     CDS             complement(515903..518347)
                     /gene="fadE"
                     /locus_tag="PN96_02405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017447771.1"
                     /note="functions in fatty acid oxidation; converts
                     acyl-CoA and FAD to FADH2 and delta2-enoyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="ALR14884.1"
                     /translation="MDILLSIVAMTIVLGITLYHRMSLVKSVSLLTAAMLVLTIAGSA
                     GFIGWAIYILAIAVFAVSGIRQSLISRKALAVFKKVLPAMSQTEKEALDAGTVWWEAE
                     LFKGKPEWKKLHAIQAPKLSAEEQAFLDGPVNEVCAMVNDFQVTHELADLPPEVWQYL
                     KDHKFFAMIIKKKYGGLEFSAYAQSLVLQKLTGVSGVLSSTVGVPNSLGPGELLQHYG
                     TEEQKDYYLPRLAEGKEIPCFALTSPEAGSDAGSIPDYGVVCKGQWEGKEVLGMRLTW
                     NKRYITLAPVATVLGLAFKLRDPQGLLGDKEDLGITCALIPTNVKGVEIGNRHFPLNV
                     PFQNGPTRGKDIFVPIDFIIGGEKMAGQGWRMLVECLSVGRGITLPSNSTGGIKTAAL
                     ATGAYSRIRRQFKQPIGHMEGIEEPLARIGGNAYVMDAASNLTVAGIDLGEKPSVISA
                     IVKYHCTHRGQQSIIDAMDIVGGKGICIGPSNFLARGYQGSPIAVTVEGANILTRSMI
                     IFGQGAIRCHPYVLEEMNAAYSDASDAVEKFDKALAGHVSFTMSNLVRSIWFGLSDGL
                     GSSAPTKDATKRYYQQLNRYSANLALLSDISMAVLGGSLKRKERLSARLGDILSQLYL
                     SSAALKRFEQDGRPVEDLPLVHWALQDSLKQAETAVDEFLANFPNKVIARTLRVLIMP
                     FGRVRKAPSDKLDSKVARILQTPSATRSRIGRGQYLAPTEHNPAGKIELALSVILQAE
                     PVFDKVCKAQGKRRPFLRLDMIAEEGLEQGIISQEEAELLREAEQHRLDTINVDDFEP
                     EQLAAKPNYPHMDSVA"
     gene            518704..519279
                     /gene="gmhA"
                     /locus_tag="PN96_02410"
     CDS             518704..519279
                     /gene="gmhA"
                     /locus_tag="PN96_02410"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8DBC5.1"
                     /note="catalyzes the isomerization of sedoheptulose
                     7-phosphate to D-glycero-D-manno-heptose 7-phosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="ALR14885.1"
                     /translation="MYQDLIKSELNEAAEVLNKFLSDDHNIAQIEAAAKLIADSFKQE
                     GKVLSCGNGGSHCDAMHFAEELTGRYRDNRPGYAGIAISDPSHLSCVSNDFGYDFVFS
                     RYVEAVGRKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEI
                     RVPHFGYADRIQEVHIKIIHIVIQLIEKEME"
     gene            519336..520181
                     /locus_tag="PN96_02415"
     CDS             519336..520181
                     /locus_tag="PN96_02415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004744816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="ALR14886.1"
                     /translation="MCELLGMSANVPTDICFSFTGLMQRGGRTGPHRDGWGITFYEGK
                     GFRTFKDPKPSCDSKIAELVQNYPIKSRAVVSHIRQANRGGVNLENTHPFTRELWGKY
                     WTFAHNGQLSDYQDLHTGRHRPVGQTDSELAFCWLLKQMEDRYPEPPEDMASVFVYVA
                     KCCDQLKDKGVFNMLLSDGEFVMTYCTNHLYWITRRAPFGKAALLDEDVEINFQEETT
                     PNDVVSVIATQPLTGNEAWQRMKPGEYGLFHLGELVDGNAAALKDVAFAPKKVASQAP
                     TEPLE"
     gene            complement(520260..520907)
                     /gene="purN"
                     /locus_tag="PN96_02420"
     CDS             complement(520260..520907)
                     /gene="purN"
                     /locus_tag="PN96_02420"
                     /EC_number="2.1.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017447773.1"
                     /note="glycinamide ribonucleotide transformylase; GAR
                     Tfase; catalyzes the synthesis of
                     5'-phosphoribosylformylglycinamide from
                     5'-phosphoribosylglycinamide and
                     10-formyltetrahydrofolate; PurN requires formyl folate for
                     the reaction unlike PurT which uses formate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="ALR14887.1"
                     /translation="MKNIVVLISGSGSNLQAILEACEANMPNAQVAAVFSNKADAYGL
                     ERAKQFNVEGHFVDPKAFESREAFDAELMKQIDQYQPDVIVLAGYMRILSSEFVQHYM
                     GKMINIHPSLLPKYPGLHTHQRAIDAKDKEHGTSVHFVTEELDGGPVVLQAKVPVFED
                     DDAATLAARVQTQEHTIYPIVTKWLVEDRLKMQDGKAWLDGQELGAHGYAAAEEE"
     gene            complement(521083..522123)
                     /locus_tag="PN96_02425"
     CDS             complement(521083..522123)
                     /locus_tag="PN96_02425"
                     /EC_number="6.3.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7MY25.1"
                     /note="catalyzes the formation of
                     1-(5-phosphoribosyl)-5-aminoimidazole from
                     2-(formamido)-N1-(5-phosphoribosyl)acetamidine and ATP in
                     purine biosynthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole synthetase"
                     /protein_id="ALR14888.1"
                     /translation="MSGNNSSLSYKDAGVDIDAGNALVDRIKGAVKRTRRPEVMGGIG
                     GFGALCELPTKYKQPVLVSGTDGVGTKLRLALDMNKHDTIGIDLVAMCVNDLIVQGAE
                     PLFFLDYYATGKLDVDTAADVVSGIADGCVQAGCALIGGETAEMPGMYEGEDYDVAGF
                     CVGVVEKEEVIDGTKVAAGDALIAVGSSGPHSNGYSLVRKILEVSGADKNEMLEGRTI
                     GEHLLEPTKIYIKSALKMIEKHDIHAISHITGGGFWENIPRVLPEGTKAVIDGNSWEW
                     PVIFQWLQEKGNVETHEMYRTFNCGVGLIVALPKDQAEAAVALLQEEGENAWVIGEIA
                     QAEANEEQVEIK"
     gene            522304..522930
                     /gene="upp"
                     /locus_tag="PN96_02430"
     CDS             522304..522930
                     /gene="upp"
                     /locus_tag="PN96_02430"
                     /EC_number="2.4.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q87MH1.1"
                     /note="Catalyzes the formation of uracil and
                     5-phospho-alpha-D-ribosy 1-diphosphate from UMP and
                     diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="ALR14889.1"
                     /translation="MKVVEVKHPLVKHKIGLMREGDISTKRFRELATEVGSLLTYEAT
                     ADFETEKVTIEGWNGPVEVDQIKGKKVTVVPILRAGLGMMDGVLEHMPSARISVVGIY
                     RDEETLEPVPYFNKLASNIDERIALVVDPMLATGGSMIATIDLLKEKGCNQIKVLVLV
                     AAPEGIEALEKAHPDVELYTAAIDEKLNDKGYIVPGLGDAGDKIFGTK"
     gene            complement(523026..524279)
                     /locus_tag="PN96_02435"
     CDS             complement(523026..524279)
                     /locus_tag="PN96_02435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014232730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil transporter"
                     /protein_id="ALR14890.1"
                     /translation="MKNALQGAQMLFVAFGALVLVPLLTGLDPNVALFGAGVGTLLFQ
                     LITKRSVPIFLASSFAFIAPIMFGIQTWGIGATMGGLMAAGMVYIALGAAIKVRGVGF
                     IHKILPPVVVGPVIMVIGLGLAPTAVNMAIGKTGDGAAQLVNGDAAIMISAVSLLTTI
                     ALSVFAKGFLKLVPIVGGILAGYSVSLAYGVVDFTPVAQAAWLSLPNFTTPEFNINAI
                     LFMIPVAIAPAVEHVGDMLAISNVTGKDYLKKPGLHRTIAGDGVATMAAAMVGAPPNT
                     TYSEVTGAVMLTKAFNPKIMTWAAVTAIVLALVGKLGAILQTIPVPVMGGIMILLFGS
                     IATVGLNTLIKNHVDLHKSRNLVIVAVTLVFGIGGMAFGIGEFSLQGVSLCGIVAIIL
                     NLVLPHDLGENHVVDNAQIEEDKAN"
     gene            524734..525933
                     /locus_tag="PN96_02440"
     CDS             524734..525933
                     /locus_tag="PN96_02440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020335123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ALR14891.1"
                     /translation="MRYLALLLIGWLSLPVYALTQVDIYRAEVIIDSEQDNGESLARE
                     QGMKEVIVRATGSQSSLSNTVIQKALSSSSRYISQLGYGQVDGKPSLDMRFNSGQIHS
                     LLTQAQLPSWSPHRANILVWAIEEQAYERTIAWENSDSAQVSALRVAAETRGLPITVP
                     VGDFDDVTGVDVSDLWGGFVEPIAKASQRYPVDAVMVLKAQGDQIRWTLYDQSPSAIL
                     VSQRSPRSGSATGVNAMAEVVDAISDYYAGKSAVVVSGESSDGITMKVVNIHSAKDFF
                     HLESALKKLNSVAGTEVKRV