LOCUS       CP007141             2165416 bp    DNA     circular BCT 19-SEP-2017
DEFINITION  Pseudothermotoga hypogea DSM 11164 = NBRC 106472 chromosome,
            complete genome.
ACCESSION   CP007141
VERSION     CP007141.1
DBLINK      BioProject: PRJNA234771
            BioSample: SAMN02584724
KEYWORDS    .
SOURCE      Pseudothermotoga hypogea DSM 11164 = NBRC 106472
  ORGANISM  Pseudothermotoga hypogea DSM 11164 = NBRC 106472
            Bacteria; Thermotogae; Thermotogales; Thermotogaceae;
            Pseudothermotoga.
REFERENCE   1  (bases 1 to 2165416)
  AUTHORS   Zhang,X., Alvare,G., Fristensky,B., Chen,L., Suen,T., Chen,Q. and
            Ma,K.
  TITLE     Genome sequencing of Thermotog hypogea
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2165416)
  AUTHORS   Zhang,X., Alvare,G., Fristensky,B., Chen,L., Suen,T., Chen,Q. and
            Ma,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JAN-2014) Department of Biology, University of
            Waterloo, 200 University Avenue West, Waterloo, Ontario N2L 3G1,
            Canada
COMMENT     Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Newbler v. 2.6
            Genome Coverage       :: 56X
            Sequencing Technology :: 454 GS FLX Titanium
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 01/17/2014 14:13:17
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.3 (rev. 423251)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 2,168
            CDS                          :: 2,097
            Pseudo Genes                 :: 21
            CRISPR Arrays                :: 4
            rRNAs                        :: 3 (5S, 16S, 23S)
            tRNAs                        :: 46
            ncRNA                        :: 1
            Frameshifted Genes           :: 9
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2165416
                     /organism="Pseudothermotoga hypogea DSM 11164 = NBRC
                     106472"
                     /mol_type="genomic DNA"
                     /strain="DSM 11164 = NBRC 106472"
                     /isolation_source="an African oil producing well"
                     /culture_collection="DSM:11164"
                     /type_material="type strain of Pseudothermotoga hypogea"
                     /db_xref="taxon:1123384"
                     /country="Cameroon"
                     /collection_date="1979"
     gene            809..1561
                     /locus_tag="AJ81_00010"
     CDS             809..1561
                     /locus_tag="AJ81_00010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002941226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="AJC72844.1"
                     /translation="MKNSSRFEFSVLGVLLLFVVWFVVSKLVSSDLVFPGPEKVLLHS
                     YRLLVEGKLLEPVGLTFLRAFFGMGLALLVGTILGFLMGLSERIYLLLQPLNMAIRSV
                     PIVSWLSTVILAWGIGWRGVVFIVFVSLLPIVTFNVCEGVRVVDKKLVEMAKVYSLPK
                     WKIFRAIYMGSVWPFLLSSLKLSIGSMWKVAIVAEYLIGETGLGVQIMQAKFYVNTTE
                     VFSYTVVAVAFGLILEALFSFLWERGSFEVHS"
     gene            1545..2243
                     /locus_tag="AJ81_00015"
     CDS             1545..2243
                     /locus_tag="AJ81_00015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="AJC72845.1"
                     /translation="MKCILELKGIFKNYGKLPVLGGIDLKLFESDAVAIVGPSGCGKT
                     TLLRVIANLEKPDSGLINRFYNRLGFVFQEDRLIPWYNVRKNLELVCDDERKIQRTLQ
                     RVGLAGFEHYKPGQLSGGMKQRLNFARALIVEPELLLLDEPFRSLDTPTKIRLINDLS
                     VLLENMNIGYVLVTHDMREALSLAKRIYIMRGRPAKFVHHIELRNKMDFFDPSFLQLE
                     KTILSHMEDAEAFQ"
     gene            2240..3346
                     /locus_tag="AJ81_00020"
     CDS             2240..3346
                     /locus_tag="AJ81_00020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="AJC72846.1"
                     /translation="MMNVLRGFLIGLANLVPGVSGATMAVIVGVYERLIDAVANFVKL
                     RFKREQIAFIVALGIGILAAILVGSAGMKHLLERSPAVAYAIFFGLVLGSIPKLRREI
                     SDLKLFHFAVGASLMLIFELLVHTVQLSGTYVLLTGIIAACAMILPGLSGSLVLLILG
                     VYDDILDALVNLKLAIVLPFGIGVILGIALMAPQRCDAIIVLGGGVLKGPEGYELRPH
                     TFKRLIEGVELAKTYNAFLIVSGGTLPGSSQQPEATIMAQLAQRFEVPNEKVLVDAES
                     KNTYENAKNVAKIVKELNLKELVLVTSAVHMKRAKMSFEKFKVRVHPYPVDYLCDYGP
                     VSWIDFVPTKESLEANMLALHEIVGLLWYRLKTR"
     gene            complement(3350..4024)
                     /locus_tag="AJ81_00025"
     CDS             complement(3350..4024)
                     /locus_tag="AJ81_00025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002251405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-triphosphate reductase"
                     /protein_id="AJC72847.1"
                     /translation="MKFARTVLTSLLDYPKSVSVVLFTVGCNFCCPYCHNPELVLAKV
                     SIAEEEEIFEEIRKRKITNRVVITGGEPTVHEDLPAFIRKLKKSDHLVKLDTNGSNPR
                     MMEDLLSAGLLDYVALDIKSGMEKFHTVTGLSEESAKEMFKSVLETLRLLKQYSVPHE
                     IRTTYVPGLLDERDIAEIKELVGDSTWYLQRFRPQKTLRSFTNVTSSTYEDLFKLASK
                     FGAKVR"
     gene            complement(4021..5835)
                     /locus_tag="AJ81_00030"
     CDS             complement(4021..5835)
                     /locus_tag="AJ81_00030"
                     /EC_number="1.17.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002251404.1"
                     /note="Catalyzes the reduction of nucleoside
                     5'-triphosphates to 2'-deoxynucleoside 5'-triphosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside triphosphate reductase"
                     /protein_id="AJC72848.1"
                     /translation="MLRSVDLVGDYLKKNDWRVYENSNMSYSLQGMNHYVYSSIVARY
                     WLEEIYPEEVSRAHMNGDLHIHDLGSLSVYCVGWNLEDLLVKGFTGVEGKISSKPAKH
                     FRSALGQVVNFMFTLQGEAAGAIAFSNFDTLLAPFIAYDGLSYSEVKQAIQEFIFNLN
                     VPTRTGFQTPFTNLSFDLVVPWHMRKEKVIVGGQRQTHTYGEFQNEMDMLNRAFWEVM
                     LEGDAQGRIFTFPIPTYAITKDFPWDLEQFKLLWELTAKYGVPYFSNFVNSDMDPSDV
                     RSMCCRLRLDNVSVKARLSRFSTQKDELVRKGGGLFGANPLTGSIGVVTINIPRIAYL
                     SSDEDEFFERLSELMELAKQSLEIKRAVLEELTEQGLYPYSKFYLSDVHMLTNSYWSN
                     HFSTIGLVGMHEACVNSLGVGIDCEEGRQFAIKVLQFMREKLLQFQRETDNLYNLEAT
                     PAEGVSYRFARIDKRSFPDIYTSGINEPFYTNSTQLPVDGDYDLSYVLEHQDALQSLY
                     TGGTVLHIYLGEAIEAETVPELLKSVFNRYTLPYLTLTPTFSVCPDHGYLRGEVRTCP
                     RCGKPAEVYSRVVGYYRPVKSWNKGKREEFSLRRPVRI"
     gene            6050..7093
                     /locus_tag="AJ81_00035"
     CDS             6050..7093
                     /locus_tag="AJ81_00035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001738727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="AJC72849.1"
                     /translation="MKLENLLPKDVVEKLKERTKCTGPYIQELSDKMKETVELVGRIY
                     SKKLQESKDGKKFLLMTLMDRTGSIRAVDWYNAEENDAKLAEGDVVLARGRVVFFEGH
                     LQLNVDREKDALVLLTEEQYDYERFVEVTKRGIDTLYEKLVRFISEIQDREIRALLEA
                     LFVEDREFVSCFVQAPAGVSVHHAYVGGLLEHTVDVATMCKRMSNVYDFLDKDVLVAG
                     AMLHDIGKVREYRITKKGLEVTTEGELKGHIALGVEILHQVASKVNIAKTKLLQLEHI
                     VLSHHGEYEFGSPVLPKTAEAYVVHALENMDSKLSRFRSINEKQKNGGKIWSEFDKHL
                     GRRIWLGRWKDED"
     gene            7083..8492
                     /locus_tag="AJ81_00040"
     CDS             7083..8492
                     /locus_tag="AJ81_00040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_003239896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase"
                     /protein_id="AJC72850.1"
                     /translation="MKIRFGTSGWRAIISDEFTFKNVRIVSQAIADYVKKTNGKRLIV
                     ARDTRFMTERYARLVAEVLTANGIKVFMPENPTPTPVVSFTIRHHRLDGGINITASHN
                     PPEYCGIKFNPADGSPAPPEVTQQIESIIASLEESKVSTMSLVEANRKDLLEIFDPKP
                     DYLNALAKIIDFDTIKKAKLKVIVDLMYGTAIGYLDELCSKLVADIDVFHNYRDPYFG
                     GDRPEPDEERLALLANRVKSKGWDVVLAVDGDADRFGIVDDEGRYVKANEVIALLAHH
                     LYKNKNMKGPVARTVATSHAVDEVAKAFGEKVVETPVGFKFLASVLLNDKAVIAGEES
                     GGLSIANHVPEKDGILACLLILEMIAREGKPLSQIRKEFREQYGNFLNSRVDFELSSD
                     EEKNKLFEKFENLEQYSEDLKVTSSDRVDGLRYFFDKPGSWLLVRVSGTEPVIRVYFE
                     AKDEPTYQKLNMLVRKISR"
     gene            8497..10665
                     /locus_tag="AJ81_00045"
     CDS             8497..10665
                     /locus_tag="AJ81_00045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002941350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="AJC72851.1"
                     /translation="MAKKIIIVESPAKAKTIKEILKGEYEVVSSKGHVRDLPEREFGV
                     DLRDFEPEFRIIEGKEKIVEEIKEKAKGKEVYLASDMDREGEAIAWHLAFILNVLDKK
                     NRIVFSEITPQTIRSAVQSPRFIDMKKVYAQHARRILDRIVGYKISPLLWKLLRTSSS
                     AGRVQSAALKLVCEREVQRHRFVPKKFWKVQGYIDSVRFYLTHIDGKRIDMQQVDEAL
                     ARQIQQEVRKLKLVQKKSRLVERKPPLPFITSTLQQEAANKFGFSVSRTMQLAQMLYE
                     GVETSEGHRAFITYMRTDSTRVSDYARDQAEKFIKDHFGERYVGEFRSEQKKPNVQDA
                     HEAIRPVDVEMTPQKAQKLLDKDLYKLYKLIWERFIASQMAAALYEETIYSFESGRYG
                     FEAKLERRIFDGFEAVLKKELEQIQPLNGEIFNVTKWDIQQDATKPPARYTESSMVRA
                     LEARGIGRPSTYATIISTLLERKYVVKRSKELVPTVLGFVVNHYMEQRFPKIVDLDFT
                     ARMEEALDAIERGEKDHKQVLSEFYKEFSTQLTKAEKEWLSIDVGTNVDCECGEKFTL
                     KIGRFGLYLSCASCGKTSSVDLSSPAVMDEGVLYFTEQEETKTYVCPSCGEPLKRYNG
                     RYGAYYHCQKCGRNYRDFARGTCPKCGSAVEKKLSKNRKYFFKCTSDACDYISWFEPS
                     NESCPECGEKLHYRRFRSSEKLYCERCKKSFEKPKEETNG"
     gene            10662..11555
                     /locus_tag="AJ81_00050"
     CDS             10662..11555
                     /locus_tag="AJ81_00050"
                     /EC_number="6.3.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005471982.1"
                     /note="D-alanine--D-alanine ligase; DdlA; DdlB;
                     cytoplasmic; catalyzes the formation of D-alanyl-D-alanine
                     from two D-alanines in peptidoglycan synthesis; there are
                     two forms of this enzyme in Escherichia coli; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-alanine synthetase"
                     /protein_id="AJC72852.1"
                     /translation="MKIAVLMGGVSREREISLRSGENVVKALKKLGHEVVPIDVKEDF
                     FLVLPSLKQFDLVFIALHGKFGEDGTVQALLDWIGVPYTGSGVLASALCFDKLMTYRI
                     VEKFVPVPEYTVIDKPTRESPFGFPCVLKPRREGSSIGVHICDNAEELEHYSQIELSL
                     YGELVLQRYVRGRELTASLIEMDGELRILPILELRPRRRFYDYIAKYTPNMTEFVLPA
                     PLTEEEYRAVCESCLKAFKACECKGFARIDGILKDGIFYFLEINTIPGMTDLSDMPAS
                     ARAAGMSFEDLIDAIVKTVRR"
     gene            11552..12571
                     /locus_tag="AJ81_00055"
     CDS             11552..12571
                     /locus_tag="AJ81_00055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72853.1"
                     /translation="MRATIDLSSLSLWLKFCNKLIGSSEFSFGNVYFSYSGGLVVRAT
                     DGCLHGWMKTGECEPFDGEISIPLRLLKGFLVGESSEFLNLTLTENEIALSSGNETLR
                     MKLMGKREKQVPVEHEPVAKSDLLNFNRALNFVTSPLEEGDFALFGSFQKDLLMFAST
                     RSIICLTRLQGELMKPFTFSFPYMSARHIVKAFEVYAKNVQLTFGLGEALLIRSNDFT
                     LQLCGEHAAFDPRVGDFLQRKETYVVPKNFRRFVSKAAWLMPRESTVRIECVKNSMRF
                     FGAYGGVSYKAILPFDCPLKFEFEISPHRLRSALARMSDKLMISIGDGFVKTPSLTIF
                     SPPQS"
     gene            12516..13100
                     /locus_tag="AJ81_00060"
     CDS             12516..13100
                     /locus_tag="AJ81_00060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72854.1"
                     /translation="MTVSSRHLRSQSFHHHSPRTRLQGELMKPFTFSFPYMSARHIVK
                     AFEVYAKNVQLTFGLGEALLIRSNDFTLQLCGEHAAFDPRVGDFLQRKETYVVPKNFR
                     RFVSKAAWLMPRESTVRIECVKNSMRFFGAYGGVSYKAILPFDCPLKFEFEISPHRLR
                     SALARMSDKLMISIGDGFVKMEDSAGRTVVVKRL"
     gene            13097..13633
                     /locus_tag="AJ81_00065"
     CDS             13097..13633
                     /locus_tag="AJ81_00065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_09022696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="AJC72855.1"
                     /translation="MSEGVWKRAWKAFGVFLKISSLTLGGGYAMVPVMQWEAEKLGWM
                     KRDEFLNLLSVAQSIPGPIAFNTAIIVGKRVAGVPGAILSGVAIALPPFVAIVAVASL
                     LKPFLNNAYVRAFLLGVYAAVVALVFNVLLGLIKKQSWTILKLMVIGVGVVLLLINRN
                     TLYVVFAATIWLLYMWGK"
     gene            13644..14153
                     /locus_tag="AJ81_00070"
     CDS             13644..14153
                     /locus_tag="AJ81_00070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_229615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="AJC72856.1"
                     /translation="MIKLALIFLKLGFLSFGGGWAVVGILQKELISAGFFSPAEFTEM
                     VSVAQMTPGPIALNLATYVGYKYFGFLGAFLNTFFFLLAPALTMILVYSLGKRIKLNS
                     NKLSQALMGFTTVMVLVTLISLASPRLTDPWFFLIATLVFFGLNKFKIHPLVLMFAAG
                     FIGVLLYAI"
     gene            complement(14139..14987)
                     /locus_tag="AJ81_00075"
     CDS             complement(14139..14987)
                     /locus_tag="AJ81_00075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006347004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="AJC72857.1"
                     /translation="MEEIESFIQSFVRNNGFEGVVVGVSGGVDSALVVSLCTRALGKE
                     RVLGLILPDRDSAKESTRLALKLCRELGIEHEVISITSALRKLRVYRLFPPAWLFPRK
                     VQESYVKGKWQSLSKDPYIDDLLNRGNETFRKGLAYYRIKHRVRMCLLYFEAEKRNYA
                     VAGCVNKTELMTGLYVKWGDNAADFEPISHLYKTQVLELARWLRIPSEILERAPTPDL
                     IPGITDEFVLGLSYADLDRILMKMEKKEDLSSEDPKLVQRVRQICEAARRRKIQNVRI
                     DSSNCV"
     gene            complement(14983..15633)
                     /locus_tag="AJ81_00080"
     CDS             complement(14983..15633)
                     /locus_tag="AJ81_00080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001549863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase H"
                     /protein_id="AJC72858.1"
                     /translation="MGKYYAVKRGRCPGIYEDWQRAREQVEGFPNAEYRSFASKADAL
                     AYLRGETWRCPDFMKDTILVCVDGSYRDGVCGSGIVVCDQEGLREFYFWTDEPDLAKM
                     RNVAGEILAVLFAVNYALQRGTKRLVIRHDFENLDKWISGEYRTKTFLTEIYREFVDF
                     AKRKNLRIEFEKIKAHSKDPCNERADGLAKLATGRKRNVDWKLEVLRDVIRSDESN"
     gene            complement(15639..16418)
                     /locus_tag="AJ81_00085"
     CDS             complement(15639..16418)
                     /locus_tag="AJ81_00085"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74597.1"
                     /translation="MMNVLRGFLIGLANLVPGVSGATMAVIVGVYERLIDAVANFVKL
                     RFKREQIAFIVALGIGILAAILVGSAGMKHLLERSPAVAYAIFFGLVLGSIPKLRREI
                     SDLKLFHFAVGASLMLIFELLVHTVQLSGTYVLLTGIIAACAMILPGLSGSLVLLILG
                     VYDDILDALVNLKLAIVLPFGIGVILGIALMALLMNWLVEKFPNQTRSFTFGLVVASI
                     IKLEPFTKQSMNLVGFALVLLIVSVTVYLSFRLSYRSSARR"
     gene            complement(16415..17113)
                     /locus_tag="AJ81_00090"
     CDS             complement(16415..17113)
                     /locus_tag="AJ81_00090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="AJC72859.1"
                     /translation="MKCILELKGIFKNYGKLPVLGGIDLKLFESDAVAIVGPSGCGKT
                     TLLRVIANLEKPDSGLINRFYNRLGFVFQEDRLIPWYNVRKNLELVCDDERKIQRTLQ
                     RVGLAGFEHYKPGQLSGGMKQRLNFARALIVEPELLLLDEPFRSLDTPTKIRLINDLS
                     VLLENMNIGYVLVTHDMREALSLAKRIYIMRGRPAKFVHHIELRNKMDFFDPSFLQLE
                     KTILSHMEDAEAFQ"
     gene            complement(17097..17849)
                     /locus_tag="AJ81_00095"
     CDS             complement(17097..17849)
                     /locus_tag="AJ81_00095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006345218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="AJC72860.1"
                     /translation="MKNSSRFEFSVLGVLLLFVVWFVVSKLVSSDLVFPGPEKVLLHS
                     YRLLVEGKLLEPVGLTFLRAFFGMGLALLVGTILGFLMGLSERIYLLLQPLNMAIRSV
                     PIVSWLSTVILAWGIGWRGVVFIVFVSLLPIVTFNVCEGVRVVDKKLVEMAKVYSLPK
                     WKIFRAIYMGSVWPFLLSSLKLSIGSMWKVAIVAEYLIGETGLGVQIMQAKFYVNTTE
                     VFSYTVVAVAFGLILEALFSFLWERGSFEVHS"
     gene            complement(17827..18741)
                     /locus_tag="AJ81_00100"
     CDS             complement(17827..18741)
                     /locus_tag="AJ81_00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate transporter substrate-binding protein"
                     /protein_id="AJC72861.1"
                     /translation="MRKLFMLLFLLAISFSFAINVLIPVGPTVVAFVGLLEKKVSSEV
                     ELKIDFWRTLDQVSAQVAAKNVDLIVLPVSIGASLYSKGIDLKLAGVILWKAFYVVTK
                     DFDLTDLKTLSGQEIYTPQGKGQTGDVLIRYSLEQVGLKPDIDVKIRYATPPEIVSLM
                     SAGKVRVAVLPEPFVTLALKQAQSRIEYDLQELWSNYTQLPARVPITGLFVTKNLDEA
                     TLYKAMTAIENSLRYAMENRHEAAALSVPYLGGMPAQIIEESLTRTLYEYKRANEVAS
                     EVIQYLKITQQVDPSAMPSIPDEKFFAF"
     gene            complement(18804..20540)
                     /locus_tag="AJ81_00105"
     CDS             complement(18804..20540)
                     /locus_tag="AJ81_00105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002939902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="AJC72862.1"
                     /translation="MTVEINGKSYEVPAGVTVLEACNQAGVYVPTLCNHPRLEPTGAC
                     RVCVIEVEGAKNLQPACVTKVQDGMKIRTNSSRVTNAVKFNLALLLSRHPKDCMTCDV
                     NGRCEFQDLIYLYDVQDIFPSEVRTITPDISSPAVVRDLEKCVVCGRCVRACSELQGM
                     DIYSMVDRGYETLPQTAFEMPLYETDCISCGQCAAFCPVGAITENMNIRRVLEEIEKH
                     DKVLIVQTAPATRVALGEEFGMEVGSISTGKMVAALRRLGFDYVFDTNFAADLTIMEE
                     GSEFLERVKKGGPFPMFTSCCPAWINLAEKLYPQFLKNLSSAKSPHQMLGALLKSYFA
                     KKINVPPEKIFVVSIMPCTAKKDDITRPQHMVNGVPAVDVVLTTRELGRLIKMRKIPY
                     ASLPEENYDDPLGESTGAAAIFGVTGGVMEAALRTAYELGLGKPLPKIEFTNVRGLDG
                     IKEATIDFDGKQLKVAVAHGGVNVRRLLDKITKGEVYYDFVEIMACPGGCIGGGGQPK
                     SLDKDVLVKRMEAIYTIDERSVLRKSHENPSIKKLYEEFLEHPLSHVSHELLHTTYMD
                     RSKKKVAQVAKV"
     gene            complement(20609..20974)
                     /locus_tag="AJ81_00110"
     CDS             complement(20609..20974)
                     /locus_tag="AJ81_00110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004661073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="AJC72863.1"
                     /translation="MRVKRSLHARKKRKKILKAVKGFRGAISRRYKLAKQHYIRAKWY
                     SFAGRKIKKRDFRKIWITRINIAARKYGLKYSELIHGLRLANVSINRKMLSELAVNDP
                     SAFASYVELAKEHLKKVTA"
     gene            complement(20990..21190)
                     /locus_tag="AJ81_00115"
     CDS             complement(20990..21190)
                     /locus_tag="AJ81_00115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="AJC72864.1"
                     /translation="MAKNKMKTSKTAAKRFRVTKNGKILFNHARTRHTTGKRRRSALR
                     ELRKKDVLDKGDAKRIKRLLGV"
     gene            complement(21206..21634)
                     /locus_tag="AJ81_00120"
     CDS             complement(21206..21634)
                     /locus_tag="AJ81_00120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="AJC72865.1"
                     /translation="MPTYKAIELARREGLDLVLVSPNSDPPVAKIMDFGKYMYQLAKK
                     QKEAKKKQKVQEIKQMKFRVKIDEHDYQTKVRHIRRFLEEGNKVKVTVMFRGREITFS
                     EKGEEILKRIAQDVSDIGVVEVEPKLEGKDMWMQIKPKEE"
     gene            complement(21844..21919)
                     /locus_tag="AJ81_00125"
     tRNA            complement(21844..21919)
                     /locus_tag="AJ81_00125"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(21884..21886),aa:Lys,seq:ctt)
     gene            complement(21926..22000)
                     /locus_tag="AJ81_00130"
     tRNA            complement(21926..22000)
                     /locus_tag="AJ81_00130"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(21965..21967),aa:Arg,seq:cct)
     gene            complement(22062..22631)
                     /locus_tag="AJ81_00135"
     CDS             complement(22062..22631)
                     /locus_tag="AJ81_00135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="AJC72866.1"
                     /translation="MSSARERILEAAKAAFSERGFDGVSMEEIAQRAGVRKPLIYYYF
                     PSKEVLFEEVWNRALEELENHIFKEVENENYYVRKIKRFLRAYIDFVTSRKVLSKVIE
                     KERASVLDESGQGDVWKRLKRRYDDFLNRVAQLIEEGKKNELVNPEIDSQTAAKLITE
                     ALAASTTSGSVLKSIESFILSGLMGRTEP"
     gene            complement(22650..24098)
                     /locus_tag="AJ81_00140"
     CDS             complement(22650..24098)
                     /locus_tag="AJ81_00140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="AJC72867.1"
                     /translation="MPVVGGVKGFIYHQAGKLVASVLRNTDEEGLYKLFSTLSALTKE
                     PSKSGLKKLALMAKDKHPMITSWVKVFRRSSPKCVEKIINNLIINEFALGEPIRQQKM
                     HEHKVVLPKLGVISPTYACNLNCVGCYAGLYGRKYELTKEEVSKVIREGNELGLYFWV
                     ITGGEPFYWPHLMEILEEFNDNYFLIYTNGTLITEEVAKRLSELGNATPAISVEGFEL
                     DTDWRRGRGVFKSVLEAWDRLRKYGVPFGASITATRMNHDTLMKDEFWQFLEEQQVVY
                     AWVFQYMPVGMNASMDLVPTPQQRYERFFKTDQVRLGGKFAFVADFWNHGFLTHGCLA
                     AGAKYFHVNAKGYVEPCVFQQYAVDSIREKSLLEILKSPFFESYKRMVPYSNNLFRPC
                     PIIDNPKVYRAMVKHFNAIPQHDGSERVVEDLAPEIDKLAEEWKVYADKLWYEHGYVN
                     RYPVNRGIYNYETRMRRYMNREEALAVDKTLK"
     gene            complement(24159..25397)
                     /locus_tag="AJ81_00145"
     CDS             complement(24159..25397)
                     /locus_tag="AJ81_00145"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74598.1"
                     /translation="MNEPVWYDDLEQFLLCPRRFQLDKGTIERSEAPLDSSELLRLGF
                     SVERAILEVEIFGVRFIADPDLAVLEENGWRLILKKEAKRFKQKYAVEAAYHAYIFSQ
                     RGFPVSRVTVSSPYFEVDLDWRDAVPRLISLLENITTFREEPYDPRPTSLCKTCSHVI
                     ECSEALIRKKDLLAIHGLNERTRLKLLKEGVEDLEDLLNVQKLKDFSKDVMEKLKKKA
                     QALLERRPILLAPLPPFPDGLFLDIESHTVADYDYLFGILKDNEYIAFLCEEKEQEGT
                     IFKKVIDFLLSTEGPIYHYCAYEPTHFRELARLHGVESDYTRLKKRFVDVYQILSKHV
                     ALPLFSYSLKSVARYYGFNWRTKLDGWRASKYFQTWLVTREPSLLDAVMKYNEDDVRA
                     TRLIVEKLRSMHLHEEVTNK"
     gene            complement(25390..26907)
                     /locus_tag="AJ81_00150"
     CDS             complement(25390..26907)
                     /locus_tag="AJ81_00150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="AJC72868.1"
                     /translation="MFIGESDLNVRSIVNVSRHNEQVSLSPSAIDRMRNPRTVVERLA
                     SSEKPVYGVNTGFGAFATTKIPKDKLLSLQKNILLSHACGVDEPLPTDVVRAMILMRA
                     HTLALGHSGVRPIVVEKLCEMLNKSIVPYVPCRGSVGASGDLAPLAHVALVLIGEGEV
                     LIDGERRPTRDALQLFEFEPIQLLEKEGLSLVNGTQAMSACLALAVNDALNLVRLSTE
                     VAALSADVLFASTDPYDEAVAKTRRHRGQGIILRMMRERFESSQLRASHVNCLRVQDP
                     YSLRCIPQVHGAVLDVLFFAKKIVEDEINSVTDNPIVYGDRMISQGNFHGEPLAFAAD
                     FLCIALTDLGNMIERRIDRLLNPKLNEGLPPFLAFGEAGVNSGLMIWQYTAAALCNEN
                     KVLSHPASTDTIPTSGFQEDHVSMGMNACLKLLKVLDNVETLSAIELMCAARALQARR
                     PMRSSKLNEELFSRVEDLLEGTSDDTYWQNSFRRIKRFVDQTIKETHTEWWRTYE"
     gene            27020..27250
                     /locus_tag="AJ81_00155"
     CDS             27020..27250
                     /locus_tag="AJ81_00155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72869.1"
                     /translation="MDKIVELQELVDKLLEDYKRLKEENEQLWSQMNEALTKLEQVDK
                     EKRELEKLVETYRNTMNSLVEKLQKMISLAGT"
     gene            27256..27513
                     /locus_tag="AJ81_00160"
     CDS             27256..27513
                     /locus_tag="AJ81_00160"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74599.1"
                     /translation="MKRTLVLKLGDKSYELSADVPEEFVLAVVNRIQNQFAQIKNNSS
                     DASIDEILVVMLANSVLNEIQYEETISKITNKLKAFMNLKR"
     gene            27715..28278
                     /locus_tag="AJ81_00165"
     CDS             27715..28278
                     /locus_tag="AJ81_00165"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74600.1"
                     /translation="MISACNTAQAALMALNVQPKENFFGILDFDLPAGLRKVGVVATE
                     ATVRSGVYLDKMRRIGVEVFQRPCQELVAAIESCARDEKIVRIVGEAVDSMRQVGVDA
                     IILGCTHFPLVKHVFERLSGKILVLDPAELLAKKLERFLSKNPNGKARVKFYVSSDAE
                     SFSKKVLSYGVALPYTVEEFSWGEIAG"
     gene            28275..29111
                     /locus_tag="AJ81_00170"
     CDS             28275..29111
                     /locus_tag="AJ81_00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide-binding protein"
                     /protein_id="AJC72870.1"
                     /translation="MKRILIVSGLSGAGKSTAIRILEDLGFFCIDNLPPTLLNDFMAV
                     VMSSSMENVALVLDVRSAQFGDLTSAVKKLLQSYGESISVLFLEASKEELIRRFSVTR
                     RKHPLEGKLSLSEAIEIEKKMLEEIRNMSLVIDTTEMDIQMLRERISGLLSIEKTFLI
                     RLRSFGFKYGLPPDTDFLLDVRFMANPYYRSELAPLDGRDERVKQFFENQNDVAEYIE
                     CAAKMIHIAAMGYKKVGRAGMTVSVGCTGGRHRSVYVVERLAEKLANEFGIEVEHRDV
                     NK"
     gene            29108..30073
                     /locus_tag="AJ81_00175"
     CDS             29108..30073
                     /locus_tag="AJ81_00175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_229509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72871.1"
                     /translation="MKVIAIGGGTGLSTILRGLKGKNLELTAVVAVTDEGGSSGKIRE
                     ELNVPPPGDVRNNIIALAKVESLMSKLFSYRFRTNGSLSEHSVGNIILAALTMMTGSF
                     AKAVRYASDILAIEGKVLPVCEELVRLKAIYSDGSTVVGETEIAKKTDSRIVLVDLDK
                     KVRALDEVLSDISQADAILLGPGSLYTSVITNLLVDGMAEVIGENKRAKKIYIANIMT
                     QPGETIGYSLEDHVYEVERYLKVRLDYIVANRTLPPKDVLESYAKQGSEPVLPRGRVD
                     ERYIFQDLLEITYEANDPRPKARHDPHKTAEVVIDLLGGRSSNEK"
     gene            30075..30992
                     /locus_tag="AJ81_00180"
     CDS             30075..30992
                     /locus_tag="AJ81_00180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72872.1"
                     /translation="MNFSEFVRHELCSLSVDDPQLAANEAYGFVKARGSLNLSQSGAE
                     VSLRFPNIQTTRRFLKLLKALSVKDYQMMVLSTKGLWPARGAQVNLGLEFLEKIGVKE
                     SLWDKIIEHRDPAMFGAFLRGFYLGCGSILNPARTYHWELTYHDGEFLQQIANVLNHT
                     LGLEAKIKRLKHAYRLSLRRAQDVVEVLHLIGAIEAANRVEELVRQRSIASDVNRSMN
                     FISANADRIGKSTAAQLKALQIIEKTIGIDSLDEELREIAKLRLENEDLSLRELGELM
                     TPPMSKSMVYSRLRKIMSIAKNLAQERVG"
     gene            30989..31456
                     /gene="nrdR"
                     /locus_tag="AJ81_00185"
     CDS             30989..31456
                     /gene="nrdR"
                     /locus_tag="AJ81_00185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001664817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NrdR family transcriptional regulator"
                     /protein_id="AJC72873.1"
                     /translation="MKCPYCGHPDSRVLDSRPTLDGTAIRRRRECLECGARFTTYERY
                     ELLPIIVVKKDGRREAFDRNKVLNGVLKACEKRPIPYETLEKLVEEVELAIQKTGYTE
                     VPSRMIGELVMQKLKNIDQVAYVRFASVYKDFREIDQFLEIVKELKKNEEGTS"
     gene            31453..31926
                     /locus_tag="AJ81_00190"
     CDS             31453..31926
                     /locus_tag="AJ81_00190"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9X232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="AJC72874.1"
                     /translation="MKKSVIKLTKEGYEALKQELESLRQKLMYEISQRIKEARELGDL
                     AENTEYDEAKNEQGRINSRIAELEQILNNAEIIESAESDVVSIGSWVVIRNLNTGEER
                     TIRLVNPHESDIFSNKVSVDSPVGRVLLNKKIGEIVRLKTPSGQVKYEIIGIRTE"
     gene            31936..33441
                     /locus_tag="AJ81_00195"
     CDS             31936..33441
                     /locus_tag="AJ81_00195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="AJC72875.1"
                     /translation="MAQEIRNQKLQKIGEIREIKVNPYPYRFEKTHSSGQIREKFGYL
                     NPAEVLENEKLSTAGRVMTIRLHGKSCFFTLKDFDGRIQAYIRQDAVGEKMYEFFKRY
                     IDTGDIVGIRGFPFKSKTGELTIFVEEFQLLCKAVRPLPEKWHGLKDKELAYRQRYVD
                     MIANDSTIERFKIRYKAMAFIRKFLVDRGFVEVETPILNFIPGGGSARPFVTRLEALD
                     CDVYLRIAPELHLKRYIVGGFEKVFEMGKNFRNEGISYKHSPEFTSIEIYQAYADYND
                     MMELTEQMISSLVHYLFGTYKITYQGVEIDFTPPWRRIRMHEFIKEKLGVDILEDSDE
                     KLYSFLKERGVEPELKTRGKMIEKLWDLVEDQIVQPTFLMDHPVDISPLAKKHRLDPR
                     LTERFEPIVCGMELGNAFSELNDPQEQLERFLAQAKLLEAGDKEAHRMDLDFVRALEY
                     GMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLVSQRFDEALDEEERSAES"
     gene            33438..35048
                     /locus_tag="AJ81_00200"
     CDS             33438..35048
                     /locus_tag="AJ81_00200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72876.1"
                     /translation="MRKWFKKWQNVIVWALAVAFIAGIAWWSVAGYISSRARNTEFQT
                     EIVGYVAVNGQEPKDTIAKVPAAELESEYANFLANYSVGSLDPLFEEPPQKANLLKEL
                     LKERAILLYAKENSLLPTKKEINAKLKEYENEIKKNQAFLQYVRQRFGSLEVYLDKVL
                     RPSIEKTMTLDKVRNKVAGVGEEEMKKHFEENIEDIKAKYDTANVELAWFENEENAKK
                     FMSLLPNMAFDQAASQMSVQITPLNNVKRGWFDKEIEEKIFSATPNSVVGPFKLSESW
                     FVVHVKEATVVSDFASFALSDFYETEKSTLQNSLFEKWYEEYVNSKKMELRITDEILF
                     VWDKISQAASQSELTELEGKISRKLFLEDGSIAIDAPDTLKSAYVVLVEKIEDFGGEL
                     NENLRNRREALVRYLYEQYPSSLYVARRMYEIDKNDVEVKYNYFTLLYSIVKPYIPLV
                     GPQALLQSILEIEAGLASIVSDTSAAIELRASACYNLYDLLKELGDATSAKFYLDQLK
                     SLSPNYIDFEVAMRELEEMLQSTREEQK"
     gene            complement(35073..35148)
                     /locus_tag="AJ81_00205"
     tRNA            complement(35073..35148)
                     /locus_tag="AJ81_00205"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(35113..35115),aa:Gln,seq:ttg)
     gene            35209..36882
                     /locus_tag="AJ81_00210"
     CDS             35209..36882
                     /locus_tag="AJ81_00210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="AJC72877.1"
                     /translation="MKQIVLRIFDTQEELQVPIGEKLLEHAKRCWKYHDTPIVAARLD
                     NTIVELTRPLDRGGTVKFIDLRSLDGLRIYQRGTLFVLNMALKQLYPNCELWVLHSLG
                     NALYCELRCSGEVRSLSEEEIQKVKARMNQIVAHDLPFEKNEYYKDEAFRIFTQQGDE
                     DRIRLFKFRKKKTIKLYRCGDHYDYYYGYMPPSTGVLKWFDLVKENDGFLLILPDQKD
                     PLNVSPPKPLPKLSSVFYEYARWLNVIGIRTVADLNEIISRGEREIAELMIINEALHE
                     KRVSQIAEQFANSGARLILIAGPSSSGKTTFAKRLLVQLRVQGFKPLVVSLDDYFVDR
                     ELTPRDEQGNYDFEALEAIDLKLFNEQLLMLIEGKEVELPKFDFKAGKRTWTGQKIRL
                     DKNQPIVVEGIHGLNEKLTESIDRSMKFKIYVSALTQLNLDPHNRITTTDTRLLRRII
                     RDYKFRGHSALDTLKMWPSVRRGEERHIFPFQEEADVMFNSAIVYEWAVLKVFAEQLL
                     VQVPPEEQEYTEALRLMKLLDYFLPITNLEDIPRTSILREFIGRSAFKY"
     gene            36879..37802
                     /locus_tag="AJ81_00215"
     CDS             36879..37802
                     /locus_tag="AJ81_00215"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74601.1"
                     /translation="MKRKLVIIFSFLLIHVFATHVYYGDQPILISSEGWLLKWDRFVE
                     LLKYYFERMGFEQPTLGNVGDFNYIVWNGHTVGYDSASKFVSLDGVSKRSEGIDLLEA
                     LKVFGLPFVLEQDRLILPNTWIHEIQKVQDVIEISYSGEKRLSALQDGGYVYFKSEGY
                     VFYGNVMYRPGQILAQFERASNESIKQQIDLKGLIRLVMAREISVSSVRFLELSENVV
                     VSENELTVLYAPGDNRVIIRPYVPEYDGADWPVYAEVRKIAEKLCQRFSLKLEICPLI
                     VLPPQTMTMLILVEDQALLDELKGFLEDLVR"
     gene            37799..38260
                     /locus_tag="AJ81_00220"
     CDS             37799..38260
                     /locus_tag="AJ81_00220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein"
                     /protein_id="AJC72878.1"
                     /translation="MKKFVLVLLIVLSAQLVARQLTLFYLDDKLNPVSVRQNVGDDSD
                     LVKTIFDRLASPPNGLKSFVPSDVLRAYFFVESYLVIDLKRGPISMLDFTQERFFVHQ
                     LLRTIFENFSGIDAVYFLVDGSRRDVLTKMVDVRFGFARHFWSRWPVEGEQ"
     gene            38260..39036
                     /locus_tag="AJ81_00225"
     CDS             38260..39036
                     /locus_tag="AJ81_00225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="AJC72879.1"
                     /translation="MDSVQLGDRVLALFEDGRSFLFKVQDGKLQTHHGIIDLASLVGK
                     NYGSVCETHTKERFYIMKPRLVDEIYKMKRQTQIVYPKDIGFILLMLDVHEGKTVIDA
                     GVGSGAMCAALARAVGTKGKVYAYERREEFKKLAQENLTKWGLADRVEIKLRDISEGF
                     DERVDAIFLDVPDPWNYIRQCYEALNGSGNIAIVCPTTNQVQHVLEEISKFSFVGIEV
                     WESLFRQYKPVADRLRPFDRMVAHTAYMIFARKVMNDWRD"
     gene            39038..40246
                     /locus_tag="AJ81_00230"
     CDS             39038..40246
                     /locus_tag="AJ81_00230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005096262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S41"
                     /protein_id="AJC72880.1"
                     /translation="MRKNVFVVVTVGVVVLLTAWLLSGAVTPKDVDKALTPFYQTLSY
                     ILNAYYERDSIDLNKLIDSAIDGLVKGLGDDFSYYEGPEEVEEKQIEMEGEYGGLGIE
                     VTYDSEYKAVKVIAPMYGTPAWRAGLKPGDRIVSIDDQPVSEMQYMEAVRKLRGQPGT
                     QVKIKVLREGVQELLTFEIVREVIRIVPVKHAYIETQKGRVGYVMITRFGAKTTQEMA
                     SALDEIFEKGVQGILLDLRNNPGGYLNSAIDVASFFVDKGIIVKTRNAYGVEEVYESK
                     GNKYPNVPVVILVNKGSASASEIVTGALKDNNVAKIVGQTTFGKGSVQTGFPLANGGT
                     LYLTTARYMTPSGKDIHRIGIEPDVVVEEENEKPRETLVYDYTKKIVEVNLEDPFIAK
                     GLETLLELIE"
     gene            40243..40824
                     /locus_tag="AJ81_00235"
     CDS             40243..40824
                     /locus_tag="AJ81_00235"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74602.1"
                     /translation="MTSFGFATICFSICLVVALLFQLQLGMNKDLIWIEPFPKVRLRS
                     PFQNFLSALGKKMNFLMELHQLPIANFLIPSQGGTVAVLRLERLADYYSVLMKEKEKP
                     IENRVEVEIAGSKKIVRASFEKNGVKIMYSASIVLDEEGQVLTNHSDVAKILIQVLDG
                     ESQRVNAVKSGEEYIESLKNLASKYGIEVLTAK"
     gene            40821..41267
                     /locus_tag="AJ81_00240"
     CDS             40821..41267
                     /locus_tag="AJ81_00240"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74603.1"
                     /translation="MRILKCLFVKDAFLKVHETWSFLIALITFNTVIIAFWDNFQLVF
                     VGTNLLVKYIEMNVAFLIYVFLLCGLTLLRRDVQDALSVPLLFFPYILTPIYAVMLAW
                     LRFPKALSFTIAFVHSIFLASEHDPLILSVRIFAYLGLLTVVRYWI"
     gene            41258..43582
                     /locus_tag="AJ81_00245"
     CDS             41258..43582
                     /locus_tag="AJ81_00245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="AJC72881.1"
                     /translation="MDMTDLVLRHHRTLLVVFLLSAFLFALFGLRRISINSDLTNLAD
                     KFDQNYKEQIGFLSEKLSSNILVVLAYTDGNIEKAKRAVELLKERFEESGYVSETLKM
                     DNPELFVKYGFLGLDSEVLRRVQNAFDFGEGSFLDFSQWRNLFASLSMLNELAEEYIN
                     RKGIEQYILLSPDQRLILINFALNSSVSDVNAIYQAVAGLRNTAKEVSKATGVRFAFT
                     GTPAGVYESNNQVQRDFAITSIVSLSGISLIVYLGYGSLSVLLCLFLSMVVGMCMTLG
                     LAGLLVGEINIVTSFVNAMVLGLGIDYGIHVMTRIAEYSRFKDLREGIKEALSELLKP
                     SLIALLTTVGAFSSMYLGLSRPFVQMATFSIIGMICFYLTMMLFLPSMLLSLRIRPVE
                     HEKLTFLRRLFSMSRSRRFALVVSAVLIAFIPLGALNLKEYWYTPPGLVAKRAESAMA
                     FAELKKSFQRVGFGEICVVAEDLEELHRLDQLLKSSDLFIPPLSVLSLMEFSKFDGNG
                     SAQNLYASLSEMVNNPFLLAVFKRIGMYPQILDMLRLLKGSKDLNDVLSELQKDVPLF
                     FYQRAGHTMYVLYTDTTKDLYKDNRLKIVHNFVTENGVKSFGTPMILYMIMEDMRKSM
                     YSVIFLTVCGIFFMLLLSVRSLKASLWITVGVLASIVGTFGAGSLLNIRTTFMTLLSV
                     PLLLGLGVDSFIHMRHAVLRNDETHTYRTFKSVFLSIITTIAAFGSFSTAQGQLLREF
                     GVLMGIGFVMCFFTTALLSFHVLGGEDRENSDVH"
     gene            43560..44837
                     /locus_tag="AJ81_00250"
     CDS             43560..44837
                     /locus_tag="AJ81_00250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001567655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="AJC72882.1"
                     /translation="MKIAMFTETYVPQKNGVATSVFLYKRALEERGHQVYVVTTVGQT
                     NDEIFVLKSSQFKYESNHVIPTSGRLLPVLDFVRRKRVEIIHSHAPFALGLRALATQK
                     YLKIPHVHTYHTLLVEYRHYIPKPLTPSRESVAEFSAWFCNMVNRIVAPTENIKQELM
                     GYGVVKPIHVIPTGIDVESFERPSLLDVRKRHGISPQTKLLLYVGRLAKEKNVSFLLR
                     VLRELLNKNYDVILIFVGDGPERDQLEEEAKGLEIEDRVTFTGALPREQLVDYYQQAD
                     LFVFASMTETQGLVVLESLAAGTPVVAVAKMGIANVLKDRKGALLLQEPKLEEFVEKV
                     EMLLSDTRLYDEMRSEGKAYVKQHWSIQKTVQDLEKVYELSLLEGPAEVEYYTSVWIE
                     IIVEKMKQISSKIFTSGGGRRAGFAPFSRTRGR"
     gene            44800..45426
                     /locus_tag="AJ81_00255"
     CDS             44800..45426
                     /locus_tag="AJ81_00255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001305388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72883.1"
                     /translation="MALHLFLGHVVADHAFTNNAKIRTYKGSKLFGHILWSFFAILAF
                     TFDVFLYSKLGTALLFGFFAIHALLDVLRVKVYPRGTPLHLVELAGLASAFIFNVMGM
                     NLLNRSYLSNEFVLYLLGMSAVSVGVTYFFRNFYPKDEFMSDIDGISERLAVFIFLLA
                     SKPLFVFLSLVIALFYRLIFVKKFDHTWWISPASGLLISLAWRFMLYR"
     gene            45423..46136
                     /locus_tag="AJ81_00260"
     CDS             45423..46136
                     /locus_tag="AJ81_00260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--acetyl-CoA-carboxylase ligase"
                     /protein_id="AJC72884.1"
                     /translation="MIGEKLIRVPIIGSTNDFLKENWKLFPHGTVIVADVQTTGRGRF
                     NRAWYSPEGGLWFSVLFKPRKNMRPNFYTKLSAVSIVRSLRPLKVEAKLKWPNDVYVD
                     GKKLAGILTETIFEEDRLGAIIVGIGMNVNNEIPKELEKKATSLKLLVGEELERLSVL
                     SMILREMNRALRVYSRKPEALTRVWKNMLIQKEGQLICVNVGGETLKGEIVQIDDESI
                     TLRIQDKTMRLSSLEIVDC"
     gene            complement(46108..46371)
                     /locus_tag="AJ81_00265"
     CDS             complement(46108..46371)
                     /locus_tag="AJ81_00265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA synthetase RNA-binding protein"
                     /protein_id="AJC72885.1"
                     /translation="MRIDKYLKQNGLIKRRTVAQRMIESGKVLVNGRVVKSSYEVKIG
                     DAIKIIFPFREIEAIVEENGVKIVGRTGRNESDPPNSPQSPAN"
     gene            46416..47609
                     /locus_tag="AJ81_00270"
     CDS             46416..47609
                     /locus_tag="AJ81_00270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_227910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein F"
                     /protein_id="AJC72886.1"
                     /translation="MPYFRYTALTPEGKRIRGTIQASSESQAADLIKRRNFLVLRIQP
                     ISSKKDIVLFGVHLNELVIFCRQLATMVTAGVRLKDALSILARQDVFSSRFRKIVNNL
                     VLSLEMGMSFSEALRNEKVFDPVFINLVSAGEEGGVLDKSLEKAADFYESSKKLQDEV
                     RAAMAYPTFVLLFAVGVIFLITFYILPRLISVFGDIPTGGIVRFLMNANRYLSNNWLS
                     VLITVALVAIGIIIFSKTRYVNYVKEWFARLFPPLAKLRNMMAVERFCRILGTLTGSG
                     VLLTMAIEMAAAASNSPRMMRVSKRISERVREGASLRQAMLESGVFPQLVYEMVGTGE
                     ETGKLEEVLMKVADFYEDQIRTGVKKLVSLVEPMLIAGVGGFIAFMALTMYSTIFQLQ
                     QTIGR"
     gene            47615..48019
                     /locus_tag="AJ81_00275"
     CDS             47615..48019
                     /locus_tag="AJ81_00275"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74604.1"
                     /translation="MLIEVLFKLLVLASFAVGMFSCVPVVDRMLDYVEPLYLKCLTYS
                     ALHYVLDDNPSGTVTISVINDEIRLRCIRPGKTSGVTTISVVPKEQVQIVTKDGGAIT
                     LSPTTVLQAGSIVSKNWTLSFPPVVLRANIKR"
     gene            48024..49004
                     /locus_tag="AJ81_00280"
     CDS             48024..49004
                     /locus_tag="AJ81_00280"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74605.1"
                     /translation="MQIFHKMITAIDIGKNWVQGSRARKFRGILSNPVFLGVRKDEDV
                     VERLKELRSKLKPDVEDIVVTNFPMEDVLFNTVDVPKEIKKRELRAYAVAEMSRILNL
                     SSSEMALDCMMNPVGKALVMVTKARRLNEWVSSITSAGFPLPDVVIPDVFKYLQLIRV
                     PVRETCVLIFLMPDYSTAIVCVAGSPLGIRTFSHSVEETIAIVSEETGLSKEEIAREL
                     AKPEPNNARNVFESIVIDLPYAIEREIIFLLSSALPGSLIRDVAGFYVFCDPMDFAPH
                     YARLFETVETFQGKIQTLRLDIEAKNLPMGIVGLLLRGGEEFGKNKLVQI"
     gene            48976..49551
                     /locus_tag="AJ81_00285"
     CDS             48976..49551
                     /locus_tag="AJ81_00285"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74606.1"
                     /translation="MERINLFRYKKPILKISSFLTLTLALLLPVFAMRFTLDFYKRSV
                     IDSIYNNHVRIVEKYRISRSVSLPNVLSTIDAINNQLVQTSKRLQTQIDQLENHIKTF
                     NERTEPLGNILRTLQRNDSNWIVLREFVYADSVKISLYELYDPSSVKTADQLEKVLID
                     LGYKVTKSNEYDAQMTFLGKRISSVSMEGRR"
     gene            49553..50017
                     /locus_tag="AJ81_00290"
     CDS             49553..50017
                     /locus_tag="AJ81_00290"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74607.1"
                     /translation="MPRRLAILLALLIALGSALYFDVYDYFSSRNMISKFESSLVKLE
                     LYDKNVEEKKEYLSNLEKAVQPRTTLKEIESLTQAANLNLSSQKDGTYLIEGTCEPEK
                     LRDLVAHLLSSANVVVQSMLIDSRQIVPVVTDEMKVAVRVSVRLVLKGVTLE"
     gene            50014..50478
                     /locus_tag="AJ81_00295"
     CDS             50014..50478
                     /locus_tag="AJ81_00295"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74608.1"
                     /translation="MNKRLIVLLLVLVGVWAIAIYVLFFYQKSPVTGVTAQPREQVLQ
                     PLIRRLTDSDIERFRKNVEAPKPIMDVFEPYLLKVDKEQLVRQALSQVEPLSKYKFKG
                     YFVSENENFVMFSNGILKPVGSTLEDRYLIIHAVSFAAIVVDLLTGNLLVVK"
     gene            50490..54071
                     /locus_tag="AJ81_00300"
     CDS             50490..54071
                     /locus_tag="AJ81_00300"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74609.1"
                     /translation="MRRLVLLLMLILAMITFATSLVRISPTFSVAGVTLVMEFDSDVS
                     ERNVYLKRNASGSLVSIYLQDVRHPLDSFFLPIAYGPVESLRVINTHQGSLVLVQLLV
                     PKEPEMSLSPRTLKLFVPSSQKQLSLALVDGDVETAVKYLCEELKLNVVVSEKVKSQK
                     LSLKLDDVLPEDALRNILVMVRVGNEPLAYSYMPDGTLHIGTRSEIAARFQKFWGIFE
                     VKDESLVQKLESLLSPNVVMSYLANKSVLFVYGDVQEQEMIAKILSLTPQIETREFFS
                     EGFVDEAKKLLDALKGLYNFEYHLLEALNKFILKADPQTLDKVFQYLRELERIIKLKQ
                     SRQEVEETQEPEMVQQTVSETLQLIYAKEAIEVLKKFQLEAEEISFGLVRIAGDPKRL
                     ELARKVLEDLGFLDSQQVRKLVIPKVHSEKILNALTEILSIPKSRILVSEDKDVVNVA
                     LIAPRNVQDVAEELCQRLIRVFTAARFSEIFFLKDRETAQQVSAILNQIYGIDASSVE
                     NVLRVVGTNEEIDRARKFINVYVRERHTKALALTIDQELFAELKTLIESLFDVRLEAN
                     LRSLGLLLLSSEDKQQLESAAQEIESVVKLLSERPSKTHELVPVIETVDFNDLRLLLS
                     EIYGVRVEKTQFFYLLVGQREALESAKQLLDRIRDLVGKPVETTYRLVKVREDLSVDA
                     LIRAVISVAKVEIVSIGNLLLIKGEETQIFKALELVALIEENVPVKVEEPKKITVIVK
                     ELVPEFPAGEFKAYLAKIGLEVDFEAFAALDIVVISGEERAVAKAAAEYEKFAETILK
                     KIQARAEEEKERREKLLKVQRVSEDAVSVECDGIALKDVIETVAEELGVSIVFVTFPQ
                     ETITMKVSTISWQQFKDVIEKNYGYSFVESEGVTVVLKPAPVLDTTAEQKFIYKVSHN
                     LDKIKSVVEFYGGRVYVDDLNDLLILTNLSVEAKQEVERLIDELSKPLKQVEIEARFI
                     DRSLTDELSRRANLALEMPSASAGIGSSGTLNLSMSVIDLVDYRNLLSLLAGAQVTLD
                     VSAQNSNSLTDLLASPRIVTVSGKEAKILIGERVPFVAGVDEAGRILIDYMDVGIQLR
                     ITPIVRSDGSIQLKLYTEVSEVKERTLSGMNTYGKITRQAETEVILKSDQTLVIGGLV
                     QDKSVKSVAKVPVLGELPFIGQLFRSVTDRKDKAELLIFITARVIEP"
     gene            54068..54901
                     /locus_tag="AJ81_00305"
     CDS             54068..54901
                     /locus_tag="AJ81_00305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004457840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72887.1"
                     /translation="MKREPVVAGSFYPASRKALIELIESCFTSKIGPGQLPKKPDRPL
                     ERNVALIVPHAGYVYSGPVAAHAYAELARLGNPKLVVLLGPNHTGYGARIGVWAEGSW
                     STPLGEVQVCEEAAQKVLEECRQASADIRCHMVEHSLEVQLPFLQYVFKDFEILPITM
                     FPLSLQVCKSLAHALDELFRSFSSTVLVVSSDFNHYEDDATTKRKDQLAIEEILRKDP
                     EGLYRVAADERITMCGLSPVACLLYMQSFSKARLLKHATSGDTSGDRSHVVGYASFIF
                     E"
     gene            complement(54888..56330)
                     /locus_tag="AJ81_00310"
     CDS             complement(54888..56330)
                     /locus_tag="AJ81_00310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="AJC72888.1"
                     /translation="MTKILRYGTLFAIATLFSRFTGLMRDVFLANRFGVGIEFDAYSI
                     AIAFPFLLRRAFAEGAMTSAFIPLYKEKADKNEFASAVITSLGIATISLTIFVQIFPQ
                     IVPFLLSSGANTETKLLAAKLARVSTPFIVFIFLWAVLYAIQNSSERFFFPALSPMFM
                     NFGIIAGVILCELFDPRILGPTIGFTLGGAAMFLSLIPGAKQVGFSYRPTFVGARDFF
                     KLFFPALLTMTVSEFNVLIDVNVAALIGPGSVSILQYANRFYQLPFGIFGVAVSTVAL
                     PLMSGEDEDSSKHLKDAMRTTFFFSVPSTIGLIVLSERLIVLVYQHGAFTHSDSIRTA
                     TALLFYSLGLPFYSMMALLSRSCHAKKDMKLPFKATVVSFVSNAVLDFVLGLTMKTAG
                     VALATALAGAIGAGYLLFKLRPEIDMKHFQKVLICSALMGLVLMIAEHVSPSKLFTLV
                     LVLLGVGVYMVSCLITKVDEAYQLLHFIRK"
     gene            complement(56327..57523)
                     /locus_tag="AJ81_00315"
     CDS             complement(56327..57523)
                     /locus_tag="AJ81_00315"
                     /EC_number="2.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660054.1"
                     /note="catalyzes the formation of oxalozcetate and
                     L-glutamate from L-aspartate and 2-oxoglutarate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="AJC72889.1"
                     /translation="MQLSKRAVEVPASPIRRLIPYAEEAVRRGKKIYYLNIGQPDIPT
                     PAVYFEYAEKYKPSVVAYTHSAGLMELREAFARYYAKFGVSVSPSQIIVTNGGSEAVI
                     FAMSVVADPGDEIVVLEPFYANYAGFAHQLGIKLVPVRTYPEDGYAVPKKEKFFEVIG
                     YRTKAIIFSNPCNPTGAVYDEAQLKTIIEVAIEKDLFIISDEVYREFVFDNYRAVSML
                     TFEEISNRTIVVDSISKRYSACGARIGTFVTKNKDLYAAAMKFAQARLCPSMTSQYGT
                     IGLLTLDETYTEQVRLEYQARRDVVYEELSKIEGAVFRKPHGAFYIAAKLPIDNTENF
                     VKFMLSEFEVDGKTTMVAPLDGFYISPNAGINEMRIAYVLNCDKLREAVKILGLGIEA
                     YTRRMA"
     gene            complement(57525..58685)
                     /locus_tag="AJ81_00320"
     CDS             complement(57525..58685)
                     /locus_tag="AJ81_00320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="AJC72890.1"
                     /translation="MKARVLLKKDQRDFHPWIFQTEIAKIEGEFENGDVVNVHLSSGK
                     FYGVGYINTKSKIAIRLLSLQPLSTEQIVDQRIAEALKRREKLAVGREAHRLVNGEAD
                     GLPGLVVDKYGDYLVMQINTLGMEKLKSLIVEKLKKYTSPLGIYEKSDAPARSKEGLE
                     ESCGWILGNGPEVLYFEQDGLLLAADLKGQKTGAFLDQLHNSRLCSMFAKDQVCLDVF
                     SYTGNFALHLLKAGAQSVVLIDYSQRSLSIAEQLLTLNGFSNYQIVQANAFDWLKENS
                     RFERFDLVVLDPPSFAKTSTSKDSALRGHKEINLRAMRILKKPGILATASCTQVISEQ
                     EFESILNDAAKDSKVLLSVLYKGGQGFDHPFLLAVPETRYLKFIVAEVRRRY"
     gene            complement(58681..59772)
                     /locus_tag="AJ81_00325"
     CDS             complement(58681..59772)
                     /locus_tag="AJ81_00325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="AJC72891.1"
                     /translation="MWQYFMPTKVYFGEKCIERGIEALRSLGKRALILTGRRSSKENG
                     SLDDLTRALSQIGIEWELFDDVEENPTFALVRNIVSEYRDGSFDFVIGLGGGSPMDTA
                     KAIAVLLKNPTLNVEDLYDASRYNEALPICAIPTTAGTGSEVTQYSVLTDDAGFKKGF
                     SHPALTFPKIAFLDARYTLNLSEALTRSTGLDALCHAVEGFLSRRATVLSDLYAKESI
                     RLIAENLPRVLKDPTDLRARENMLLASCLAGMVISQTSTTIAHALGYPLTTFKGIRHG
                     EATAAFLDVIVEQAMIEVPEKVDFVRSVLGDVAKFLEYVGLNVRVPINDEELMLWTSR
                     AKNAPHVQWTRGNFTEELIRYLYERVKLH"
     gene            complement(59786..60463)
                     /locus_tag="AJ81_00330"
     CDS             complement(59786..60463)
                     /locus_tag="AJ81_00330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_229661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="AJC72892.1"
                     /translation="MNYRNLHAWDVSATRAVEIQKELRSLIELTPLTDVELVAGADLA
                     FPDAKHGVAAIVVLNISTMRVVEQVIVHETVNFPYVPGLLAFREGPVFLKAWQQLRVL
                     PDVVMFDGQGIAHPRRLGIASHMGLFLDLPTIGVAKSHLYGSFIEPPNVQGSYTFLYD
                     NNEVIGAVVRTKVGNKPLFVSPGHKCDVLSALKLTLRCCTKHRLPEPTRLAHELTQKY
                     KHVGLFG"
     gene            complement(60466..61644)
                     /locus_tag="AJ81_00335"
     CDS             complement(60466..61644)
                     /locus_tag="AJ81_00335"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74610.1"
                     /translation="MKLVRTLAILTLTVTLSALLFLTLICGWLFEFFLYREPEVNPYS
                     LLVVGVDAMIEGTRRADAIMIALINHKDRRIMISSVPRDLLLQNSKINATYARSGISG
                     LEQTLSKLLDINFNGVVVVDYAAFKYLGDELGPVEIHIKEPMKYVDSVQKLYIDFQPG
                     VYLMRGDELLAYIRYRKGPMGDLSRIERQKEVLMKLVENARHVTLQKLLSVFKNLQKN
                     VDLKVSTGELVYLFSKLRKGFSVDFVSFPYMINEQGDVVLDEKKLAAYKQTLKEMKTQ
                     AQKETFRIVLINAGPDKTRVFLERHVVLWNRVSLQPSLIVWEDVGLSFRDDVVFVLDK
                     NTQEALKGLLKSVYPEKTFTFTSLDEPSTLKNYFELIDKLSKNRIYVKFPIDAFVVVR
                     "
     gene            complement(61667..61948)
                     /locus_tag="AJ81_00340"
     CDS             complement(61667..61948)
                     /locus_tag="AJ81_00340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_10014020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72893.1"
                     /translation="MARVRIKVNPGARHESIEVMGDGTIKVGVTAPAVEGKANDAVCE
                     LLAKRLSLRKSDVKIVAGKTSKLKQMELPLSLEEIYRRLNRPPESRVVK"
     gene            62000..62398
                     /locus_tag="AJ81_00345"
     CDS             62000..62398
                     /locus_tag="AJ81_00345"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74611.1"
                     /translation="MKLLFETTVAIGLSVLFLILIKKRKIQLKNLENVVLERLRRNGW
                     TVHMSLVQNGAKFVLLKRGRNSILVVFLRHFGFDKFKRAVILALLNEAQRVEVYYSSI
                     TPHTKKAVYFFNKNARIHKMKMIVMWRGSS"
     gene            62389..62853
                     /locus_tag="AJ81_00350"
     CDS             62389..62853
                     /locus_tag="AJ81_00350"
                     /inference="EXISTENCE: similar to AA
                     sequence:GenBank:EJR05467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="AJC72894.1"
                     /translation="MLMTVKLVVFCSLVLFFLAILLKNKRRKVSGIQVDNGQQFETFL
                     CELFKRAGYNARSTKFSHDFGADLLIESGGKLIVLQAKYYNRPIDTDAVEEAVVAGTV
                     YGTGYVGVITNNEIPEKVKEFAKQFEAKTFVKRIYFIDGRALEKLKRREKII"
     gene            62866..64122
                     /locus_tag="AJ81_00355"
     CDS             62866..64122
                     /locus_tag="AJ81_00355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001511976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine 2,3-aminomutase"
                     /protein_id="AJC72895.1"
                     /translation="MRSFKEIPLWKNVSEEEWQDWRWQLSNRIMNLEQLEQIINLTHQ
                     EREGIKHSLKFLRMAITPYYASLMDPDDPNCPIRKQAVPTSRELHISDGEMVDPLHED
                     VDSPVKGLTHRYPDRVLFLVTDQCAMYCRHCTRRRFAGETDAPLAQQYIEAAIDYVKQ
                     NKKVRDVLISGGDPLTLSDEKLEEIISRLREIDHVEIIRIGTRAPVVLPMRITESLVQ
                     MLKKYHPIWLNTHFNHPKEFTEDSKKALAMLADAGIPLGNQTVLLRGVNDCPKIMKKL
                     VHELVKNRVRPYYIYQCDLSRGLSHFRTSVAKGIEIIEYLRGHTSGFAVPTYVIDAPG
                     GGGKIPVGPQYLISMGEGKVILRNYEGGIFVYQEPTDYRSECEPDEDVEGIASLLSGK
                     GKYLLPQQLERSRRIQEWKEKRSSTS"
     gene            64092..64982
                     /locus_tag="AJ81_00360"
     CDS             64092..64982
                     /locus_tag="AJ81_00360"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74612.1"
                     /translation="MEGKEVVYILGTKKGAGKTTVLNSLVRDCQGCCITSVGVDGEEK
                     DNLTSEPKPRVTVSTSHFVLTGERFLNLSMFEVLDVFSYNPIAGYIVLARPLIETSVM
                     IAGASPAIIKQLTDKHCFSKILVDGALDRLVHAGILDGAKIFLVVHSVGSESLKIVKK
                     ILFGSRLAKPPREIEATFNGLAGVWGINEAGELVKVADSCLTIKRFGEQKFEWLYVSG
                     IATKSILGLRDRLKICLANPLAVVEPPDDFDNIYTVNRILLEKIFINQSAQHGLVKAL
                     RCWVEDLPVEIEDALSIEEV"
     gene            64985..66088
                     /locus_tag="AJ81_00365"
     CDS             64985..66088
                     /locus_tag="AJ81_00365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="AJC72896.1"
                     /translation="MARIAVDMQELITKVTVVSKVVPSKVIKPILGCVLFDLTEDGVF
                     LLASDLETGVKAKLNCEYEGFGRFAVDGKVFYEVVKTLPTDVGASLEITPASLSIECG
                     KSKFKLSVVDPSDFPEVSLSESSVSFEIDASLLHKMIEKVIFCAATDEFMRNLNGVYW
                     ELGNGFLRLVASDGFRLALAEERLEIQGEIGFLLSLKSMKELMSVAESCGDRKLRFEY
                     DGKRVGIVATDVETLVRIVEVEFPDYKRVLPKAFKTKLVAPTNILVEALRRTMVIAKR
                     GSESIRVEAMENVLILSSRSPDFGEVTEEIEVRKEGEDIIAAFNPKFLIEALRHIETD
                     EVELNFIDSTSPLQMNPLDVEGYLYVVMPIRIV"
     gene            66092..66751
                     /locus_tag="AJ81_00370"
     CDS             66092..66751
                     /locus_tag="AJ81_00370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_229438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="AJC72897.1"
                     /translation="MRLIFEHVTKKFAQTKAIDDVTFDVEASCVAVVGGNAAGKSTLL
                     KLIATVLKPDEGRVILNGIDIVKHAHLIRKELSYLPEEPALMDTLTARDNLALFSKIK
                     KADYSEELLRSLRFEPNGKKLVKNLSKGSRRKLSLCIALLGEPKILVLDEPTSGLDEE
                     AKQAFWSHLSTLKEKNVAMIIATHDMEEMKKLADFVIVLDRGRLVKIESLNSAASYIQ
                     L"
     gene            complement(66725..68047)
                     /locus_tag="AJ81_00375"
     CDS             complement(66725..68047)
                     /locus_tag="AJ81_00375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase U62"
                     /protein_id="AJC72898.1"
                     /translation="MKEKQFAEMVFVLAKKQGFDDCEVLVSNHREFEVVVSKGKIENY
                     TDASSKRVTLKAVKDKRSSFATTEILDETSARFLVESAYENFMITDTLDEDDIWAERP
                     AKEPFEYEDAFERLSVREKIDLAKTMEEKCLSYDKRIQNVIMSGYGHQRSEIWLFNTK
                     GLELSESFGYGAAFVYLVASDGKKPKRGFRAMYGSHPNEVNVEKVALEASSEAISQLG
                     AQSVKSGKYKVLLRRDVFAQLFFAFSSIFSAEAVQKGLSPLKGKLHQKIAVESLNLIE
                     DPFFEKLPIKRSFDNEGVPTVRKSFIDHGVLTTFFHSIKSARKDNVKPTGNVFSQRCV
                     PLNVILPEGSLGYEDLIKSVGEGLLVIAFDGLHSGVRPVSGEFSLGANGYRIAGGRIV
                     EPVEQFTVSGNFLDVLQKIELIGSDCEIVSANWFGPSVVVSELDVAGS"
     gene            complement(68044..69432)
                     /locus_tag="AJ81_00380"
     CDS             complement(68044..69432)
                     /locus_tag="AJ81_00380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TldD protein"
                     /protein_id="AJC72899.1"
                     /translation="MLEISLIEKIIDYGVSKGADFVEIFVEDRFDTRITLIDGRIDSA
                     SSERDFGLGLRLFKDDQQVYAYTNDPTEKQLLTMLDRLIEVLQIKSAEPKTVNLMNLD
                     VKNSHTIILNPLEVSKMEKAKIMKLAYEGAKNYSDLISQVVVRYWDYDQKVFIANSEG
                     TMANDRRIKTRLMVTAVASKDGEQESGFYGPGASMGLEFFNFHDPKDIGTEAARIADK
                     MVKADYAPAGKMPVVIANEFGGVIFHEACGHALEATSVAKGASVFANKLGQKVAADCV
                     TAVDDGTIPNAWGSSNIDDEGIPTQRNVLIENGVLKSYLVDRFHAKKMNTKPNGCGRR
                     ESYKYIPTSRMSNTFIMPGKYLPEEIISATDYGLYAKRMGGGSVHPATGEFNFAVMEA
                     YLIEKGRIVKPVRGATLIGKGIDVINNIDMVGNDLARGQGMCGSISGSIPADVGQPTI
                     RVKELIVGGRKR"
     gene            69518..70597
                     /locus_tag="AJ81_00385"
     CDS             69518..70597
                     /locus_tag="AJ81_00385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="AJC72900.1"
                     /translation="MKFVALCTSGLEGAVCKELKRMGLKILKVTAGHVNFLGQMSDVP
                     RLNLTLRSAERVLIEMAEFEAKTFDDLFDGTFSANWQDFLHSRATLVIEKVKVRNSKL
                     SATGAVASVVKKAIYEKIGSKNDPDGTIYPLYVYLKNDRVSLLLDTTGQSALSKRGYR
                     LKASAAPLRETIAAGLIIVSDWDEQKLLVDPFCGSGTICIEAARMALGILNDKRTFAF
                     QSWPIFADVKMTIHSFDGVKSKMNKIAIGFDRDPSMIRIARENAVRAGVAGSVEFVCK
                     RFEELEDFKNVHVVTNPPYGVRLKDIDRNFLAKLAKLLDKFAGSKICVLSPADLERIL
                     KIKASKKLRFQNSGIWTWYYIFEPS"
     gene            complement(70638..75590)
                     /locus_tag="AJ81_00390"
     CDS             complement(70638..75590)
                     /locus_tag="AJ81_00390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="AJC72901.1"
                     /translation="MAISTFKRKIAAVKIGVASPDTIRSWSSGEVKKPETINYRTFKP
                     ERDGLFCEKIFGPTKDYECACGKYKGKKYEGTVCERCGVRVESKEARRKRMGHIELAA
                     PVVHIWYLKSTPSILSTLLNIPARDLENIVYYGSRHIIEKAYIVTNPKKTSFAEGDVI
                     YETEYNIYKKVLDFEAEQSVIVKNPKTPVISEIDGEVSLKNERSNTGRTITWIIVRNV
                     VRSHVQLFPGMILLVKNGQEVSEGDILVAEKEVPALYAPFDGTVEIDELTSSLTLKPL
                     ATSKDQPLTVSIPYCCRLTVKNGAKVKAGDQIWTAGMIQALTSPASGKVVFGKELNVR
                     PLEDGSYEVLSSGSIYVEQTAIEKKYPIFEGALAYVNDGDRVKAGDYLADRFLFEDEH
                     LSLSEYAIFQQYYPDQFTVETEVENDRPILAITKIDEELARETSLTVGSIITENEYEA
                     YRELYPGKIEAHYGAAAVKKLLEMIDLEKLKAQIEAELAELPKSSGRALKLLRRLKIV
                     KSLINSGARPEWMVLEALPVIPPELRPMIQIDGGRFATTDLNDLYRRVINRNNRLKRF
                     LELNAPEVMIRNEMRMLQEAVDSLIYNGRVGRPVADRNGRPLKSLTDLVKGKKGRFRR
                     NLLGKRVDYSGRAVIVVGPELKIHQCGLPKKMALELFKPFVLAKLLEEGGESSKTARK
                     LKKTIIEREMPEAWDVLEEVIKGQTVLLNRAPTLHRMSIQAFEPKLIEGNAIQLHPLV
                     CPPFNADFDGDQMAVHVPLSAAAQAEARYLMLSRYNIISPAHGKPISMPGKDIIVGIY
                     YLTAVSKDYDFVSTDRIEFKFSSPEEAILAHSLGFVGLHTPVLARVKQNGEEKTLKTT
                     VGRIIFNEIVPEDLRDYSKTFGKKEIKDLIYETFKRHGMEATADLLDDMKDLGFHYAT
                     VSGLTISLKDLVVSPKKNAIIKDALEKVEKVEQEYAEGFLTYEERYKEIIRIWTKATE
                     EVQKVTYEALGENPFNPVFMMVNSGARGNIDQVKQLAGMRGLMADPSGKTIEIPIISN
                     FREGLNSIEFFISTHGARKGAADTALRTSSAGYLTRRLVDVAQSVFITTTDCGTENGV
                     KALELMSGTLTVQKLKDFLFGRILARDVIDPLSGEVVKNPDNNREYVRNSMLSDEDAE
                     FLAKYVVSVPVCVEQVLDLQSLQLPASYAVTDEEIRLEDGTVYEVGTEVSWDLVRNAR
                     NAGKKQIKIKVYPVVGTISQEIVWDKKGEKQLLVYQEEIDEVTAMLLEQNGVSAVKVR
                     PNIYVRSPLTCEAEHGVCAMCYGMDLSNHKVVNVGEAVGIIAAQSIGEPGTQLTMRTF
                     HTGGIATTADITQGLPRAEELFEARKKLKEPEGIFSMVSGFVKDIKEVDGKKKIYIED
                     LAGEIHEYEVPEKVKEIVTRGQKVLPGQMLTTGAVKLRRMMDALGVEATAMYLLRETQ
                     KVYVEQGVDIHNKHFEIIIRQMLGRVEIVDPGDTDFLPGQLLTLSEAMRINNEILKAN
                     AQVQSNRNMVVGKILAKKIVAKLKDEVEEIAPEGTEVSEDIVEKAVAAGVKEIVVLED
                     GKPVTYQIAPKEPMKYRRRLLRITKASLEQEGWLSAASFQQTPQVLTEAAIEGRIDYL
                     RGLKENVIVGQLIPSGTGLEIFANIQIEETPRAAEEEKMA"
     gene            complement(75616..79134)
                     /locus_tag="AJ81_00395"
     CDS             complement(75616..79134)
                     /locus_tag="AJ81_00395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="AJC72902.1"
                     /translation="MRTALYGKRERLTFGHTVDALKVPNLIAIQIESYREFLEKGLME
                     ILRKFSPITSQPHKGDLRKGEKGFILEFVSTRIGEPNATIEECKQKGLTYQVPIYATV
                     RITDVNSGEMREEEAFLGSIPYMTENGTFVINGAERVIVNQLVRAPGVYFVDEIPKTQ
                     TAAPIYVAHFLPVKGAWLELLYNTADDMFYARIDRKRRINLFLLFKALGFENDLDILD
                     LFPDPVDAEDEYSMMKAVGSIILEDVSIDGKKVVERGGVLTEHAARTILESKISTIVR
                     AHPVAQKTLEKLNSAYGEVDSNRAYIEIYRKLKPGEIPRVNAAKAYLNSLYFTPERFE
                     LSEVGRYKINRKLQQAYRKYLVQVKKMSDSEAEKMQYNPTELVLTPMDIVLATRYLLE
                     VSKNPEIMDTKDHLGNKRVRTVGELIKLEFERAFSKAQRLIQERLALYNSLDKISVQS
                     LINIKTIIAGINQFFATSPLSQFMEQVNPLAELTHKRRLTAVGPGGLKRERARFEVRD
                     VHHSHYGRMCPIETPEGANIGLITSLAVYATVDEFGFLTTPYRRVKKGRVTDEIVYLT
                     ADEEEHYHIAPCTVRVDENMMIVEDRVPVRYMQKILYVEKEKVQFMDVSTKQIVSVST
                     SLIPFLEHDDANRALMGSNMQRQAVPLLKPEAPFVATGVEHDAALYSGYLVVAKHDGI
                     VKKVDARRIVVHRTDENGNLMYKDGKPLMDEYRLMKFVRTNQDTVINQRPIVNVGDRV
                     KRGEVIADGPATDMGELALGRNVLVAFMSWEGYNFEDAILVSEELLEEDAFTSIHIEV
                     YETQARDTRLGPEEITADIPNVNKEALRNLDENGIVRIGAYVGPQDILVGKVTPKGEG
                     ETTPEEKIIRSVFGERGKDVKDTSLRLPHGTEGRVIDIQVFDKEDVAELGPGVNKLVK
                     VYVASKKTLEVGDKLAGRHGNKGVVSKILPREDMPFLPDGTPVQIVLSPLGVPSRMNV
                     GQILETHLGWLAKLTNSWFATPVFDGAKEEDILPWLYKERKALGLEEGDDENNPSGKV
                     LLRDGRTGEPFAEPVVVGYIYMMKLIHIARDKIHARSTGPYSLIHQQPLGGKAQFGGQ
                     RFGEMEVWALEAHGASHTLNEMLTIKSDDIKGRNEVYKAILKGKNIPEPGIPESFRVL
                     IKELRGLALDVRVYDENGNEVDIDRF"
     gene            complement(79292..79690)
                     /gene="rplL"
                     /locus_tag="AJ81_00400"
     CDS             complement(79292..79690)
                     /gene="rplL"
                     /locus_tag="AJ81_00400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660040.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="AJC72903.1"
                     /translation="MTVEQIVEAIEKLTVAELAQLVKALEEKFGVSAAAPVAVAAVAA
                     PVAGAAPAAQAAAEEKTEFDVVLKSHGANKINVIKVVREITGLGLKEAKDLVEKAGSP
                     DAIVKSGVPKNEAEEIKKKLEEAGAEVILK"
     gene            complement(79693..80253)
                     /locus_tag="AJ81_00405"
     CDS             complement(79693..80253)
                     /locus_tag="AJ81_00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001411274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="AJC72904.1"
                     /translation="MLTREKKQQILESFKEVLPKANLLVFVNFFGLDVAAIRELRGRI
                     NSKHGEDAKLTVVKNSLLSIALNEIGYQEAHYEKFLKGPTAVFYSLSGDPVDALRTLV
                     NFAKEKRLENFFKGGFIEHQPFNADQVADLANLPTKKELYAMLVGRIQGPIYGLVFAL
                     NDVMRKLVYVLSAIEEKKKSENVGGV"
     gene            complement(80402..81109)
                     /locus_tag="AJ81_00410"
     CDS             complement(80402..81109)
                     /locus_tag="AJ81_00410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001567423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="AJC72905.1"
                     /translation="MPRHSKRYLEIRQRVDRTKFYSIDEAIELVKKNATAKFDETVEL
                     HLATNIDPRRPEQQLRGTVVLPHGTGRTVRVLVFAKGEKAEEAKKAGADIVGGDELVE
                     KILNEGFTDFDVAIATPDMMKSVGRLGKILGPRGLMPSPKSGTVTEDVASAVKEFKMG
                     RIEVRSDKTGSIHLPIGKCSFDSQKLRENLISAYKQIVSMRPAGIKGQFLRKAVLTST
                     MGVGVKLNMSELEAAKI"
     gene            complement(81130..81555)
                     /locus_tag="AJ81_00415"
     CDS             complement(81130..81555)
                     /locus_tag="AJ81_00415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="AJC72906.1"
                     /translation="MAKKVVAQVKLQLPAGKATPAPPVGPALGQRGVNIMEFCKRFNA
                     ETADKAGMILPVIITVYEDRSFSFVVKTPPASFLLKRAANIESGSGEPKRKIVGKVTR
                     KQIEEIAKLKMPDLTANDLEAAMRIIEGTAKSMGIEVVD"
     gene            complement(81605..82669)
                     /locus_tag="AJ81_00420"
     CDS             complement(81605..82669)
                     /locus_tag="AJ81_00420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusG"
                     /protein_id="AJC72907.1"
                     /translation="MRKAWYILRTMAGQEESAKENLLTKIRSAGYERFFGRIVIPEET
                     IIDATGKSLKRFSVSPNAKLHIKTGSDVKKGDLLAEEPAIHARHSGTIVSVKNCRKIT
                     IETIDKKYSKTYVIPESSKIVSGIKVGARIRQGMPLTQDGEYICEIDGKVIESERVKR
                     VEVQQENGEIDVYHIPYELYDANRIYKGKQVRNGELLAEGRKIYSSIDGRVEVVDMGT
                     RKEIRIAKTQKKRMFPGYIFVEMMMNDDTWQFARTVPGIIDFVASGGQPLQLKQREAR
                     AILRLAGIEAFEERAKPVRVEMDIKVGDVVKITSGPFEDFAGVVKEIDPVKQELRVAV
                     TIFGRETPVTVRVSEVEKIQ"
     gene            complement(82675..82872)
                     /locus_tag="AJ81_00425"
     CDS             complement(82675..82872)
                     /locus_tag="AJ81_00425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="AJC72908.1"
                     /translation="MEKLKKFFREVWGEAKRAHWPNRQELLVSTSVVILILVVMGVYF
                     FLLDLALSGGIRAILRALGIG"
     gene            complement(82901..82977)
                     /locus_tag="AJ81_00430"
     tRNA            complement(82901..82977)
                     /locus_tag="AJ81_00430"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(82941..82943),aa:Trp,seq:cca)
     gene            complement(82981..83127)
                     /gene="rpmG"
                     /locus_tag="AJ81_00435"
     CDS             complement(82981..83127)
                     /gene="rpmG"
                     /locus_tag="AJ81_00435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001305888.1"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group have the CXXC motif; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="AJC72909.1"
                     /translation="MTIKIALKCSVCGHKNYYTEKNNTKKTKLSLRKYCPNCNKHTEH
                     VETK"
     gene            complement(83159..83245)
                     /locus_tag="AJ81_00440"
     tRNA            complement(83159..83245)
                     /locus_tag="AJ81_00440"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(83209..83211),aa:Tyr,seq:gta)
     gene            complement(83259..83334)
                     /locus_tag="AJ81_00445"
     tRNA            complement(83259..83334)
                     /locus_tag="AJ81_00445"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(83299..83301),aa:Thr,seq:tgt)
     gene            complement(83455..85287)
                     /locus_tag="AJ81_00450"
     CDS             complement(83455..85287)
                     /locus_tag="AJ81_00450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_143164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde ferredoxin oxidoreductase"
                     /protein_id="AJC72910.1"
                     /translation="MNKGAKRMILRVNLTTKKISKEPIDEKILDQFIGARGLAAKILW
                     DEVKGVDPLSPDNKLIIAAGPFNGLRTPSGGKLVVAAKSPLTGGYGDGNIGTMVSMHL
                     RKAGYMAIIVEGASDRPVYLYVDDDVVQIMSAEGLWGLSTFETEKRLKQVHGNVGVLS
                     IGPAGENLVKYSVVISQEGRAGGRPGIGAVMGSKKLKAIVVRGTKDVEVKDRENFEKY
                     TREVFKLIPTLPAYSFWIRQGTMATIEWANKNRALPTRNFSQVKFEYARTVDGYAMEA
                     MKISRRGCPNCNMACGNVVLDIEGKESELDYENVGMLGPNTGIAFLNRVAHINRLADE
                     FGVDTISLGAVLGFAMEAAERGALKEAPKFGDYEGALELTKKIVFRQGETGNLLAEGV
                     KRAAEQLGLEEIAMHVKGLEVSAYNCYIYPAMALAYGTCAIGAHHKEAWVIAWEIGST
                     PMEDSSGKEYVMNYSPEKAKKVVEQQRIRGGMFEMLTACRLPWVELGLDLEWYAKILS
                     SIVGKNYTLDDIYIAADRVYSLVRSYWVREFKGDWDRKMDYPPKRWFEDGVDGQHLDP
                     ERYDELLSEYYKIRGWDDRGIPTEETLRKLGLDFVVEDLRPWLK"
     gene            85348..86187
                     /gene="glyQ"
                     /locus_tag="AJ81_00455"
     CDS             85348..86187
                     /gene="glyQ"
                     /locus_tag="AJ81_00455"
                     /EC_number="6.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002534011.1"
                     /note="glycine--tRNA ligase alpha chain; GlyRS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthase subunit alpha"
                     /protein_id="AJC72911.1"
                     /translation="MYLQDVIAKLNEYWASLGCMIDQPYDLEVGAGTFHPSTFFGCLR
                     EGEWKVAFVQPSRRPTDGRYGENPNRLQRYFQYQVIIKPSPDNAQKVYLDSLSALGID
                     LKKHDVRFIEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGIVLKSIPLEITYG
                     LERIAMYLQGKSNIFEVMWNEKLSYGELYRENEKQFSKYNFETASVEKLFTLYDIFAS
                     EFESQIKAGCYLVAYDYMAKCSHVFNLLDARNAFSVTQRQDFIRSIRSMARRCAEAFR
                     GGK"
     gene            86188..88203
                     /locus_tag="AJ81_00460"
     CDS             86188..88203
                     /locus_tag="AJ81_00460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002334464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="AJC72912.1"
                     /translation="MNNWVLLELGVEELPASEMDSIKEQLQVLVPNLFSEARISFGSC
                     EVFITNRRIAVRLQNVSDRQEDVVLEKRGPSERVAFSDGQPTKALLGFLSSNGATLED
                     VFVKDGYVHIKKLVEGKNVCEVVPETLVKVITNLKFARPMRWANGDFEFVRPVKWVLA
                     LLNDEVIPLRIFDKNSDRYTMSHPYLEKWIAMRHPKDYVQVLEENLVIVDETARRQFI
                     VEQLTEIERAYGLVCEKDPLLIEKICKIAEWPQAIVGKFDENYLKLPQELITVTVKHH
                     LSAFSTSRAGSLTCHFVAFIDRPRDDFSIIVRGYESVVNARLEDARYYFEIDRRKRLE
                     EFNENLKRMVFQKELGSLYDKVVRTQQLVQYMVEKLSKESMKDKAMRAAFLSKADIAT
                     HVVYEFPELQGVIGRIYALLDGEDESVALALEDQYSQEPESELGALIGACDRIDTIVG
                     NIAVGNLPSGSKDPYGLRTKADTIYWSVVRYGWDVDLVELLLTAKKLLNIDFDVDKLF
                     EFMSSRFYAFLLSQRFSFDIARAVNHLWSRPLRGYLAAQALTKACQSEDFNNVAIGFE
                     RVHNITKNHSDRHFDGALFEEDAEIELLNQFVSVKPKVIESVLKLNYEEAIRHLSSLK
                     PYIDRYFDEVFVMVDREDIRQNRLGFLKNIDELFMLVGDLTQLIRRD"
     gene            complement(88207..89670)
                     /locus_tag="AJ81_00465"
     CDS             complement(88207..89670)
                     /locus_tag="AJ81_00465"
                     /EC_number="1.1.1.205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660030.1"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine 5'-monophosphate dehydrogenase"
                     /protein_id="AJC72913.1"
                     /translation="MKYEEALTFDDVLLVPQYSEVLPSQTDVRTRLVKDIWINIPLVS
                     AAMDTVTEAALAKALAREGGVGVIHRNMSIEEQAHQVSIVKRAENGVIYDPITIGPEE
                     TVEQALKLMSMYKIGGLPVVDEQAKLLGLITNRDIRFEKNLSKPVKLLMTPRSKLIVA
                     RPNVTLEEAKQILHKHRIEKLPLVDDGDRLVGIITIKDIMSVIEHPHAARDGKGRLIV
                     GAAVGTGEDVLARVQALRDAQVDFIVIDTAHGHSKRVIETVKKVKQNFPNLPVVAGNV
                     ATAEGVKALVEAGADGVKVGVGPGSICTTRVVAGVGVPQFSAIVECARMARELHVTLI
                     ADGGIRYSGDIVKALAAGADSVMIGSIFAGTEEAPGETILYQGRKYKAYRGMGSESAM
                     RRGSADRYFQNENAKFVPEGVEGMVPYKGTVKDVVDQLVGGLRAGMGYVGARNLDELR
                     RKAKFVRVTLAGLRESHPHDIIITREASNYWTSSPQE"
     gene            89752..90021
                     /locus_tag="AJ81_00470"
     CDS             89752..90021
                     /locus_tag="AJ81_00470"
                     /EC_number="3.6.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660029.1"
                     /note="catalyzes the hydrolysis of acylphosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acylphosphatase"
                     /protein_id="AJC72914.1"
                     /translation="MKAVFVKVFGHVQGVGFRYFTYRVAKRLNVTGYVRNAEDGTVEI
                     HAEGEEKILERFLDEVSRGPTMAIVTDVRVEEVPVQGFRSFDIVH"
     gene            90032..90631
                     /locus_tag="AJ81_00475"
     CDS             90032..90631
                     /locus_tag="AJ81_00475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="AJC72915.1"
                     /translation="MFISFEGIDGSGKGTQVELFLDYLERNGVDFVYVREPGGTPIGE
                     LIRNILLSSQNMISKTELLLFLASRAQLVETVIKPALAQNKTIVADRFADSSVAYQGF
                     ARGLGVETVKRLNDFATGGLKPDLTFYIDVPVAVALSRKKHFDRIESEGEEFLNKVRQ
                     GYLELLKDEPERFVLINGIADELTVHRFIVEEFEKRRKK"
     gene            90645..91739
                     /locus_tag="AJ81_00480"
     CDS             90645..91739
                     /locus_tag="AJ81_00480"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74613.1"
                     /translation="MFSAELKRTLKNPYSLVLILIVPLVVTTIAIVLFSSFGFLQTKI
                     GILNLDTDPLSRLTVGIVMSLFKGGNISYVSEDYRQKLLNGDLQAVVVIPKDFSRKLY
                     AAQQTELIFIPSPVDLQVSTVMYRTFQSMFEDLNGSPFFDPQVIRYLFSSPGYPAPKL
                     SALEREKVLNLTSLLIPVTVFLSSACVLLAIASGSFQLDEQSKLTELFLSMNVGKFTY
                     VVSKILAYTSVGLTLSMVALLILLRFRVFLITPAMIELIVLNSLFHASVGLIISAVSP
                     NTQVSSMLSVVLTVVSFYFSGSVVPLSSMPTHLQSFARNYPLFLAIYSLRKQQLFEFD
                     VTSDIKKMTLLVVVFVVLSVVAGSSKLRRR"
     gene            91736..92296
                     /locus_tag="AJ81_00485"
     CDS             91736..92296
                     /locus_tag="AJ81_00485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="AJC72916.1"
                     /translation="MILRKILIVSDTHGSLTSWQRLKSLVGQVDEVYHLGDVLYHGPR
                     NPIPDGYNPAELARELRRENLFLVRGNCDADVDLMLLGISEAPKVLLASFGQVNFVMS
                     HGDFFQSEEQLFTFLEEHGARVLLYAHTHVPRFDWIQSRLIINSGSPSLPKMGSEPTF
                     VLMEINELVKISLISLTGKLLREALL"
     gene            92293..93282
                     /locus_tag="AJ81_00490"
     CDS             92293..93282
                     /locus_tag="AJ81_00490"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74614.1"
                     /translation="MMDVAKLIRDSNARITMIKYQEEILPEDVKFGSSSCWLVEEEEP
                     FVSEGPEKIIFVDSRRRRFTSIEVEGYVLLLTQIVTGAVLLENHRCKPLFSPDEPPTV
                     KLVLGVPDVIAKRWNVLNGEQVSIGRLSCDVAVGLTAKDATDSYMQEIERRTVERFLQ
                     EALVVKDGAINFTTPTFQIERGPLGLVKNIHMPYVDAEKFRTFGLMKKGQRSRCFATQ
                     LAEGEELLKVMSYLKLSDTPGLRGLVRIEAVVQKDCFAGSKRHIFELFGRLCGTLVRV
                     SDDSGLIPRTPEDTLPVVFLEKYLDRYFYSETYVRCAFIEAVKETKNFSTEIS"
     gene            complement(93335..93931)
                     /gene="tsf"
                     /locus_tag="AJ81_00495"
     CDS             complement(93335..93931)
                     /gene="tsf"
                     /locus_tag="AJ81_00495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470090.1"
                     /note="EF-Ts; functions during elongation stage of protein
                     translation; forms a dimer; associates with EF-Tu-GDP
                     complex and promotes exchange of GDP to GTP resulting in
                     regeneration of the active form of EF-Tu; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Ts"
                     /protein_id="AJC72917.1"
                     /translation="MEISAEMVKKLREMTGAGVMECKTALSEANGDFEKAIEILRKRG
                     AAVAQKKASRTTKEGIVTAYVHFNDKIGVLLELGCETDFVARMPEFKELAYNLAKQVA
                     AMRPRYVSREDVPQEVIEKEKEIYLAQLKDSNKPQQVIEKIVEGKLEKFFEEVCLYDQ
                     KYIFDDTKTVKQVIDEAIAKIRENIRVTRFVRMQIGEE"
     gene            complement(93981..94466)
                     /locus_tag="AJ81_00500"
     CDS             complement(93981..94466)
                     /locus_tag="AJ81_00500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001305768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="AJC72918.1"
                     /translation="MKAMYPGSFDPITYGHLDVIHRALKIFDELWVVVMVNPKKKPLL
                     PLAKRLELIKELLKDEPRVHVDSHNGLLVDYAKRKNIKTIVRGLRAVTDFQYELEMAI
                     ANKHLWHELETVFLMTDEKYSFLSSGLVREVASMGGDVSNWVPPNVLRTLRDLYGNGV
                     L"
     gene            complement(94472..95095)
                     /locus_tag="AJ81_00505"
     CDS             complement(94472..95095)
                     /locus_tag="AJ81_00505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="AJC72919.1"
                     /translation="MTFVIGDVHGCSDCLRKLLGKLPLTRDSRLIFLGDYVDRGPDSK
                     GVIETLIELSKSYDCIFLRGNHEQMMLDYLLKGENLELWMMNGAGATLRSYGGVNEIS
                     KQHVDFLESTLIYHVQGNDLFVHAGIRPNVPLEKQDQFDMLWIRYEFIYSEDPLPNFR
                     IFFGHTPFHDVMISKNKVGLDTGCVYGNKLSAICLETMKIYQVSCGG"
     gene            complement(95076..95942)
                     /locus_tag="AJ81_00510"
     CDS             complement(95076..95942)
                     /locus_tag="AJ81_00510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglyceryl transferase"
                     /protein_id="AJC72920.1"
                     /translation="MKRALILLLFLILLSVFLAYVFQGRLLLPQYLFRIGPFELRFYS
                     VFILTGVLVSYSLARKQAKRENVSLEQVDELVFYSVVFGVVGARALYVISNWKFYSKT
                     PSEIFKLWHGGLSIQGAILSGITVFLVYSTVKKNVTFKPLQALDLGAAYLPLGQAIGR
                     WGNFFNYEAFGEPTNLPWKMYVPVAMRPPEFKQYEYFHPTFLYESVWDFLLFLLLTHY
                     MKHYRKNFGEVFSLYLCFYSLGRICIERLRLDSMYVGSIRLAQLLSALLILFGFTLYV
                     LLRGGTIDVRDR"
     gene            complement(95945..96379)
                     /locus_tag="AJ81_00515"
     CDS             complement(95945..96379)
                     /locus_tag="AJ81_00515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72921.1"
                     /translation="MSCDVCKTDINVKVYKFLSDGIPKEVHMCSNCLRKTLKEAAIFK
                     RENLKYLAGYMRVVQDSDMGNFSGGHLSSGDLVFSIAPVAVLRELFAGESESQLEQRE
                     VAMRHLYVLKHRLEEALKREDYKSAHKIKNQISMIEKTMLGK"
     gene            complement(96376..96933)
                     /locus_tag="AJ81_00520"
     CDS             complement(96376..96933)
                     /locus_tag="AJ81_00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="AJC72922.1"
                     /translation="MIGLGNPGPRYASNRHNVGFMFLDRYAQRAGCTSSFVRETNYEL
                     LECGNVKLVRPLTYMNVSGLAVKALVAKYGVSVDDIIVVYDDVDLPLGKIRIRQKGSA
                     GGHNGLKSIIETLKTDQFIRIRIGIGPKPEGVDLAQFVLTDFSDQERVVLDKVLDVAV
                     QAVQTILSEGVQKAMSLYNSVEVIT"
     gene            complement(96942..97601)
                     /locus_tag="AJ81_00525"
     CDS             complement(96942..97601)
                     /locus_tag="AJ81_00525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25"
                     /protein_id="AJC72923.1"
                     /translation="MQLTAEIRTEHGKRPVRRLRNQGMIPGVIYGPEMEPVSIKLKKQ
                     EVEKFIHALSEAKPVTLRINVDGKTQDIEVFVKKVQIDKVTDEIVHIDFYKPAMGHVM
                     RIEIPIRVVGKPIGVEKGGIMEVLHTELPVETLPGALVEHIEIDVSHLNLGESYHVRD
                     LKLPEEMKVLLPADEALVTIIVPKGLQVEEVTAAAPAETIEPEVIKKGKKAEETEEEK
                     E"
     gene            complement(97617..98567)
                     /locus_tag="AJ81_00530"
     CDS             complement(97617..98567)
                     /locus_tag="AJ81_00530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="AJC72924.1"
                     /translation="MPFQRNDLKFFAGNSNPPLAQKVAEYLGLRLGDCQVSRFSDGEI
                     NVRINETVRGHDVFVLQSFSPPVNENIMELLVMVDAFKRASANSIAVVIPYFGYARQD
                     RKAKGRDPITAKLVANIITVAGATRVLTIDLHAEQIQGFFDIPLDNLYSFPVFIEEIT
                     RRYSNFKKDITVVSPDVGAVRRASKLAEKLQVPLAILDKRRPADNVAEVVNIIGDVKG
                     KIALMFDDIIDTGGTMIQGAQALKRAGAVRILACATHGVLSGNAVERIQNSEIDEVYI
                     TDTVHQTNLPSKFHVVSIANLLGEAIMRIRKNLSVSILFK"
     gene            complement(98569..99915)
                     /gene="glmU"
                     /locus_tag="AJ81_00535"
     CDS             complement(98569..99915)
                     /gene="glmU"
                     /locus_tag="AJ81_00535"
                     /EC_number="2.3.1.157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660016.1"
                     /note="forms a homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-1-phosphate
                     uridyltransferase"
                     /protein_id="AJC72925.1"
                     /translation="MRIIILAAGKGVRMKSRSPKVLHPVCGKPMLLWVIEAVQGLSER
                     VCVVLGHSAEQVKQVLPSHVEVRIQNEQLGTAHAVMSAQDFINPDEDVMILYGDMPLL
                     KKETLMKVVDQHKNDENCVTIISTTMADPTGYGRIVRDSAGKFLKIVEETEASDEEKM
                     IREINTGIYVFKGRALLETLPRIKPDNTKGEYYLTDAVNMLDRVGIHHVSENEQFFGV
                     NDRVQLAVAQKLKQREILERLMLNGVTVVDPDSTYVEADVEIGCDTVLHPMTFLLGKT
                     KIGEECVIGPMARIENCSVGNRVRIISSDCVGATIEDDVSVGPFARLREGTVLKSNVK
                     IGNFVEVKNSKIGSRSKAQHLAYLGDATIGEDVNVGAGTITCNFDGKKKNPTFIEDGA
                     FVGSNSCLIAPVKIGKGAFIAAGSVITEDVPEWSLAIARSRQTVKPGWVIKKREES"
     gene            complement(99928..102129)
                     /locus_tag="AJ81_00540"
     CDS             complement(99928..102129)
                     /locus_tag="AJ81_00540"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74615.1"
                     /translation="MVYDLAISKVPLRCLYSYKSQEKLEPGERVIVDFHGRKTIGYVV
                     KVSDKPASRELKEILQRLDRVSYLDQSDVEALESISERFFSPPGLLFDLAFPSFIDDY
                     AETVVESLTPLVGFESLPLGEFIKKYGHDALKNQLDKGYIQLKKCFGRKTPRPRVSKW
                     YVVVRNGLKALTRVHDEIEYDVISFLLTNGYATVEQLIESVGVSTKKIKQMQQEGLIE
                     LTQFLPVNTENLELAEAQLEPAPRGVTVLSGSTIGERLRSVIAFMKKITDENKSVLIL
                     VPFTSLTYMVAGFIRKFLNVTVQVYHARMSRSQRAKVWLDSVGDKTQVVVGTRVAAFL
                     PMRNLGLIVAEESDDDAYYQFEDPVYDALELAETRARLRDIPFVICSSEPRLIDFHRR
                     EHLKWLRIPKENLNSDVSIVDVRQSGSILSEDLVESVRKTISEERASVILVRRKGFAP
                     YVVCFACNHVLMCPNCDVALSFHKSQNVFKCHQCGYVRKAQSECPNCGAKALYPKGVG
                     TERVERLLKYHLPGARIVRLESEELEPFEVQEQFLKLQTNEIDVLIGSRIVLQGFGTD
                     RVGLICILDYDGLLSQPDYNTRLRMFQTMRKIRSNFTSARILIQTFQPQDGFLRDVFT
                     VNSEDFYLEELKKRKEVNYPPFCDLVQVILESDLPQTGWELVNYCVRSLEGETVLGPV
                     EHPIFKMAGKYRYHFLIKTKDLRKTLSKFNDVLMKIGKMGWRVFVNPPRLW"
     gene            complement(102141..102356)
                     /locus_tag="AJ81_00545"
     CDS             complement(102141..102356)
                     /locus_tag="AJ81_00545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_227861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72926.1"
                     /translation="MDVEKYVRAIEKSLTQMVLREMSSVDVSEIWIDTSIPVDLIVEI
                     LKTQQLKIPQELQAITNAGKVIWVRKT"
     gene            complement(102360..102893)
                     /locus_tag="AJ81_00550"
     CDS             complement(102360..102893)
                     /locus_tag="AJ81_00550"
                     /EC_number="2.4.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470079.1"
                     /note="regulates pyrimidine biosynthesis by binding to the
                     mRNA of the pyr genes, also has been shown to have uracil
                     phosphoribosyltransferase activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="AJC72927.1"
                     /translation="MVKRIKVLGEQDIRRSLLRIAHEILERNRGLEDLVLLGILTRGA
                     YLAERLAGFLKSVEGKPVSVGKLDVGPFRDDEKRTEQDLSEIPFDLHDKIVVLVDDVL
                     FTGRTVRAALDAVSKRGRPRAVQLAVLVDRGHRELPIRADFVGKNLPTSKTRERINVC
                     LKECDGEDAVYIVHLEE"
     gene            complement(102887..103684)
                     /locus_tag="AJ81_00555"
     CDS             complement(102887..103684)
                     /locus_tag="AJ81_00555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72928.1"
                     /translation="MVLADIVDFTNDGRSVTSSGVWSFRTNPAGIVENEVRQILLSNT
                     LRISSVRNVRSFTFALIEPSLDTLAGVLSISAEFSDFNQERMSFLYGVAGTAGLTSLG
                     VNFGIERTVKNAAVDTSIVLDVGAKGKFVENGPLGYGLAVKNFRIWSSDPQLANQATF
                     GAGLCLDYDQMKFALDVIYGFNELWTILPGAQLNLEPVSLYVTIPVFYSPENDSILAI
                     DAGGSFQIGNLNIQVSVFYPFSKKESPDFFKELSYDYQIDFRIGVRW"
     gene            complement(103662..104852)
                     /gene="tgt"
                     /locus_tag="AJ81_00560"
     CDS             complement(103662..104852)
                     /gene="tgt"
                     /locus_tag="AJ81_00560"
                     /EC_number="2.4.2.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470077.1"
                     /note="Exchanges the guanine residue with
                     7-aminomethyl-7-deazaguanine in tRNAs with GU(N)
                     anticodons (tRNA-Asp, -Asn, -His and -Tyr); Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="AJC72929.1"
                     /translation="MSDRPPSNARPSNFEIVCRTGCARLGRLKTLHGTFETPIFMPVG
                     TNANVKLMRSDDLKRVGASIILSNAYHVAVRPGLEVIELHGGLHNFMAWDGGILTDSG
                     GFQMFSLKNFRKVSDEGVTFVSPYDGSKLFLTPELSMDIQRTLGSDIVMVLDHCPPID
                     VGYTEALDATRRTHEWAERCLKRGVKEGQLLFAIAQGGAFEDLRRASARYLSEKDFDG
                     FAVGGLSLGEPFEMTLRLAHATVSELPDDRPRYFMGGGSPRTIIELVAIGIDMFDSVY
                     PTRLARHGAALTSEGRLNIKASRYRKDLSPIDHRCDCLVCRNYTRSYIHHLLNRGETL
                     AGMLLTYHNLYYMFRFMERVRESILNGTLEEMRREVAEIYEERRGSPVDVLALDYNGA
                     RRHS"
     gene            complement(104809..105447)
                     /locus_tag="AJ81_00565"
     CDS             complement(104809..105447)
                     /locus_tag="AJ81_00565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formiminotransferase-cyclodeaminase"
                     /protein_id="AJC72930.1"
                     /translation="MSFEKMQIRDFVEKVADKSPTPGGGAVSAVVACLAAALNEMVAQ
                     LTLGREDYAEWHAEMERVIEEMEEIRHVLLELADADAEAFDEVMNAYKLPKGTEEEKE
                     KRKKSIQEALKRAAHVPYEICRCCRDIVKAAHVVAKWGNVNAISDAVSAAEMAHGAFQ
                     SAKANVLINLKSIKDEAFVENMKHELRTFTGEVEGELENVRQTAKQRAAIEF"
     gene            complement(105444..106184)
                     /locus_tag="AJ81_00570"
     CDS             complement(105444..106184)
                     /locus_tag="AJ81_00570"
                     /EC_number="4.1.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002534684.1"
                     /note="catalyzes the formation of D-glyceraldehyde
                     3-phosphate and acetaldehyde from
                     2-deoxy-D-ribose-5-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="AJC72931.1"
                     /translation="MSTLEEKIEERIIEFQRNYKFELPQRAILAQEVVSAIEHTLLRP
                     TATEEEIDRLCDEAVQYGFYGVCVNPVYVKRAVEKLKDTSVKVVSVVGFPLGANTQYC
                     KAREAEELVRLGVDELDMVLNISMMKSKDYKYVYEDIKSVVEASQGKSVKVIIETCYL
                     TEEEKIAACVIAKLAGAKFVKTSTGFGPSGATVEDVHLMKWCVPELGVKASGGIKSYE
                     QAVKMLLAGASRIGTSSGVNIAKEGVSK"
     gene            complement(106199..106747)
                     /locus_tag="AJ81_00575"
     CDS             complement(106199..106747)
                     /locus_tag="AJ81_00575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_229358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="AJC72932.1"
                     /translation="MLDRNAALDLLNEHVKTKNLVKHCIAVEAIMKALATRFNQNAEL
                     WALAGLLHDLDYEYTKDKPDLHGLKTVEILESYDVPKEVLDAILAHCEKKERETLMEQ
                     AIYVADPTSGFIVAAALITPEKSLSVIDVDFLNRRFKEKLFAKGANRQQMMECEKMGL
                     SLNEFFEISLEAMKAISKDLGL"
     gene            complement(106740..107948)
                     /locus_tag="AJ81_00580"
     CDS             complement(106740..107948)
                     /locus_tag="AJ81_00580"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74616.1"
                     /translation="MQDEKDERILNLLRLKEELEKDLKKKGILREHRAEQRKQTSQPK
                     IEFEPDIDLPVENIWTLHDLNHYAYGISDDVIQKSLQKKLHSVKDEEHRYVITNLIKL
                     LRGEKIEATRTNSVHVECLKILSELYFLEGDVVKDTIQLLRKYPGQPLVYLTAAEVFL
                     AFGRFNEAVKLFQIYSELTKDPYAALVLEAYTEGQVSSSTFATCVSRDGYKSMLLIIS
                     ALTEAEEKLMKVAPVLEKRDFACAQYVSARSKGKVSKPFFHCSRLLIYDEALKFVQNK
                     SVNQTLLEKIAVKDPLARLLLVSINLQDDPGKGFEHMKAFFNSVGEILYVETDASDKP
                     RLVRNLLEFQKLSKNFKRVTSERDLEHLFEALSSQDVWIFFKDPEYLRLYFGERHCKN
                     TCLWEGWTNA"
     gene            complement(107999..108655)
                     /locus_tag="AJ81_00585"
     CDS             complement(107999..108655)
                     /locus_tag="AJ81_00585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_754312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72933.1"
                     /translation="MRPRERMKMAGPESLSDVELLAIILRTGREGKNVNELAQEIMDR
                     FDSSLRSLCNASLEEIAALDGVGLAKAASIKAAFELGKRLYAELSKPRTLLNSPSAIF
                     EFCHEMRFYEKEIARVLLLDSKLSLITYSDVTVGTNNQTLLHPRDVFRLAVRANANAL
                     ILVHNHPSGDPSPSRDDERVTLSIAEAGKILGIKLIDHVIVGRENYYSFRAAGKISED
                     "
     gene            complement(108652..109212)
                     /locus_tag="AJ81_00590"
     CDS             complement(108652..109212)
                     /locus_tag="AJ81_00590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_834174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation protein Maf"
                     /protein_id="AJC72934.1"
                     /translation="MRRIVLASTSPRRLRIMRMILDEFEIIAPDIEESKFSTPQETAE
                     KLALMKAIKVFEQNKDAIVIAADTVVDLDGEILAKPSNEIEAREQLLKLMKRWHLVHT
                     AVAIASESEVWLKLKTAKVKFREVPIDFVSMYASKHSLDKAGSYGLQDIGAVFVESVI
                     GDPYVVVGLPVYEVWSYLRSREVLAC"
     gene            complement(109145..109684)
                     /locus_tag="AJ81_00595"
     CDS             complement(109145..109684)
                     /locus_tag="AJ81_00595"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74617.1"
                     /translation="MSSRKLALISSLASLGSVIYFLETFIPFPLPFGRWGLSNLVVLI
                     AVVLYDWQTVFAVSLLKSVVSALITGQLFSIVSLMSIAGSITAAACEYITFRTSIFGL
                     TGVSVLGSVANNVAQSIVGAVSIKSWSFLLVLPHMLILGVPGAVLNAYLTERVVKRAK
                     NSFGLNVAQKVTNNENDSR"
     gene            complement(109681..110049)
                     /locus_tag="AJ81_00600"
     CDS             complement(109681..110049)
                     /locus_tag="AJ81_00600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005097018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72935.1"
                     /translation="MNRRGKLFKKYDLLLVIVIVVGFFVFYSTRSREGQSIEVFVEGK
                     LFMQITKPGTYELHDGDKYLMKVVFNGQKVHVEDSNCPLKICERTGNVGPGGTIICVP
                     NKVLIKFRTNVDTAVDVMTW"
     gene            complement(110033..111085)
                     /locus_tag="AJ81_00605"
     CDS             complement(110033..111085)
                     /locus_tag="AJ81_00605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ApbE family lipoprotein"
                     /protein_id="AJC72936.1"
                     /translation="MWKRDSKNILKLDKRILLVGVSLLVVLLALFLTSFFKAPPSYYE
                     LDGFTLGTYCRIVVSSKKNSKVLAQVIFNELERIYKKYNPNDPNSVVSKINASDDWVD
                     VDEETFVLLDAAVRFSKLTEGSFDPTLGELIQLWGFDRIAEKLPSRVPTSEEINEALK
                     RVGVDKLELDFQRRRVRLLHGAKLDLGGIAKGYALDRAYQVAKEVDKDCTGFVEAGGD
                     IRILGPKFGSRPWVVGVRDPRNAGSAIAYLYLTSGAVATSGDYERYFEAEGVRYHHIL
                     DPKTGFPARGAISVTVVADNAVTADALSTAGFVMGAQWEYVVLEFPKLGGSVLMVTEE
                     GSIRRSATMVVYEQAR"
     gene            complement(111055..112044)
                     /locus_tag="AJ81_00610"
     CDS             complement(111055..112044)
                     /locus_tag="AJ81_00610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="AJC72937.1"
                     /translation="MQRMALYFSTLENNKIKCELCPHHCVLEDGQVGFCLTRRNQDGA
                     METLNYGQITSIALDPIEKKPLFHFNPSEMILSVGTFGCNMKCPFCQNWEISQQVAPT
                     KSVSPQQLVSIAHSRGSRGIAYTYNEPFVWYEFVLDTSRVAAKEGLYNVLVTNGMIER
                     EPLKLLLQSIHAMNIDLKAFDEKIYAKLGGDLKAVLRTIEMCVEANVHVEITTLIVPG
                     VNDDLSHLEKEFQWISALDKSIPLHLSRYYPNYKYHAPATSPALLIEAYRLARKYLDF
                     VYIGNLWDPEYEKTVCPNCGTVSIVRRGYDVEIVGLDDEGRCSKCGREIVRIF"
     gene            complement(112056..112580)
                     /locus_tag="AJ81_00615"
     CDS             complement(112056..112580)
                     /locus_tag="AJ81_00615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72938.1"
                     /translation="MKGNHPFVKWAIKSIESYILEKRIVDPIKDGAPQELLKRRAGAF
                     VSLHLLDGSLRGCIGTFMPTKANLALEVRDNAIAAATEDPRFEPLTPDELDEVEVTVD
                     ILSEPEKVTELSQLDPKKYGVIVASGYRRGLLLPDLPGVDSVQEQLQIALRKAGISER
                     ERFEMYRFTVERYH"
     gene            complement(112534..113265)
                     /locus_tag="AJ81_00620"
     CDS             complement(112534..113265)
                     /locus_tag="AJ81_00620"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74618.1"
                     /translation="MLAVFVGGICPGARLLFEELRRSGLDLLQLNEQMNDLSVVVASP
                     RELQKRIDEAHQRHRLEGLLFVGNDELMKVAYGLCSAGFRVAYVPSADASLTWQGLGF
                     RTIVSHLVRVATLARSMKSLKTIKIVLPKSLKTHLSRFEPLLKVCEDQKNLVLVIRGE
                     QRGESTIKLEGFLNCLEADERDRECIAKLARKISEAFASWRKVHHVFQCEVEPIPISQ
                     AYELWKKVREGEGEPSVREMGDQEY"
     gene            complement(113339..114247)
                     /locus_tag="AJ81_00625"
     CDS             complement(113339..114247)
                     /locus_tag="AJ81_00625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl CoA-ACP transacylase"
                     /protein_id="AJC72939.1"
                     /translation="MTAFVFPGQGSQYSGMGKEFMSYPRARYFFERAKEVLGIDMYQL
                     MNSDEEILKITENAQPAIYLASYIAFDELVRNGIVPNIVAGHSLGEYTALAAADVYDF
                     DLGLYLVRKRGEYISQAVPPGLGSMAAVLGVNLSKLEQTISDMDGVWIANYNAPDQIV
                     ISGSVESVKKAVERIKTFAKRVIELKVSGPFHTPLLESAREKMARELRGVKFRRPRWP
                     IVMNSTAKETTDPEEIRENVLAQISGPVRWYQSVERMTLLGVHSFVEVGPQRVLTNLI
                     KKMSRENCKHFSEVLAEEKRLISEPV"
     gene            complement(114244..115182)
                     /locus_tag="AJ81_00630"
     CDS             complement(114244..115182)
                     /locus_tag="AJ81_00630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="AJC72940.1"
                     /translation="MKNRVTELFNIEYPIIMGGMAWAGTAKLAAAVSNAGGLGMIGSG
                     AMRAEQLRDAIAQIKKLTDRPYGVNIMLASPYVEELLRVVIEEKVPVVSFGAGNPSKY
                     IPTLKDHGIKVIVVVASDSLAKLVERAGADAVVAEGMESGGHIGEVTTMVLVNKVARS
                     VRIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFLATVESEVHENYKRKILNASIRDT
                     VVTGAKLGHAARVLKTPFARQVVELEVRSPEEAEMILVGSLRKAVIDGDIDSGSFMAG
                     QAVGLIDDVPTVKELIEKIMREFFETVQKLCREVNT"
     gene            complement(115163..115594)
                     /locus_tag="AJ81_00635"
     CDS             complement(115163..115594)
                     /locus_tag="AJ81_00635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymyristoyl-ACP dehydratase"
                     /protein_id="AJC72941.1"
                     /translation="MNVEEIMQILPHRFPILLVDRVIERDEKRIVAIKNVTISEIFFL
                     GHFPDYPIYPGVLIIEGMAQTAGLLLLKPEQKLVPLFLGIDNARFKSPVKPGDVLKYE
                     VEVIESKLNVVKVKAKASVDERIVATAELLLGVKKREEQGD"
     gene            complement(115591..116817)
                     /locus_tag="AJ81_00640"
     CDS             complement(115591..116817)
                     /locus_tag="AJ81_00640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="AJC72942.1"
                     /translation="MRRVVVTGMGIVSPIGIGKEEVLMNLERSTVAIDYISSFDASNL
                     PVRIAAEVKNFDVEKYIDRKLARRTDRFVHFALAAFKEALDQAKIDLSSFSERTAVLV
                     GSGMGGFITLDTENNKFLAQGASKVSPFLIPMLLINMASGIISIEHGLKGVNFAPVSA
                     CASSGHAIALGTLLIRHNYADVAIVGGAEATIAPLPIAGFASMRALSTRNDEPKRASR
                     PFDVQRDGFVMGEGGAILILEAEEIALKRNAEIIAEIKGFGMNDDAYHMSAPDPEGAG
                     AEKAMRLALEDANLSPQDIQYVSCHATSTPAGDEAEAKAIERIFGKEIYVNSSKALMG
                     HLLGAAAAAESVVAILQMQKGFLHAMPNLDEKDPQVNVNVVGKEPVRIEIENFVKNSF
                     GFGGHNVSIVIGRYEP"
     gene            complement(117127..117603)
                     /locus_tag="AJ81_00645"
     CDS             complement(117127..117603)
                     /locus_tag="AJ81_00645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="AJC72943.1"
                     /translation="MWLIISDTHDNLHSIEKFVEEANRRKVTHVFHCGDVVSPFALLR
                     LLKLEAEFHGVFGNNDGEWLLLSQRSSGRLVKGPVELVVDGKKVAMMHEPFALEALLE
                     SQHYDFIFYGHTHKLDFRRQGKTLLVNPGDGSGYIAERPSAVFLDPETGQIDVYQI"
     gene            complement(117624..119381)
                     /locus_tag="AJ81_00650"
     CDS             complement(117624..119381)
                     /locus_tag="AJ81_00650"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74619.1"
                     /translation="MHRFFLLLACVSCLVVVSCVPLCDETGSLTVSVVLKKAIPSVEP
                     TLGVVTLKKGARILSQTFNFPGENSVVFQSIERGNWTVSVELKDGQNYTIYVGETQVE
                     VLAGKHSTVHVPVTLNSADLTVDVSVTSSEASTVELRLEHSQDVILERRNLEDREITF
                     EFHNLASAVWQLKLTLYDQSGNEMLVWPETGSVGLELQPGRMNTYSVRIDQFGNVEIV
                     LEVETVQTVSSATLTNLDEGILISWDPVENAAFYEIYKAEQGYWIKIHECTSTSYLDQ
                     DVVENVEYSYVFNVVAENGRHSGFSRPFTVVRDTQRIFVALSDRSVVRFKVNQSHLTP
                     VASNVVSEANDAKLLRAIGDDLYFLTSGSLVRLNANDLTVLSSQNVLLFTGTNSAFND
                     EYFFQVGSNTLRRYSLPNSATYETAPIGGTAVDADRYVVVLNGQTVSLVDPVTLQVLS
                     TKTISNAQRIFTRGEFVFVYVQDVSHRLEVYSVSDNNLELVKTYAVEGDVRRLDASEQ
                     FFCLGVSGEGIYLGRLTDATLTKINSNFPVSIKIVGNLLYTLFTDRLEVYTVDVASLS
                     VSLTARSNFTQQALAMFAD"
     gene            120037..121248
                     /locus_tag="AJ81_00655"
     CDS             120037..121248
                     /locus_tag="AJ81_00655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="AJC72944.1"
                     /translation="MVDSSLTLAHQQVRGLKFFLLSLQHFVAMFGATVLVPLLTGLDP
                     LVALFTAGAGTLLFHVITGGIVPVFLGSSFAFIAPIIMVKEQLGDLAYATGGIFVAGL
                     VYLIFALLVWFVGTDKIKRLFPPLVTGPMIVVIGLTLSPVAIQMASQNWLVAMVVVVT
                     VILTSVLLKGFWSMIPVLFGVLAGYAVSLPLGLVDVSAVQQSGWLSVPHFILPKFNWT
                     AIATIAPVSIATVMEHIGDITTNGAVVGKNFFEKPGLYRTLIGDGLATSLAGLLGGPA
                     NTTYSENTGVLALTRVYDPRVLRGAAFLAMLVAFLSKFGAVLRTIPTPVIGGISLILF
                     GMIASVGIRTLVNAQVDFSRPKNLLVASLILTVGIGGAVLKINHVEFKGLSLAAIIGI
                     VANLLVPDKKG"
     gene            121333..121935
                     /locus_tag="AJ81_00660"
     CDS             121333..121935
                     /locus_tag="AJ81_00660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP cyclohydrolase"
                     /protein_id="AJC72945.1"
                     /translation="MNIKRALISVWDKTSIVWFAKALEERGMKIFATAGTADYLRSHG
                     IVVENISQITDFPEMPEYNIKSIHPKIFAAILMNLFEESPKRISVEPFDLVVVNPRPF
                     QLGDDLDEEQILKNVDIGGIAMLRAAAKNYRNVVPVCDPEDYNMIVESIDRCGDVELQ
                     KRRYLCVKAFLFCHRYDESVFRILCDLFAIDATELKRGSE"
     gene            121956..122558
                     /locus_tag="AJ81_00665"
     CDS             121956..122558
                     /locus_tag="AJ81_00665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComFC"
                     /protein_id="AJC72946.1"
                     /translation="MKVVFPNSCVLCGRTISAFSLLCEECEAKLFRGPIPLVEKTKWC
                     EVYFYGRYESLLRDVILAYKNGGHWRLRKILARAIFETMSRYSTSFDVLTWVPSSFKA
                     LEERGFDTMGMIAKVVSKNIHTKCVSLIESAAPSTKRGLTRQQRRESVRGMFVLKAKP
                     RGTVALIDDVYTTGATINECSKLLLQAGAEKVIAYCIARA"
     gene            122571..124541
                     /locus_tag="AJ81_00670"
     CDS             122571..124541
                     /locus_tag="AJ81_00670"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74620.1"
                     /translation="MSLKLKVVLLVVVFLVVGVSTVTITNLLAIRGRLLAYAEGEMLQ
                     KVEKEAIKLDNWFRERLITLQGIAPNLENLFLFFDVNMIDMSLRSYAEDLEKLGFVGQ
                     ILMSPDGKTFTLNLQLEKDLSKERFFQEALNGNIFVQDNVVIKDTKGLLFSVPVLSYS
                     QEIVGVYAAFMPQVKIDELVLNVKHGERGYGFLTNKDAVVISHPDMNMVGKKLSQIDE
                     NLKTVEEKILKAEAGTVDYIFQSERKLAAIANLPSVGWSIAVTIPKKEIEAVFQQTIV
                     MSLSVAALIAFIATIVAVLFGRSITKPITMLSAVSQKIAEGDLSQMIEFKKSSGEISL
                     LSSAFSTLTNGLKDSIMNIKKIQQKMSSLNEQIRKDTESAKSASQEAKAVSEDVNKII
                     ASVGQLVHQVNMGAREVASGSEQTSKSALLLSENSEKLRKSSKAVQQAVKKLIDSVED
                     MARQQQTVSKSIQELADFTGKIEEVISTIYSVAEQTNLLALNAAIEAARAGEAGRGFA
                     VVAEEIRKLAEQSRVSTKQIGDFLVGIKSHAQLMLEQEEEIARRTEESNKAINESLKT
                     LEGMMEEIEKVASMSNDLAAISQEQTAAVEEINAAIERIVKEIDKVSSSIDKLSKGVT
                     DQAERVEGLSQSLEEVMKVFEELTMTFAKYKV"
     gene            124548..125102
                     /locus_tag="AJ81_00675"
     CDS             124548..125102
                     /locus_tag="AJ81_00675"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74621.1"
                     /translation="MRSKLLLIAFLTFLALAIVIFRTSRQRLKLYCEDDLKSIVVNVL
                     REQGMKYEFSEREKAVLIVERSKIIYKGVEYNLAWEKRLNERIEEILSVYFKGARIEA
                     LSSGFLSERYRVMVQGSVRIVEVRVAGKDALSDVIESILSERGDYFENGFILAPIEAI
                     MEGKRIFFYDPRTEQVLFEDAGGS"
     gene            125103..126077
                     /locus_tag="AJ81_00680"
     CDS             125103..126077
                     /locus_tag="AJ81_00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="AJC72947.1"
                     /translation="MESILTVKNLSTYFYMEEGVVAAVDDVSFELKPQEVLGIVGETG
                     SGKSVTVKSIMRLIKPPGKIVRGEVIYKGQDILKLDEKEMYNIRGKEISMVFQDPMTS
                     LNPLFTIGNQLMETIMQHQKVSKEEAYKRAIEMLKLVQIPEPEKRMKSYPFEFSGGMR
                     QRVVIAIALSCNPSVLIADEPTTALDVTIQAQILELMKQLQETLKMAMIFITHDLGVI
                     ASMAHRIIVMYGGKQMEEGSAEDIFYNPVHPYTNMLLKSIPRVDKKVERLEPIPGQPP
                     RMIDIPKVCPFLPRCPRSVDECSKSVPDMVEVSPGHRVRCFNPVEGGV"
     gene            126070..127065
                     /locus_tag="AJ81_00685"
     CDS             126070..127065
                     /locus_tag="AJ81_00685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002250886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="AJC72948.1"
                     /translation="MYDVSEKDVLVKVVGLKKHFPIKQGFFIKRTVAHVKAVDGVDFE
                     IKKGETFALVGESGCGKTTVGRTILRLIDPTEGQIFFDGTDISKLGYKQLLPFRRRMQ
                     IVFQDPMSSLNPRMTVGQIVTEPMIFHNVVKTKQEAYERAKELMEMVGLKTFHLDRYP
                     HQFSGGQRQRVAIARAIAIQPEFIVLDEPTSALDVSVQAQIINMFLDFQERFHFSYLF
                     ISHNLGLVRFISQRVAIMYLGRIVEMGDSEEIFSQPLHPYSKALLSATPVPDPKVEKA
                     RKRIILTGGVPSPINRPSGCFFNPRCPFKVEICEKEYPQMIQVSNNHWVACHLVK"
     gene            127078..128841
                     /locus_tag="AJ81_00690"
     CDS             127078..128841
                     /locus_tag="AJ81_00690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005097180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="AJC72949.1"
                     /translation="MRKALVVLMLLAVVAIFAAEKYVWFDENTPYLGSDATGKYGGRI
                     VVAALGGPRTMNYTVAKETSSTDVIALFMGYGGTLVELDNYARLHPCIAKRCEVELTD
                     EGKMIITFWLREGIKWSDGQPFTADDFVFTVNDVYCNPDIPSSTQDVIKDSQGRLPRA
                     EKIDDYTVRVIYEEPNRLAVRYIGGLYIWPKHIAEQWVKDGTFREKWTVEAINNKELV
                     GLGPFIPVEYVPDQYIRAVRNPYYWKKDANGNQLPYLDEFVFKILPDLNAIKLAFENG
                     EIDIYGVTAQFYPEIKAKAKEKNWIVGTGGPTYGTTFITFNWNHDDPVKRSWFRNEYF
                     RKAVAYAMDKEAMIDTLLAGLGIAQWGPVSVLSPFYNEDALRKYPYDLDYARMMLQLG
                     GFSWDKDGNLIDADGNKVEFILSTNAGNIVREGMCNIIREELGKLGIKVTFVPLDFNL
                     LVNKMLNTTDWEAIVIGLTGSDEPQGGRNVWAQKGTLHFWNYHPEAAPGGQIKPEIYE
                     APDWELEIDRIFAENIKILDQKKVYEMFSRFQELVSEHLPLIYTVQQLYLYAHKADLN
                     IIDPNAFGGMLWTLPWIYWKK"
     gene            128889..129854
                     /locus_tag="AJ81_00695"
     CDS             128889..129854
                     /locus_tag="AJ81_00695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="AJC72950.1"
                     /translation="MLKYIARRLIIAIPELLIISFMVFMIMEAAPGDFLDQYKLDPSM
                     SKETLEAMRKELGLDQHPLVRYFKWLSGAVRGNFGYSFYYRRPVSKLIWERVAATLTL
                     SLTSLAGSWILGVALGTFAALKKYSLADKILTVFAFSFIAVPSFFLGLLLLYLAARTG
                     WFPIGGMISIDHNTMTTWQRFKDLLWHMTLPATALTLGSMAGLMRYMRGSLLDVLNED
                     YVTFARAKGMPERIVVFKHAMRNAINPMITFLGFSISGILGGSLFIENIFAWPGMGRL
                     IYQALIQKDLYLVITSGLISAVLLVVGNLVADILLALVDPRVRLT"
     gene            129868..131382
                     /locus_tag="AJ81_00700"
     CDS             129868..131382
                     /locus_tag="AJ81_00700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002533679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="AJC72951.1"
                     /translation="MAQNNNQMDFQEKYLSRGQLIWRAFLKHKLGVGALVVLIVLYLM
                     ALFADFLSPYNPAEQSLRHTYSPPTKVYRTYKGQRTKPYVLPSMSYVDKITYERTYKE
                     MLFPRRLVIEKADGTRMTYELGKDGVESFKFSVNRVESIKVNGQWYDVKKSPAITDYF
                     LFNYNENVLNKGVSRFETTSAVAQEMFFKTYKDRFGLTSEYDVEAVAVTEILDSIVIK
                     KDGKFEMIKGKVVDYDYKTYPIKWFIKSWTGKLLWLFPSKLHLFGVDNYDNNQFVKFY
                     IMGADLFGRDVFSRIVFASRISLSIGLIGVFITIAFALVFGGISGYYGGLVDEAFMRF
                     AEIIMSIPGFYLMIMLRAVLPLDLPSTQIYLLIVFILSFIGWAGTSRVIRGLVLSIRE
                     REFVEAAVAIGLSNWKVLTRHVLPNTTTYLIVNATLRIPGYILGEAGLSFLGLGIREP
                     QASWGLMLAQAQDVYVITRASWLLIPGVFIFVTVLAFNFVGDALRDALDPRSLG"
     gene            complement(131374..132702)
                     /locus_tag="AJ81_00705"
     CDS             complement(131374..132702)
                     /locus_tag="AJ81_00705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--alanine ligase"
                     /protein_id="AJC72952.1"
                     /translation="MRIHFVGIGGVGMSSLAIHCHLMGHDVYGSDISRNEHTEVLERL
                     GVKIFLGHTRENWLNPELLVHTPAVSANNPELLRAQEENVRIVTRFELLRQLVESSTQ
                     FAVTGSDGKTTTTAMLAHVLKAIGADPTVFLGGMNPSLEFGNYRKGSGPFVYELDESQ
                     PSFSSFHPTHLIITNARRDHLENFHGDESYYMSCFEKLAESAQNVVTFREDRLTSHLG
                     HHTFGLNEGTCVLLDRKVERFEQLATIRLDGKTHKLRLRVPGLHNVLNAMAVVTLLWA
                     AGFNPADAVKALSSFVGTYRRFSVTTIDESKNIYVVDDYAHTPDEIAWLIRTSREVFT
                     GLKQVMIFQPHRYTRLAREDGNFAKALMDADEIYVTEVYGAFEQVLPNVSARMIVDGL
                     KNHGKKAEYVPSPEELLMKVKPAPNTVYLFVGAGDIIDYSKKFVRESIST"
     gene            complement(132699..133718)
                     /locus_tag="AJ81_00710"
     CDS             complement(132699..133718)
                     /locus_tag="AJ81_00710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-UDP N-acetylglucosamine
                     transferase"
                     /protein_id="AJC72953.1"
                     /translation="MKVLAAGGGTGGHLYPALAILEELSKHVKLKVVYFCTPRGIENK
                     IVPAEHPEYKLVKLDVQGLERPIFKPTNVKRVLKILRTKSIIASETDGSNCCLVTGGY
                     VSYPLGLVCGKKRIPLYIQEQNVVPGLANRSLSRYAKKIFVGFEEAIINFPRSVRNRI
                     VVTGNPIRVSNVNRGVFGEGYVLVFGGSRGSDLINTVMEKIYREEKNLKFVHGTGDPV
                     WTKRLSIFDNVLALDYIYDMPSAWRGAIAVVCRAGALTISELLHYGVPAVLIPWEGAA
                     EGHQVRNAEFVAKIGRGVIVRESEATPRRVLEAIEVAIGLGKLPEKETNPADTIAKII
                     LEECL"
     gene            complement(133715..134797)
                     /locus_tag="AJ81_00715"
     CDS             complement(133715..134797)
                     /locus_tag="AJ81_00715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell cycle protein"
                     /protein_id="AJC72954.1"
                     /translation="MPSHALALLIITAVLIAVGLIVISSLEVSAQMNLYGGVARDIFR
                     SHVTKLSIGVVLMIITCFVDYRYHERYAWFYYVLALFLLLIPYTLPPVAGSRRWILLP
                     GFSFQPSEFAKFATIVCCAAYMKKRREKLNSFIHGFLKPLLLVLPVLLLIAFEPDLSS
                     SLIILLVVLLMLYSHGGRLLYLLSTFGSMALLFFIAEKFGILLKGYQLSRLKAFFSGD
                     LPEQVLQAVRAFREGGFLGKGVGLGEVKLSVPAVVTDFIFAAIGEELGLIGIVGVVLL
                     FFLLVWTMLKLVESSSDTFVTAFVSGLALLIMVQVLVNLGVTSGTLPVTGVTLPFVSY
                     GGSSLAMMMASLGVVINMATSGSETK"
     gene            complement(134797..136074)
                     /locus_tag="AJ81_00720"
     CDS             complement(134797..136074)
                     /locus_tag="AJ81_00720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="AJC72955.1"
                     /translation="MFYALMGYGVSNRSLCKMLVEMGHRVFVSEAKALSEQDRRDLDE
                     MHVEFEDNGNTERVLKADWIVVSPSVKPDHPIVSRAREKTLTDLDVVLNIKKPGFIVA
                     VTGTNGKTTTCHMFEHVLTKLGKRIIVAGNIGNPIANVRDEQLDYLVLEISSFQLFWS
                     KSLPIDVGVILNIEPNHLDWHPSFEHYVESKLKLFTFAGKRFSHESCRKFINKRWTDV
                     VGFSTMHLVNEHQVEFHGQIYPLRNGFLKTHQNLQNLSAVLTVLESLGFEPRMVLEAL
                     EDFTPPQHRMQLVAIIDEVHFVDDSKSTSAAATIAALQNYQDGKVVLILTGRGKNENY
                     DALVGQVKKKVKFVVVFGEITALITPLLRASNVPFRVVENMEEAVFEAFRRASRGDIV
                     LLSPAAASFDLYANYAERGEHFVRVVESLKEGA"
     gene            136223..136858
                     /locus_tag="AJ81_00725"
     CDS             136223..136858
                     /locus_tag="AJ81_00725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_09319765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketohydroxyglutarate aldolase"
                     /protein_id="AJC72956.1"
                     /translation="MNSIVEKIIESGIVAVIRVDSPARAIEVCRACKEGGIVAIEVTF
                     SVPRAVEVISQLSKELGDEILLGAGTVLDPYTAKIAIEAGARYIVAPNLSEETALLCN
                     KHRIPYIPGALTPTEIVKALEVGCELIKLFPASAVGPSYIKAIHGPLPQAKLMPTGGV
                     ELENVKEWIKAGAAAVGVGGGLTKGSKEEITDRARRFVELIKQARSEIAGR"
     gene            136855..137820
                     /locus_tag="AJ81_00730"
     CDS             136855..137820
                     /locus_tag="AJ81_00730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_549823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation pathway signal
                     protein"
                     /protein_id="AJC72957.1"
                     /translation="MSVVRRALLLVLLTAVMLSVFAANYPRKPVTIICPWGAGGGTDR
                     LARFLADELSKKLSQPFTVVNRTGGGGAVGHAAGAYAAPDGYTLTLVTLEIATMHWMG
                     LTELTFEAFDYIAQVNEDPAGVIVKADAPWKTLHDLLKDIKANPGKYLFSGTAAGGIW
                     DLARIGMLDAAGISPDAVTWVPTTGAAQGLVELLGGHVHVVTCSIAEAVSQIQSGQAR
                     ALAVMADERHPMFPDVPTLKELGINWTAGTWRGIAVPKGTPSEIKKILEDAIIEIANS
                     ESFKNFMQTNGFGIKIRRGQEFYEFVKQQDQAWKKVLELGGYLQK"
     gene            137868..138344
                     /locus_tag="AJ81_00735"
     CDS             137868..138344
                     /locus_tag="AJ81_00735"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74622.1"
                     /translation="MSIADLILGFVLVFISFFVLLYSRKFPRFVVRGVRLPGPSFFPR
                     ILAVLLLIFAAYMFVEYFLLRKRKTSDEKYPVDAKSLLNLLWISLMVLFFFPLANLIG
                     TFVALITLSFLLMVVLKSKWYEALVFSLSVSLIVHLVFSVVFKIPLPVGVLFAKLR"
     gene            138350..139819
                     /locus_tag="AJ81_00740"
     CDS             138350..139819
                     /locus_tag="AJ81_00740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_01743050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter permease"
                     /protein_id="AJC72958.1"
                     /translation="MQLFTVLKPDVLFPLLLSMFFGIFVGAIPGLTATMAVALIIPVT
                     YYMKPIAGLAMVLGVSFTAIFAGDIPATFLRIPGTPASGAAILDGFELSKKGKGSLAL
                     MLDLFCSALGGLIGVIILITVSPPLAKFALKFTHFEYFWLGIFGLSMAAVLSRGNTVK
                     GLMSATLGLLISTIGIDVTTGYPRFTFGVTDLMDGVSFIPAMIGLFGLSEVFKRVTEK
                     SQLQLSAVSEVVKPNLKETFKHIWKHKFTLIRGALIGTFIGALPGAGADVAAWVSYGV
                     EKNVSKDEELGMGSVRGVIAPTSANNAAIGGTWIPALVFGLPGDSITAIVLGAMLMYG
                     LRPGPMIFTQSKDLVTQLFTVAVLIQILLLPIGWLGIKAFSLFVKLKTSLVMVAVTVF
                     CIIGSYALRNSVFDVYVMFVFGLIGYAFEKLRIPLAPMILGLILGRTVEDNLRVGLIK
                     TKGSFLPFLSRPISLMLFVMIVLVLIVPPLTKILSRKKV"
     gene            139841..141061
                     /locus_tag="AJ81_00745"
     CDS             139841..141061
                     /locus_tag="AJ81_00745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005471984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence damage-inducible protein A"
                     /protein_id="AJC72959.1"
                     /translation="MKTAAVLTIGSEIVEGIILNTNAQYICQRLAENGYRVNRVVSVD
                     DEEDSIKGEVQRLLASCDVLVLCGGLGPTEDDKTREAVAKALSRRLILDESIREKIHE
                     RVSRYYNNLPRNLDKQAFVIENAQIVPNPVGTAPGQLIDFEGKKIVLLPGPPQEMRPM
                     LDSVLEKLKTEQDFKTIKMLFFAVPESVLDQFMTDTSVKGCVKIATQASFSEGVWVRL
                     TAPLDCFAEAENLAQRLVEKFQRNFVGYGDTSVERALFEELEKRNLTFSVAESCTGGL
                     VSAKIVSVSGASRVFVGGVVAYDNSVKMRILNVREETLKRFGAVSEQCVVEMAHGIKE
                     LTRSDLAVSVSGIAGPTGGTQEKPVGTAYFCVTDGKRDSVEKIFYPQERNIFRSRIAT
                     HALYLLLIRLRGMI"
     gene            141091..143097
                     /locus_tag="AJ81_00750"
     CDS             141091..143097
                     /locus_tag="AJ81_00750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="AJC72960.1"
                     /translation="MNEQYLSIFIDESREYVQSLNESLLKLEKNPRDEETVNETFRIL
                     HTLKGMAGTMGFERMAKLTHRMEQLLDKVRSKKIALTSDLLDRLFAGVDMVDKMVNNI
                     ASGGNDQVNEEDLKSLMDAFEVVQEEKVEEQKVQSETKKESVDVEDSVMKVIQEASKE
                     GYSAFKVRVTLAEGTIMKAVRMYMVFKAIEDSGGQILSSVPPVEDIEQEKFDREVELV
                     VIAKQDAESLHKMIASISEIEKVTVMTIAKVQERLKEEEKEREVEKKEVHEEAKIAEE
                     KAQEQKISQKRRLVQTVRVDIDKLDTLMNLMGELVISRSRISDILRKYNIKEVDESLS
                     QLNRITLDLQNVVMKIRMVPIAFVFNRFPRMVRDLAKQLSKEINFVIEGEDTELDRTF
                     VEDIGEPLVHLLRNAIDHGIETKEERIAKGKPPVGTVVLSARHEGNNVVIEVKDDGRG
                     IDRATVLKKAIEKGLISEAQAENLSDEKVYEFLFLPGFSTRSNATELSGRGVGMDVVK
                     NVVESLNGTVKIESVKDRGTTVTIRLPLTLAIIQALLVTVNKHVYAIPIANIDSTLNV
                     PANKIQKLQDKLVTVIRGEIVPLVKLWEVFGLNGHKEEQYYNTVIVRMGNRKYGLVVD
                     SLIGQEDIVIKSLGKIFNDVRIFSGGAILGDGSIALILDVSNIV"
     gene            143109..143546
                     /locus_tag="AJ81_00755"
     CDS             143109..143546
                     /locus_tag="AJ81_00755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005470736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="AJC72961.1"
                     /translation="MAELSEFEVFVFGVGGQEMAFDVEHVSIVIEKTDITPVPRAKKN
                     VLGVMNLRGRIVPVIDLASMLGLSCKDSAEGKIVVVNYEDIETGFLVEKVRGVMRVKS
                     EDVEKMHKFDSFGEKSKGIIKKQEELIIHLSVGKILEELTMSS"
     gene            143571..143930
                     /locus_tag="AJ81_00760"
     CDS             143571..143930
                     /locus_tag="AJ81_00760"
                     /inference="EXISTENCE: similar to AA
                     sequence:GenBank:EIJ79593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="AJC72962.1"
                     /translation="MAKRVLIVDDAAFMRMLLKDIITKAGYEVAGEAANGVEAVEKYK
                     ELKPDVVTMDITMPEMDGITAIKKIREIDPNAKIIVCSAMGQQAMVIEAIQAGAKDFI
                     VKPFQHSRVIEALQKLS"
     gene            143944..144279
                     /locus_tag="AJ81_00765"
     CDS             143944..144279
                     /locus_tag="AJ81_00765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliZ"
                     /protein_id="AJC72963.1"
                     /translation="MSKLIVQFLLALGILIGLLYVMYIFVRKRVPFVASRDVQVLQRH
                     YIDRNTSIVLVKVLDEYYYLLLSHSSSSVLKKLSEQEVAHLEVREPFSKILFKRLSKM
                     RGQDKEEKE"
     gene            144276..145031
                     /locus_tag="AJ81_00770"
     CDS             144276..145031
                     /locus_tag="AJ81_00770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005470738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="AJC72964.1"
                     /translation="MKKRWLVLALLLLVSLSFAQEEVPFPSISIRVNPPQNQRDLVVT
                     LEILLILTVLTLAPSILVLFTSFTRIIVVFSFLRNALGTRQTPPNQVLVGLALFLTFF
                     IMQPVWNDIYNDALTPYLNGKIGYQEMFDRTMNRVRQFMINELKNHHNEDNVFLLASS
                     VGSKFDKVEDAPNSVIIPAFVLGELEIGFKMGILLYVPFIVIDMVVASVLLSMGMIMI
                     PPVLVSLPFKVLLFIAVNGWDLLVSGLIKSFAR"
     gene            145037..145303
                     /locus_tag="AJ81_00775"
     CDS             145037..145303
                     /locus_tag="AJ81_00775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliQ"
                     /protein_id="AJC72965.1"
                     /translation="MTVDVFVDVMKEGIELILILITPPLLVSLIAGLIIGVLQAATQI
                     HEQTLTFAPKIILTFLTIMLLGSWMLQKLVEYMQQILEKFMGMI"
     gene            145305..146072
                     /locus_tag="AJ81_00780"
     CDS             145305..146072
                     /locus_tag="AJ81_00780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliR"
                     /protein_id="AJC72966.1"
                     /translation="MNLYEFVQEKFLVWALALTRIAGMFTVAPFFGDWFLPLQAKVSL
                     TVLLSWLISPILQQSIPLDTPVLTLVLSMLNNYLYGLVIGFLALLPLAGLSLAGEVFG
                     TQMGFAMSSLFDPQREEVPLHGELLYTIGLFVLVTIKGHLLVYQAIVDSFKHFSLTAS
                     LSGLSFMDVLIDKASESLVVALKFGMPLIGFMLIVSVALGILSRLVPQMNVFMVGLPL
                     KVLVGMLLMAGMIGVWAQMSASLAEKTVNFIEFFLSR"
     gene            146183..147127
                     /locus_tag="AJ81_00785"
     CDS             146183..147127
                     /locus_tag="AJ81_00785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FlhB"
                     /protein_id="AJC72967.1"
                     /translation="MALSFFAAAIILRLILPQLSRSLANTSTFFLALDPMDSETLLSH
                     IFQLFKDPLILLILLMGLVALVGIIAGALQTKFLFSFKPLKLDLNRINPIEGLKRMFS
                     LRNLFELFKAFVKLVIVGYVSYVVIRQRYRELPNLTDLEPSESIRYLADLIYALLLRC
                     AIAILALALLDYLFQRWEFEKSLRMTRQELKEEFKEVEGNPEVKRRQREIMMRLARGR
                     MLQKVPEADVVITNPTHIAVALQYDSEQMEAPEVVAKGADELARRIVEIATNNNVPIV
                     RNPQVAWELYRTCEVGDQIPPTLYRAVAEILAYVYSLR"
     gene            147165..149210
                     /gene="flhA"
                     /locus_tag="AJ81_00790"
     CDS             147165..149210
                     /gene="flhA"
                     /locus_tag="AJ81_00790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005096455.1"
                     /note="membrane protein involved in the flagellar export
                     apparatus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="AJC72968.1"
                     /translation="MKGLDVFVAVAVVAIVLLMIIPIPDFALDFFQLLNIALSMIVLL
                     SSMYVRHALDMSSFPTLLLIITLFRLALNVASTRLILLEGEKFGGRVIRTFGEFVVKG
                     DYIVGLVIFLILVIIQFIVITRGAERIAEVAARFTLDAMPGKQMSVDADLNAGLITEE
                     EARKRRELIRREADFYGAMDGASKFVRGDAIASIIIVLVNIIGGILIGVLKHNLSFAQ
                     AAQVYALLTVGDGLVTQIPALLVSTATGILVSRAAAKENLGQDLVKELSSERKVITIT
                     GFILLFLGLATPLPITASIIGAAFLALAFYSSRVAPKQVAPAPAGAPAAPAPSKPILT
                     TPQEIAEVIQSDTVEVEIGYGLIPLADPSQGGDLLERIAMVRKQIAYDLGLVVSPIRV
                     RDSVLLKPNEYLIRIRGAEVARYELIPNRLLAINPGTATEKVTGIAVKEPAFGLQAFW
                     IDSSRKEEATRLGYTVVDPPTVFITHLTETLKRNAADLLGSREFNMLLDGLREKFPQL
                     VNDLIPSILKATDVKKILQRLLNEGVSIRNLPLIFETLLEYAEKSTDLVYLTEQVRRA
                     LKRQIVQSLTSEDGKLHAVALDGELEKRLVESLQDVAGEKRIVLNPQILREIMENLSK
                     QLETLMKKRFFPLVVCSGAIRPYLAQLVKRFLPNVPVIAYEEVPEDRVLQVEGVVRL"
     gene            149207..150316
                     /locus_tag="AJ81_00795"
     CDS             149207..150316
                     /locus_tag="AJ81_00795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis regulator FlhF"
                     /protein_id="AJC72969.1"
                     /translation="MKMKKYIVNDIKEALEQIKKDLGEDAIILSTRSVKKGGFLGIGA
                     KRYLEVTAVCEDKEQEKTESSEVYKLQELLVKNREKRQEEEIRELKQMLQEMKQMLGM
                     QRLSDLPQNLQRILKGLQAQEVDQTIAGKIVEYLRISYGDVSLDDSLRRSLAEHLLAF
                     VKTEVPALEGTVLFSGPTGVGKTTTLAKLAARLKIVEKKQLAILTLDTYRIAATDQLK
                     TYATIMDIPMRVAYTPKEAKMELDAMKSFDVVLIDTAGRSQNNDMQMSELKALFEVIQ
                     PNLAFLVISMNSRFSDLKDVLERFQVARHTHLILTKMDETRTFGHLINAPLIGGIPVA
                     FITNGQRVPEDIVEANAKDIAHLLSREVLRIAQSS"
     gene            150300..151130
                     /locus_tag="AJ81_00800"
     CDS             150300..151130
                     /locus_tag="AJ81_00800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="AJC72970.1"
                     /translation="MPNQAEGLYGSRARMVSVASGKGGVGKTLVAVNLSVVLQERGHR
                     VLLFDTDAGFANAEILMGVTPKFTLKDFLKKKVGIEEVIFRTPYGVDLISTGMDVEDL
                     ITFNVEDKGRVVNELRKIGEDYDYIIFDFPPGFNEQLERFYLSSDHVLVLTATEPTAL
                     VNAYTFVKILVLKGLEPVSFHVVMNMVKDLREGRKVVEKFSSVVSKFVGVNFDSTHLM
                     KFEPLVRESVARQIPFVVLKKTSQPSLAIHGIADRITNKIVAKKLSFIERVKLLFGMG
                     "
     gene            151137..151820
                     /locus_tag="AJ81_00805"
     CDS             151137..151820
                     /locus_tag="AJ81_00805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus biosynthesis protein PilZ"
                     /protein_id="AJC72971.1"
                     /translation="MAEYVVKVNAKDVIKPGMPLAIDFEDKKGEKLKLKSSVHDTYFD
                     RGILKIAMPSYQGRFLPLPRGEFIRVTVIADKVVYAFSSRVLDYGRDQESNLLIMYIT
                     VPEQVNRVQRRRYVRIPLVLSGSFTIENEEGKYSFLTRDFSAGGMLMCTSKFLKVGQI
                     IYVELDLTDLRLSNQRSQIVRYAGLNQTTGFHEYGVQFLDVPAELEKALVSYVFQQEI
                     KLRKLREEV"
     gene            151822..152427
                     /locus_tag="AJ81_00810"
     CDS             151822..152427
                     /locus_tag="AJ81_00810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="AJC72972.1"
                     /translation="MILSEKELDLLKEIGNIGTGNAATALSQLTNKKVEITVPKAEVV
                     PISKIPFIFPEPEDLVVGVRMSVHGDINFDVLLVLNRLAAKRILQDLLGSPCEDVTQL
                     DELSQSALKEVGNIMCGSYITALAEFTGLYLDPLPPDLIVDMLAAIISEALLPTASYE
                     DSAIYVETELSIEGLQTITSYMLLIPGENSLEIVFKKVGLR"
     gene            152424..152906
                     /locus_tag="AJ81_00815"
     CDS             152424..152906
                     /locus_tag="AJ81_00815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_07739414.1"
                     /note="catalyzes the conversion of glutamine residues to
                     glutamate on methyl-accepting chemotaxis receptors;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheD"
                     /protein_id="AJC72973.1"
                     /translation="MNKKVVIGIGELAVERNPAVIITLGLGSCVGVCMRDPVAKVGGM
                     AHVMLPDSGGRDVQLPGKYADTAIAALIEGLLSLGGSKSRLEAKIAGGASMFETSGMN
                     VGARNVEAVRYWLKYHQVPLKAEDVGGNRARSIEYNIETGKLLVRKVGGGETIQVLEI
                     "
     gene            152922..153632
                     /locus_tag="AJ81_00820"
     CDS             152922..153632
                     /locus_tag="AJ81_00820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005096461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-28"
                     /protein_id="AJC72974.1"
                     /translation="MYDMDEEQIVKELLPTVKRIANDLVQHLPKNVEVEDLIQEGVLA
                     LISAVRRYDPRRGVNLKTFLIKRIKGAMYDYLRNIDWMPRNLRKNIKEVEKAIYELES
                     KLGRHPTNEEISLYTNLSNEEVMRAKNEMVRKQFLRLDEYLYDTYDSYGLDVEDSMEP
                     LQVAYREILLEQVTEAIKQLSEREQLVLSLRFEQELSLKEIGLILGVSESRVSQILSS
                     ALIKIKKHVLGEEDGKSS"
     gene            153616..153918
                     /locus_tag="AJ81_00825"
     CDS             153616..153918
                     /locus_tag="AJ81_00825"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74623.1"
                     /translation="MVNPVDLQTMIVRGVDVSSSASQQVNAQIALAQMTNAQMIQKSA
                     QHSRMVNPREAVEQKMVGSSTEERSSSSFYRPSSRRNVPVNEAHESEKGTILDVRL"
     gene            153915..154403
                     /locus_tag="AJ81_00830"
     CDS             153915..154403
                     /locus_tag="AJ81_00830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC72975.1"
                     /translation="MKIGYVSVRKIDEKYVGAVLIVDEFGIPQEFKYTEPVSPTPLQK
                     ILYGKSLDLYLTVEIIAKSLLKNVEQKPEIFLTDNVSLVESSDQVYYVSSYPATKSEQ
                     DHDSEPNECVISSQTESLKFIAKSNFSQDKVEKLKKIVEEFDVMEPFQRLAKALEFVC
                     RS"
     gene            154391..155071
                     /locus_tag="AJ81_00835"
     CDS             154391..155071
                     /locus_tag="AJ81_00835"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74624.1"
                     /translation="MSFLKQIVDTLKLELGFIKVHALDPSLPSLNVKEERSMVKPRLS
                     SATLSCELKRLSLHTSARVLSHLIESSSVKMVDQTLKVKEPLMERMKFEETSSKVHST
                     VLKVTPSLKKVVLELALDLRKSLFRVNVRSRNVPLLRTVRFKPSSMSEEQRNRVLKAI
                     QTFLAQEKIDSFKFVGFYRNVPSDCAKKMIVLDRQLIVELKEGAKGMKKDLAVLLTEE
                     GYVFLSVP"
     gene            complement(155060..157816)
                     /locus_tag="AJ81_00840"
     CDS             complement(155060..157816)
                     /locus_tag="AJ81_00840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="AJC72976.1"
                     /translation="MLLIVPTEKEASQIASTLNARYFPGPDVFPFEEVPVSFFVRKGR
                     IETLWSLLNKECKLVVTSVHSASRYTMSVESLKSLSMRFKRNERFVDADWLQRLGYER
                     AYLVRSGGEFAIRGDIIDVFPPVYERPVRIELFGNSIEDIRSFDVISQTSVEKLEEFV
                     LLPAREYACESHDYDTIVGKAGSNGTIFDYADFEILLVDADRCFEEFAKLERQIREFL
                     SDEQYEEYRKYSRLNLAELQRRLQVAKEVQLDLQGLEYSEKKGSLLQVPIIDEEELNV
                     GDFVVHENYGVGVFEAVKPVTNALGTKEYIVIRYEDATIYVPVERLDKIHKYIGDPDV
                     KIDRLHGGTWKRRLDKVKEDLRRKIAELVDIYMRRQEAKGLGLVGDFDLERRFAETFP
                     YVETHDQSVAIQDVLEDLASDRPMDRLLCGDAGYGKTEVALRAAFRCVVSGKQVALLV
                     PTTVLAKQHYRIFKQRMEPFGVSVALLDRSVPKSERNKIVEDLRAGKIDVLIGTSALL
                     SDNVKFSDLGLVIIDEEQNFGVEQKESFKKIRLNVNVLSMSATPIPRTLHMAMNGMRD
                     MSVLTTPPLGRLPVVTYVARYDDRLVRGAILREINRGGQVIYVHNRVEDLREVYEKIC
                     RLVPEARIVMAHGQMPTRKLMEAVRSFYERNSDVIVCTSIMQNGIDVPSANTIIVDDA
                     HRYGLAQLYQLRGRVGRSDKRAFAYFLFDSELNLSALKRLQVIREFSGPGSGLKIALK
                     DMEIRGIGTIFGFEQHGNVNAVGLNMYLQILNEELKHTMHAEPLERVDVEIEGVPGSF
                     YIPEDFIENEMERLRTYRRMASCESLKSLDELKAELRDRFGELPEQVEQLIDLFKIRL
                     VAIQKKIKKIAFDETTLKVYTENGSLKLPGKFIYNEKEKVYLLYNVPAERCLLLLKKI
                     FLRD"
     gene            complement(157854..158834)
                     /locus_tag="AJ81_00845"
     CDS             complement(157854..158834)
                     /locus_tag="AJ81_00845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ExsB family protein"
                     /protein_id="AJC72977.1"
                     /translation="MRFAAESELQETAHRLIQEIRSVVWDKNVIVAFSGGEDSSLAAF
                     LCKLALGPERVILSTVDWGQFTYRTIKENVAASALRLGLRHIVLDGTERQRKVWRYGP
                     NCNECTRFAKLLTIRTTFPDSVIVTGSNQFDSWGRIGPKVHDNFYSPLKELTKDSIRQ
                     LLKLFQIQPVKVGESSIREGCKLKHLMKMLINPAYHGRAVAEANEVLLEFLQRNNKNA
                     QLANVKIIGPLSKNVALVNVHPQLSDEEKQELLSLLKNVDTIDEAYILDKPVRLKILA
                     NPGLYNDPSAREDVFRGFIERDFAVSVTPVWIKARNNRLRTFHVVDFEYE"
     gene            complement(158786..159268)
                     /locus_tag="AJ81_00850"
     CDS             complement(158786..159268)
                     /locus_tag="AJ81_00850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="AJC72978.1"
                     /translation="MKLLLVSDTHVPVYLKCLPAGLIELAKQVDIVVGLGDYVDLNTV
                     LELKSASRNLYAVHGNMDEVDVKDTLPQVLTVHIGGLNVGLCHGWGPPQQIRERILKL
                     FEEKPHVIFYGHTHFPDDSQLEGTRFINPGSFGENGSVAIVEICDSQLKVNFKKLPIV
                     "
     gene            complement(159265..160209)
                     /locus_tag="AJ81_00855"
     CDS             complement(159265..160209)
                     /locus_tag="AJ81_00855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase"
                     /protein_id="AJC72979.1"
                     /translation="MNIVGVDLGGTNYAVGLVDENGKILARIDGETKVHEGPDAVVER
                     LASSIMSLSEGKSVLAVGIGSPGSIDHLTGTVKFSPNFPGWTDFPLGEKIEKLTSLKV
                     FVENDANAYALGERTFGVAKGLDHVVCLTLGTGIGGGVITHGVLLRGSTGIGAELGHM
                     NVMPNGPKCGCGARGCLEALASATAIKNFVKDGFERHKDSSLFRNKSAEAVTPKDVFD
                     HAKKGDQFALEIFNIVVDALAAAVGSLINIFNPQIVVLGGGMANAGEFLLAPIEERVK
                     NYVLPTMLGTYRIALSRLGKDAGILGAASIVYERLGKK"
     gene            complement(160229..161494)
                     /locus_tag="AJ81_00860"
     CDS             complement(160229..161494)
                     /locus_tag="AJ81_00860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002941556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="AJC72980.1"
                     /translation="MTVKINDLEQMTIKQLYELAKQYDIPRYTSMRKRDIIFAILEAQ
                     AKSHGLIFGEGVLEILPDGYGFLRSSDNLLPGNNDIYISQSQIKKFNLNTGDIISGVI
                     RPPKEGERYFAMIKIEAVNYKSPELSNERVNFENLTPDYPKERFILETSRDVLSTRLI
                     DLFAPMGKGQRGLIVAPPKAGKTTLLKEIANGIAINHPDTIRIVLLIDERPEEVTDIK
                     ESVNAKVIAAPFDMAPDKQIKVAELTLEMSKRLVEYGYDVVILLDSLTRLARVYNIQV
                     PPSGKLLSGGVDPAALYKPKHFFGAARNTREGGSLTIIATALIETGSKMDEVIFEEFK
                     GTGNMELVLSRQLANKRIFPAINLQLSGTRKEELLLNEDTLKKVWILRRMLSGMTEEE
                     GLTLILKKLQETETNEDFLALIDQQKVKY"
     gene            complement(161717..162106)
                     /locus_tag="AJ81_00865"
     CDS             complement(161717..162106)
                     /locus_tag="AJ81_00865"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9X1I1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="AJC72981.1"
                     /translation="MRHRMVRSKVGSYGSHSRALIKNQLRELVEHRSIVTTVAKAKVV
                     KRFFDKLMVKAVKASKSNDRAESVALRRQINRYLCDRKLTNKLVDEIAKNIGDRNSGF
                     SRIVRIGQRRGDGAEMVLLQIVEKTNE"
     gene            complement(162111..163112)
                     /locus_tag="AJ81_00870"
     CDS             complement(162111..163112)
                     /locus_tag="AJ81_00870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="AJC72982.1"
                     /translation="MEFMIPKRLKVEEERSEADCYYARYVFSPLEKGYGITIGNALRR
                     VLLSSIPSIAIVGLRFIKPERYHEFDTLPGVKEDILEIILNLKKVQLRAEVPVRERIK
                     IMVEKKGPGLLLAGDIKTPAGIEVVNPGLKIATLDEEADLLFELYVQAGKGFVPAQDI
                     EEHPEIGSIPIDGVFSPVLRVNFKVESARVAKRTDYDKLVLEVWTKKSIFPHEALKRA
                     IDTLMNHFKVIDESLPSTMAPLSAEFVTVTAQEETVAEQMPHVEEESIYSKKIDELEL
                     SIRSLNCLRRDKIETIGDLLKRTEEDLLKIKNFGPKSLEEVKQKLMEKFGLTIRKGG"
     gene            complement(163118..163747)
                     /locus_tag="AJ81_00875"
     CDS             complement(163118..163747)
                     /locus_tag="AJ81_00875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="AJC72983.1"
                     /translation="MARYTGPVCRLCRREGMKLYLKGERCFTEKCAFDRRPFAPGDHG
                     RSRGKTSQYAFQLRSKQVMKRIYGILERQFRRYFDRALRMTGDTRENLVRLVESRLDN
                     VVFRMGFAINRRQARQLVTHGHFLVNGKRVNIPSYLLKPGDIVEVKESSRSIEVIKRS
                     VELAKGRTIAPWIQVDFDAYRGTFERAPKLEELTDLPVDVQAIVELYSR"
     gene            complement(163763..164149)
                     /locus_tag="AJ81_00880"
     CDS             complement(163763..164149)
                     /locus_tag="AJ81_00880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="AJC72984.1"
                     /translation="MARRSESKKRRKVLIDRAIVHIKSTFNNTIVTLTDQDGAVLTWA
                     SGGTVGFEGTRKGTPYAAQLAADKVAKEALRMGIKRVDVLVKGPGPGREAAIRTLQAA
                     GLEVDSIKDVTPIPFNGCRPKKKRRV"
     gene            complement(164169..164555)
                     /locus_tag="AJ81_00885"
     CDS             complement(164169..164555)
                     /locus_tag="AJ81_00885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="AJC72985.1"
                     /translation="MARIMGVELPANKKCFVALTYIYGIGKTRAMEILKNTGVNMDKR
                     VKDLTDEEVNRITKYIQDHFKVEGELRAEVNRNIKRLIDIGCYRGIRHKLGLPVRGQS
                     TRHNARTRKGPRPSRIKTKKKKEQAV"
     gene            complement(164706..164948)
                     /locus_tag="AJ81_00890"
     CDS             complement(164706..164948)
                     /locus_tag="AJ81_00890"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A9BFZ5.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="AJC72986.1"
                     /translation="MPKEDVIKMEGTIVEARRNATFLVELDNGHKVLAQISGRMRKNF
                     IKLLPGDRVVVELSIYDLTKGRIVYRKKLDKKSDVD"
     gene            complement(164953..165708)
                     /locus_tag="AJ81_00895"
     CDS             complement(164953..165708)
                     /locus_tag="AJ81_00895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="AJC72987.1"
                     /translation="MIRVKSPQEIERMRIACRSVAVVLKEIEAIVVEGATAADVEHFV
                     EKRFKELKVKPAFKGYKGYKYATCVSVNEEILHGAPLKKKVFKKGDIVSVDVGAIYEG
                     YYGDGATTYCVGEVDEIAKKLVDATRLALENAIRFAKKGYKVGDISYAIQSAVEAAGF
                     NVIRDYVGHGVGRQLHEEPEIPNYGRPGTGVSLIPGMTLAIEVMACEGDWKTMLLDDG
                     WTVIMADRKRSAHFEHTVLVQEDGAEVLTVDKE"
     gene            complement(165705..166358)
                     /locus_tag="AJ81_00900"
     CDS             complement(165705..166358)
                     /locus_tag="AJ81_00900"
                     /EC_number="2.7.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470230.1"
                     /note="essential enzyme that recycles AMP in active cells;
                     converts ATP and AMP to two molecules of ADP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="AJC72988.1"
                     /translation="MRIVLLGAPGAGKGTLAKDLVGLFNVPHISTGDMFREAVASGSE
                     LGKQVQHILSSGALVPDEIVNKLVRERISRPDCKDGFILDGYPRTVQQASALDEMLKE
                     TGQKLDAVLYLRVSEDVVVKRLTNRRVCPKCGRIYNLLSMPPKNDELCDDCGIRLVQR
                     DDDKEEVVRNRFKVYNEMTAPLIDYYKKKGTLVEVDAEADHQNTVQKAVEALKKVIA"
     gene            complement(166360..167640)
                     /gene="secY"
                     /locus_tag="AJ81_00905"
     CDS             complement(166360..167640)
                     /gene="secY"
                     /locus_tag="AJ81_00905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470229.1"
                     /note="forms heterotrimeric complex in the membrane; in
                     bacteria the complex consists of SecY which forms the
                     channel pore and SecE and SecG; the SecG subunit is not
                     essential; in bacteria translocation is driven via the
                     SecA ATPase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="AJC72989.1"
                     /translation="MWKALRNAFKIPELRDRIVFTVLTLIVFRLGVYIPVPGINIQAW
                     AEAFKRFAGAAAGGIISFYDVFTGGALENFSIFAMSVTPYINASIVLQLLSSVITKLR
                     EMLREGEEGRKKFAKYTRNLTIVLGAFQSFIVSFSLVRQSPDIVAYGLNPMVFVLIST
                     ISMLAGTMFLLWLGDRITEKGIGNGISILIFAGIVARYPSYFGSVLLGNLNLFGWIFL
                     IAIAVVTVAGIIYVQQAERRITIQYATRVVGRRVYGGASTYIPIKVNQGGVIPIIFAS
                     AIVMIPAAIAEMTGLQWLRAIFSPGNALYIILYGLLVFFFTYFYSVVVFDPHEVSENV
                     RKYGGFIPGIRPGKPTEEYIQRVLSRVTFLGAVFLVVIALLPHFVEAVTRVNIVIGGT
                     STLIAVGVALDVLQQMEAHMIMRHYEGFVKKGLK"
     gene            complement(167642..168085)
                     /locus_tag="AJ81_00910"
     CDS             complement(167642..168085)
                     /locus_tag="AJ81_00910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002534554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="AJC72990.1"
                     /translation="MRLEDLKPTPGSVKEPKRVGRGIGSGLGKTSGKGHKGQKSRGTG
                     KVHPWHEGGQTPLHRRLPKVGFKSFVHKDYAIVNLRTLEERFESGEEVTPEKLIKLGI
                     VKKLKDGVKILGDGELTKPLIVKAHAFSETAKKAIETVGGRAEVI"
     gene            complement(168095..168286)
                     /locus_tag="AJ81_00915"
     CDS             complement(168095..168286)
                     /locus_tag="AJ81_00915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="AJC72991.1"
                     /translation="MAKIIVELVKSPIGYKYDQRATLKALGLKKLHDRVVKPKTPQIL
                     GMIEKVRHLVKVEDVSEEE"
     gene            complement(168290..168826)
                     /locus_tag="AJ81_00920"
     CDS             complement(168290..168826)
                     /locus_tag="AJ81_00920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="AJC72992.1"
                     /translation="MDEILEEEVIKRESEEFEERIVEIRRTAKVTKGGKTLSFRVLAV
                     VGNRKGKVGVGIGKAREVPDAIRKALSAARAALIDVPLYRGTIPHEVTAKQDASVVLL
                     KPAAPGTGIIAGSVVRAVVELAGVQNVLTKSLGSTNPVNLALATLKALKGLVPPDKAA
                     RLRDLSVGQVIRGAKKGA"
     gene            complement(168847..169215)
                     /locus_tag="AJ81_00925"
     CDS             complement(168847..169215)
                     /locus_tag="AJ81_00925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="AJC72993.1"
                     /translation="MIKKEDRNLKRIKRHLRIRKKVKGTPEKPRLAVFRSEKHIYAQI
                     IDDTKGHTLVSASTLDKELRQRLSKTYNTEAAREVGKLIAQRALSLGIKTVVFDRGGF
                     KYHGRIKALADAAREAGLQF"
     gene            complement(169230..169784)
                     /locus_tag="AJ81_00930"
     CDS             complement(169230..169784)
                     /locus_tag="AJ81_00930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="AJC72994.1"
                     /translation="MSKLGKKPIVIPTGVDVKLESDTITVKGPKGTLSQKLSPYVKIE
                     IEDGKIWVRQNEERMIRKSFRRILRMFQGTYWSLIRNMIHGVTKGFEKQLEIVGIGYR
                     AQAQGNKLTLQVGYTHPVVLEAPAGVSVETPSPNLIVVRGADKQKVGQFAANIRSYRE
                     VNVYTGKGIKYRDEVVRRKEGKKA"
     gene            complement(169797..170201)
                     /locus_tag="AJ81_00935"
     CDS             complement(169797..170201)
                     /locus_tag="AJ81_00935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="AJC72995.1"
                     /translation="MWSDPIADMLTRIRNANVAFKEYVDVPASNMKRAICEILKREGF
                     IQDYKYIEDGKQGILRIHMKYKGLRRNRERVIHGIVRVSKPGRRVYVTKDELPKVKNG
                     LGIAILTTSKGIVTDKEARELGVGGEVIAYIW"
     gene            complement(170217..170402)
                     /gene="rpsN"
                     /locus_tag="AJ81_00940"
     CDS             complement(170217..170402)
                     /gene="rpsN"
                     /locus_tag="AJ81_00940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470222.1"
                     /note="located in the peptidyl transferase center and
                     involved in assembly of 30S ribosome subunit; similar to
                     what is observed with proteins L31 and L33, some proteins
                     in this family contain CXXC motifs that are involved in
                     zinc binding; if two copies are present in a genome, then
                     the duplicated copy appears to have lost the zinc-binding
                     motif and is instead regulated by zinc; the proteins in
                     this group appear to contain the zinc-binding motif;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="AJC72996.1"
                     /translation="MPRKGLIERWKRPKKFKVREYTRCVMCGRAKSVYREFGLCRVCF
                     RKMALEGKLPGVRKASW"
     gene            complement(170417..170965)
                     /locus_tag="AJ81_00945"
     CDS             complement(170417..170965)
                     /locus_tag="AJ81_00945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="AJC72997.1"
                     /translation="MAQYVPLKEKYEKEIVPIMMKEFGYKNIHQVPKLEKIVINMGIG
                     EGARNADLLTKHSNELAAITGQRPVITKAKKSISNFKIRKGMNVGLKVTLRGLRMWNF
                     LYKLANIALPKVRDFRGLNPDSFDGRGNYSFGLSEQFVFPEITPDQATRVQGMDIIIV
                     TTAKNDREAKRLLELLGLPFRK"
     gene            complement(170980..171297)
                     /locus_tag="AJ81_00950"
     CDS             complement(170980..171297)
                     /locus_tag="AJ81_00950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="AJC72998.1"
                     /translation="MRIKRDDLVQVISGKDKGKRGKVLKVIPKEDKVVVQGVNMVKRH
                     QRPIPQLREGGIIEREAPIYACKVMVVCPSCDKPTRVGMKFLEDGTKVRFCKKCGEII
                     DKA"
     gene            complement(171310..171678)
                     /locus_tag="AJ81_00955"
     CDS             complement(171310..171678)
                     /locus_tag="AJ81_00955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="AJC72999.1"
                     /translation="MIQTESYLNVADNSGAKVLRVIRVLGGHHKKYGRVGDIVVCSVR
                     DVIPNTGIKKGEVVKAVIVRTRKPIRRPDGTYIRFDDNAAVVLDKFNEPRGTRVFGPV
                     AREIREKGYMKIVSLAPEVL"
     gene            complement(171675..171962)
                     /locus_tag="AJ81_00960"
     CDS             complement(171675..171962)
                     /locus_tag="AJ81_00960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006345646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="AJC73000.1"
                     /translation="MPRRRLVGVVVSDKMDKTVVVSVARWLEHPVYKKHIKRSKKYHA
                     HDEHNECKVGDVVVIEETRPLSRTKRWRVVEILQRAYQAENIPAVEESEEA"
     gene            complement(171969..172169)
                     /locus_tag="AJ81_00965"
     CDS             complement(171969..172169)
                     /locus_tag="AJ81_00965"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P38514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="AJC73001.1"
                     /translation="MKVTELRNYTDDELKKLLEEKKRQLMELRFQHALGQLRNTSLIE
                     ETKRDIARVKTILRERELGIRR"
     gene            complement(172166..172594)
                     /locus_tag="AJ81_00970"
     CDS             complement(172166..172594)
                     /locus_tag="AJ81_00970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="AJC73002.1"
                     /translation="MLMPKRVKYRKQQRGRLKGEAKGGTTVAFGEWGLKALAPYWITA
                     QQIEAGRIAIMRVLKKGGKLWIRVFPDKPYTKKPAESRMGKGKGNVEGWVCPVKPGKI
                     IYEIAGVDEETAKEALEYAASKLPIPTKIVSRSSFGGEAV"
     gene            complement(172613..173242)
                     /locus_tag="AJ81_00975"
     CDS             complement(172613..173242)
                     /locus_tag="AJ81_00975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="AJC73003.1"
                     /translation="MGQKVHPRGFRLGVTSEWQARWFNEKNYGPWLKEDEEIRKLVKS
                     MYSQAGISEVFIERPDNETVTVIVKTARPGVIIGKKGAEIGKLREELEKRLNRRVLVN
                     VEEVKTPELDAQLVAESIATRIEKRASYKRAMKRAISDAIRKGAVGIKTMVSGRLAGA
                     EIARREWYLRGRLPLQKVRAVIDYGTAKAETKYGTIGVKVWIYKGDAQI"
     gene            complement(173247..173669)
                     /locus_tag="AJ81_00980"
                     /note="50S ribosomal protein L22; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(173684..173971)
                     /locus_tag="AJ81_00985"
     CDS             complement(173684..173971)
                     /locus_tag="AJ81_00985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="AJC73004.1"
                     /translation="MSRSKKKGPYVDPKLLKKIRMLNETGEKKIIKTWSRASTIVPEM
                     VGHTIAVHNGLKHIPIYITENMVGHRLGEFALTRRFGGHADKKAASKGQVK"
     gene            complement(173985..174812)
                     /gene="rplB"
                     /locus_tag="AJ81_00990"
     CDS             complement(173985..174812)
                     /gene="rplB"
                     /locus_tag="AJ81_00990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470212.1"
                     /note="one of the primary rRNA-binding proteins; required
                     for association of the 30S and 50S subunits to form the
                     70S ribosome, for tRNA binding and peptide bond formation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="AJC73005.1"
                     /translation="MGLKKFKPITPGRRFMVIPDFSEITKEEPEKSLLVPIKKTGGRN
                     HYGRTTVRFRGGGHKRRYRIIDFKRDKIGIPAKVVSIEYDPNRTARIALLVYADGEKR
                     YILAPNGLQVGDTLMAGPEAEIKVGNALPLEKIPLGTMIHNVEIRPGSGGKIARSAGV
                     ACQLMAKEGDYALLRMPSGELRKIHIKCYATIGVVGNEDHKNEVDGKAGRVRWKGRRP
                     HVRGMVMNPVDHPMGGGEGRGKGQHPVTPWGVPCKGYKTRRGRRPSDRFIVRRRNEV"
     gene            complement(174826..175128)
                     /locus_tag="AJ81_00995"
     CDS             complement(174826..175128)
                     /locus_tag="AJ81_00995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="AJC73006.1"
                     /translation="MNQQKLTPYDVIVRPIVTEKSTAAREDRKYIFEVNLLANKHQVK
                     MAIEKLFNVKVEKVNVLLVKPKPKRRGLFEGKTRQWKKAIVTLKEGYTIKELEVQQ"
     gene            complement(175125..175799)
                     /locus_tag="AJ81_01000"
     CDS             complement(175125..175799)
                     /locus_tag="AJ81_01000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="AJC73007.1"
                     /translation="MAIVDLYNMKGQKIGEQELKDEIFNIEPNLDVMWRYVDYQLSRR
                     RAGTASTKTRAEVSGGGRKPWPQKHTGRARHGSIRSPIWRHGGVAHGPKPRDWSKKLP
                     KKMKRLAIKSALSQRFREGNLIVLDDMKFDEPKTKNMRQVLSDLQLTGKKVLFVLPWK
                     KTEYENVKLACRNISGVKAIIADNTGASQNGEVRVDGLNVYDILNHEKLVLTKDVVAK
                     IEEVLK"
     gene            complement(175821..176453)
                     /locus_tag="AJ81_01005"
     CDS             complement(175821..176453)
                     /locus_tag="AJ81_01005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="AJC73008.1"
                     /translation="MKMIIGRKMGMTQLFEGNEVVPVTVIKAGPCYVVQKKTPQVDGY
                     CAVQLGFEEIKKTNKPLEGHFKKANLKALRVLREMRLESEEELSKYEVGQTIKVDIFQ
                     PGELVDVVGWTKGRGFAGGVKRWGFSGGPKTHGSKFHRELGSLGQHTEPAKIFKGKKM
                     PGHYGNERVTIHNLEVVKLDVENNLIAVKGSVPGARGGLVLIRSPKKTRK"
     gene            complement(176474..176782)
                     /locus_tag="AJ81_01010"
     CDS             complement(176474..176782)
                     /locus_tag="AJ81_01010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="AJC73009.1"
                     /translation="MPGQKIRIKLKAYDHELLDESAKKIVEVAKSTNARISGPIPLPT
                     ERTLYVVLRSPHKHKDSREQFEKRVHKRLIDIIEPSPKTIDALMKINLPAGVDVEIKL
                     "
     gene            complement(176838..178037)
                     /gene="tuf"
                     /locus_tag="AJ81_01015"
     CDS             complement(176838..178037)
                     /gene="tuf"
                     /locus_tag="AJ81_01015"
                     /EC_number="3.6.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470207.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="AJC73010.1"
                     /translation="MAKEKFVRTKPHVNVGTIGHIDHGKTTLTAAITKYLSFKGLANY
                     VPFEQIDKAPEEKARGITINITHVEYQTEKRHYAHIDCPGHADYIKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHVLLARQVNVPYIVVFLNKVDAVDDPELIDLVEMEVRELLSK
                     YEFPGDEVPVIRGSALKALEANDPNDPAYKAIQELLDALDNYIPEPVRDVDKPFLMAI
                     EDVFSITGRGTVVTGRIERGRIRPGDEVEIVGLSYETRKTVVTSVEMFRKELEEGIAG
                     DNVGCLLRGIDKDEVERGQVLAAPGSITPHTTFKANVYVLKKEEGGRHTPFMKGYRPQ
                     FYIRTADVTGEILELGNNAEMVMPGDNAILTIKLIYPVAIEKGMRFAIREGGRTVGAG
                     VVAEIVE"
     gene            complement(178058..180142)
                     /gene="fusA"
                     /locus_tag="AJ81_01020"
     CDS             complement(178058..180142)
                     /gene="fusA"
                     /locus_tag="AJ81_01020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470206.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="AJC73011.1"
                     /translation="MLEVQALYVPLEKLRNIGIMAHIDAGKTTTSERILYYTGRKHML
                     GSVDEGTATLDWMEQEKERGITIQAAATTCFWKGHRINLIDTPGHVDFTIEVERSLMV
                     LDGAIAVFDATAGVEPQSETVWRQANKYGVPRLAFMNKMDKTGADFDMAIKTMIDKLH
                     AKPVAIQMPIGSEKDFAGVIDLLKMKAIYWISEDGSQYVEEEIPAHLVSEAEDRREEL
                     ISALAEEDEEILNLYLEDEDIPIEKLKAAIRRLTIENKIVPVLCGAAARNRGIQPLLD
                     AVIDYLPSPLDLPPLRAQTPDGEAVEIVPSEEAGFTALAFKIQVDPYVGKLTYLRVYS
                     GRLNKGSYVYNSTKNIKERVARLMFMHADKREEVEFARPGDIVAVVGLKNTTTGDTLC
                     DENRPVLIERFNFPEPVISVAIEAPTKEEEEKMVRAVTALSEEDPTLKVGVDKETGQI
                     ILSGMGELHLEIVTDRLKREFNVNVRVGRPQVSYRETITKAAVAEGKYIRQTGGRGQY
                     GHVVVRFEPIPYEKGKHFEFVNNIVGGTIPKEYIPAIEQGIREAMETGYVAGYPMIGV
                     RAVLVDGSYHEVDSSEIAFKIAASLAFKNAMKECEPVLLEPVMKLEIVTPEEYLGSII
                     ADLSSRRANIQGLETKGNTKIIRATAPMSELFGYATVLRSLSQGRAAYTAQFSHYQEI
                     PDRILERILKAV"
     gene            complement(180154..180621)
                     /locus_tag="AJ81_01025"
     CDS             complement(180154..180621)
                     /locus_tag="AJ81_01025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="AJC73012.1"
                     /translation="MRRRRAEVRKIAPDPVYGDVLVAKLINRIMWDGKKTVAQKIVYK
                     AFDYIREKTGKDPLEVFQKALDNVRPVLEVRPRRVGGATYQVPIEVQEPRKTSLALRW
                     IVNAARAKKGRPMYLKLAEELIASYQGTGAAVKKREDVHKMAEANRAFAHLRW"
     gene            complement(180640..181014)
                     /locus_tag="AJ81_01030"
     CDS             complement(180640..181014)
                     /locus_tag="AJ81_01030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="AJC73013.1"
                     /translation="MPTINQLIRFGRERKVEKSKAPALMGNPQKRGVCIRVTTMTPKK
                     PNSALRKIARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGIRYKIIRGTL
                     DAAGVENRRQSRSKYGAKRPKK"
     gene            complement(181171..181680)
                     /locus_tag="AJ81_01035"
     CDS             complement(181171..181680)
                     /locus_tag="AJ81_01035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobinamide adenolsyltransferase"
                     /protein_id="AJC73014.1"
                     /translation="MGYVHVYTGNGKGKTTAALGLVLRALGHKMKVYVAQFLKGMDYG
                     ELHSLQCFENVTLERFGRPKFIHGEPDEEDTKLAKQGLNRCREVVSSGEYDIVVMDEA
                     NVAVYLGLFNVQDLLDVVSNRHERTELIITGRYAPPELIDVADLVTEMVEVKHYYSRG
                     IQARKGIEY"
     gene            complement(181692..182978)
                     /locus_tag="AJ81_01040"
     CDS             complement(181692..182978)
                     /locus_tag="AJ81_01040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001411247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73015.1"
                     /translation="MRVLGVIVEYNPFHNGHLYHLTKAKELINPDYVVAVMSGSFCQR
                     GEPAIIDKFSRAEIALLNGVDVVLELPFIYAVQDAGGFARGAVWSLHNTGVVTDIVFG
                     SESADLSFLQTIAEVMVRQPDPFPELMREELKKGHSFPNARKYALMKYFEITKAMEPK
                     EVLKIEKSNDILGIEYIRSIMLLNSPIKPHVVRRVGAEDRDERFQGKFSSATAIRKCI
                     SNGEWDKISKALPTSSLRIISRELNEGRGPVFLQHMETMILSKLRLMDRSQLQRLHGF
                     DEGLDKRFVDCAVKTTNLEDFFSCVKSKRFTLSKIRRLCLYALFDITGEFVERSNSLG
                     PQYLRVLGFSSRGRELLSKMKRVSRVPIISLCSLYRKVLEQAMKKPERFQLDPQLFEQ
                     QLLYDIKATSLHALLFPKHSERIGDKDFKIPPIVIG"
     gene            complement(182975..183427)
                     /locus_tag="AJ81_01045"
     CDS             complement(182975..183427)
                     /locus_tag="AJ81_01045"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74625.1"
                     /translation="MKTVLYLALIIGVLWSTFGLVMLIGYSLLSYASPFLNDILNVTV
                     KSSRWFLAFALSFLASGMCICLYSLAKANGDNHVVFLSFAFSSSALSIAIQIYRMVVS
                     GFGWFAYDLLGSYGEIGLVKLVSVGLLALSLIFFSFQFSLIRMERYSS"
     gene            complement(183443..185116)
                     /locus_tag="AJ81_01050"
     CDS             complement(183443..185116)
                     /locus_tag="AJ81_01050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="AJC73016.1"
                     /translation="MDLRRKAELAPNKPGVYIFYGDKEYLYIGKAKDLRRRLMTYFSD
                     SSHRKNAKVQALMKEALELDYLVVSNEKEALLLEASLIFQHKPKYNVMLKESEYYPYV
                     EITKEDFPLVRIVRKRSLEGEYHGPYTNITLLRNLLDYLQQVYQFRTCERDLKRVKKP
                     CAEYHLHRCLAPCSSGIDPETYVNLSIEPLRRFLKGETRETFKLLEEKMKKHASMLDF
                     ENAAKYRDLLLNLQRLLENQGVVLEPWRNLDVIGNNGRCYVVLRVRGGNIVAKLNYSL
                     DSTRIENFLFHYYVVNRNELPELVLTRRPVKLKLQAQIRPPADETEAELLRKALENAQ
                     LSAQKLELSIKALEQLKELLKLQNVPRTIDGIDVAHLQGQLTVASLVVFKDGLPIKSL
                     YRHYKLQSVANDDPAAIREVVKRRYSKHQTPDLVFVDGGIAQVRAAFDGLREIKKECA
                     VVGLAKAEETVCTNEGEMSLPKDHPVIRLLVVIRDEAHRFANTFHQKLRDKYLLESII
                     ETIPMIGPKRRKKLLQKFSSLQQIREASIEELAKILGSERLAKLLVSKV"
     gene            185208..185684
                     /locus_tag="AJ81_01055"
     CDS             185208..185684
                     /locus_tag="AJ81_01055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004459772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoA"
                     /protein_id="AJC73017.1"
                     /translation="MRMNLNKKRGDGTMSLSDVPVGFEAKIISVPDDDVGSRLLSIGF
                     VPGNSVKVISCAPLGDPRVYMVMGKMVTLRNDEAKRIQVSMEDEIEQLSNVTEGSWRV
                     IHLVGGRNFRDKLRSMGIDIGSTVKVISKGVVETNRGVFRIGLGMARRIYLRRDDV"
     gene            185681..187612
                     /locus_tag="AJ81_01060"
     CDS             185681..187612
                     /locus_tag="AJ81_01060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002333887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoB"
                     /protein_id="AJC73018.1"
                     /translation="MTIRVALCGNPNVGKTSLFNALTGMRQYVANWPGVTVEVKEGVR
                     SWKGHQLIITDLPGTYSLFATSLDEKIARDFLLYNTPDVVVVVADALSMEQGLYLLLE
                     ILELEARAILVVNAIDEAKKKGLIIDKQELSKHLKVPVVLTSALTGEGIHELLDCIVS
                     TASTEQKKVLFNFSDETEKMIQQLATLIKTQVGESASRWFAIKYLEGDPHTVEQLSRF
                     DLQSSVKPGSLKSQIARERYDHIQLIVKESVAAISKELSMSEAIDHVLTHKFIGIPVF
                     LALMYLAFKFAFETVQPLSDLLENTFSRLADLVTAHLGDGMIASMLADGVLGGVGAVL
                     VFVPNIFALFFLLGIMEDSGYLPRAAFVMDRVMYSLKLSGRSFMSFLLGFGCSVPAVL
                     STRGMPDTRERIVSVLSVPFISCSARLPVYLLIASIFFSRNQGMVVFSIYLLSMFAAM
                     ISSLVLNKVIFKGQRSVFILELPRYRLPSFKNLTLYTWLRGKHFLVKAGTIIFVSSLV
                     LWALMYFPNPNDVTQSFAAQIGRAVSFVLKPLKFDWRASTALFFGVAAKEIIVSTFGM
                     LFNTTDEGLAAQLSQLFDPVTAFSFIVFVMAYIPCFATLATIKSEIGTKYVVITIFYS
                     LFIAYVLALAVRMMGGIFV"
     gene            187609..187932
                     /locus_tag="AJ81_01065"
     CDS             187609..187932
                     /locus_tag="AJ81_01065"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74626.1"
                     /translation="MKFLLLIEWLAAFLLFFLMLKDDAMLAFCVLIFSLIYLFGLLES
                     RKDPQRIHAHGMVGGIMFFVAAVLTFLNDLARFELKFNLSRTLLILLGLVGLIQARAV
                     RKQFK"
     gene            complement(187925..189127)
                     /locus_tag="AJ81_01070"
     CDS             complement(187925..189127)
                     /locus_tag="AJ81_01070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate permease"
                     /protein_id="AJC73019.1"
                     /translation="MILLVAFIVGFLMAFSIGANDVANSMSTAVGSRAITPRQAVMIA
                     AVLEFLGAVMFGSHVVTTITKGIIKVEFMNDPRQVLAGALAALLGSSVWILLATVWGM
                     PVSTTHSIVGGMAGFGIANAGLHAINWNKMASIVISWVLSPIVGWLLAYTVFKIISYV
                     ILRKSHPAMAMKRSIPLIIFTTFFIVCLLFALKTLKMQFDRALGWSLIIAAVIGVLGT
                     TFFRKIQPAGSDEYEYVESIFKRLQIMTSCYVSFSHGANDVANAIGPVALVYWIVSHG
                     NVAQKVGVPMWLLALGGLGISAGALLLGARVMKTVGEEITQLNNSRGFCIDFSTASTV
                     LFASVLGLPISTTHVVVGSVVGVGTARGVELVNVGVLKNILISWFATVPVSALVSAGF
                     YLLILRFI"
     gene            complement(189141..189818)
                     /locus_tag="AJ81_01075"
     CDS             complement(189141..189818)
                     /locus_tag="AJ81_01075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002334063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoU family transcriptional regulator"
                     /protein_id="AJC73020.1"
                     /translation="MTRFLGKLFPQESPLKLLYEHARLVEKSAEQIPVALGKFLRHEP
                     VEDLAQLVDKLEDEADEIKVRIREVYSKLKFVYFDRVDLLLILHDQDAVIDAVDDFLK
                     MLCIYRFDKPLPKELTDMLFELAERVQDAIKFMVESVHELLKLVESSFSPVIAGEENA
                     LTQKVESDESGTDRLSLALAKKVFSLKNVLHPVDIMYLEKLTRLLTRAADHAENVAEK
                     VRMIAKS"
     gene            complement(189834..190991)
                     /locus_tag="AJ81_01080"
     CDS             complement(189834..190991)
                     /locus_tag="AJ81_01080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73021.1"
                     /translation="MVTVSVVLSLVLIVTVQRLTKTLLLSMISGFGLFVAMNSVLRGA
                     LVELFLATVRDRSFLTLIPTIFFIYFLGEIMDVSKDARRMTESFQKLFQGSMGAVVFI
                     PSAIGLMPMPAGAMFTAPMVDRMGEGMSNLDKLLTNYWFRHCLEFFWPVYPAMYLLAG
                     LTSTKIGSVSLKLSPLFFVSFLAGWVYLNGLKLPKFNKLSRSEWKQLWPLILVLSVGF
                     MILLFKMEGWLALLLVSLSYAFLRTNHVSEAVKRTLRRLDVVPIILLVFMFKHAMMDF
                     GLGERVSLELTSLGLSTKFVAILLPLLSGMSTGITHASLGISYPVVVGMGGERLGLLV
                     YVFSVLGVLLSPVHLCLILTLNYFKVDLSKAVLKMLPLIGVTAFVAYLFYA"
     gene            191040..192152
                     /locus_tag="AJ81_01085"
     CDS             191040..192152
                     /locus_tag="AJ81_01085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="AJC73022.1"
                     /translation="MIKIKRLYEEGKDLFAVSDESPFYPDGKGGQLGDRGTIGPAKVL
                     YVKEVNGEVHHKIDEPIEPGEYDFEIDQARRKDIATQHTAQHILSAAFLKVVQAQTVS
                     FHMGEKTSTIDIDLPVLTERTIEDVERLANEIVKSCVNVEILFVEREEAEKMNLRKSL
                     SEKVGQTVRVVKVQDFDLSACGGFHVANTGEIGIIKIVDWEKVKQNLTRVHFVAGERA
                     LKHFQQCVFVTKNLQKTLTCSLSDLAIRIEALIEKIRSLSSTLDRLSEEHARFISTNL
                     PKRKIFEYEVAFYEGFPSVARALLKQPLADLLVCKLEDEFAISSDRIDCGQIVSKLRS
                     VLNVPGGGGKKRGSIKISMDMEEFLNLLEKALEVEK"
     gene            192149..193174
                     /locus_tag="AJ81_01090"
     CDS             192149..193174
                     /locus_tag="AJ81_01090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006347315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-cysteine desulfhydrase"
                     /protein_id="AJC73023.1"
                     /translation="MKISLAKLPTPIEMLTRLGKRYEREILVKRDDMTEFISSGNKIR
                     KLEFLLADALRQGCDTVFTCGGEQSNHARATAHLCVKLGLKPVLFLRESQPEQGNNSM
                     RKIRNFFASDEAERSYFKEVVNGNLLIDKLLGAQIVFVTQQQYSRIDEVFEEYRQKYE
                     SQGRRVYVIPEGGSNALGALGYVWAVAEMTGQIDLSQFDAIYCAVGSGGTYAGLLAGL
                     RFLGYDTPVVGINVTKREASHFAEKVLKIIDDLSKYGIRVKVQPDEVKILDDFSGPAY
                     AVPTEADIECIKMVASMEGLVLDPVYTAKTFRGMLQTSKRGQRILFIHTGGTFGLFAQ
                     AYRFIEP"
     gene            193171..194454
                     /locus_tag="AJ81_01095"
     CDS             193171..194454
                     /locus_tag="AJ81_01095"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74627.1"
                     /translation="MRRIAFLAVIPLTLLLASCMSLNSSTIRVVLPSELYAGKPFEMK
                     VGVVGPLGFLLRNVEVKIDGQTYTTDESGYARVPFFFLDAGSYAVILSYGDVSTKIVL
                     NVKPASWLVLCWFGADNNLWEYVNSDLEEMKSAAKDVAVIAFVDRDGTMSDGIYALSM
                     DSVFVRIEFFNETNSGSGTNLSWFVNKYGTCDANKKSLILWNHGSAWDDTDPYRAKGI
                     SYDDQSKDFLTTLELKNALQGTRWDVLGFDACLMGSVEVLYELKDLADYFLASPGEIP
                     SSGWDYRFLASISDLDSKGFCEKAIDRWRSFYTNRSYKPLLNAWDSEKLSKAVSSLVE
                     KMNPANGLPEVNTVYSTSPRLCDLGEVLYSFGWSDVLSQFQSARIPQTTNALLYLSVF
                     LPQNSNQLDQYREMYSQLSFSEHTGWLDWLDSLFH"
     gene            194773..195162
                     /locus_tag="AJ81_01100"
     CDS             194773..195162
                     /locus_tag="AJ81_01100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001192249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS200"
                     /protein_id="AJC73024.1"
                     /translation="MQLRKTRWSLYNLNYHFVWIPKYRKKILVDSVRQELEKLIFEIA
                     KKHGIEVLSLSVQPDHVHLFVSAPPRLSPAQIANLFKGVSSKKLLEKFPHLRTKEGLW
                     SRTYYVGSAGTVSEETISRYIEECQDI"
     gene            195623..196078
                     /locus_tag="AJ81_01105"
     CDS             195623..196078
                     /locus_tag="AJ81_01105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004933535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter
                     substrate-binding protein"
                     /protein_id="AJC73025.1"
                     /translation="MEGSLNELLRIPSPSGNWECQNNLDMFAFQVSRVASVIMDIESR
                     IDVVILPVDEEAIQALANYLGTTKFFIEPGVYKSVTEPVPTVGDYTCLVIRENLPEDL
                     VYKLAEALWNKKDQIAKAFVDMAELNPEEAISQGVPAHPGSVNFWSQLK"
     gene            196127..197983
                     /locus_tag="AJ81_01110"
     CDS             196127..197983
                     /locus_tag="AJ81_01110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004933536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter permease"
                     /protein_id="AJC73026.1"
                     /translation="MRKLKGVTYYFAFLSLVAMGVFHIYTAIFGTFEAYLQRNVHLIF
                     ALPLAFIFYPATKNSPKDRVPWYDWIFAGLSVLPGLYAILNYEMIIYRMVQVEEVTTA
                     QIVLGTLLVVMVLEATRRIVGLALTILAAASVFYMYVGHLLPGQLKGMYVTYDRIIEH
                     LYLTGEGIFSTPLGVSATFVMLFLILGGFLEHSGVGEYFMDLSKALAGKTIGGPAKIA
                     VVSSGLFGSISGSAVANVYATGTFTIPMMKQLGFSPVFAGAVEAVASSGGQIMPPIMG
                     AAAFIMASFLGIPYKQVMIAAFVPAFLYYFYVFMSVHTRAIKRGLRGLPAEMIPSIKH
                     VLKKLYVLAPIIVLVVMIMRGYTPMRSALIAIIVSWFVSLLDKRYRMGPKGVLNAIYD
                     GSKNVFVVAIACAAAGIVVGAVTLTGLGFKLVSFIFSLAQNIPFLALVMVMLMSIVLG
                     MGLPTTAAYIVASALAVPALIRLGFKALPSHMFVFYYAVFSAITPPVALAAYAASSIS
                     GAKPSETGYQAFRLGLIAMIIPYAFMYDTGFLLQASWMRNLLSLAAGLVSAMALSYAI
                     EGFLKTKLNLVSRILLGAIGVLVLFPILWLKILCIVAFAIVFAQFSMRAEKI"
     gene            complement(198005..198808)
                     /locus_tag="AJ81_01115"
     CDS             complement(198005..198808)
                     /locus_tag="AJ81_01115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="AJC73027.1"
                     /translation="MKLAFNGATIIKATLAEDIVCARLAGFEMIEIWKSKLLSTLKTG
                     GVEVVKQLLEQNALKPLTINSIEQATFSENRQEKLKECEELCEIARELGVEAIVVVPG
                     FLREKLDEVRIVKESVDVLKEMSKIAGRFGVRLGFEFLGFSNCSVNKLTVAWEIVRQV
                     NEDNVGLIVDTCHFFSGDSRLEELEEIDARKIVVVHVNDLPKVEDVKDSDRIMPGDGI
                     LPLRDFFETLEKIGYDGPVSVELFNQDYWDKPACETTRIAFEKLMRFLH"
     gene            198914..200182
                     /locus_tag="AJ81_01120"
     CDS             198914..200182
                     /locus_tag="AJ81_01120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001568317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl glycosylphosphotransferase"
                     /protein_id="AJC73028.1"
                     /translation="MRKYNPLVLYLAGYGVLSLVYFLLSGSIGGSLLLPLVCCLALFS
                     FRTFDREHLTDFNQLLVRSFVAIALSNIINYIILRLIYLSFFQGFGRVRLTALAVHTI
                     ICGPAVALIGYSLFSVLRRKIRPYRYAVIGGEKEIKELLKEIEQKSDEYRFVQFIENK
                     DQLKTLNDEIDGIVVSDYNLYEFFQPELARLNLNNIIFLPHIAETVLKRIPLKLVEKF
                     KAYYETSFNAIVEDAYKRILDVALATLALVITSPIVLIIAILILLEDGRPILYRQKRV
                     GKDGKEFEFVKLRSLKQRDFDPDNPNRNIEQRMLKIGKFIRKYRLDELPQFWLVLKGD
                     MSVVGPRPEMVEYHLQYVNRIPYYHYRLILKPGLTGWAQINYQHTTTFEEYKTKLEYD
                     LYYVKNHSILLDLSVILKTLEAVVFKRGAR"
     gene            200182..201180
                     /locus_tag="AJ81_01125"
     CDS             200182..201180
                     /locus_tag="AJ81_01125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="AJC73029.1"
                     /translation="MKCVILAGGSGERFWPLSTRETPKQFLKLFSDKTLLRETFERIA
                     ARLDPKDIYIVTNRAYAELTHMDVPEIPRENVLLEPLKKNTAPACTYATLKFDPSETI
                     FIVPADHYISNVEKFWCCVQLGQNTLQEYEAIITFGIVPSRAETAYGYIEAGERIDEN
                     IFEVIKFHEKPDHQTALSYLEKGNYFWNSGMFMYKAGYFTEQMKKHAPQVIEPFLKKK
                     DLEQIYQEVPSISIDYALMEKADRIIMVKADFVWSDVGNFNSLKDLGVKNSQLTVVMN
                     GENLFVKTSKPAIVIGVSDVVIVENENGILVCKMDQIDKIREALKALQQKRTDSQH"
     gene            complement(201378..202622)
                     /locus_tag="AJ81_01130"
     CDS             complement(201378..202622)
                     /locus_tag="AJ81_01130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="AJC73030.1"
                     /translation="MKRLTEKDYRWNFVVNSIDNAFFSVGMTFGSVFTIFPVFAKNLG
                     ASNIELGLISAITNLGWGIPAIWGAKYAERSAKKLDLVLKVTMLERIPYFLIGLIALY
                     LVGFSPKLSLYLSIATMGIAIFAMGFLGPPWMSMIEKVIDSRRRGTYFAVGSGLGAIM
                     GIGGSFIARNLLANHPFPKNFAYVFFTGFVFFMLSLLFLSLTREVPDERIYDDEPVLS
                     YIKKMRHVFADKNFRNFLIERIISSFMFSSGGFVTVYLLKKFSLPDDSAAIFTAIVLA
                     FQGASSFLFGPIGDKMGHKLNLIVSKVCYVSATLLAVFSKRVEQAYVVYALMGVVNTT
                     GNVGSMAITLDMTSSKRKELYMGSLYFLIAPFSFVAPLICGKMIDLLGHTLAFLLTGV
                     IGVFNLFYLLRFVVDPRMRRRL"
     gene            complement(202691..202852)
                     /locus_tag="AJ81_01135"
     CDS             complement(202691..202852)
                     /locus_tag="AJ81_01135"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74628.1"
                     /translation="MCHSGIKIGLILPKRDAIDYLVQKLKGFGELVPSDIASWFHDQI
                     EHKGFNTEY"
     gene            complement(203080..203958)
                     /locus_tag="AJ81_01140"
     CDS             complement(203080..203958)
                     /locus_tag="AJ81_01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002533595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="AJC73031.1"
                     /translation="MEIRKIVGQVCYVPNPVNICIVYTKDSAVLVDSGIDENFARKLC
                     RLLEKPAKFLINTHSHADHCGGNAFLKDKFSVHIMAPEIERHIIESPILEPFYLFGAA
                     PPKELQTKFLMAKPCRVDETLEPGTITLQDVTLNIVPLAGHSPNQIGVAVDKVLFCAD
                     ALFSKGAIEKYKMFVVYDVKNFLQTLELLEKSNYDFFLPSHGDLTGDITELLNLNRKV
                     VQNVSNEILNLLRTPHTFDELFRMLLGRFDIEVKNFVQFVLYRSTVHAYLSYLLDEGH
                     VEKDLIKNSLLWRIKA"
     gene            204090..204974
                     /locus_tag="AJ81_01145"
     CDS             204090..204974
                     /locus_tag="AJ81_01145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_01039240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="AJC73032.1"
                     /translation="MRKILCLSLLSVVFSVLVSNPLVFLNDPRTTFCFDFQVDRFRFS
                     LFLPLVRSIAPIDWFLPKENAVILKGLIKVESDFFVHALSEKGAMGLTQLMPSTAKEL
                     GVLNPFNVFQSVDGANRYLKDLQKRFNSVNLALAAYYEGPTRVARQGPSVEGLKYAQK
                     VLNSARDFENRTAFFKDAVYFEPYFELGKHFSGGVNFYLSLLGVAYLTGGLNVSDRVS
                     QHVFVYPNITDSVSLILGERDLNLVGGFFFRKMPDFGIQLLVGKNELDVNALARVWRF
                     YITAGFSQQRLRVGFIFK"
     gene            complement(205013..205222)
                     /locus_tag="AJ81_01150"
     CDS             complement(205013..205222)
                     /locus_tag="AJ81_01150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73033.1"
                     /translation="MKRLFLDFVNEEDGKRRRITIPNPKEDLTSEQVSEAMDMLISLG
                     ALPSTFVKDRAAIVETVTNEFFNLL"
     gene            complement(205236..205439)
                     /locus_tag="AJ81_01155"
     CDS             complement(205236..205439)
                     /locus_tag="AJ81_01155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002533562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73034.1"
                     /translation="MLSMKQIRIVYNTGEVDESGRPVLRRGTFAVEDSVTTVQAEQIA
                     NLIDSLSDYTVQEAYLVTTTQVI"
     gene            205893..206900
                     /locus_tag="AJ81_01160"
     CDS             205893..206900
                     /locus_tag="AJ81_01160"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74629.1"
                     /translation="MRDYLETALRNLRYLREQNASSEQDLKRLVVEPVLLWIGIDVYD
                     PAVLREEFKIPQVKALTRADYVIMKDGKPILAIEAKGTEENIEDGLKQLIDYCNYGNV
                     RFGVITNGKDWWLVDEQWKQNPQRVFFKLSLDSERVSLLKLLSPQNFHLLEEFAQNVE
                     KILQLDLTPTLKEKFLDTTAKEYIEKIGTKEPSPPSITEGWIDLDRLLQLMKDKNIRK
                     FIKCPEKVMINSKAMSAESWTQVYREFVIAYAEKIKEPIKFPKAQNQPLICFDHLPSG
                     VNPLNYSRLQVKGKTLFLLTCLATYDKLRAIKYFQQVLQLPPDSVLFPKEWFEELASS
                     K"
     gene            complement(206966..207799)
                     /locus_tag="AJ81_01165"
     CDS             complement(206966..207799)
                     /locus_tag="AJ81_01165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_176618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="AJC73035.1"
                     /translation="MRKLNRKRLIKNVVSLIILSLLGLMAFIPLYWMVVTALKPPTLV
                     LKFPPEILPKSVTLTNFKYLFHRPYILRWTINSFVVAGSVTVARIVLCAMAGYALAKK
                     KFPGAKIFFWLYIGSMMIPSQVTLIPLYVIVSSLRMINTYWGLILPSVAAPFGVFLMR
                     QFMVTLPDEIIEAGRIDGASEFQTFWKIIFPISKPAIAVLGIFTFVNEWNAFLWPLIV
                     TNTTAMKTLQAGLVMIREEVPLEFALHMASSTYAAIPMLIVFFAFQRYFLEGITVGAI
                     K"
     gene            complement(207809..208687)
                     /locus_tag="AJ81_01170"
     CDS             complement(207809..208687)
                     /locus_tag="AJ81_01170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_07707239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="AJC73036.1"
                     /translation="MNLLKRIYKHRYAYFFLLPHFAFFLIFFLLPVGNGVYLSLFDYN
                     VFSKTFIGIENYREIFSDWLFRKALLNTFIYTFGVVPLWLGKALLVTVLIYPFRKPIK
                     TFFKTVFYLPHVTSSVIISLIWLWIFNPTFGLLNYFMKLLGLNPVIWLGNKLTAMPSL
                     IAMQVIMGGGSTIVLLSAAMASIPEYYFESAKLEGASSWKIFTKITVPLLKPTILYAL
                     VMGTIANFQTFSNIYVMTQGGPEFSTITVAYLVYTTAFRDYNLGLASAMSMVMFVILV
                     GLGILQFKWLGSNVQY"
     gene            complement(208757..210106)
                     /locus_tag="AJ81_01175"
     CDS             complement(208757..210106)
                     /locus_tag="AJ81_01175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="AJC73037.1"
                     /translation="MKTSWKVLLALLLLVGTALFSAKITITWWINPWRIAPPGHPADK
                     PLTGEEFPKWISEEFMKLHPDVEVKYVLVTNQEYAQKLAAAIATKTQPDFFKGPVWDS
                     RWAKSGLLEPIDDYLSPEDWKDFYEQCLKAGYVDGKHYMWPWVYGTNGMGATMLLYTP
                     DFEKAGIDWRKIVNEGWTMEEFVEVCKKLTWDSDGDGQIDHYAIGLGAKSDMVHNVLN
                     FIYAHGGRLTNEDETEVILNSPEAIAGLQFVLDLIEKHGVAPKGAEALDIYGVINLFH
                     THKVSIGFGGPYEIGRITRYVREGRLSEAFYPVVAPFPHVEGKDPVAYARGSGFIVFK
                     QSDPKKRDMIFEFLKFITNHENIALLETLNYLTARRSVNELLYKDDPYMNEQVRRYAQ
                     IMDKYGMEFFGSQEFPWSQMNAHFVAALEATFSKSKTPEQALNDFVREANRILKKVK"
     gene            complement(210472..213015)
                     /locus_tag="AJ81_01180"
     CDS             complement(210472..213015)
                     /locus_tag="AJ81_01180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="AJC73038.1"
                     /translation="MIAFTQVAIPHRDIIEGRLTMDVFAADLWQVKNNKGPIEYTDKD
                     LFFRKTYETKGLRNLIEVAENRLMRGTGDPVIQLQTPFGGGKTHALIALYHKAKEWGV
                     NVVVLDGTAFDAKEVRLWEEMERQLTGCEDKTKGDSAPGKDKLIELLSEGSPVLVLID
                     EILEYATKAAAIRVGDSNLASQTLAFLQELTGAVSSVGKALVVLTLPSSTPEHYDENA
                     ANLFLQLQKLVGRTERIYTPVLDDEIEYIVRKRLFERVDEEKAKQIVDDFVRYAVEEK
                     LLKSEEASWYRERFLKSYPFKPDVIEVLYKRWGSFPTFQRTRGVLRLLALVVRDLIDK
                     EIPFIRLGDFNLNDPEIERELTKHLGPEWESVIFQDITSPNSGAAAVDEEIQVSYKSY
                     KLGSVVSTTIFMYSFSGKGEKGVTAQEIKNSVVYPTVPSSIVDTVLSKLREKLFYLSE
                     EGWFFTNQPNLNNMLISREQNIDDEKVVERERQIIQEFARKDDRTLKVYVWPANHKDV
                     PDDERLKLVVLKEPESRMEFLESCGDKPRVNRNVLFFLCPDEDQRIEFEKFLRSLIAT
                     EQVREEVTSLTENQKKQLEEKIKSLKSRLYEELRKYYRRLFVPVVADFQEIDLEIPAF
                     GANSLVSEVCERLRSEGHIVQKIAPVLIKGRYLSNQDYVETKKLYEALLRTPGETRVV
                     SKEVLAQGLAEGVKIGLFGLGRLGENGPMCDHFKKEVQVRLDEGEIVVSSELCSKISS
                     SKEDAYKPTVQKETDQRISEDVAELKQEKKPERAYKSVHLKLNVPFGKVSEVVRTINY
                     LQSRFSSINLQIDVKATGGSLDKDEYENRVKEALMQSNVKIEEEETEPW"
     gene            complement(213012..216368)
                     /locus_tag="AJ81_01185"
                     /note="DNA methylase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(216374..219685)
                     /locus_tag="AJ81_01190"
     CDS             complement(216374..219685)
                     /locus_tag="AJ81_01190"
                     /inference="EXISTENCE: similar to AA
                     sequence:GenBank:AFV11425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="AJC73039.1"
                     /translation="MLKEGDIVKGNIANEPVRVDKIVDFGEHVQIVGSTLHTKRYVNR
                     FLRKSELTQLQIVSQTIDFSFPARDAFLFIEATRLKYASLFDPFLAMNVSKIDPLPFQ
                     IEAVYGYVLKQPKVRFLIADDPGAGKTIMAGLIIKELRLRKLASRILIVVPGHLKDQW
                     RRELSEKFDEKFTVLDRHTFDAHYGENPWEINDRVITSLDFAKQDDILPTLNSVRWDL
                     VVVDEAHKMAAYSYGNKTEKTKRYRLGEVLSKVANHLLFLTATPHRGDPENFRLFLDL
                     LQPGFFANPEMVEESLKNRDNPLFIRRLKEDLRDFNNNPIFTRRFTNTVKFKLSEREK
                     ELYNEVSRYVIEQYNKGLKNDKKKNVAFALVILQRRMASSTFALMKSLERRKRRLEEI
                     LAKGQEKQKEYHLDYETLEDLEEEERWKREEEWETLTFATDRDELTGEIKIIQELMKR
                     ADDIVRSESEAKLSKLRKAIEDGFKKSSEMGGNAKVLIFTESRDTLEYLVDKIRKWGY
                     KVNYIHGGMKLEERIKAEKLFKEETQIMVATEAAGEGINLQFCHVMINYDIPWSPVRL
                     EQRMGRIHRYGQQKDVYIFNLVTEDTREGEVLAKLLSKLEEIREKLGSDKVFDIIGQI
                     YPDKDFHQLIVDAVTNAKTMDEVLKELDERVKVDPEYIERIKEMLGESLATKYIDHSR
                     IKEMFEKAEEYRLVPEYVEEFFKRAFRRLGGEWEKTRDGFLTVRSILYEIKKIAEKLE
                     FKNKFGILMKSYRKITFDKEKAFREPDSEFVSFGHPLLEALIEWVVTEFREGVKKGST
                     FEDPSGKYDGLIWFYMGEIVDGRSEVVARKIFAIYDDGKEKREVDPALLWDLVPFEGT
                     VEPLNASESEVLPFVIKAVEKYKEQLRRERERQAEIKRKYGLRSLDYLIGELDAELSE
                     LYERQSFGEKVDLAILNKDQQKKSYERAREELEKEIQQEQHLVISFLELLTVVRVVAR
                     TADEMIRDEEIERIGIQIAMEYERKHGREPKDVSRENLGFDIRSKGEGEVRYIEVKAR
                     AGCGQIALTPNELMKAKQLKNDYWLYIVVNAATNPELYVVNNPAENLKFFEKVEVVRY
                     LVEPEEWKSKGKREV"
     gene            220004..220849
                     /locus_tag="AJ81_01195"
     CDS             220004..220849
                     /locus_tag="AJ81_01195"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74630.1"
                     /translation="MKRIDKLVRSFVDQAMAEGFELFLSPETEVLRDLSQINDNVVFF
                     QAKNGQLFKLRDDYTTTIVEFFNKNASDSLRVWYSGFVYRYDQTGQIQNTFQLGLEIV
                     PYNSPQDSFVVLRVMLESILRSLTDELLVEIGDSRVIEKCVQHVPKKFRKKLFELIDR
                     KDVSELEFFASLNDLDLSDVLKLVEASFTKRSVNQLKEFELDPSIEREIVELVDFLSG
                     FSGVTVEIDFSLARTVEEYDGPTFIFFDLKDPALIAAGGRYRVNERTLGVGGTIFLEE
                     KAWSR"
     gene            220837..221463
                     /locus_tag="AJ81_01200"
     CDS             220837..221463
                     /locus_tag="AJ81_01200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002573350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="AJC73040.1"
                     /translation="MVKIALAKGRLEDEAFAFLERCDFQFKERSERSLIVEDVEEQLK
                     IFIVKPSDVPTYVFNNVADVGICGTDSIVESQFRLVQPMKLPFGKARMVVAGLEGFKV
                     KNGSVSVATKFPVSAKLYFDSKGLDVKIIKLHGSVELAPIVGLAPLIVDIVQTGRTLK
                     ENGLSILDEVYPISAVVTLNDVAYRIKRAEILDFLGRLERGLEREGTR"
     gene            221447..222736
                     /locus_tag="AJ81_01205"
     CDS             221447..222736
                     /locus_tag="AJ81_01205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="AJC73041.1"
                     /translation="MRVLVEPTKGQIFEILEERKTNFLNIEENVRLIVENVRKNGQSA
                     LDEYISKYEKCALKGEQILVRQEELESAKVEPEFEEACEKLIERLEAFHSMQLERSVW
                     SLTKNGSFTAQLVRPIESVAIYVPSGKKVYFTTLLMCAIPAKIAGIERIVVASPADEE
                     GKLSPYVLHLCRRLGVKEVYKMGGAHAIAALAYGTEVVKKVDKIVGPGNAYVSCAKKL
                     VFGDCGIDSVAGPTELLIVADETADPKLVAIDMLAQAEHDEMAMSVLLTNDEDLLDRT
                     LEELAKQLNELSEPNRSIAQVSLERNGLSILTKDLNNAIEFVNLFAPEHLELFLEDPF
                     SLLPKVKNAGSVFLGSWSAEAFGDYGIGPNHVLPTSTSARFSSGLSVQDFLKRIFVTR
                     VSEEEVLKEGRFYSTLARLEGFEAHARSIEVRMEGSR"
     gene            222733..223770
                     /locus_tag="AJ81_01210"
     CDS             222733..223770
                     /locus_tag="AJ81_01210"
                     /EC_number="2.6.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228846.1"
                     /note="catalyzes the formation of L-histidinol phosphate
                     from imidazole-acetol phosphate and glutamate in histidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="AJC73042.1"
                     /translation="MSFKAVVERIRKDVEAYQSETRSPIYLALNENPYPFPEELIRQC
                     FESIDPSKVNLYVDSPSKEFLKELVDYLSTDSWRAREEQISVGNGADEIIYVLLLMFK
                     DLSIYVFPPTYSCYEIFANALGVKVNKVPLRGERIDTKTLKGLLNEDCVVFLPNPNNP
                     TGHLFEEEEIFWLLKTKALLILDEAYFEFSGKTFAPLIEQFQNLAILRTFSKAFSLAS
                     QRIGYIVANPSLIDAYNRVRLPYNVSYLGQTFATIALRNKRIFQERVRKIIEERERLK
                     NALRSMGLKVNDSKANFVFVYLERERTERVYRALLKRGITVRKTEFGLRMAVGQPKQN
                     DLLIETLEGSL"
     gene            223800..224363
                     /gene="hisB"
                     /locus_tag="AJ81_01215"
     CDS             223800..224363
                     /gene="hisB"
                     /locus_tag="AJ81_01215"
                     /EC_number="4.2.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_003845353.1"
                     /note="catalyzes the dehydration of
                     D-erythro-1-(imidazol-4-yl)glycerol 3-phosphate to
                     3-(imidazol-4-yl)-2-oxopropyl phosphate in histidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="AJC73043.1"
                     /translation="MERETLETNIKLWLIDDGKGEFTGSSRIGFLDHMLKTFCRFSTL
                     SLSLEQFEADLHVDMHHGVEDLALVLGTAFRELLDYSRAKRFGYAIVPMDEALTMCSI
                     DLSGRSFLNFQASFETQSIGDFPVELIEEFFRSFSSNARITLHIVKLFGKNSHHIAES
                     MFKAFAIAVRSAIEKIESTQSTKGVID"
     gene            224360..224971
                     /locus_tag="AJ81_01220"
     CDS             224360..224971
                     /locus_tag="AJ81_01220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002250846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="AJC73044.1"
                     /translation="MNVAIVSSMPGNVMNLYRALKGLEQSLNVELLEKPSQSSFDVIF
                     LPGVGHFEEAMRRLGENEMDKFLLNQAEKSFIVGICLGMQILFEESEESVSSRSVRGL
                     GLLEGKVTKLKAQVLPHVGWNQVRFQNDKFKDLDGRYFYFVHSYRVLCEESLVVATCE
                     YEEEFPVVVMKDKVLGVQFHPEKSHAVGKAFLKRVLECASSQR"
     gene            224950..225678
                     /locus_tag="AJ81_01225"
     CDS             224950..225678
                     /locus_tag="AJ81_01225"
                     /EC_number="5.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228843.1"
                     /note="catalyzes the formation of
                     5-(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino-l-
                     (5-phosphoribosyl)imidazole-4-carboxamide from
                     1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="AJC73045.1"
                     /translation="MRVIPAIDLYDGRVVRFERGDKKKIHLYDYDPVELLKLFAEEGF
                     QLVHVVDLSCAIDGSMANEVVLKKISRRNLARFVQIGGGIRSLERAIQLVQMGFRRQI
                     LSSALIEDPTLICKLMQQGIDVVFSLDTANERVRTKGWNETSELNVVELLKTLKELGL
                     KEVIHTDVEADGTLKGRKLDFTKHLAQKTNLTFIVAGGISGVEDLEDVRRLNLEVPFV
                     DGVIVGRAFYEGKITLKEMKSYAC"
     gene            225668..226438
                     /locus_tag="AJ81_01230"
     CDS             225668..226438
                     /locus_tag="AJ81_01230"
                     /EC_number="4.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001180796.1"
                     /note="catalyzes the conversion of
                     5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-
                     1-(5-phosphoribosyl)imidazole-4-carboxamideand glutamine
                     to imidazole-glycerol phosphate,
                     5-aminoimidazol-4-carboxamideribonucleotide and glutamate;
                     the HisF subunit acts as a cyclase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="AJC73046.1"
                     /translation="MLAKRIIACLDVKDGVVVKGRQFENLVYGGDPVELAQKYCDSCI
                     DELVFLDITASLESRRTMIHVVKKVAEKTNIPFTVGGGIRDIETASELIYAGADKVSI
                     NTAAVENPKLIEKIASKFGSQAVVVAVDAKRTQLGFEVFILSGKKATGIKLEDWLRNV
                     QELGAGEILLTSIDKDGTKEGFDLELISLARKVLKIPLIASGGAGTKQHFLEAFKAGA
                     DAALGASVFHFGLIDVQDLKRYLSQNKINVRLDCWEVE"
     gene            226443..227051
                     /locus_tag="AJ81_01235"
     CDS             226443..227051
                     /locus_tag="AJ81_01235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001664523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="AJC73047.1"
                     /translation="MRPVVVQEAFTKEVLMLAYADEEALRLTKETGFAHFYSRSRQKI
                     WKKGEESGNTMRVLQIVEDCDRDALLYLVEFPENKVACHTGRRSCFFNVVHGENVKDG
                     LGFLQKLHKIVEDRKNNPTEGSYTTSLFRTGLDEILKKFGEESIEVILAAKHQTKERL
                     INEISDLIYHLIVLMCAEDVSWNDVIGELEKRSKKCPENERS"
     gene            complement(227264..228136)
                     /locus_tag="AJ81_01240"
     CDS             complement(227264..228136)
                     /locus_tag="AJ81_01240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002534112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formamidase"
                     /protein_id="AJC73048.1"
                     /translation="MKVIPKDNVIYAFSPGMKPVAHVHAGETVQFETLDALGGQIQDE
                     ANVMNLDFSKVNPATGPIYVEGTKKGQTLVVEILDINISSDRGVIVAEEGFGVLKNVV
                     KGFKAKILPIRDGHVIFNDLSIPIRPMIGVIGVAPEREEFPTGTAHKHGGNMDTKEIS
                     IRCKIHLPIFQDGALFALGDVHAVMGDGEVCVSACEVPATVTVKIDIEDRTIEWPIVE
                     TEENVYVLVSLPKLEDALEEATRVAVKMISEARKLSFEEAYMLASLIVDVGVSQLVDP
                     NLTAKAKIPKRYLV"
     gene            complement(228114..229421)
                     /locus_tag="AJ81_01245"
     CDS             complement(228114..229421)
                     /locus_tag="AJ81_01245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RarA"
                     /protein_id="AJC73049.1"
                     /translation="MFTQGSEPLAERMRPKDLDELVGQDHVLGESGVLRRALESGSIF
                     SCILYGPPGCGKSSIAELIRKYVDAEFHSLSGSLHGAAEIKQVLSRAQELKKYGKRTI
                     LFIDEIHRLNKAQQDLLLSRVEDGTIVLIGATTENPSFEIIAPLLSRCRVIQLKPLTA
                     EDLLKIMKRAVERDELFRRSQVEIEEEVLSYIAKESNGDARYALNTLETIVETTLSKG
                     LKKLRLEDLAELSPSKILTYTEENHYDLASAFIKSLRGSDPDAALYYMVRMLESGEDP
                     RFIARRMIILASEDIGLADPFALVIAVSAAQAVEHVGMPECALNLAEAAIYLATAPKS
                     NSTYEALSRAKELVAKTKDAEVPLFLRNPVTKLMKNMGYGKGYVYPHDVGGFVQRSYM
                     PEGLEDIRLYVPKDVGKESSIKKRLEQLWGKREGDSGESHPKG"
     gene            complement(229421..230347)
                     /locus_tag="AJ81_01250"
     CDS             complement(229421..230347)
                     /locus_tag="AJ81_01250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="AJC73050.1"
                     /translation="MANVLVTGGAGFIGSHLVDALLREGHRVVVVDNLSNGKIENLNR
                     QALFYQQSIQDEEMMERVFMLHHFDYVFHLAAQASVSVSVKEPVKDAMSNIVGSLVLL
                     EKSVKYGVKKFIFSSTGGAIYGDDVPVPTNEEVCPKPVSPYGIAKRSVEMYLDFFKKE
                     KGLDYVSLRYGNVYGPRQDPNGEAGVVAIFTSRMLKNEEVHIFGDGEYVRDYVYVSDV
                     VEANLLSLKPEVSGIFNIATGVGTTVNQLFKMLAELTNYSKEPVYAEPRKGDLRKSIL
                     DCSKAEKLLGWKPKIDLKTGLALTLEFFKSGG"
     gene            complement(230350..230880)
                     /locus_tag="AJ81_01255"
     CDS             complement(230350..230880)
                     /locus_tag="AJ81_01255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="AJC73051.1"
                     /translation="MPRGRKKTLTPALEDYLTVIYEIQQKQPAARISTIARRVGVSLP
                     SVTNAVRRLADLGYVEYEKYGLIILTSRGKRKAQSLYALQRRIKNFFHYVLGISIDIS
                     EKLARHLSHYLTARTRERIKDFYRLIIDFSEDKAKELREFIEESRKLVNAPTLPEEVL
                     EDLKAMEKETEEEEGE"
     gene            complement(230867..231472)
                     /locus_tag="AJ81_01260"
     CDS             complement(230867..231472)
                     /locus_tag="AJ81_01260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="AJC73052.1"
                     /translation="MTREELIQILTERVQECEACQLAQGRTNVVVGEGSLYAPIMFVG
                     EGPGEEEDKTGRPFVGRAGQLLTKILESVQLTREEVYICNVVKCRPPNNRVPNAQEQK
                     ACAHFLYAQIMIVDPAIIVPLGSTALSFFLNQNVSISDYRGKEIQWKAGKKLFPMFHP
                     SYLLRNPSREKGSPKDLTWQDIKKVRKFYDELKGRYQDAKG"
     gene            complement(231602..232306)
                     /locus_tag="AJ81_01265"
     CDS             complement(231602..232306)
                     /locus_tag="AJ81_01265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73053.1"
                     /translation="MRKLMQRFCVKNCFPPHIQLFFVYDTSDPQQLPFLVPHYCIFDH
                     HNNPHKGFVEKAFYSHIRLRSANVLNLYDLSRQVLPDDVLFCFAVALVSETAFLRTAC
                     SEDLMYLSRFLSGHVLEDVFELILEGRVKDISDFLTRLSRIEIVDSRERIGIIECKDD
                     DEFLCVVDLAMYPLSLSVLLGKMPWGVWVYCKKKLVQKVYSALRRFENRKAGRIYETK
                     DVQAVLNAILETFEPT"
     gene            complement(232422..234860)
                     /locus_tag="AJ81_01270"
     CDS             complement(232422..234860)
                     /locus_tag="AJ81_01270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="AJC73054.1"
                     /translation="MKLTPMMEQYMKIKSKHKDAILLFRLGDFYEAFFDDAKIVSEKL
                     DIVLTQRQGAPMAGVPYHALNTYLKRLVQLGYKVAICDQVEDPATAKGLVRREVTRIV
                     TPGTLLEEELLEGSLNNYLVAVCKQDDRYTVAGADVSTGETFWTSLNDLDELCDLLKS
                     IGASQILYEPSLKGQLEDRFTNNIVLEPLQDWHLNRANIDQDIAQALNVAIVDHLELS
                     EGRLAFAALVRYIRYTLMSEQIFLKPPRLLRSDDYVFLDASTIEQLGLLMKNGQTSLF
                     DVLNFTRTSMGARLLKQWLLQPLRDRGKIEWRLNKVEALVKDQLLHNELTEYLAAVKD
                     LQRILGRLEYNKATVKDLVHIRSTLSVCPAIKMAMQTNEAFDDMSNLDCIEDLHDELN
                     RALQEEPSMNVGEGNVIKVGYDAELDELRNLVFNAEDFLKQIEQREKMRTGISNLRIG
                     YNEVFGYYIEITKSNLSRVPKEYIRKQTLVNSERFITEELKQLEEKIITAKEKLEKRE
                     KELFNDLCSKVRKNSTRLAKLADVLSTLDVLCSLATAAVRHNYVRPSFSDGELVLKNS
                     RHPIVETKVEGFVPNDLTLDEKNSFVVLTGPNMSGKSTFVRQIGLIAVMAQMGSFVPA
                     EQAILPIFDRIFAKMGVRDDVVAGRSTFLTEMNEVAKIVYHATKDSLVLLDEVGRGTS
                     TFDGISIAWAVSEYIHNKISCKCVFATHFTELTELANLYEGVLNKTVQVAEEGSTIVF
                     LHKVVDGVADKVYGIEVAQIAGLPREIVDRAREVLETISEKSELENRLRVVSTERLKK
                     IKRRKVHPDQSTLW"
     gene            complement(234866..235471)
                     /locus_tag="AJ81_01275"
     CDS             complement(234866..235471)
                     /locus_tag="AJ81_01275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="AJC73055.1"
                     /translation="MSLEQIGQLIPTVIESTGRYERAYDIYSRLLKDRIVFLGYPIDD
                     HTANLVVAQLLFLEAEDPDKDIQLYINSPGGSVTAGLAIYDTMQYVKCDVVTICVGQA
                     ASMAAVLLASGTKGKRFALPNARIMLHQPLGGAEGPVKDVEIITKELLRIKSLINRIL
                     SEKTGQPIERIEKDTDRDFFMDAYEALQYGLIDKVIEPKRR"
     gene            complement(235428..236732)
                     /locus_tag="AJ81_01280"
     CDS             complement(235428..236732)
                     /locus_tag="AJ81_01280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="AJC73056.1"
                     /translation="MERNVVNVDENVVTYEYLFNDEEKRAAESVALKKIARDVEVPGF
                     RKGKVPEFILRARFPETLKAETLEELMSKVLEDLKQEDIILPVYPIDIDLEANGARLV
                     VEVHRRPEVQLKPFEEFELKRIDKLSVLSKYVEDKLKELQEQHAIVQPKEGPAEYEDL
                     VRVKMTISTNDKVLLDSKEIEYVLHKDDDRPIVTELIGKKAGEVVEFEKTFEDGKTYH
                     YKIEILQLNSRTLPIVSDEFAKMVNSQYETLQQLREAIEKEASEMYDRDIKHFLRDQA
                     IDVLIRTSELKISDKTLERLANRALEEIKSNRGEYERLLKEYDNDEEKAFEAIKRYYL
                     QDLKVEYAIAEAVRQNNIEVSDEEIMAQAEKLALAWGISVERAKSLLKNRRDIYEEVR
                     DELIKEKITDRILEKCKIFDVKPEEVNTNESGTDRAADTDGD"
     gene            complement(236810..236883)
                     /locus_tag="AJ81_01285"
     tRNA            complement(236810..236883)
                     /locus_tag="AJ81_01285"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(236849..236851),aa:Gln,seq:ctg)
     gene            237044..237916
                     /locus_tag="AJ81_01290"
     CDS             237044..237916
                     /locus_tag="AJ81_01290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook capping protein FlgD"
                     /protein_id="AJC73057.1"
                     /translation="MKRLLLLVLVLVYTVVLAEYVVVVRTEPFSWVYVDGIYRGIADM
                     NGVLVLTFQTLGQYKISVTKSFYLPFEGIVFVTQAGQIVVQAPLKRAGQLRVFSNVYP
                     VEVYAEDYYLGTIRSVKDTVLVPEGSQYLTFKASGYQPQTHLVNVAYAKETAVNLTLV
                     EETLTVNLKIEPKTFSPNNDWYQDATSFYIYLSKPADLTVNIMDKSGKTVWTKSLKGK
                     AGTNVLAWYGTGVEDGEYVVEVVANTTEESYTARETVAVDRSVYTYTKEKILTVSAIG
                     LGAVLLMLLISSSR"
     gene            complement(237864..238805)
                     /locus_tag="AJ81_01295"
     CDS             complement(237864..238805)
                     /locus_tag="AJ81_01295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="AJC73058.1"
                     /translation="MIDWFKNNLSNCRLCPLSCGADRRRRVGHCGVGARPKLSSVVLH
                     FGEEPPISGETGAGTIFFTGCNMRCIYCQNMNFSQKGLGTEVSTQELAEFFLDLQQSG
                     AKTLNLVTPTPNITFTVEALLFAKERGFNLPVVYNTSSYENVETLRRLEGIVDIYLAD
                     LRYADDETGWKYSKVPNYFSVASKALVEMHRQVGPFDEKRMKGLIVRHLVLPNDVAKS
                     QRVLDFIYFCLSPSVPVSIMSQYNPVFGARTDPVIGRRINKEEYERVIDYALKLGLNG
                     WMQTDEKKRVTVKAVTSAYKIIEKMRSRASREPLLNR"
     gene            complement(238810..240069)
                     /locus_tag="AJ81_01300"
     CDS             complement(238810..240069)
                     /locus_tag="AJ81_01300"
                     /EC_number="2.5.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9WXW3.1"
                     /note="adds enolpyruvyl to UDP-N-acetylglucosamine as a
                     component of cell wall formation; gram-positive bacteria
                     have 2 copies of MurA which are active; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="AJC73059.1"
                     /translation="MGKLIVHGGARLNGSVKISGAKNAALPILAATILLDELVVIHNV
                     PDLLDVRTMLEILQSVGCDVRFEKNTVYLRPSTNLKGEVPYEPVRKMRASFNVLGPLA
                     VKCSEASVSLPGGCSIGVRPVDFHLEGLQKLGFSIEIEHGVVRAKREKKLKECYVYFP
                     FPSVGATEHIMTTATLLGGTRTIIENAAMEPEIVDLANFLVSCGAKILGAGSRRIEIE
                     GVDRLKACEHSIIPDRIEAGTYAIATAATRGKVLLEGVRSDHMMAAIEALNQSGARIK
                     FDGENLLVQMNERPKPLKLQVSPYPGFPTDLQPQMIAYLSVADGTSVIVETVFKSRFQ
                     HVDELRRLGCKIELTDGTAIVYGVEKLQGTIVKATDLRAAAALVIAGLMAEGTTIVED
                     VDQIFRGYEDLTRKLTELSAVVEYENG"
     gene            complement(240071..240643)
                     /locus_tag="AJ81_01305"
     CDS             complement(240071..240643)
                     /locus_tag="AJ81_01305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="AJC73060.1"
                     /translation="MEEKEELLQKIRMLEDQLEYYRTREAQMEQLIREYNEFIRRQFD
                     IYDQFVRDIGTSRIIDPYTRVYSAEHISKLVSYYHQRAFEENREYGLILVRLVEKDEN
                     FDANLLALAKLLKNVIRVPMDSVGRLNEDTFVLLLTEIGKENTRKVVERIKTFINQHL
                     AIPVKISFRSYPDDGSNLEDMMKQLQAEVS"
     gene            240882..241097
                     /gene="rpmE"
                     /locus_tag="AJ81_01310"
     CDS             240882..241097
                     /gene="rpmE"
                     /locus_tag="AJ81_01310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335332.1"
                     /note="RpmE; there appears to be two types of ribosomal
                     proteins L31 in bacterial genomes; some contain a CxxC
                     motif while others do not; Bacillus subtilis has both
                     types; the proteins in this cluster have the CXXC motif;
                     RpmE is found in exponentially growing Bacilli while YtiA
                     was found after exponential growth; expression of ytiA is
                     controlled by a zinc-specific transcriptional repressor;
                     RpmE contains one zinc ion and a CxxC motif is responsible
                     for this binding; forms an RNP particle along with
                     proteins L5, L18, and L25 and 5S rRNA; found crosslinked
                     to L2 and L25 and EF-G; may be near the
                     peptidyltransferase site of the 50S ribosome; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="AJC73061.1"
                     /translation="MKKDIHPQMKLVTVKCACGAEHRFYTTRDTIRIDVCSNCHPLYR
                     GQGAAGLVIDAEGRIEKFKRRYEGVEY"
     gene            241129..241485
                     /locus_tag="AJ81_01315"
     CDS             241129..241485
                     /locus_tag="AJ81_01315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="AJC73062.1"
                     /translation="MVKVGDVVKSKVTQITKFGAVVTLENGETGFIHISKIANQYVKN
                     VEDFLKQGQEVTARIIGKTRDGKWELSLKEEKSQEEQKDAKKAEFEKKLARFLRDSEK
                     KFAEYKKRAEKKGGRF"
     gene            complement(241486..242664)
                     /locus_tag="AJ81_01320"
     CDS             complement(241486..242664)
                     /locus_tag="AJ81_01320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73063.1"
                     /translation="MLWLFLTSSLIFGAAHELFVRSFENNMMELSLRPIYTAGEQPKL
                     YLFTQTGHRLAKVTKENSFTFDVSSTDWIIVEGFGKSSLGYPMRGVRPTFLKLSSYRQ
                     DPHVFFFTDPEKYLFYIGVRLPQDWKLLDCDFQNLKFRRFSFNGLLYLYTPDKPKDGI
                     HTLKLTFELPYGLRKTTSLDVFVFHGLVNSLRGSTTPMRVEPVAPYTHVVKPGETLWS
                     IANMYGLTIPDLELANGISDGNRIVSGTVLKLAKVYFDSSLTSIVINTATGRLALYYN
                     GFLVKVFPVAVGRSDMTPPGTYWIMKKEIDPALYWFGEYIPPRSPINGLGTRFFQLSN
                     PTYGIHGTTKPWEIGKRISHGCIRMFNQDIETIDAFIDVGTKVVVVRNTEEFPINWTF
                     "
     gene            complement(242615..243796)
                     /locus_tag="AJ81_01325"
     CDS             complement(242615..243796)
                     /locus_tag="AJ81_01325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/pantothenate metabolism flavoprotein"
                     /protein_id="AJC73064.1"
                     /translation="MKVLVGVTGCIALYKVLGLVSSLRKDGHELRIIMTESAQKLVSK
                     DLFSAVGNCPVYTDEDAFNIKDGWIPHTELSRWPDVFVVAPATANTIAKIAHGVADNL
                     LTMVSLAFAKDKRLLVPAMNVRMFENPITQENIEKLRRMGWWVLDPAEGHLACGEMGR
                     GRYPENEVVQEAIYILGSDKPLRDLRLLVTAGPTWESIDPVRVITNRSSGKMGFEIAR
                     MAARLGAEVTLIAGPTCLRPPFFIKEYVSIESAQQMFEETMKRFESVDGVIMAAAVAD
                     YTPALKSSSKLKKSEERLSIELIKTKDILEELGRKKSKQILVGFAVETEELETYAEQK
                     LRKKNLDMIVANEVQAMGSDQNTVTIIKRDGSKKRVGPDAKDRIALAILDELAHLWRG
                     S"
     gene            complement(243801..244031)
                     /locus_tag="AJ81_01330"
     CDS             complement(243801..244031)
                     /locus_tag="AJ81_01330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="AJC73065.1"
                     /translation="MSKQILHYDRLSQKIPYKYAIPIAVAKRAEALKEYAKPYVTPIE
                     NNPVSIAFQEIQAGYVRIKNEEILRILLPNVK"
     gene            complement(244028..244651)
                     /locus_tag="AJ81_01335"
     CDS             complement(244028..244651)
                     /locus_tag="AJ81_01335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="AJC73066.1"
                     /translation="MAGVLYVISGPSGVGKTSIIEGVMKRVKNLVFSVSCTTRPKRPN
                     EVEGRDYFFVDEETFMRMMKEDEFLEWAIVHGYYYGTPRRFVEEQLRSNVNVILDIDV
                     QGATTVMKKVKDAVFIFVAPPSFDELKKRLLKRGTERQEDMIKRLEDAKKELEQIPKF
                     QYLIVNVDLQESIDQLTSIIVAEQLKVNRVIERLGFHKIFSDGGDSK"
     gene            complement(244656..244931)
                     /locus_tag="AJ81_01340"
     CDS             complement(244656..244931)
                     /locus_tag="AJ81_01340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73067.1"
                     /translation="MYGLINIGFGNVISGDRVIAIVNPESAPLKRLKEEAKDEGKLID
                     ATYGRKTRAIIITDSNHIILSAIQPETIAQRFKQSMVEIEETLSKVR"
     gene            complement(244955..245833)
                     /locus_tag="AJ81_01345"
     CDS             complement(244955..245833)
                     /locus_tag="AJ81_01345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73068.1"
                     /translation="MPKSMTGYAKVERISKEYRVSCEVKALNSRYLNIELNCPSFLSS
                     REIELTKLIQRYVKRGKVFLKLFVEFLVPPADALRIDFGLAKAYYDGLEELVTKLGIP
                     EPVNLDQLLRFRELVKFELSEEQEERIWKICEEVVEEALQKLDLEREREGQQLSKQLQ
                     AIVEGLNALTDKLRETANGVLPPLKEKLRNQIQQLLDNAQIDANLFENLVAMSLQKLD
                     IREEIDRLETHLSKTMELLSSKEAVGSHLDFLAQEILRELNTVLSKSEDAGLIDLALR
                     GKVLISQFREQVQNLE"
     gene            complement(245921..248098)
                     /locus_tag="AJ81_01350"
     CDS             complement(245921..248098)
                     /locus_tag="AJ81_01350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73069.1"
                     /translation="MKRVLTLLLSSILGLLLFGIVISDVRFVGLVTISEAELLPLVKN
                     YLGVELKDEAIQDIAKQIFDTGYFSSLEPKLVASEGRFVLQIVVQENPIVRDWKINLE
                     GAEIVKATELASAVTLEKNKALSMVKVKESLSAMKKMFEDAGYFLVELSGDFKDSVYV
                     FNVVPYALWDIYFEGETEGLDISQVRNQIKISTLKDFYTTPAFLRFLIKDIKRCYPTV
                     SDISSVFSTLANYVYFGKETSVDFEKIEIPNVSEKAVVMKVKVVQPKFVPEEGKVYEK
                     IEFSGNNLIGSEQLRKVVSVSEYRLVRNPDVLRSMQAIIDLYKQNGYPMCHVVPVDED
                     ETLRFNIVEKYVANVEFKGFDRTKIYVVEDLVTFRSGEPLTEKDFYDTTSALNRTQFF
                     DGVAVYPVGTPENRDVTVVVEVKEKDKKFTLSGGISWSPVKDRPWYEGFFGELSFSTM
                     NPFGYGQTFSTTLKLGFESRLVQFDYSIRKPFQIPATLGALFSYEWTDGTQVLKVGGN
                     ASTLRFSGHAFGGGVTYENRMYSDFKENTLILSGNYSYDTRSDPIFPARGQYIYLGVD
                     KAGLFDFLADRDYWKFRLDARIFVPVWNDQLVSAFRFFTSAVLFEQYENPGTTPETIL
                     FYGIDSVRGMDGGKAKAGILASGELRYNLKSQTLPMYALVFVDVGGTGETLSQPTLSL
                     TAGPELDVAIPLLGVLGFGVAYNFNGQWTWDNFKPFFRFGAAF"
     gene            complement(248095..248655)
                     /locus_tag="AJ81_01355"
     CDS             complement(248095..248655)
                     /locus_tag="AJ81_01355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="AJC73070.1"
                     /translation="MGLRTIVDHVMDIVQNSFKAGARNVHLKISQTRDTFCFTVEDDG
                     TGMTQDELNRVFDPFYTTRDPKVRRVGLGLPFLKQACEATGGFVKLESEKGKGTKLTA
                     CFNTSHVDCQEVGDLVGCLVTLLTGTPEGVELCIERCYEDACYEISTSRLIEIFSDLS
                     SPIVISSLYDVIDQLEKSLFEGEVSK"
     gene            complement(248646..249356)
                     /locus_tag="AJ81_01360"
     CDS             complement(248646..249356)
                     /locus_tag="AJ81_01360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="AJC73071.1"
                     /translation="MKADLHVHSCLSPCADITMVPSVVCSKAKEKRLDIIAICDHNSC
                     ENLESFTKACDVPVLGGIEITSQEEVHVLAYFRSIEVANTFCEVLKRHRLKVEFDPET
                     LGYQLLVNENDEFIAMEEGYLHIAVDMSLEKIVELIFAFDGVPVYAHVDRQFGVLYQL
                     GIFPTNDRVRMAEVRTKEGWQKVLRSGYVPLTNSDAHRPDEIGCRFTRFDLDALSIEE
                     FFDFLKNPDPSKVLTIWD"
     gene            complement(249356..249688)
                     /locus_tag="AJ81_01365"
     CDS             complement(249356..249688)
                     /locus_tag="AJ81_01365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73072.1"
                     /translation="MKLSEIVKTLNLEICCGNCEVDVRYGCVGDLLSEVMAHAKSDSI
                     WVTVQSHVNIIAVSVITGIRAIVLCNAHSFSNETIEKAKAEGVCLLRTDKSPFEIVGR
                     LYGMGIEP"
     gene            complement(249685..250632)
                     /locus_tag="AJ81_01370"
     CDS             complement(249685..250632)
                     /locus_tag="AJ81_01370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma regulatory factor, serine/threonine
                     protein kinase"
                     /protein_id="AJC73073.1"
                     /translation="MEKVLDHVQSFFLDMPVLEVMNPNVISVRPDRTLRQVKEILRIK
                     RISGVPVVDSERKIVGIVSIEDIIKALEGGYIDEKVQDHMTKNVVCLKSSDTLKEVIE
                     TFEKYSYGRFPVVDENNRVLGIITKNDVMMALLAKLGLVYLHDERRKEVLESPDYFGR
                     SLITGESLDKSGADFFFPIDYYDINLAGVGASKLRQFLLSKGVDPETARRVAIATYEA
                     ETNVVIHSGSTGAIYCFIKPDSIFVRVEDTGKGIDNVELAMKEGYSTAPDYVRELGFG
                     AGMGFTNMKRCSDNLMVVSKVGAGVVVEMEFRRNKEGSR"
     gene            complement(250636..250989)
                     /locus_tag="AJ81_01375"
     CDS             complement(250636..250989)
                     /locus_tag="AJ81_01375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73074.1"
                     /translation="MKLAEILAELKAKVLANAHKVDQMQFEHAAASDLMSEVLAIAKP
                     DVILITGLCTPQVVRTAEVVGIPAVIVVRRESLPSETVEMAEVAGIVLAATKMSMFEA
                     CGRLYAKGIRPIWEV"
     gene            complement(250995..251624)
                     /locus_tag="AJ81_01380"
     CDS             complement(250995..251624)
                     /locus_tag="AJ81_01380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="AJC73075.1"
                     /translation="MRIDVLDHGFVELVDHMGDDTSVVRAARICHASQPGDEERDRQL
                     IEFLMKNRHETPFEHVTFTFHIKCPIFVARQWMRHRIASYNELSGRYSEYEDEFYVPG
                     KDRLDEKSIEKIEKTYRLAYETYQELIASGVRREIARMVLPVALYTQFVWTVNARSLM
                     NFLSLRADSHAQWEMQQYALAVAQIFKSICPKSYEAFVRYTYRGDLLKG"
     gene            complement(251627..252403)
                     /locus_tag="AJ81_01385"
     CDS             complement(251627..252403)
                     /locus_tag="AJ81_01385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471256.1"
                     /note="similar protein in Methanocaldococcus converts GTP
                     to 7,8-dihydro-D-neopterin 2',3'-cyclic phosphate as the
                     first step in methanopterin biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase"
                     /protein_id="AJC73076.1"
                     /translation="MKDVQNQKDDRNVYLQRVGIRNLSYPITVMDKTNGYQDTVAKIN
                     MYVDLPEHFRGTHMSRFVEVLNKYRLGIDPKLIRQMLEELRTKLKASTARVEIEFPYF
                     LVKEAPVSGQKSFLSYTCRIEGQKTFEKYDFLVGVGVPILTLCPCSKEISEYGAHNQR
                     AVAWINIRSRKLVWFEELIEYAEQAASAPVYTILKRSDEKYITERAYENPRFVEDVAR
                     EIALKLNADERIFWYRVEVESFESIHAHNAYACVTKYKEE"
     gene            complement(252375..252764)
                     /locus_tag="AJ81_01390"
     CDS             complement(252375..252764)
                     /locus_tag="AJ81_01390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-pyruvoyl tetrahydropterin synthase"
                     /protein_id="AJC73077.1"
                     /translation="MFFLSKEFVFDAAHRLDKYKGKCENLHGHTYRLRVTLVGLPDEE
                     GMIMDFVELKRLVHEQVISLLDHNYLNQIIPQPTAENIARWVWNKLEPLLKNERRKLY
                     EVTVWETADSFVTYRGSNDERCAESEG"
     gene            complement(252769..253551)
                     /locus_tag="AJ81_01395"
     CDS             complement(252769..253551)
                     /locus_tag="AJ81_01395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74631.1"
                     /translation="MTGLFEIYQKSLLAGILTAISTAIMGVHVVFRRMAFFGDAIAHV
                     AFAAAAIGVILGFSSFFSAVVLSVLVSLLLGKLSRKSVSEDAAIGVLFSLTMAVGIVL
                     FSVAKKQRSLTAYLFGDVLTVTKSDLLHLSIVTGIVILFNVVFRDALIHFTFDEDFTR
                     LMHPKIDVVYQLFLAILAISVVVGVRTVGVILVSAFLIIPASTATMSFKDYRWAFIFA
                     PLISSISVVLGLFLSLVIDAPPGALTVLIQGVMFFTALFVRR"
     gene            complement(253548..254261)
                     /locus_tag="AJ81_01400"
     CDS             complement(253548..254261)
                     /locus_tag="AJ81_01400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_175198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter ATP-binding protein"
                     /protein_id="AJC73078.1"
                     /translation="MENVTVVLNGQEVIKDVSFSIKKEGLYVIVGPNGGGKTTLVKTI
                     MNLLKPSSGSIHIFDQPNHEYLQRNVVGYLPQRSSFRRSFPIRVYDVVKMGLREGKNE
                     KDLVLAALEKVGMRQFSQANFSTLSGGQQQRVLIARAIVSHPKLLVLDEPVTGLDYES
                     QNEFYLLIKSLVQDGTTVLMVTHDVGFAMDFSDQIFCINRTLVCHVSAQEKFSMDSFL
                     VKLYGYGVKPLTHRHGEGE"
     gene            254343..255170
                     /locus_tag="AJ81_01405"
     CDS             254343..255170
                     /locus_tag="AJ81_01405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="AJC73079.1"
                     /translation="METSKRFEQVRERQKRLEENMARIKHKLAILSGKGGVGKTTVAV
                     NTAVALAEEGFKVALLDLDLHGPNVPRMLGIEDAPSARDGLIVPVKYGPNMLVLSIGM
                     IVEPEQAVAWRGPLKHSAIMQFLADTDWGDLDFMIFDLPPGTGDEAMSLMQLVKLDGI
                     VLVTTPQRVAVDDVLRAMHFSQEMGHRVLGFVNNMAYLICPHCGKRIETFGDDSSSVL
                     SQLLGLECLATIPLEPRLAKFLDEGKTALMYMRGTEVEKAFRELAANILSRLGGERA"
     gene            255185..256306
                     /locus_tag="AJ81_01410"
     CDS             255185..256306
                     /locus_tag="AJ81_01410"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74632.1"
                     /translation="MSHFITDFFVSFLNPLAPFFMRKFDIGVKEIALLITSISFFSSI
                     FQIVFGMIASRLESLKRGLLASMLLTVGSMALVGFSRNIVVLLLLFLMAYFGNSAFHP
                     IGAVMARGSSPYSLSIFVAAGTLGTALGPVFVTQFVSRYDFEKLWIVSIVSVVTFLML
                     YMRQPEKVNASKVKDHTRFRDNLQGLRRIIVLWFVVTVRTLVITLSNTYGPIIASKRG
                     LPLTFGGLLLTLGVGLGVATTMVGTWMSERFGNHITNLVSFAGMAIGVLILAQPVSAL
                     MLVVGYLLVNGCGYLTMSTNVAHAQQLMPENAALASSTVMGFAWACGVALRYLLILPF
                     GENIMAQLIVLFVISIVMVPISVLKIERNHTVLNGRGGY"
     gene            256303..257313
                     /locus_tag="AJ81_01415"
     CDS             256303..257313
                     /locus_tag="AJ81_01415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73080.1"
                     /translation="MKERNVALYYTLLYTAIVMFLWIVFKPFFQICLFSFILVMLVDA
                     IASLLKKFFRLKRKRIATILAMVVFFFLFAWALVEVLPKAFTQLADFYNLVSKVIREK
                     AWQEYLAQQEGLAKLLNDLADFLVPYLDKLLEFVLKWIAANVPNFLVVTFFTILCGIY
                     ASFHAGAIARFIPNLYPATCRSFVDGFVNDFKVSMRRFIGVLVLNAMIVGLAFGVLFT
                     FLSPRYAPLIGIWAFVTNLIPIVGVPLELVPILLFSLTLGLGTLLWVFVFAFIVHLFV
                     FVLFFEVTKTTMRVNPVLMILSIALGGMLFGFAGVFVGAPMAAYATIFYKHFLKARFE
                     ET"
     gene            257310..258455
                     /locus_tag="AJ81_01420"
     CDS             257310..258455
                     /locus_tag="AJ81_01420"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74633.1"
                     /translation="MTVKSFLLIVLLLFVLNILAQSLEELEKNWDELLQRILREPESD
                     QLIELGKKLSAKRRLAQLESLRDSVLEEKLDKFVRDLSEMSETREDLLDECFVLFPKL
                     KEDVANFEHGDFLKLNSVSALWKLGYRAILPQGFAEWLVQRFLSDPFLVDWNLVFLLK
                     NSLNKNDVARQIRQECEKLKDKEESYSALYRLMVLAKQLDGLDSQFENELSRYIELMT
                     ALERLPAERFSEEEFEKFSRAIDALNLKKDNLKAILSHLAERSGIQDAVMRELGNDRS
                     NLQRVVARWKFRVDLMILVVSAFFVTLFLLPRKLKISFFAFFKAYRIAIWLCQKELSK
                     DPTDIRLRTQLAMFYERIGENEKAFQQYKIVRDLSRMVKKDRILPRA"
     gene            complement(258424..259836)
                     /locus_tag="AJ81_01425"
     CDS             complement(258424..259836)
                     /locus_tag="AJ81_01425"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9WZS2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter MatE"
                     /protein_id="AJC73081.1"
                     /translation="MKYSLLKHSVRGSELRFISKQLLKLAIPSMAENLLQMLFGMVDT
                     AFLGHLSWQAMSGAGLANQLIFVFQVVVVAAAVGVNVIVSNATGVGNKHKASGSLWNG
                     VHLCLLWSAALMILAPFSSNFLKIFGNVDSVVFDYASTYLKTILFGMPSMAMMAVLGA
                     ALRGSGDTKTPMFVTGIANSLNVFLDYAMIYGKFGFPRMEVFGAALATVISRFVGSFM
                     LLLAIMKNPHLNEDVRRAIKLDLANFRDIVSVGLPAAGENFMFSSGLLIFASILLASG
                     PMAYAGHRIGISIESLSFMPGWGISVAVTTLAGQYNGRRRLDKVTAVARQGFIIAALI
                     QVSVGVFIFLFPELLINLFTNQAEILQLAKIPVRLVGLFQIFLALESSMNGVLRATGN
                     TTFGMIVSTVSMWAIRLPLAYLFSVKLGLGLLGAWLGMMIDMSFRSVVKLLFYMSGSW
                     EKMAMKVSSKVTHVGGSDLS"
     gene            259937..260512
                     /locus_tag="AJ81_01430"
     CDS             259937..260512
                     /locus_tag="AJ81_01430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="AJC73082.1"
                     /translation="MGGYYSLKDQTLRITSEVNGQRVIVINTGAEDVFTKLLLDRAVF
                     VTTDEEFLKLADPRSIRLVMNPTKLSFAPETFDAAVLFFTFFYLPKHEAIIENVNRVL
                     KKWGKLYIWDAVIPKKMAHKSFFVVPLLMDTGQELIRTVHVTKWRREQPVGLVKKIAR
                     ERGFKVTKEELYDQIFHLEMVKIASLKQQKF"
     gene            complement(260515..261825)
                     /gene="fliI"
                     /locus_tag="AJ81_01435"
     CDS             complement(260515..261825)
                     /gene="fliI"
                     /locus_tag="AJ81_01435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471519.1"
                     /note="involved in type III protein export during
                     flagellum assembly; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase"
                     /protein_id="AJC73083.1"
                     /translation="MSEPAKFLRQFKEKLNSTEFPKYNGKIVRIVGLTVESIGPDAFL
                     GEVCEVDLESRKALCEVVGFKDGRVLLMPLENISGAKHGTLVFGTSRQLGVAVGEDML
                     GRILDGLGRPIDGRPLTTSKRYPLLRNAPHPLKRMRITEPLPVGVRAIDGFITIGKGQ
                     RIGIFAGSGVGKSTLLGMIARNTIADVNVIALIGERGREVREFIEKDLGEGLKRSVVV
                     VSTSDQPALLRAKALYTATSIAEFFRDLGYNVLLMVDSLTRWAMAQREIGLAIGEPPT
                     SRGYPPSVFAGLPSILERAGNSDKGSITGIYTVLVEADDFNEPISDTVRSIVDGHIVL
                     SRRLAELNHYPAIDVLASISRLMIDVVSEEHLKASRTLRSLMAAYQEAKDLIDVGAYK
                     PGSNELIDKAIKMKSLLDAFLKQDIGEKPSFEETVSTLVKLASM"
     gene            complement(261770..262483)
                     /locus_tag="AJ81_01440"
     CDS             complement(261770..262483)
                     /locus_tag="AJ81_01440"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74634.1"
                     /translation="MIIKKKQLLIDAPCIIGRKERQSNDSNNAFDPATVARILEEAKA
                     KADEILRQAEAEAFKLLNEAKEKRQKMIQEMELERQQFKKHLGELSQRLNILMSNFQK
                     QLEDEREEIFKELIDVLRILIEKIAFKSLDEVDFRQKMNRIFAKLSEVKNAKVILSEK
                     DAESFPEILKQCEEMGFEVVRSSSLKPGEVLVDTELGVLNGTKRAAVMLVEKLIEEVF
                     GPVGTSEVSQTVQRETQQH"
     gene            complement(262480..263490)
                     /locus_tag="AJ81_01445"
     CDS             complement(262480..263490)
                     /locus_tag="AJ81_01445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="AJC73084.1"
                     /translation="MPEKKQLTGKRKAAILLVMLGPEKAALVLKHLDESDVEQLTIEI
                     ANLGKITDEEKKQVLTEFQDIANARQMIAQGGIEYAKEVLQKAFGPEKAMKIIERLVS
                     NLQVKPFDFLRQADPLQLVNFLQNEHPQTIAVILSYLEPQLAGKILSAFPEELQIEVI
                     KRIALLERTSPDVIRDIEKNLERKLSGFVMQTFSQVGGVDTAAEIMNSIDRSSERKIM
                     EKLSYDSPELAEEIRRRMFVFEDIVKLDDRSVQIVLREVETRDLALALKGASEEVKQK
                     IFKNISKRAAQLLQDELEYMGPVRLKDVEEAQQKIINVIRRLEEAGEIVIARGGGEEL
                     IV"
     gene            complement(263492..265105)
                     /locus_tag="AJ81_01450"
     CDS             complement(263492..265105)
                     /locus_tag="AJ81_01450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar M-ring protein FliF"
                     /protein_id="AJC73085.1"
                     /translation="MDFLGRLKEFFSKLLDKWKGLPTASKILFGGIVVSIIVVIVIMA
                     IVLAAPGYVPLVSGLTEEQAGYIAQQLDAMGIKYRVEPGRILVSKRYNVYELRMRLAS
                     AGILGPMTRGFEILDQQSLGATSFDRQVRYQIALQGELERSIMTISGVKSARVHLTLP
                     KYTYYVRGEMVEPRASVLVVLEPGKDLSQTQIKGIMQLVAGAVEGLKLENVRVIDQYS
                     RVLSDRVTSSAEMLVAADRTELKMNLESYYAKKIKQTLEAVFGAGRVEVIPDIKLDWE
                     KIERQITKYEPITRQGGLIRSQEQESEKSVNIPPTGGPVGTEANIPPTYPSLTPQGTA
                     TYERTRTITNYELSSIVENLVQNKEGEIRSVSLSVIIDASSSVFSGFNETEMNRWARI
                     VSDLVEKGIGASSSEQNLSVSVAFLPFDRSLEEEFRKSQLELEQRRRYTAMMLGLSLL
                     AGLSFLLIYLIILQVRRVKARKAIETRKVKMEEELKRMLEEEKVKEVPLSPEEKALQE
                     LRENLEKVFKQDPEEVASVIKLWLVERGT"
     gene            265267..265809
                     /locus_tag="AJ81_01455"
     CDS             265267..265809
                     /locus_tag="AJ81_01455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_227966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73086.1"
                     /translation="MDWTISVEDVLLKKRLIIQGIFETEYVDAPNARCRVIEPIEVKI
                     VVVAARDGIAIGGYARTTIEHPCDRCLKPVLLPINGTIEALYKPVSEMPVSDQEELKS
                     LRNVLYYDSDRIDLTDRIIEAIVVEIPMKVLCSDDCKGLCPYCGADLNEEKDHKCTEE
                     SVDPRWKKLFLVKQNLTKEG"
     gene            265813..265995
                     /locus_tag="AJ81_01460"
     CDS             265813..265995
                     /locus_tag="AJ81_01460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="AJC73087.1"
                     /translation="MANPKQKRSRSRTHMKRAKIYRPISVPMAVCPNCGQPKLPHRVC
                     LHCGYYNGKQILEVAE"
     gene            265999..266988
                     /locus_tag="AJ81_01465"
     CDS             265999..266988
                     /locus_tag="AJ81_01465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001305724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acyltransferase"
                     /protein_id="AJC73088.1"
                     /translation="MPRIGLDVMGGDKAPVEIVEGARQFLADGKAELILVGTKQALKD
                     IDNVEKVEVNDFLPMDVRPTEVLRRKNSSMYVGLQLLKEKKIDAFVSAGNTGALFAGA
                     TFVLGRIEHVDRPALAVPVPSLKDFTILIDAGANVRVRAEHLLDFAVMGLAYAKVLGK
                     DRAKLGLLNVGEEENKGDETTKEAYELLRTHLAENFAGNVEGHDINAGKVDVVVCDGF
                     SGNVAMKTMEGTAKMIVTILKEQIKRSSFFAKLGALMLSRTLRKMMEKLDPRTYGGGF
                     ILGVNGLVIKAHGSSDRKAIKNALEVALKGVQMNLVEKIAGEIARVRDSGAGR"
     gene            266960..268780
                     /locus_tag="AJ81_01470"
     CDS             266960..268780
                     /locus_tag="AJ81_01470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase"
                     /protein_id="AJC73089.1"
                     /translation="MCGIVGLVGEIVVSDLIEGLEKLEYRGYDSAGVAFLRDSSLCVE
                     KNKGRVASLKEKLSELLNERITLGIAHTRWATHGEPNDINAHPHTDCQSKLCVVHNGI
                     IENFKELKKRLEEVGHRFVSDTDTEVIPHLIEEYYTTDLVEAVRKAVKLLEGSFAIAV
                     IHVDHPDIIVGTRKGSPLILTVGNGVAGIASDVTPLLKYSKDMVFLEDGDIFCVSKGG
                     FEVFDVVGRKKERKPTHIDWTYETAQKSGYKHYMLKEIFEEPSCVAATLSGRIKSAKV
                     HLPEIEELQDLLASSKTLKVVACGTSSYAALSFKYFLENLSDVCVDVEVSSEFRYKRP
                     NFDENTVLVAVSQSGETADTLESVRLAKSKGAKVLAITNVVGSTLMRESDHTLLLNAG
                     PEISVAATKSYVTQLVLLYLLGLKIVELRDQWNERCTKLIDSLLRLPEVLDATLSRAE
                     HIKEVALKYKDFQHFMYIGRGLGYPTALEGALKLKEISYIHATAYPAGELKHGPIALL
                     GPEFPVFAIAPFDALYAKMKNNMIECKARKTKLVVLTSDDCEDVREIADDVLSVNSFS
                     EQLYPVLMAPVIQLFAYYIADALGHDPDKPKNLAKSVTVE"
     gene            268785..269117
                     /locus_tag="AJ81_01475"
     CDS             268785..269117
                     /locus_tag="AJ81_01475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002534083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73090.1"
                     /translation="MEFLKKLFDLMNEKEAINTVVLDMRKTPMPADFFVIATANSQTH
                     MGTLRNAVVEFFLTNGHSLIYYDKGEGYDWLLIDAGDIVVHIFTTRGREFYDLEGLWS
                     DAVKLFQA"
     gene            complement(269108..270040)
                     /locus_tag="AJ81_01480"
     CDS             complement(269108..270040)
                     /locus_tag="AJ81_01480"
                     /EC_number="4.1.2.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471509.1"
                     /note="catalyzes the formation of glycerone phosphate and
                     glyceraldehyde 3-phosphate from fructose 1,6,
                     bisphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="AJC73091.1"
                     /translation="MPLVSSKGMFEKAYGKYAIGAFNVNNMEILQGVIEAAKEERAPV
                     ILQISAGARKYAKQVYLIKLIQAALEDAPDIPICVHLDHGDSFELCKAVIDTGFFTSV
                     MIDGSHLPFEENVKLTKQVVDYAHPRGVVVEGELGRLVGIEEHVVVSEREAFMTDSDK
                     AVEFVERTNVDSLAIAIGTSHGAYKFKGEAKLDFDRLREIANRLPNFPLVLHGASSVL
                     PEFVEKINKYGGKVEGAQGVPEDMIRKATTMGICKVNIDTDLRLAMTATIREVFALHP
                     EEFDPRKYLGPAREAIKQLVKHKMRNVLGCSGQA"
     gene            complement(270072..270161)
                     /locus_tag="AJ81_01485"
     tRNA            complement(270072..270161)
                     /locus_tag="AJ81_01485"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(270125..270127),aa:Ser,seq:tga)
     gene            270210..271064
                     /locus_tag="AJ81_01490"
     CDS             270210..271064
                     /locus_tag="AJ81_01490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="AJC73092.1"
                     /translation="MLVLGLDGGGTSLKATLAKDGRAIKRKIFEKGVNISAVSAEELE
                     RTIKEVRGWSGPVDEVRAAFSGAGDPERKAVLTAVLEKFFAKSSRMILSDAEALIACL
                     YEGKPLTIAIAGTGSIVVGIDENGRFVRAGGWGHLFDDEASAFSIVKSIIVEALLHVD
                     GLVGHDPVFHELLNYYGFDKLEQLANLQRFSDFKEKIASFARVMPNTQLVKRIMKKEL
                     KLFTDRVRQVLALTNADRVLGFGGMFLNEEYRNIFCSMLRDVEFEHLKLHLDEALATK
                     TNLKVGFK"
     gene            complement(271068..271144)
                     /locus_tag="AJ81_01495"
     tRNA            complement(271068..271144)
                     /locus_tag="AJ81_01495"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(271108..271110),aa:Pro,seq:tgg)
     gene            complement(271213..272544)
                     /locus_tag="AJ81_01500"
     CDS             complement(271213..272544)
                     /locus_tag="AJ81_01500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase U62"
                     /protein_id="AJC73093.1"
                     /translation="MRGEAFYRNLFRLMNEHFIGLKFLAVVWEQDQALTRFANSRIHQ
                     NVAERKASLSVLATRGNKIALATSNDLTVPGLKALKEKLETMLEFATPLDYEFSLPEV
                     SVGYPVENVAESLKKVFAEQRASVFDRMLKIAPNDVQLFGYVSDNVTENVIMSSNGTF
                     LYQSFGGVSFNVVAMCDSASGYASGVAKSYEELSVDEKVERAVRFAKMSKNPVEIDPG
                     SYTVILGPEAVSDLFMYFGWLCTNGYTHELKISPSAKYLGTKIGPSELNVYDDPTHPL
                     QLPFVYDLCGKKREKMAIIENGVFKNVLYAHGAALRFNKKPTGHTFSLDDLDNSVPVN
                     LVVDAANTPVEEILSNTKSGIYVNRFHYMNIVDPQEAIFTGMTRDGTFLIENGQLTKA
                     VKNMRFNVKFFEFTQNIEAISKEIETVASEYFPQIAPYMKVQQFNFTSKTA"
     gene            complement(272541..273986)
                     /locus_tag="AJ81_01505"
     CDS             complement(272541..273986)
                     /locus_tag="AJ81_01505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C69"
                     /protein_id="AJC73094.1"
                     /translation="MQEKLEKLLNFLVSKGARYADVRYEEHARQELFVENGVLKSFTH
                     SVDVGTGVRVLYENGWGFAATDERGDSALERTALKALEIAIASNKRANKEVKLAPEPV
                     HRAAFKSWVMKDPFLISDNEKIELLKSATLKMKENPRVVRATGSMSFRKIDKLFLNTE
                     GSVIYQEIYVTGAGIEADALGEAGFQRRSYPASFGGDHATRGWEFIEEMKLLDHAPKV
                     AEEAAMLVDAPEIEPGEYDVIISGNQLALQIHESCGHPSELDRVMGSELSFAGGSFLT
                     LDKLGKLKYGSEHVNITADATIAGGLGSFGFDDEGVEAQKSYIVQNGLFVGYLMDRQT
                     AAELGLRSNGAARADSWSHPPIIRMTNINLLPGNCTLEELIAGIDYGFLLDTNKSWSI
                     DDLRLNFQFATEIAYEIKGGKLTGKIFKNPVYYDITPNFWNKCDGIANESYWHVWGVP
                     NCGKGQPMQVMHVGHGTSPARFRRVKVGVRR"
     gene            complement(274025..274189)
                     /locus_tag="AJ81_01510"
     CDS             complement(274025..274189)
                     /locus_tag="AJ81_01510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73095.1"
                     /translation="MKPDPIQRLMKHYPRIVVIKAALMILQSGQKMSEENIERALKQI
                     LSDDEEESRD"
     gene            274269..274344
                     /locus_tag="AJ81_01515"
     tRNA            274269..274344
                     /locus_tag="AJ81_01515"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:274302..274304,aa:Met,seq:cat)
     gene            complement(274938..275612)
                     /locus_tag="AJ81_01520"
     CDS             complement(274938..275612)
                     /locus_tag="AJ81_01520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA:3-ketoacid-CoA transferase"
                     /protein_id="AJC73096.1"
                     /translation="MIQDPKIARTVIAKRVALELKDGDIVNLGIGIPTLVANYIPKGV
                     TVFFQSENGILGMGPAPEPGYEHPNLTNAGGGPVTFLPGAAAFDSATSFGLIRGGHVD
                     ITVLGGLQVDEEGHLANWMIPGKLIPGMGGAMDLVTGAKKVIVAMTHIEKNGVSKIVK
                     KCTLPLTSVRRVDLIVTDMAVIEVTEKGLLLKEIAPQTTLDEVLNYTAASLIVPENIP
                     TMPIDL"
     gene            complement(275609..276267)
                     /locus_tag="AJ81_01525"
                     /note="acetyl-CoA:acetoacetyl-CoA transferase subunit
                     alpha; disrupted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(276282..277484)
                     /locus_tag="AJ81_01530"
     CDS             complement(276282..277484)
                     /locus_tag="AJ81_01530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="AJC73097.1"
                     /translation="MRKVYIVGAKRTAIGTFGGSLKDVPAVQLAVTAAKAAMEQANVK
                     PEWIDETIVGNILMAGQGMGPGRQVGIYAGIPAEKPGYTVNMLCGSGMKAIMIGATDI
                     MMNEAEIVLAAGMENMSMAPYLLQKARFGYRLGNGEIVDHMVYDGLTDVFNMYHMGVT
                     AENLVEKYGISREEQDLFAYKSQMKAKKAIESGRFKDEIVPVVIKEKKGEKIFDTDEH
                     PRFDTTLEALAKLKPAFKPNGTVTAGNASGINDGASAVILASEDAVKKYGLKPMAEIV
                     SFAQHGVDPAIMGIGPVGAISKALAKAKMKLTDISLIELNEAFAAQSIAVLRDVKKEH
                     GVSDEWLEERVNVNGGAIALGHPIGASGNRIVVTLLYEMKKRGVELGLASLCIGGGMG
                     TAIIIKNV"
     gene            complement(277500..278829)
                     /locus_tag="AJ81_01535"
                     /note="short-chain fatty acid transporter; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            278957..279358
                     /locus_tag="AJ81_01540"
     CDS             278957..279358
                     /locus_tag="AJ81_01540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001409951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="AJC73098.1"
                     /translation="MWFKIDFTSHVPVYKQIKEKLKLLILTGELKPGDFVPSIRTLAD
                     DLKVNVNTVARAYRELAMEGVLEPVRGEGYLVRQLNGEGFIRSNIENFIDAVERCKEV
                     GIGIERLMSLLKEIYGRRDDGSEREELGEEL"
     gene            279321..280106
                     /locus_tag="AJ81_01545"
     CDS             279321..280106
                     /locus_tag="AJ81_01545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="AJC73099.1"
                     /translation="MVLSVKNLVKSYRNKRAVEGVSFDVEKGQIFALLGPNGAGKTTT
                     MKCVLGLRKADSGEITINGSYSYLPEQKELYRYLTVEKMVRTNNRINRRFDAKKALDL
                     LEEFQIPLKEKIANLSHGMNTLAYLSLVLAEDVDLYLMDEPTWGLDPLMRNRVLELVR
                     TMPQSGKSVLYTSHILSEVEKIADIVAIMVKGRIVEMDNLDNLKEKYVACVVPKGEKL
                     NGYLYRSTKEEDVYIVKRSEANGKIQPADFDMIFEALVKGVKI"
     gene            280106..280867
                     /locus_tag="AJ81_01550"
     CDS             280106..280867
                     /locus_tag="AJ81_01550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73100.1"
                     /translation="MHKELADMKLRSIVIFFLGAGLFFFVAPFHRLTLEMLNEYTQLE
                     NMPKLLERFVPKNFVERLSDWSFYIYTQWFGKNLGQFVPILAIIIAFPLFARETENGT
                     MEFLLARSSRKKVFWSKSCIAIAVLTVEMLVFSLLPGIYSLLASKDLKYELLGAYTIH
                     TLVGALFWFTLTMLFSVMYDDQVKPILTAVGILASSTVIGIFKPLRFMNTYSYILGSK
                     IISTGKMDVIYTVSLLTVIAVILLSSYAIFLKKEF"
     gene            280880..281200
                     /locus_tag="AJ81_01555"
     CDS             280880..281200
                     /locus_tag="AJ81_01555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_003346071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73101.1"
                     /translation="MILTTTEKLEGYEVVETLGLVMGNVVYSKHLGKDIAAAFKTLAG
                     GEIKSYTELLTEARNIALQRMIAEAEKLNADAVIGLRFGGSSIMQSAAEVLAYGTAVK
                     LRKL"
     gene            complement(281181..282335)
                     /locus_tag="AJ81_01560"
     CDS             complement(281181..282335)
                     /locus_tag="AJ81_01560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004661077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="AJC73102.1"
                     /translation="MDSSILLSAAEVFGTPFYFYDLDFIRDRVRKVYDFFNQFDFHLA
                     YAVKANFNFEILSMLNELGTMVDVVSFGEYERVRKAGFTPERIVVNGNCKSVGELKKY
                     VEDSVYCINLDSLEELLRLESIADRPVRVAIRVNPDVDPKTHHHIATGLKENKFGVDY
                     DTAERMIQIISRSRFVRLVGLHCHIGSQIVEVDPYRQAFESMRDFASKLNLQLELVNL
                     GGGWGIDYGDGKQLDLEEYRRNVFPILEDFNCRIVLELGRWIVGPAGYLISKVEYVKK
                     TKNKNFIVIDAGMSHLIRPALYGAKHRIEPLYEQKDRPTIVADVVGPVCESADTFAKN
                     LELPEPQEGELLIIRDVGAYGYVMSSHYNLLRRAPEILYSKETGFRVSSA"
     gene            complement(282359..283105)
                     /locus_tag="AJ81_01565"
     CDS             complement(282359..283105)
                     /locus_tag="AJ81_01565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="AJC73103.1"
                     /translation="MIQLERVTVIYNRGTLDEKVALKNVDLLVEEGQFVVIVGANGAG
                     KSTLMKVVVGEVKPTFGVCRIMGQVLREEKIFKCGSIVCQDPNLGIFPNLSIEENLML
                     ARKKGFRGLSFGRVDPRAIELLRSCELGLEENLKKKASKLSGGQKQALAMVMAVSSNP
                     KLLLLDEHTASLDPKSTEKIMELTDRINKTLGTTILMITHDMNIAEQYGDTVIVMEDG
                     KIIARIDKSKQKVQASQLKSMIKSKLTATT"
     gene            complement(283102..284064)
                     /locus_tag="AJ81_01570"
     CDS             complement(283102..284064)
                     /locus_tag="AJ81_01570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="AJC73104.1"
                     /translation="MIAILEQGLLLALAAMGVYISFRLVDLPDLTPDGSYIVGGAVAV
                     VLLRSGHGWVSATLLAALAAGAAGFITALISTRFRIHTLLASIMVMTGLYSVAIRVMN
                     APNLPIPRFSTEKILSYEQVVGKTPLDDILGGIGNLQYESQGMKAVTVPFNNKADGHD
                     LILIASLLLFISFLFWLFLRTELGTMLRGYGRNRFAVKVLGVNPNLFALMGLTVANFL
                     VGLSGALFSMYSGFADVNMGTGMVVVCLASVILGEIIFGSREVAYGLFFPIVGAVVYQ
                     ILLTLAMKYGYRIGFKPSDMKLLTAMFVVSVIAARRLKKSEVTV"
     gene            complement(284061..285038)
                     /locus_tag="AJ81_01575"
     CDS             complement(284061..285038)
                     /locus_tag="AJ81_01575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="AJC73105.1"
                     /translation="MSKSLAAVVALLIVSVLSFGTVKIGITQIVDHPALNAVFDGIIK
                     AIEDAGFKVGTDVVIDRQNAQGSVQNAAAIARKFASERVDIVVAIATPSAQACVQVIT
                     DRPVIFSAVTDPVGAGLIKQLGKNESNVVGISDMVPVSTHLKLIKAVFPNAKKVGVLY
                     NPGEANSVTLTNMAKAAAPSLALTILDMTGTNASEMVAAVNSVGPDVDVIYIGTDNTA
                     ASSMQAIGAAALRLKKPIVAADIDIARQGGLIGFGFNYFQVGVETGKLVVEILKGKKP
                     SELESHLLGPESLMLFINLDLAKELNVSIPQELIDRADIIVQNGQEVKR"
     gene            complement(285360..285965)
                     /locus_tag="AJ81_01580"
     CDS             complement(285360..285965)
                     /locus_tag="AJ81_01580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004761726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="AJC73106.1"
                     /translation="MDPSFSLRQAQPEDGPDFSELFLISAPFFVELFKDDTKRVLKNL
                     FVSPRNLFSFQHVCFAEIDGQIAGMILSYSWETHRKEYLRTGHLFFRVLGFKMLRIFR
                     VLLRLNAELCKLAESDYYISNLAVYPRFRGIGIGRLLMEKAEEDAKKIGSRRLVLEVE
                     ESNTIALSLYRKLGFEVVEKFQTKLSKDHSLNFCRMIKPLV"
     gene            complement(285990..286077)
                     /locus_tag="AJ81_01585"
     tRNA            complement(285990..286077)
                     /locus_tag="AJ81_01585"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(286041..286043),aa:Leu,seq:taa)
     gene            complement(286127..287731)
                     /locus_tag="AJ81_01590"
     CDS             complement(286127..287731)
                     /locus_tag="AJ81_01590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_10739180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltranspeptidase"
                     /protein_id="AJC73107.1"
                     /translation="MILPQHMVQYTARGVLSMRTAVAIQFALNVVEPMMSGIGGGGFM
                     MIYLAKENKIVVLDYREQAPAGAKPTMFLDAEGKPLPFRTAIQTGHAVGIPGTLKGVA
                     TALENFGTMSLAQVIEPAIELAEKGIMVNKVLAQSIVDSMYKFNDAAKQVFAPNGQPL
                     PEGALLVQPDLAKTFRLIKERGVDVFYTGEIAQAIVEVVQARGGTMTLEDLKNYEVKF
                     REPIRGTYRGYEIVSMPPPSSGGLTLIQMLKILEGFDIKALGHNTTQTLHLMIETMRL
                     AYADRGKYLGDSDFVKIPFKGYFDEKYIEERRALIDWQKANPNIKAGDPWFYEGSPTC
                     PASQLKNVFAMVNENETSQTTHYTVIDKWGNLVACTTTIEDVFGSGIMVPGYGFMLNN
                     EMTDFDFVPGGANEVQPGKRPRSSMTPTIVFKDGKPVFSVGSPGGARIITTVMQVIMN
                     MIDHGMSVQEAINAPRIFSSSYPTVQWEAGLPEHVKKELELRGHKIADAPRIMGSVQS
                     IVIDLETGKIYGGADPRREGTVIGVP"
     gene            287774..289069
                     /locus_tag="AJ81_01595"
     CDS             287774..289069
                     /locus_tag="AJ81_01595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_003706295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="AJC73108.1"
                     /translation="MKRRFLWVLLFVLGTFVVAQSSGNVHGTTSYDPFAYTQHPLGTV
                     WGDPLPDAPALAARGKFMVGVRTLQLFNPNQIDVINTLTSDSTIVYDRPLIVEVWYPA
                     ILEPGQVQLTIYTDFLGRSDKPGSLRPYTFLGRATRDARPNTTDGPYPLVVVSHGYPG
                     SRYLLAYLCENLASKGYVVASIDHTDSTYRDVASFVSTVVNRSLDQRFVAREILKMPI
                     WKDLCDPNAVGIIGYSMGAFGALRTLGAGLEENDIVKRYFGRFTPMIVAKPSDEPDPL
                     FKAAVLFAPWGGAVGTSPTGVWNKESLAKINVPTLWIAGSQDDVAGYRGIVNLFESAV
                     NSKRYLLTYLNALHNVAPHPAPPIAKEFDDYYRFADPVWDIWRINNINQHFVTAFFDY
                     YLKRDENAKTYLEVTPTSWPGFKPRTTVGLEFLTVDPRE"
     gene            complement(289202..289495)
                     /locus_tag="AJ81_01600"
     CDS             complement(289202..289495)
                     /locus_tag="AJ81_01600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001469717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body protein FliE"
                     /protein_id="AJC73109.1"
                     /translation="MIDGISGVGPSNVQRLQQDKTLKKAPDFAEILKEAFDKVNQVQK
                     NAEQMASDFALGKISNIHEVIIEAEKATIALRLTTEVRNRIVEAYREIMRMQL"
     gene            complement(289501..289908)
                     /gene="flgC"
                     /locus_tag="AJ81_01605"
     CDS             complement(289501..289908)
                     /gene="flgC"
                     /locus_tag="AJ81_01605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001469716.1"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="AJC73110.1"
                     /translation="MSEFTIFSVSASGMTAQRLRLDVIASNIANSETTRTERGGPYRR
                     RVPIFAEHLLDKNRTSAVKVVRIEEDPSPFRLVYDPSHPDADENGYVSYPNVNVLREM
                     VDLINAQRSYEANVSAFNVTKSMINSALQIGRG"
     gene            complement(289910..290287)
                     /locus_tag="AJ81_01610"
     CDS             complement(289910..290287)
                     /locus_tag="AJ81_01610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgB"
                     /protein_id="AJC73111.1"
                     /translation="MFNTNFQTLKVAMDVSMLRQSVHAQNIANAETPGYKRKYVVFEE
                     LLKEASRIRLATTHERHIPSSQSLPRARIELDKQAFYRNDQNGVDVDYEVTQMVANGL
                     RYEVLARLMSKNIEYYNTVLRGV"
     gene            290374..291387
                     /locus_tag="AJ81_01615"
     CDS             290374..291387
                     /locus_tag="AJ81_01615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_377488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation factor Sua5"
                     /protein_id="AJC73112.1"
                     /translation="MSMILKVDPINPAAEVMKRAAEVIKKGGTVAFPTETVYGLGANC
                     FDKSAVLRIFEIKRRPPDNPLIVHVSSLAQLDLLIDDNVERAEAIIEKFWPGPVTLIF
                     KKKAEVPKEVTGGLETVAVRMPSHPVAKMLIDLSNVPIAAPSANLSGRPSPTNAQHVI
                     EDLYGMVDVIIDAGETPLGLESTVIDLSRDRPTLLRPGPATVEEILRVVPDLYVPDFL
                     FGKGQVERPLSPGMMYRHYAPNKPIILVLDENKLDIVLMKYPDAPIVCPEEMVQNFYG
                     RRIINMGKLSKPYTIAQNLFRVLRSLDTLVADVAIVVGLPERGILFSVMNRLRKAASQ
                     VIE"
     gene            291469..292038
                     /locus_tag="AJ81_01620"
     CDS             291469..292038
                     /locus_tag="AJ81_01620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005470868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="AJC73113.1"
                     /translation="MVELYVPKIEEYMPDKVVFLARMRARYKNIVGETDLLVRFNELF
                     LQGLKISRPIVHHRVCLIEELPSALIPDSFSGVKQVSLFLSTLGKDIDELINSLLEEG
                     KTHDATVLDAWASEALEALNEAFDRRLRERFGDGTMRFSPGYGNVDVRWNKYIVELLN
                     VEGIEVLSSGIMLPRKTTTCMIGWYDEKR"
     gene            292025..294349
                     /locus_tag="AJ81_01625"
     CDS             292025..294349
                     /locus_tag="AJ81_01625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001568804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine S-methyltransferase"
                     /protein_id="AJC73114.1"
                     /translation="MRRDEFLKLLEKRVLFLDGAYGTELFKRGFRGKLVEVLNLENPE
                     MVRELQCDYTGAGADILLTNTFSANRMKLTQYGLAEFIEQINAKAVEIAKSACKTDQL
                     VFGDMSSTGTFVKPLGEIDFDEVYTIFKEQAQILIDSGVNGIIIETMSDLKELKAAVL
                     AVRDVSRDIPLIVSMTFEEDGKSVTGTSVEIFATVMNDLDVDVVGINCTLEPKQMLSV
                     FSKLAKYSKKPLCVEPNAGKPMLVGNRLVYRTSPEEFAIYMRDFVELGANIVGGCCGT
                     GPEHIKLMRNYIGERTPVQRAVTKEQFIASRTVLKPTEPFLIIGERINATGKKKLQEE
                     IRQMNFSHLVKLAQEQEQEGCAAIDVNLGLEKVLSEEHFRGVINELDRYASLPLSIDV
                     QTLNFLEICFREYVGRAVLNSATCDEKHLLPRIELIKRYGGMLIVLCMEKDIPEHSEE
                     RVKLAKKAVEILKAEGIELERVFFDPLVLPIGAKKDHRVTVETVRKLKELGLKTSIGL
                     SNLSFGLPERESVNAAFLSLCVDAGLSAAILNSKEQTTMNVLRGALTLKGEQLVQIDQ
                     IEEEPLVQYILKGQREQVMNLVQEMLKYREPLDVSQNVLAKAMERVGQLYATGKIYLP
                     HLLLAAETVQPVFDHLNSLIATGKNRLGKVLLATVQDDIHDIGKKIVATVLRSGGFEV
                     VDLGKNVPAERVLEAVKELKPNIVGLSAMMTTTVGYVKETADLLKKNGVEVFVIAGGA
                     SMNQQLAQQFGVYYARDALEALKLCKELLGGEKA"
     gene            294346..295698
                     /locus_tag="AJ81_01630"
     CDS             294346..295698
                     /locus_tag="AJ81_01630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="AJC73115.1"
                     /translation="MSVFVVKFGGSNLKNKEDLLKILEVVRMYKMYNKSLIIVISAAY
                     NVTNQLIDAVAKIDRLNVDEFLTSLYERYRSFLGRDDEQLKERVFEIKNVLLGAKLLG
                     EVPVQVQDRIVSHGERCSSLMLTKFLQDHGFNCEEALPELFGLVTDGRFGNATVELET
                     SRKNAISFFERGKNYVVPGFYGLHEGRVTILGRGGSDYTATCLAYCLDAERVDLYKDV
                     SGFMTCDPKHVNNVKPVRSLSYDEAAELSYFGAKILHHATVEPLRKKGIPLYIFNINN
                     FKSIDEPDTIITANGSMTKDVVKSISFTDDIAVIQFKGSNVGRVPGLLGQIASTFGAE
                     NVNIKSVITAQTSINVLISRQDLEKSQKIVSRIKIAEVEQIDFKTNISLIAAVGNGIL
                     QRHGIAARIFTAVSKEKINVLMISAGASEVTVYFIVNLEDRDRALRAIHEEFFGDERE
                     "
     gene            295695..297017
                     /locus_tag="AJ81_01635"
     CDS             295695..297017
                     /locus_tag="AJ81_01635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002246388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73116.1"
                     /translation="MKSVEEINKRILSGEAVVLTAEEVVKLAKEEGVKRVAEKVDVVT
                     TATFAPMCSSGAFVNFGHTRPPMRMEKIEIEGVEVYGGLAAVDGYIGATQESKHDKSF
                     GGAHIIELLIKGKNLRFKAEGKGTDCYPRKQFEGFINRDMVNDFFMFNPRNAYQNYAA
                     ATNSSDRTIYTYMGKLLPRFGNVTYSTSGELSPLLKDPKMFTIGLGTKIFLCGTEGYI
                     VWPGTQFRNDVKLNEHGIPISAARTLAVIGDAKKMNPRYLRAAYFKNYGVTIFIGIGV
                     PIPVLNEEIAYYVSRSNEEITTELRDYGKAGRPVIRLTNYAELRSGWIEIEGKKVKTS
                     PISSLAMAREIAQLLKKWIAEARFTLTVPAKLFDEHRSLKGLEEVKEAEKFDMEEPTC
                     VNCGMCVSVCPYDALKLVNDELSFEKELCTECGLCNDVCPVGVKLPPL"
     gene            297014..297757
                     /locus_tag="AJ81_01640"
     CDS             297014..297757
                     /locus_tag="AJ81_01640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005471838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73117.1"
                     /translation="MKKFYRECSEGRFQSFTVQYRETDLWIGVDRFDSTMPDMVLELV
                     EKLHCELYELAKVAPQFFSSLEPVQLFEGPKIALKMAQAANRANVGPTAAVAGAIADE
                     VGQLLLKEFKCNEVVVENGGDIFINCERPITSLIYAGNSPLSNKIALKLPSGTWGVCT
                     SSAKLGHSLSFGNADAVTVVCRNATIADAFATAYCNMVKNKNDVEDLLRTAINEDVLG
                     VVVIFEDMLGVRGQFEIVLLDGDGDETHR"
     gene            297741..298691
                     /locus_tag="AJ81_01645"
     CDS             297741..298691
                     /locus_tag="AJ81_01645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002334893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="AJC73118.1"
                     /translation="MKLIDKLKEGPILSIEVLPPSRGHGVEEIFRTIDQLMEFPISFI
                     NVTRHAPELAYVESDGQIVKVTKVKRPGTVGLAAALMHRYRIDVVPHVICYGMDKYQI
                     EDLLIDLHLIGIRNVFVVRGEYENPLSEQQDRSSYRHAVELVQHIANLNRGVYLYPTE
                     GSEPTDFCIGVAGYPEKHFEAPNMEEDLMNLKRKIDAGAHYVVTQMVFDVEIYKRFVQ
                     MARSFGIHVPIIPGVKPVVNLKSIYSIPKKFFVTIPASFVSQMHQASSSEEEFRIGVR
                     FAAKLAEDLLAAGAPGIHVFTMGRAKATKAMLQLLYSKQV"
     gene            298704..299741
                     /locus_tag="AJ81_01650"
     CDS             298704..299741
                     /locus_tag="AJ81_01650"
                     /EC_number="1.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006527385.1"
                     /note="catalyzes the formation of aspartate semialdehyde
                     from aspartyl phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="AJC73119.1"
                     /translation="MKKRRVVILGATGTVGQRFVQLLANHPFFEVVALAASEASAGKK
                     YAEAVHWHLPCEIPEDVRDMKIVGMDSTFECDYIFSALPSDVAGPIETRLVEQGYIVF
                     SNAASHRMDQDVPLLVPEVNLDHIKLVERQETLGRLITNPNCSTIGLVMALKPIMDLF
                     GIEFVNVVTMQAVSGAGYPGVASLDILDNVIPYIKNEEEKMCSEPKKILGRLTEDGVD
                     LATFDVVAQCNRVPVQDGHMISAYVETSEKVDLDELIRAIDNFNPLKDYKLFTAPDNP
                     VVYLPDKDAPQPRLHRDLGGGMTVSVGRLVKVSERALRFVALVHNTIRGAAGCAVLNT
                     EIYEFLYGRGV"
     gene            299738..300244
                     /locus_tag="AJ81_01655"
     CDS             299738..300244
                     /locus_tag="AJ81_01655"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74635.1"
                     /translation="MSFITVQLLIYLFVSLCFIAIAGMCLSTVITHFFQITKRLEEDI
                     DLMMAIDFLRYDFWFKSISTAQVSSSAMSFWEKVDGKEKKVWYRVEMEQGDYVLKRVA
                     NDGTNVVYRSKKPISFYEETGIWGVKIGELCFDMVNATPSDVRVRLNLKPGELPYFLR
                     PKQVDVSE"
     gene            complement(300219..300746)
                     /locus_tag="AJ81_01660"
     CDS             complement(300219..300746)
                     /locus_tag="AJ81_01660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="AJC73120.1"
                     /translation="MLQITGGFLKGRKVQPVPDPRTRYTSSMVRQALFSMVDVTDKSF
                     LELFCGSAVVSLEAISRGARKAVAVDVSKLATKVARQNAEKLGVQLTVLCVDYRRFLE
                     KNSESFDVAFIDPPYELGFVNEAVRLLSEKKVAETIVVEKSKREKIIVPTELEVLKER
                     SYGDSDLVILRRRPV"
     gene            complement(300762..301997)
                     /locus_tag="AJ81_01665"
     CDS             complement(300762..301997)
                     /locus_tag="AJ81_01665"
                     /EC_number="3.2.1.86"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_229086.1"
                     /note="catalyzes hydrolysis of cellobiose 6'-phosphate
                     into glucose 6-phosphate and glucose; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="AJC73121.1"
                     /translation="MKIAVIGAGSSYTPELISGLLDVSEQIDLREVWMHDIDERKLQI
                     MYGFCQRLVKNRFKLFETKDFVEAVRESSYVVFQFRPGGLKARKLDEEIPLKYGLIGQ
                     ETTGVGGFAAALRAFPIMERYVDSVDKHSEAIVINFTNPSGHVTEFVLNYLGFERFIG
                     LCNVPINFLNHLASLLSCEMEEIFVKYYGLNHLSFVERIWMNNEDVTEKVFQMLSKFE
                     SPELPSWLILSAKLLMNPYLRYYVSTQQMFKKIYEEGTRAEKVIEIEERLFRKYETEN
                     EIPAELSQRGGSLYSTAAARLIRDLTLSNNSVHIVNTRNMGAIANLPDDYVLEVPCLT
                     KANRVLPITEGSADPFAVGLIHTVKMYERLTIEAYLKKSKATAIKALLLHPLGPRSHN
                     VRELLEEICQANREYFELL"
     gene            complement(301994..302956)
                     /locus_tag="AJ81_01670"
     CDS             complement(301994..302956)
                     /locus_tag="AJ81_01670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001469680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BadF/BadG/BcrA/BcrD type ATPase"
                     /protein_id="AJC73122.1"
                     /translation="MRLLGVDVGGTKMHILIVDELGNVIVFEEGPGANYQGVGVEKAY
                     QTLKRLIEKALKSASLSLDELDAAFFGVAGADFEYENRIVRSILERLGLKRYAFDNDG
                     RIALRSGTFDDVGIMISCGTGGINYACDGKRMERIGGFSSFFGERLGSYIIAGKVASA
                     IVRAKDGRSENTVMVEMFESQIASKIEDIMHYEYEGDYEKMRDYAVLLIRTLYSAARD
                     HDFVALKILCEIVDEVVRIVEAFRKKLNFTPPIKLVLEGSFFKNADPILLNMICSALG
                     RDYRLIVPKHPPVVGAVLLASELVGCSFTDRAIEKLIGFWGDQT"
     gene            303023..304543
                     /locus_tag="AJ81_01675"
     CDS             303023..304543
                     /locus_tag="AJ81_01675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_003305032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="AJC73123.1"
                     /translation="MRRKITGVLFILLVVLMAFFTLIFYWIVFMFPRLQKTLLNYHMN
                     SLTHQLDLAISMVNIHYSNFVQGLEDESTAKQNAMRHLKSLFYGPEGKDYFFVLNLDG
                     VLLVHPYRSDLEGQNAFMSDDAVFTSAIRTIVEGAKEGKKFVEYDWYLYGEKKVEKKF
                     SAIRVFEPWGWIIGTGLYSETLMEQSKKIAREFQSVAILLMTMYSAIVAFLLVLLNRQ
                     YKERERLLTLHLQEGERLKTILSSIPQPVAVLKDSQIIFMNQSFEETFVREAESSPAL
                     KEKISQVIEETLNEVRKTKKGLVKALEIALGQEKKWFDVHAVPLFSGERVVETVLLFV
                     ETTHQVKQIEFWRFSAETDPLTGLANRNVLDVILSDQHVLGEKFCVIMLDVDGFKEIN
                     DRYGHSVGDEVLKEFARRLSNNARKDTILVRFGGDEMLVIVPNADRETGLKIAQRLQE
                     VLKKPLHLENLTLNLSASMGLSEFPTDGNDLRSLIDVADRRLYKAKSLGKGSLCVD"
     gene            304582..304668
                     /locus_tag="AJ81_01680"
     tRNA            304582..304668
                     /locus_tag="AJ81_01680"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:304616..304618,aa:Leu,seq:gag)
     gene            304718..305560
                     /locus_tag="AJ81_01685"
     CDS             304718..305560
                     /locus_tag="AJ81_01685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="AJC73124.1"
                     /translation="MIKLVCIDLDGTLLDSEKRISQHNIEAIRRVVELGVHVTIFTGR
                     SFGSAAHYVRELGIKIPVVFQNGALIIDPVSMKVFRNIELESGLARHFVEEARENSVY
                     PVVYESFFFEKDMLVEGPYVGAFERYFQLNSHRIRMVEDLSKELSKRKSVVEVALVGK
                     IENVNRVIEEASAKLKNGYTVVENQKRDTEAFVEIFGPGVGKERALEFFLEMYAVTPE
                     EVMYVGDNLNDASIMRMVGTSVAMMNAPDEIKRIATHVTDSNDESGVAKALEKLVLRE
                     RVEE"
     gene            305557..307053
                     /locus_tag="AJ81_01690"
     CDS             305557..307053
                     /locus_tag="AJ81_01690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002334025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="AJC73125.1"
                     /translation="MSFLFLVLSSVVTALSMPGFLFGFLVWFSLIFLFIALEEKNVLT
                     STLYGFLYFYFFSAINLYWVLPVLVKNLPRTFSRFPGWLGFFVFLLMLTIEALPFALF
                     GLLYSIGKNSIRNRPWLDALFVASLYTLMDFLRGIGEMGFTGGTLADALYKDVGLLQL
                     APLIGSYGLTFLIVLTNRLLYTMMKKSSRSIEKIAFVVLAIVLISYTVERALPFPAKG
                     ETKLVALQTYVRPEEKYSSSSIDLYSKLVEHLEQHSNGLIILPEDVFFTDPRNNEIGE
                     LLRELTERRNIKILLGAISTDSGTKNSIFLADESGVRRVYSKVKLFPFVEMLPYERIF
                     SVFKFLRGLVYLQPGEGFFPLKIEEYPTLGIQICFESYFSEPSRQLAKKGAEVLIVCT
                     NDGWFDYNTALIQHFSKSVFRAVETRRQVIQVSNAGVTGAVDPYGRIVKTLPVKRYDS
                     MEIELLPKKNETFYTRYGDLIVWFCLGVVLLTLLLPREKSVRVRRIWR"
     gene            307050..308225
                     /locus_tag="AJ81_01695"
     CDS             307050..308225
                     /locus_tag="AJ81_01695"
                     /EC_number="5.4.2.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002939778.1"
                     /note="catalyzes the transfer of phosphate between the C1
                     and C5 carbons of pentose; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="AJC73126.1"
                     /translation="MRVIAIVLDSVGIGELPDAHLYGDEGSNTLVNTARAVGGLNLPN
                     LAKMGLGNLDEIMGVPKMDAIGAYGIMMEKSPGKDSTTGHWELAGIVLKKPFDLFPNG
                     FPKELIEEFERRTNRKVLGNKPASGTEIIKELGLEHERTGALIVYTSADSVFQIAAKE
                     EIVPVEELYRYCEIARGLLDEMGFKVARVIARPFTGEWPNYVRTPRRHDYSLPPEGRT
                     LLDILTDSGIAVYAVGKIYDLYAGRGITESFKTEDNMDGVDKTIWVMRNKREDCMIFT
                     NLVDYDMKYGHRNDVKGYAKALEEFDARLPEIWDSMEHDDVLFITADHGCDPTTPSTD
                     HSRERVPILVCGEKVCRNVNLGIRESFADFGQTVADIFQVEKLANGVSFKDLLFGCP"
     gene            308227..309477
                     /locus_tag="AJ81_01700"
     CDS             308227..309477
                     /locus_tag="AJ81_01700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyglutaryl-CoA dehydratase"
                     /protein_id="AJC73127.1"
                     /translation="MSKKSVAYGKFVRFFWNKPTVALNLLTLGLKLENTRRKVVATTR
                     NDFSSWVDFAALSIVASAFSGEEVALVNLFFPSEIMAGFALKSVSAEGLSGMLAAMHL
                     EDFALARAESIGVSKNTCSFHRAGLGLNLLNMMKNVRAVAVTNMLCDGNVPIFRTIAS
                     LYGLKLIVLDVPRNLDEFNVDYVSQQLEQAVYELENQLNRRFDWKKFEEQMKIESEIF
                     EALRELYPKLCEKPIKMHLYQHVNLLYTIHVRPDFHLLKAVRALERDLKAETSDDAKR
                     ILWMHLSPYYDNVLNEIFSKDSPHTVVASELCWDWLDWRIDVRRGFKSIAEKLLLNPL
                     LNDARKRAEFAVKLAKDFRVNGVIHFNQFGCKQSSGSIELIKGVFDELKIPFLSLDGD
                     CVDHTSSSSEQFKTRVQAFLEMIE"
     gene            309474..311156
                     /locus_tag="AJ81_01705"
     CDS             309474..311156
                     /locus_tag="AJ81_01705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA activase"
                     /protein_id="AJC73128.1"
                     /translation="MIVYNCPLVPFEFFHALRIPFKRIEPISIEFQKLHPNVCSFCRS
                     AVCSVKPTDVLVWTDSCDSMRRAYDFLSQNVSFYLHIPVKNDELAVLSLSRDLKRLWE
                     FLKTVFNSEVPLSELERVHRWFIEKSIHLERLIEKDLNEAKTIFEELSNQEWVGSVAR
                     KGKSVLLLGSWANSKLVEIVEKAGGFALNATCSGPYSLIFEAEPARDIFESIARRILN
                     KRLPCGRFASTRELKMLIERFRPEAIVLHTAKFCDFYHFDERLLRELKIPFVTIENDF
                     TNALEQARTRIEALLEDTKDRPRVSVKAFHFVGIDSGSTSTKIVVVNNRGDILFEQVC
                     RTGADPKESAKRLMIQAMKHLKFDPQESFVVATGYGRDAIDFAHARVTELTCHAVGVK
                     HLYPDVRTIIDVGGQDSKVMRIEEGKIVDFVMNDKCAAGTGRFLEIVSSILETPLQIM
                     GKESLKAKTQLSISSVCAVFAESEIICLRSKGYSKQEILWAAHNAIARRLVTMYERVK
                     GRPPVVLTGGVALNEGLKRALEELLKVEIIVPKNPVTTGALGAALMGLQQKL"
     gene            complement(311141..311947)
                     /locus_tag="AJ81_01710"
     CDS             complement(311141..311947)
                     /locus_tag="AJ81_01710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2C-methyl-D-erythritol
                     kinase"
                     /protein_id="AJC73129.1"
                     /translation="MVEVGAGFSEKAYAKLNLYLDVVGKRSDGYHDIVGLFQTIDMYD
                     ELFFIQTEDVGQIVVESNVPIEGQNLVERAFRKFKEFYPVDFGLKAVLKKRIPMGSGL
                     GGASSDAAATLRFLAQRCGIPHSDILEIAAEVGSDVPFFLIGGTAIVEGKGEKVTPLP
                     QISGYTVDLFCPGVSVSTAKAYSMLKETDFKKGPRPIERLYEAYVKHEHEVILRMSYN
                     VFQTIVCEVYPEIKTALAQAWSTDPIVAQLTGTGCCVFALREHSGLYSFC"
     gene            complement(311899..312492)
                     /locus_tag="AJ81_01715"
     CDS             complement(311899..312492)
                     /locus_tag="AJ81_01715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002334371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="AJC73130.1"
                     /translation="MDMEQVLVVPTKIIDDLVNGTDGIFPIDLEKLRDLIEKNAFFID
                     REIAENDETLHQLIPYVLMRQQGKFLLLRRTKKQQERRLHGKLSLGVGGHINLGDGDA
                     PWRAFLKGMEREMHEEVNVEVLQLSYVGLLNDTSSPVSRVHVGLVYLAEVKFLGLNEP
                     DMFDFWFMDLKEIEQRREELEGWSKLALDFLKKLMPN"
     gene            complement(312446..313039)
                     /locus_tag="AJ81_01720"
     CDS             complement(312446..313039)
                     /locus_tag="AJ81_01720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002941155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine kinase"
                     /protein_id="AJC73131.1"
                     /translation="MSGKLTVIVGPMYSGKTTELLSYLEIYKLGKKKTLLFKPALDVR
                     YGTDVVKTHSGLEAQAVSVEFSKDMLPHLQEKIDAVFIDEVQFFDKDLIKVVRKLLDE
                     NVNVFCAGLDMTFKQNPFETTMLLLALANEVIKKRAVCHVCGEHNATLTYKISDNDSE
                     IDVGGKEKYIAVCRDCYNKLAGSGHGASSGGSDEDNR"
     gene            complement(313043..313906)
                     /locus_tag="AJ81_01725"
     CDS             complement(313043..313906)
                     /locus_tag="AJ81_01725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase XerC"
                     /protein_id="AJC73132.1"
                     /translation="MEDLLREYVEYLKYVRRASDHTIMAYGIDVSQFLKSLKERKLRL
                     ETFSVKDAEDYLKHLSKSFGKPLSVSTLARKISSLRNFFDYLVLRNYVSSNPWMKVKV
                     PRLRKRSPDFLTKQEMENMLRVSEQKERDHLVLSLLYYCGLRVSELCNLRVSDVSFSP
                     AFVRIEMGKGRKDRIVPLNSSLASELRVYIEKYKKEADEYLFGTSLRLHPSTVFRIVR
                     KYAKLCNIRKRVHPHTLRHSFATHLLQRRVNVRVVQELLGHANLSTTSTYLHLLDEEK
                     FAAVNALVEEE"
     gene            complement(313914..315188)
                     /locus_tag="AJ81_01730"
     CDS             complement(313914..315188)
                     /locus_tag="AJ81_01730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate transporter"
                     /protein_id="AJC73133.1"
                     /translation="MVKQIVAMFLFFLAYYVILSRSRRTSVKVFLLGLIAAVLKLSEG
                     LTTENISRVVDFNTIGLLLGMMIIVSVLKSTGFFQMASVYAVRLGRGNLRRTVSMLAV
                     FIAILSAFLDNVTTLLIFAPILFLVSDAAEVDPSKVLVLGVIASNVGGMATMIGDPPN
                     IVIGNASGLSFASFIVHLAPMSFLMLLISLRMLSSVVSVDRASEAGLKRLAATNPREA
                     ITDKKLLLRTATIFVATICAFAFHEALDIDMAFIALLGATLSLIVANKSFEDVAKEIE
                     WDTLFFFMGLFSLTHVMQELGLLSGFASLISMVRSRSLLLVVLVWLSAVMGSLLSAVP
                     TTVVLVPVVKYLIGLGYSTHLWWAIALGVGLGANLTPIGAAVNIVGISLLKRFTGKSV
                     SFREFFQTSFAWVLTGLIIASLYMVVMAFVGW"
     gene            complement(315195..316436)
                     /locus_tag="AJ81_01735"
     CDS             complement(315195..316436)
                     /locus_tag="AJ81_01735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein"
                     /protein_id="AJC73134.1"
                     /translation="MKFLKLASLDQVYSEYFHRVKPIDETLEVPTLESLGFVCAEDVL
                     ASQNLPGFDKSLVDGYAVRSKDTIGASTNFPVMLRVAFEVKVGEEPKRAINENEAAWV
                     ATGAMLPEGANAVVMVEHTQRFDEYVEVMKPVAVGENVLRMDEDVRKNELVLAKGERI
                     KPGHLQLLLQLGVERLKVFRRAKVGVISTGDEIVEPFVEKKSLVQVRDSNGYGLVAWL
                     RSLHFEANRVGLCRDDEDELFRTLRSRFDEYDVLVVSGGSSIGARDFTEAAINRLGKP
                     GVLFHGILIQPGKPTVLAIVNGKPVVGLPGNPVSFTISAKFVLIPILRKLENEKDFLF
                     KPSGMVKLTRNVYSRQGREQFIRVKLLVRHGQVWAEPLESETAQVSNLVKAEGVIRVP
                     PDVEGLYEGELAEFYPLWLGW"
     gene            complement(316433..316930)
                     /locus_tag="AJ81_01740"
     CDS             complement(316433..316930)
                     /locus_tag="AJ81_01740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaB"
                     /protein_id="AJC73135.1"
                     /translation="MRVAILVVSDRVSQGEMIDKNAQIVKKLMGQIGGTIEVESIVPD
                     EVDLIKNELLKLCEAQFDVVITCGGTGVSPRDVTPEATMNVIEKRLYGMEMAMMLEAM
                     KHTPTAMLSRAVVGVRKETLIINLPGSPNAVEQNLKAILPAIPHGLEKIKGSTKDCHQ
                     EGETP"
     gene            complement(316927..318840)
                     /locus_tag="AJ81_01745"
     CDS             complement(316927..318840)
                     /locus_tag="AJ81_01745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001213166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeA"
                     /protein_id="AJC73136.1"
                     /translation="MERKIYLKKMVLDRALELYLSRLKEAGFFEPKTQKVKVGEAIDR
                     VLARAIFALRSVPHYNSAAVDGIAVRSSDTVQASKHAPKRLNREQFMIVNTGQPMPEG
                     FDAVIMIEDVHFLEDGSVEIFEPVPTFHNVRTIGEDAVEYDMLFCRYHRLTPQDLALL
                     LAAGVFEVEVLKNLECAVVPTGDEIVDPSSELKEGFIPETNSVLVKTFLEKLGVAVRV
                     LDPVGDDPEKLASTLQGLLPAYDLVLFIGGSSAGRKDFVYRALEKLGEIVAHGLSIRP
                     GKPTVLAIVEKKPVIGLPGFPASCFTVLERVVKPVVEAWYHQSDSAEDFLIAECATRI
                     FSSAGDDEFVRVALAKVKDRYVCIPLKRGAATISSLTKMDGVLVVPRGQEVIDEGEKV
                     EVRLLATKKRIDNTLLFVGSNDPLIDRLSDLLIERGVRLSVVNVGSLGGVKAIAKSHA
                     HLAGIHLFDSESETYNLPFLKKMLNGFVLVKFAKRLQGLVVQKGNPKSIRTLQDLVRK
                     DVRFVNRQKASGTRILLDYYLSKLGIEPRQINGYENEELTHMSVALKVKRGLADAGLA
                     VAYVAQLMDLDFVPLCWEEYDLLILPEFLNDERFQTIFDVMTSSDFRNVVFQCSGYDI
                     SDLGKIVEEDESK"
     gene            318903..319310
                     /locus_tag="AJ81_01750"
     CDS             318903..319310
                     /locus_tag="AJ81_01750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001409730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="AJC73137.1"
                     /translation="MKLSEVQIGQEHAASFTITDEMVKTFAEITGDKNPVHLDEEYAK
                     KTRFKKRICHGMLVASMISKVLGMDFPGPGTILVRQQLSYRAPVFVGETVEVRVSVMD
                     KKEEKQRLILQTNVFKSDGTLAIEGQAEVLIER"
     gene            319307..320071
                     /locus_tag="AJ81_01755"
     CDS             319307..320071
                     /locus_tag="AJ81_01755"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74636.1"
                     /translation="MRPYGQHFLKCEDVALELVDRLNPRTDDVVVEIGCGKGFLTRFV
                     AQRGCRLVCYEIDESLSEEFKRNVPFENVELRLKDFLEVGTKEIESARLCYGSIPYQI
                     SSKIVRKMIELGFERCLFIVQKEFAEKLVLGRERRKHTLITLLSQTYFNVSILRRVPK
                     RCFEPPPKVDSVMIELVRKDVEVDLDSYEDFLKRLFLRPNRSAKAVLKEMGVDQCEAF
                     EDARIWDLNVEQALSIYMRWSDDERRTLRNRSEFDR"
     gene            320025..321749
                     /locus_tag="AJ81_01760"
     CDS             320025..321749
                     /locus_tag="AJ81_01760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005836647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="AJC73138.1"
                     /translation="MTREELFETVLNSIVEGIIIVDRNARVLYMNKQASIILGIPASS
                     VIGKHVVDAIPNTRLHIVVQTGKAEIDNVQDIGDVKIITSRIPIKDKNGEIIGAVAIF
                     RDITSVQRMLDEVTNLREMEALLKAIIESTNDAISVADADGKIVMVNKAYTKITGYSA
                     QEVIGKPATIDIAEGESMHIRVAQTKQPIYGARLLVGPTRKEVVVDVTPLFVKGEFRG
                     SVGVIHDVSEIVRLSKELEEMRRIMRRMSAKYTFDDIVAESTKMKIIIEQAMKVAQTP
                     ATVLLRGESGTGKELLAHAIHNASERKDQPFVSVNCAAIPESVLESELFGYAPGAFTG
                     AKREGKKGLFEEAHKGTIFLDEIGKMPLSVQPKLLRFLETKEITPVGGTKPIKIDVRI
                     IAATNMDLEKMVQEGSFLPDLYFRLNVFPIHIPPLRERREDIPMLVQHIIKKLNQEYG
                     RIVEGISPEALHRLMSYDWPGNVRELENIIGRAMITMEPDERFIRAHHLPPLKLSYQA
                     QEVPGDVKDLRRALREYEKGLIMKALERNNWDVQNTAREIGMSVRTLYHRMKLLQIVR
                     PMSKRRQS"
     gene            321873..322664
                     /locus_tag="AJ81_01765"
     CDS             321873..322664
                     /locus_tag="AJ81_01765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="AJC73139.1"
                     /translation="MGKKKRKRRCSEECLWKTVRQMQENQKKTRNRSCVELRKFSLII
                     DNVVVLKDVDLSFEAGQLTVIYGPRGAGKSALLRSLLRLNREIYENVDWSGELLINEK
                     PIQAYDKKLLRQMVSYVEPSFVEAMDELTFADFIKITLSDSEASLEDFASELDRLGIL
                     KFLKRELKTPIKQFYTMEKIMLLLFAAIVRKSSVVVLDCILDHLDDDTLVPVLKELLN
                     IKQDRIVVLSTRQKLRFLPIADQFVMMKSGRIEYRGAAREFVLER"
     gene            322669..323631
                     /locus_tag="AJ81_01770"
     CDS             322669..323631
                     /locus_tag="AJ81_01770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005471304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="AJC73140.1"
                     /translation="MKVITVTLNPALDREFIIEGFAVNAYHRIKTQDHMVMNPGGKGI
                     NVSMALAKLGVSSIAIGIIGGYTGRVLLTELNKTSPLISTSFVHIEEETRENIVIVDP
                     VNHTMTSINSPGPRVDKKAVELLLKRYEIYLSRAEAVVLSGSLPQGLTGEIYGKMAKM
                     AREKGRMVFFDMIDEYLTEALEICVPDVVKPDVRGSYTILQQRLESLEDYVEAAANLV
                     KRGCKLVVVSYEIKNDVVATQDGVWLISTKEKVEPENILGAGDAYVAAMVYKRLTDRN
                     TSMLETAKFGYAAALAKTKKLTKEMPEYDEIGEALNSCKLERLR"
     gene            323647..324093
                     /locus_tag="AJ81_01775"
     CDS             323647..324093
                     /locus_tag="AJ81_01775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001305924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73141.1"
                     /translation="MRVYDVMVRDVTAVTQEDSVENVVRIMATQFLSGVPVVTEDMRV
                     IGFVSESDIIRAAIPGYFSLLQSTTFIPDMSQFLKMAAKLRDKPVREIMTHPPLVVNE
                     NASLAHVADLMIKHNVKILPVVDEHGRLLGVITRTNIVRAAMEGYL"
     gene            324090..325391
                     /locus_tag="AJ81_01780"
     CDS             324090..325391
                     /locus_tag="AJ81_01780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002940077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylthioadenine synthetase"
                     /protein_id="AJC73142.1"
                     /translation="MRAFVTFLGCKVNQYETELIIEQLERAGIVVSSQPVDVDICVVN
                     TCMVTNEAARQSRQLLRKLRRMNPDALVIATGCYPHLDALSIKDCGVDLVLGNREKKE
                     LVKHINEWFRNKEQKVLISQPDYEISEQVSSFLADRVRAYVKVQDGCDEYCTYCIVPL
                     ARGRKIRSKPTQVVIREVKNLVNSGYKEIVLTGVNLGRYGRDIDTSLAHLVRRLLNEV
                     VEDFRIRLSSINVQDISAELIELFKNNEKLCPHLHIPIQSGSNKILKAMNRSYTVEQA
                     LALFERLRSLDPFFSITTDIIVGFPGETIGDFEETLALVKRAMFSRVHAFKYSDRPNT
                     PASRMRHKVPPEEKDRRMKLLREIAEKVAADYRAASVGKIRTVLVEMNKDGVSYGYDQ
                     YYVRHEFVSLSTNVLAKVVVKKPNGAGVVSQVVSLEKSVVD"
     gene            325360..326193
                     /locus_tag="AJ81_01785"
     CDS             325360..326193
                     /locus_tag="AJ81_01785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase IV"
                     /protein_id="AJC73143.1"
                     /translation="MLVWRKAWLTEAETKLDIDEPGFLYGGVAYETLRTYDMKLFAPK
                     YHYERLLNTLSYLGLELPLDYPTFRRILEEGVQKLGKEASIRVIVVPRGRFSAFEYSP
                     EHGELIVYMRELKVEPLGYVKIKVSNVRKIDPLSTPADLKVAGRTDILLAKRSKGDAY
                     DVIMIGNRGQVCEGTFTNVFLVKKDRLITPSVESGILPGITRLNTLRLCRTLGMTVEE
                     RWVELAELYGADEVFLTHTSRGIVPVNEIDEWKRYETRIGQFLASRFEEFIKTVKENW
                     E"
     gene            326190..326489
                     /locus_tag="AJ81_01790"
     CDS             326190..326489
                     /locus_tag="AJ81_01790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001305921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73144.1"
                     /translation="MKKLSDVLEGLTRHDPLFKQLKLRLVVSDLAGILGESLAKHCRF
                     VEFSNGTVFFVCDSDVWLTEARFMSKKITEKINEKLGEKMVNDVVFRRDRNGDRL"
     gene            326479..328374
                     /gene="gyrB"
                     /locus_tag="AJ81_01795"
     CDS             326479..328374
                     /gene="gyrB"
                     /locus_tag="AJ81_01795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002334711.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="AJC73145.1"
                     /translation="MDYRPEDIRVLKGLEAVRLRPGMYIGSTGKSGLHHLLYEIIDNS
                     MDEVMAGACDRIRVVLHEDGSAEVEDNGRGIPVEIHPETGKSTLETVMTVLHAGGKFS
                     NSAYKVSGGLHGVGASVVNALSEVMEVWVRRNGRIYYQKYSRGQPICEVKELGETTER
                     GTVVRFRPDPEIFSTTEFDPDIIENRLRELAFLNPGLTIEFEDKINDYKSKMSYAGGI
                     KEYVSYIVKNTNSKPLHDIVYISDSYENIKVDIALVYIASQDEETLYSFVNNIRTIDH
                     GTHVSAFRNVLTRLLNDYGKSLGYLRKDEAFLGEDVREGLVAVVSVLMPNPEFEGQTK
                     GRLGSESAGTAVSKIAKERLTEFFEINKPVLKIILERVQQAKRAREAAKKVRELVKRK
                     SAFDGAALPGKLADCVTNDVEKSELFIVEGDSAGGSAKQARDREFQAILPLRGKILNV
                     EKSSIQKLLSNEQIKDIIVAVGTGIGEKFDRTRLRYGKIIIMTDADVDGAHIRVLLLT
                     FFFRYMRPLIEEGRIYIAVAPLYRVQFSNRILYLYSDDEYQALMKELNGSEKVEVQRY
                     KGLGEMNPEQLWETTMNPVTRRLIRVTIENAEEADALFGILMGQDTVERKNFIERHAL
                     KVTYLDV"
     gene            328367..328870
                     /locus_tag="AJ81_01800"
     CDS             328367..328870
                     /locus_tag="AJ81_01800"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74637.1"
                     /translation="MYNFKKAVTLVGIFCSLCIFFFTAKFVNVAAKPTSGERVFLVAH
                     KGRLWWVGRSGELLEVARTQDVLSKAYVSGLEIVNARLDESSLHLIEKLKPALDSLYI
                     VEVIPNEKRVMLLKGVSLRFNDWEDLLRNLQALPEAIKRMEPRGEYFLSPQGLFYKLR
                     GGDDEKR"
     gene            328857..330113
                     /locus_tag="AJ81_01805"
     CDS             328857..330113
                     /locus_tag="AJ81_01805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="AJC73146.1"
                     /translation="MRKGENYCLIDIGSHTCKGVVLRHTPQGLEVLAKGFVKSRGIEG
                     GDVRDVAAIIEVIESLVNELEQESRIKRAEFIVSSSHSNVRLIDHGTELILSENDKKT
                     VDEATADSLSTTAEEELSSNYRLLHFYPKRYIVDGTKYVLNPVGMNANKVRFEAAAVV
                     MEKDSSSVFDFLSDTLPEPLFVGHSSLFAADCALSDVEKENGVCLVDLGYSHTFTVIY
                     LNSVPTRVHVIPLGLKNVLRDISIVLGTSIEEAERLLRSEGSAVYGESSYAQQKIEYR
                     GLDGRTLKTTTKEELARIIHARLREILTKVRRTIREFTMQSPINMVGKLPGGIVFVGG
                     GAKIPRLIDLALDVFEGPARVGTFNVTNVPILNDDEAADDPALCGVLGGIVQLLRQSQ
                     PIVSAKTSSSKESFFRKLVEMFKSLW"
     gene            330132..331196
                     /locus_tag="AJ81_01810"
     CDS             330132..331196
                     /locus_tag="AJ81_01810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002940083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="AJC73147.1"
                     /translation="MPFELSKQEKGKEAEKLTRKRIPIIKVIGVGGAGNNAVNRMAKM
                     GLKNVVLIAVNTDVQVLEETEADLKIQIGERRTRGLGAGGNPKIGEEAALESLDKIEQ
                     VLKDTDMLFITAGFGGGTGTGATPVIAEAAKKLGVLTVAVVTTPFYFEGKERWQRAME
                     GLRKVKSSVDTLIKVSNNKLLEELPADVTAVEAFAAADETLHQGVRGISELITKRGYI
                     NLDFADVESVMRNAGVAMLGIGIGKGANRAAEAAKKAMTSRLMEQPVENAKAIILNVS
                     APKTVQLRELHLAASIVRQSCSEEADVKFGLIIDDDLKEDEMKVTVIATGFDQEERIL
                     FPETDIPAIYRLGLEDMTNA"
     gene            331189..332889
                     /locus_tag="AJ81_01815"
     CDS             331189..332889
                     /locus_tag="AJ81_01815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretory protein GspE"
                     /protein_id="AJC73148.1"
                     /translation="MPDRIRYRRIGEVLLEKGIIAKEQLNRALEHQKHTKKPLGEILV
                     ELGFVTWEELTEALAEQYNLPMLKDFPRSIPAEVLNSLPRALIEELRIIPIDKRDDQL
                     VLVTDSVFNLSRIRGEVKFITGKEPLIYLVTPSLFALMYKQHVQGGIAELAQQIPVAE
                     EVEPEVLTIEETEELEAEPEAPIIKMVNALIQKAVQMEASDIHIEPFRNYVRVRYRID
                     GLLRKIIDYPKAQHGAVVTRIKILSGLDISEKRLPQDGKFYMSIHGEQYDFRVSTMPS
                     VHGEKVVMRILRVSAAYKQLEELGFSEYNYKLISQLLMRPNGIILVTGPTGSGKSTTL
                     VAMINKLKDITVNIVTAEDPVEYTIDGVTQCQVNPEIGLTFARFLRSFLRQDPDIIMI
                     GEMRDKETANLAVEAALTGHLVLSTLHTNSAAAAVDRLVNLGVDRHLLSTALVGVVSQ
                     RLVRKLCENCRVKAQLRPEYLQMWKEVFPELDPVEYTVGPGCAECNGMGYKGRVAVGE
                     VLVLDREIKDVIVAGGSEREIYDLALRKGMRPMFIDGFEKVLRGITSFEEVLRVTTSI
                     "
     gene            332886..334088
                     /locus_tag="AJ81_01820"
     CDS             332886..334088
                     /locus_tag="AJ81_01820"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74638.1"
                     /translation="MKYHSRDPESWRKKEQEIARREQEKTQKYRRRGFYFLLLNLVAV
                     FVFFFGIRSYYAQLSIEKSPLNQLLIQCEDTHSAGAPLDVQIRLYNNSEKKREIVISD
                     FAFQIFNAEKQQVYSFKQTQPVRSVFEPFTSRLLFDLKREKEITNLPSGEYTIHVEAT
                     VDGKKVSAEKRFTSVERYELIVENFNDFYYVGEKAQLKVSLLNQTSRSQDLRIDSLSV
                     TLKQDGKIVWQTTVQVKPFWQDVKVGEIVELVEALVVPFDREGVYSIQLECVVNGSTN
                     SLLLPVACISNAEKNLKKVKIYTDAPKIYNLRTPLQFSVYLLNESRDDVFLEIEEIIV
                     SLLPTSLNFKKGPVRMWLTPYSKYEIFRFYPYSVPAITQPGNYKLLVKVSTKNDRLDF
                     ETTLQVNE"
     gene            334113..336413
                     /locus_tag="AJ81_01825"
     CDS             334113..336413
                     /locus_tag="AJ81_01825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="AJC73149.1"
                     /translation="MEVHTLERLDYDKFLSLLANYAVTQLGKKFVRSLRPKKDPTQEL
                     KFVEETIELLRSSESLLPSNAGSVDVEDVLTKLNSGSILEPQELLRIADAVAVVRVLK
                     ERLERLPDTFTMKMLAQAVEPAKHVVEEIHRCVDTNGWVKDEASENLKEIRHQMRSTL
                     SEIKKKSDSFIKANKVFLQDPICVLRDGRHVFPIKASYKGQVKGIVHALSSSSATCFV
                     EPDDFVPLNNTLYELREEEQREINRILRELTTLVRQNVRRIEEGLNFVATVDSLHARG
                     LFAIDQKAIVVYPSSRKVVRVVQARHPLLDRSRVVPIDLVLPEDKYGLILTGPNTGGK
                     TVSLKTIGLFCCMMMAAIPLPCEHGSEIFAFESIFADIGDEQSIEQNLSTFSSHLRNI
                     VLALESASENSLVLLDELGAGTDPVEGAALGLAVIEQLKRIGCKFIVTTHLTPIKLRA
                     VNDEKLMSASLEFDPETLRPTYRILMGVPGGSHALEIAQRLGLDETVLEMARNYLGKD
                     YFEVEKVVEEYQKQLVLMEKRIEELEAERAELEKLKQDYEQKYQELKQKKIEELDKEL
                     KQLYDYIKQAKRDVDETIRSIRSKKDLASLRSASKQFENHVVKVKQIQLNQEPAEESQ
                     ISIGDTVRLRSGDAIGKVVEVRDDRYIVDFNGLRLEARAKNLVKVARKGTQVQQAIHA
                     IKPDLKKPEIDVRGLTVEEAEPLIEKFIDNLLMSDFRIGYIIHGKGTGRLAVGIWEIL
                     RRDSRVKRYRFGTSSEGGTGVTVVEI"
     gene            336410..338503
                     /locus_tag="AJ81_01830"
     CDS             336410..338503
                     /locus_tag="AJ81_01830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="AJC73150.1"
                     /translation="MKSVFALDVGTRKVAGLIGTFEDEVLTVVDYESMEHPVRSMLDG
                     QIHDIGSVARIVEKIKKNLESRNDTMLEEVAVAVAGRYLKTQIVEASTKVPTGVVDEK
                     ILKELEARALAQISFSDESGVNLYCAGYSVLEYKLDGFWIKNPLGHRGDELYTKLIVA
                     MLPNQVIDAMISALHLAGLRCSFLTLEPMAALEVALPDDLRFLNIALVDIGAGTSDIA
                     IAKGGTVLGYDMVALAGDEITEAIAKHYLLDFKTAEMLKRKIESTQTIEVNNLTGEAI
                     LVERSQLERIIDPIVTQIAENIAQRIEALNLGKPSAVLLVGGGAKLSLLRERIAEVLK
                     LPKERVALKSVEEFERIKSIKEGFVGSEFVTLAGIAYMKAKELGSIYDVVRLNGEEVR
                     LLNFGRAPTVLQLLTQSGYSIRDLIGEVRPSFVYTLNGEARLVRGSIRKKYRVKINGR
                     ECALHETLKTGDEVEVEFLEGETPESPMLKDLVKPVRVFLNGSEIFEILPTVLVNGQN
                     VADLERFVSDGDDIVVSWPKKEEIEQLLNEKVGLVKCTVNGEIKVVPRFKLTLQRFEE
                     TEQGFFYHFEGVEMKVKDLLAQPLSVRVKFNGRQIEITQKNHMVMVNGEYVSSDRVLS
                     DGMSIQLPRFEPIVADVLACVEINTRNLKDYRITLNGREASFVDPIKEGDEIEFIASP
                     KVLDEPEKSSEPSRE"
     gene            complement(338442..338693)
                     /locus_tag="AJ81_01835"
     CDS             complement(338442..338693)
                     /locus_tag="AJ81_01835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005358511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="AJC73151.1"
                     /translation="MVLEDYRGKGVGKMLIEKAKQVTQGLNCRAIVLETQTNNSAVEF
                     YKKRGKIPRRSLLGDGFIGFILWKVQMTFLAHPKPLGLR"
     gene            complement(339170..340123)
                     /locus_tag="AJ81_01840"
     CDS             complement(339170..340123)
                     /locus_tag="AJ81_01840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="AJC73152.1"
                     /translation="MRLFLALIDIFTNPAFYKLTLTAATPLVFASLGGVFSEITGVVN
                     IALEGIMLMGAFVSVVFTWLTGNAWIGVLFAVLVGLGMAWLHAWASITWRGNQIVSGT
                     ALILLAQGVTGFLMEPIFGRPGQTDIVGKIPEVRIPLLMKNRFLAQSIGELSPMIYIA
                     FASVFVAWFIIYRTKLGLRMRAVGENPEAADTLGVNVYAVRYFGVLMSGVMASLGGAF
                     LSVGEVGNFRELMTGGRGFIALAAMILGNWNPVGAMWASLLFGFSEAFANQLQSSPLL
                     RVASTTKPLFNMFPFIVTLIVIAGFIGKTRPPAADGVPYEK"
     gene            complement(340120..341154)
                     /locus_tag="AJ81_01845"
     CDS             complement(340120..341154)
                     /locus_tag="AJ81_01845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001305283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="AJC73153.1"
                     /translation="MNQKVWSFLVPILSIIVALIIASFVILMIGKNPIIAYAALIRGA
                     LGSKMAIASTIVKTTPLILTGLAVGFGFRAGLFNIGAEGQMIMGAMAATAFAINVGWM
                     PAVLAIPLTMLVGMLAGAGYASIAGFLKAKTGAHEVVTTIMLNWIADYLSSYVVTVPM
                     GVGFGTPKSPEIASSAKLPPLMVVQATELTSGIIVAVLAAVFIKILLDKTSKGYELKA
                     AGFNPYAAEYGGIKLAENIVLAMAISGALAGLAGTLEVMGVHHRFLGTLSGGKGFDGI
                     SIALIGQNNPIGIIFAALLMGSLRNGSNEMQFVGVPKHIIMIVQAIIIFLVAADRIVR
                     TIFLRKKVAK"
     gene            complement(341151..342683)
                     /locus_tag="AJ81_01850"
     CDS             complement(341151..342683)
                     /locus_tag="AJ81_01850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATP-binding protein"
                     /protein_id="AJC73154.1"
                     /translation="MEKAVEMIQIVKRFPQVVANDHVDLTVLKGEIHAIVGENGAGKT
                     TLMNQLYGLLRPDSGEIRIFGKKVNFRGPRDAILMGIGMVHQHFMLVNNLTVAENVVL
                     GSETGVGPLFDLKRARKKVLELSKLYGLHVDVDAKIEDLPVGTQQRVEILKVLYRGAE
                     ILILDEPTAVLTPQETEELFETMFKLKDTGKTIIFISHKLNEVMRVSDRITVMRQGKV
                     TGVLKKNETDPRQIARLMVGRDVVFTVEKTPARPDGVVLKVEDLHVKDYRNLEAVKGV
                     SFEVRAGEIYAIAGVAGNGQTELVEALTGLRKPVSGKVYFLGKDITHATPRELREMGM
                     GHIPEDRHKYGLILQFPAYYNVILGRHYRPPFANGEFLSHSKILNFAEELLNRFDVRP
                     NNVRMLGANFSGGNQQKLVIAREVGLEPKLMVISQPTRGLDVGATEFVHRTLIQLRDS
                     GVAILLVSMELDEVLSLADRIAVMYNGQIMGEVEPNAVSIEEIGLMMAGHRLEEIRGR
                     VA"
     gene            complement(342733..343815)
                     /locus_tag="AJ81_01855"
     CDS             complement(342733..343815)
                     /locus_tag="AJ81_01855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="AJC73155.1"
                     /translation="MKRLIVLSLIVMLSVFAMAFKVIMVTDVGGLGDKSFNDGTWEGI
                     VRAAKEIGAEYKVIQSYEQADYIPNLTRAAQEADVVFAVGFMMTDALFKVAKQFPNVY
                     FVGIDIVPPEGTNLPNVLCYVFKEEHAGFYAGYIAAAMTSTGKIGFVGGIPIPPVERF
                     RYGYEAGAKIYSTLHKKKVDILKGYTNDFEDPKKGKDLTMAQYAQGADIVFLAAGACG
                     NGGIEAAKEKMVALVGSDKLVDIIDYVVMNNKGFFAIGVDVDQDYMAPGVVLCSAMKG
                     ISMASYYGVKSAWEGTFEGGLKVLGVKEDGAGVSPMKYTKGMIPNRVIAELEYLTKLI
                     KDGKLVIPDTEDALKAFQVPAITFPF"
     gene            complement(343812..345734)
                     /locus_tag="AJ81_01860"
     CDS             complement(343812..345734)
                     /locus_tag="AJ81_01860"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74639.1"
                     /translation="MLSKTVVFVVLILTLTCWALQLPDALNLYLELVREYETGSIQNP
                     FLIKTVESLEHFALYRYYRFLIAGSVDKREATPDLGYYLSLIYSSYDFETEEEQLAAA
                     LFLSYLSSKLAKTRLTADYVMKDASFIDFFTRYRDVISREARSFFAWIIAYQVGLTDE
                     KPPLDLVQRYRIEITDYSFTPPIDLKHLVDLTTFYSDPTIQSILTQALERVVENAKKD
                     PARIAAHINREAAFVARDIVKPITNFQTYVAQTVQKITPAEKNYWWLRLIVYTCALFA
                     AIRFVKLRSLLLGSVLGFEAIYLFFFFDPTSMYESLTYGLVLIFGFAFAALRLPKKRP
                     IWLNVVCIILIVLAAIFPLVPRCEELSMDKREEFLGSRYYDLLKRELYVDELSLVSQY
                     VRRLSSTMYTSMEDTKAIVNDLVETLANLNSRGVVTEILLSSNYGAFFNDLSSFFRYG
                     GSKGRMEMFQPLSNTLRFYLLDERSRMKSFERDLDSLLKYSKRLVEYSAPRLRQEFKQ
                     HIEGLFSTKYPILSDLQSTFEKRIFQNSQRTASPHIRIFNNRSSLSIILITILVFLTN
                     FFLNPKISVGPSIVLLIVSVMGWLNVRNLMLIVEQTSPLLQLQTSSSINPLVFLVAMF
                     VASVNLLKLFRKGESR"
     gene            345823..345975
                     /locus_tag="AJ81_01865"
     CDS             345823..345975
                     /locus_tag="AJ81_01865"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74640.1"
                     /translation="MRVYVFGQLRIEDDRGNNVDITKIRSRKARELLLYFIIFHKRRI
                     PRRTVV"
     gene            346031..346789
                     /locus_tag="AJ81_01870"
     CDS             346031..346789
                     /locus_tag="AJ81_01870"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74641.1"
                     /translation="MSLIRRFLGKEVLTYSDATYCFDKDDKVIVDAEEFESSIVSARS
                     CQNEEKKILRLKQIVEGYTNDVLPEYCYEEWIVHAREHYKDLFIDVLMELIAHAEYSG
                     SFAEVQDLSKRAMEKDPLNEQACLSYMKALAQLGQETEALRFYESFSERMEKELGVLP
                     PQQVKDLRDELLTHRKRMIWIVTIEANSVSEAMQILKSVLRGDDEVRIISSQKIGLFV
                     KDVDREVAESIRKRVEKAFDGGSMQVKISLRLAR"
     gene            346881..347204
                     /locus_tag="AJ81_01875"
     CDS             346881..347204
                     /locus_tag="AJ81_01875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73156.1"
                     /translation="MAYKFKCINCGDISYSAAPLELQKFPLCEKCGGTVLRVQPPMKL
                     GEILIALGIMSEQDLKRALEVQEKMTEHLVIGRLLIKLNLIGRNELERALQIQRDMLS
                     GAQVQ"
     gene            complement(347198..347968)
                     /locus_tag="AJ81_01880"
     CDS             complement(347198..347968)
                     /locus_tag="AJ81_01880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="AJC73157.1"
                     /translation="MVEISLRNVDFAYVKDPVLRSIDLQINKGEFVSLIGPNGSGKTT
                     LLKLVAGLLKPTCGTVLVRGMEPGRMRKRQLARIVGFVTEDLNPIYPFQVKQIVLTGR
                     LPYKSSFFASWDELDFQKVKEALAKVDALEYLDRYFGQLSAGEKKRVSIARILAQDTP
                     ILLFDEPTAHLDPGHAVEVLEIMKKLHDEGRTILTAFHEINFAVRLSDRIVMMKEGKI
                     FAEGKAEKVLTKENLEQVYNTRFRLVNDPSTGLPYVIY"
     gene            complement(347961..348950)
                     /locus_tag="AJ81_01885"
     CDS             complement(347961..348950)
                     /locus_tag="AJ81_01885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002534155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter"
                     /protein_id="AJC73158.1"
                     /translation="MMKFGKWLALVTVFVVLVLLCLSVGSVKVDFADVLRALFDQTSK
                     HRSIVWGLRLPRVLMGLIAGASLAAVGAAFQGLLRNPLVDPYLLGVSSGASFGAVLSI
                     YLATVSGFQFLYRLPTLSFAFAMIASLVAIVLAKKDGTIPIVELVLSGVMVSVLFSSA
                     TITLLMLLRRNITHAYVWLFGSLSGMTWNDLLSPFVFFLLFFWASLGLSQQLNAMAIG
                     EVQAKISGVNTEFVKLIVYSLGSLAAASVVSKTGVIGFVGLITPHMARKLFGSDHKVL
                     LVSSALIGAILLCVCDAIARVIVSPSEMPIGVVTAFVGVPVMLVLLKKGENHG"
     gene            complement(348947..349840)
                     /locus_tag="AJ81_01890"
     CDS             complement(348947..349840)
                     /locus_tag="AJ81_01890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="AJC73159.1"
                     /translation="MRRFATLLLLIVFLALVWSYPITVVDDAGRTVTIVQKPERVICA
                     APSTTKFLQYLGLEDKIIAVTNWDDFEAERIGDLFPINLEKIVSLNPDLIFTFGGFQL
                     PEVVKLEQHGLTTVVLNANSVQQILNDLVLVGIIMGVPEKAKKLANQLQEHYLNIAKK
                     AYNIPLDKRVKVAYLMDIPGPDVREVWTCGQGSYLNDLIVLAGGANIAALFTGPNGFL
                     PISLEYIVSQDPDVLIVASYVPNSEEQIKEKVSNHPILKSLKAVRNKRIYVYDNYLLS
                     LPVPQLVEYIEKFYNDFYGGK"
     gene            complement(350069..351313)
                     /locus_tag="AJ81_01895"
     CDS             complement(350069..351313)
                     /locus_tag="AJ81_01895"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74642.1"
                     /translation="MNRKTLLVLLTVVVLSYVVTSIGFWMVEDTFSIAGRIFLYHTHR
                     KLIEGVGPAPNQYRYVPYPLVEYFFKHSPIRWYSNTYVKLKQWLGFDAREIVKRNNQL
                     SLNAHVPPEEREKMLTDVENFLREKLLEITKNPLTSNILLGILNNLGWRDWVKDPFNA
                     LEKISKELPSPIIDVFDNDSDLTKVVNGYATMRFTFTILLFLVLHAWMKFFVRDFTAY
                     VSLFAYSIFLAFGYGDFAQQEFIISLLFFVAGLILIYRRKPWWVVLLLVIGQCFVRTD
                     HALFTAVIYSLFNFSREKKKLLRQGVLVVIPVFMILVLSEVIFPKAEYYISAVMIMEN
                     VQDPWALVYPLFFFALPLFFVRKIRNNDFFRKTWLWMIPFIVMNFVMGCAREVRLYLP
                     IMAYIFPMFWLGVESLYNRTEK"
     gene            complement(351310..352395)
                     /locus_tag="AJ81_01900"
     CDS             complement(351310..352395)
                     /locus_tag="AJ81_01900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006345872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster-binding protein"
                     /protein_id="AJC73160.1"
                     /translation="MGKSKVFVLRTTPERVVEDIAQLLKEANVDVILDKSRPVILKDN
                     ISWHLPMPSSNTTPWQLEGTILGLKRLGFEQIIAVENKTVVTKPQKGAQLNKLASVYK
                     KYNVPILHNFEPSHMKWIDYQPRCELNVLHKIFPEGVKIPDFFVGKNIVHLPTMKCHI
                     YTTTTGAMKNAFGGLLNTKRHYAHSWIHETLVDLLKIQKEIHSGIFAVMDGTTAGNGP
                     GPRTMNPVRTDLVLASDDQVAVDAVAAKIMGFDPMSIDYIRIANEQGLGNGRLENIEI
                     VGYDVSSLNYRFKVGDNLASRVGDVLWFGPLKRLQHLFFRTPLVYLFVLASEVYHDVF
                     WWNLKGRRILEDWKKSSPWGKLWENYT"
     gene            complement(352409..352762)
                     /locus_tag="AJ81_01905"
     CDS             complement(352409..352762)
                     /locus_tag="AJ81_01905"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74643.1"
                     /translation="MKSFLVLLMALTANALANVFVKVAAVSLVRSENIAHFFLNSMKN
                     LYTWLALFCFAVAFVLYALSLTRLKLSVAYPIMTSAGFVLVSLFSHFLFKESVTVTKI
                     IGMIVIVAGIWLVSV"
     gene            complement(352767..353636)
                     /locus_tag="AJ81_01910"
     CDS             complement(352767..353636)
                     /locus_tag="AJ81_01910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_02863420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribose diphosphate:decaprenyl-phosphate
                     phosphoribosyltransferase"
                     /protein_id="AJC73161.1"
                     /translation="MPNVLRLLRIKQWVKNLFVLAPLVFSKRFFDPSSFLLSFTAFLI
                     FCLASSAVYILNDIRDAPLDRLHPKKRNRPIASNRVSVRTAYVVFSILLSASVLMAIE
                     VGLKFLACIVVYLSLNVFYTFWGKYLVLIDVFCIAAGFALRVMGGSYAIRVSPSGWLI
                     TSTFFLSLFLGFSKRKAELVSLDGNNHFQRPSLQFYDLDLLTNVVVSTGTGAIVFYTL
                     YTLDVRTIEQFGTDKLYLTVPFVCYGVFRYMFLSMHRGEEDPTDVLTKDRSLWIAIGL
                     WFFSVMMILYLGR"
     gene            complement(353732..354835)
                     /locus_tag="AJ81_01915"
     CDS             complement(353732..354835)
                     /locus_tag="AJ81_01915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="AJC73162.1"
                     /translation="MAKVELENVTKIFDNKVVAVKDVTLTVEDKEFVVLLGPSGCGKT
                     TTLRMIAGLEEITKGTIKIDGKVVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLK
                     LRKFPKDEIDRRVKEAAKILGIEELLDRKPRQLSGGQRQRVAVGRAIVRNPKVFLFDE
                     PLSNLDAKLRVQMRSELKKLHHRLEATIVYVTHDQVEAMTMADKIVIMKDGTVQQIGT
                     PYEVYNKPANTFVAGFIGSPAMNFLNAVVVAEKGGIWIKTSGFKVKVIKEHEPVLEPW
                     IDKEVIFGIRPENIFDKLFAIAPQPENTITGIVDVVEPLGSETLLHVTCGEDSLVARV
                     DPRTKAKEGEKIDLVFDMNMIHVFDKETQKAIL"
     gene            complement(354840..355103)
                     /locus_tag="AJ81_01920"
     CDS             complement(354840..355103)
                     /locus_tag="AJ81_01920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005470672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="AJC73163.1"
                     /translation="MKNQLEFFSLADAKAKLSEVLKRVQQKDVVITKNGVPAAVLIDY
                     ERYRKIMNFLDQVYDLYLLDVGDPSAHGSVNQRELFQEDIEEV"
     gene            355233..356705
                     /locus_tag="AJ81_01925"
     CDS             355233..356705
                     /locus_tag="AJ81_01925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="AJC73164.1"
                     /translation="MLNQISSHRLYSLLSSFIREIMNATEPDLLLDALMKIFQRFVDC
                     ESIVVLDNDLNVKKIKGDTAEIDEDLKKMIQWVMNNHSPMSLPKGDAMIHIFPLVKAG
                     KTLGVLLAWSNEEIVVETSELLRTFAFLSAVVLENLELYSSLQRQHMALEATKNYMQR
                     ILDSFPQHIAVFDQDSRIVFANKGYSLSSFGEDIASKVTQLVQKTFLTGSRQTLEVEE
                     GANFYSIVAEPIEYEGQPQVLLVITDVTNTKEVERLKAIDQLKTEFVANISHELKTPL
                     AAIKAYAETILMSIEMLDQQTLNEFVQIIYKESQHLESILEGLLDFSKLEQRMMTLEK
                     TTFDLTGLVRETMRSIEELARSKQVRLELLTKEPVLIRADQKRIKQVITNLVNNGIKY
                     SKEDSQEKYVRVRIERKGDKVLIEISDNGLGIPKEYHEKVFERFFRVGTVMDHRVEGT
                     GLGLTIAKQIVELHGGRIWLESEPNVGTTVFVELPVGDER"
     gene            356702..357565
                     /locus_tag="AJ81_01930"
     CDS             356702..357565
                     /locus_tag="AJ81_01930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001409925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="AJC73165.1"
                     /translation="MKLEEIITKIEELPTPDPIVQKIIAVASDPNASAKDLADVIKLD
                     PSLSVRVLRLVNSAYYGLPRKIAQLSEAVMILGFKTVRNLALSVFTYNSLMRRKRSTI
                     DHTALWKHFIGVAVASELMAQVVGYPNKEELFVAGLLHDIGKVTLEFVSPEMFAAVAK
                     LTKTLKISFFEAEKKLNLPNHALISMKTIERWGLPELVSQSCGGHHTPESFSESLYSD
                     VISMIHVSDFFVNTINYGESYSYGGFVLSPYALNLLGLKPRMLTNYLKKLKEKLMTAD
                     EFLKIEQEAVS"
     gene            357562..357918
                     /locus_tag="AJ81_01935"
     CDS             357562..357918
                     /locus_tag="AJ81_01935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="AJC73166.1"
                     /translation="MRPDYRKAMLESEIVKLISEALREAKDPKLKDRIITVSRAELFA
                     DKRFVDVYVSSIGDESERKALVEHLNKIKGYFRTYLANNLDLFVAPQVRFKEDPGIEA
                     SVRVQELLNRLKEEKK"
     gene            357921..358841
                     /locus_tag="AJ81_01940"
     CDS             357921..358841
                     /locus_tag="AJ81_01940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660146.1"
                     /note="catalyzes isomerization of specific uridines in RNA
                     to pseudouridine; responsible for residues in T loops of
                     many tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="AJC73167.1"
                     /translation="MSGILLVDKPKGPTSHDVVDEVRKKLNQRRVGHAGTLDPFATGL
                     LIVGVGNATRLLEYLMNHNKVYRVKMKLGLITDTFDITGKIEEERPCNATREEIIETI
                     KSFVGSYVQVPPAYSAKKYKGERLYELARQGRIVRLPPRQVTIHRIEDIEIEDLFVSF
                     TVETSPGTYVRSLCMDIGYKLGCGATAVELRRLSVGPFKVEDAVDVYNLSAEEITKKI
                     IPISKVLHFPKVWINNEAKERVLNGMKIHVKDILYHEQFEKDSIVQVFNEEELLCLAR
                     AERRSTFLRTLLQQERNEAVLKPFKVFRES"
     gene            358844..359581
                     /locus_tag="AJ81_01945"
     CDS             358844..359581
                     /locus_tag="AJ81_01945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002334416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibF"
                     /protein_id="AJC73168.1"
                     /translation="MYVTTIGVFDGVHLGHKALLKEVNRLAQERNLRSRAFVVSHPFE
                     HLTGNFDGLIMSHERRILLLSQYLDEVELLDLRCIKDMTANDFFERILAKDTAVLVVG
                     RDFKFGRNALGDLSLLEKLCEDRKITLRTFPDVLDENKERISSSRIRNMIRDGRIEQA
                     ERLLGHEYLLEAVVLNVSSFNSRSVALLHTAKELVKPQSGAFQIEEQSLKIRGTLILN
                     GETKLVSQDLRLAPGTYLYLRFMEGRL"
     gene            359578..361437
                     /locus_tag="AJ81_01950"
     CDS             359578..361437
                     /locus_tag="AJ81_01950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002534858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="AJC73169.1"
                     /translation="MRVGVVTGINSSDPYVFYVRLEQEDGRPRHMLQIDDVVKVQFDY
                     HPQGSLIYYGIVVKIMARWDFGPISGYEEELALKGLSPANPIFIATVMTTRMLKIESG
                     KILPDAPQVPPPPGSEVSVASESELDVALGFDELLQKHCAIPIGLFRNNRCAYADVRY
                     ILGENGAHINISGQSGVAAKTSYATFLVKSFLDTGNRLKEKNELMACLSRSRFIIFNV
                     KGEGLLFLDKWSKDWKEKEETNTGKSWKRMYEALQMKAEPFEKVAFFAPRKLAKDEPW
                     VNKRSQGVQIYGWDIVDIMKLGLFELLFDQEELEKNQNLQLAVTSVQEVLQSRFEEAI
                     LEAKRFCERNRIKVPNDPEMIIRTAIANGFDVSTMARLPDGLDELIKMFDEDEDFKTR
                     IAQEVQGKATVAALIRRLKAAKAVGFDLLWVRTNFLNYNATRRIDWDKPGQVTVIDIS
                     KLKNRPQSFVVGAVLLEVMRSREEKTNQDPVFIFLDELNKYAPRFGGGPLSSIFRDIA
                     ERGRSFRVILIGAEQTASEVDYRIITQSSTTVVGRQKGAELAKPEYSHLTDEQKARAA
                     LLQQGEVIVDQPFMRIPITVRFPLPAWCTREDDAYTMSEQERRTLEERAYGGD"
     gene            361439..362788
                     /locus_tag="AJ81_01955"
     CDS             361439..362788
                     /locus_tag="AJ81_01955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005472143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="AJC73170.1"
                     /translation="MTLKNCLVYRDGNFVKMDLNVEKGIFVDNPSEPLIDATGYYVMP
                     GFVDSHAHVIGTGHKYGHVNLENVGSIEELLQILQAEDHGVIIGRGWSEEKLGTRPTR
                     QLLDLLEKPVLLIRRCGHVAVANRSLMELTGRWREDGVFKEQDLEQLRKDLPSREDEK
                     FFKIGQEHFLMHGVTFVHSDDLHGLSWENLKEILKDSKMRVFEKVYFPSLSDLEKFDD
                     FGQISDRVIVKAVKLFADGSVGGRTAWLSVPYADDPSNFGTKLIDEEELEKFAILCER
                     KNVQLCVHAIGDEALHMVGKVFSRHPNHRVIHAQLVRNEDLSLLRKSFFSIQPHFAFE
                     DRHLIESVLPKNLKALRYPFLMLFQQGFKIAFSTDAPVSPEDPKYVIECAMKLGFTKQ
                     QAIELYTVAGARMAGLNNLGEIKSGFLADFCLYEKNPLDLDEDPVAVYVAGELVYEK"
     gene            complement(362791..362867)
                     /locus_tag="AJ81_01960"
     tRNA            complement(362791..362867)
                     /locus_tag="AJ81_01960"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(362831..362833),aa:Thr,seq:ggt)
     gene            complement(362927..365458)
                     /locus_tag="AJ81_01965"
     CDS             complement(362927..365458)
                     /locus_tag="AJ81_01965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase"
                     /protein_id="AJC73171.1"
                     /translation="MIFCFVSPCSFDGSVIRLRQMIEFAKERGMKSLLLADTNFHAAV
                     RFNKLCQENGLIPIHGLRKGQKIFYARDREEFEELVRSYNENREPRLNSLDVKEVRLV
                     YYLDRSSFEAHRFMTRLVGSEPCEDCEPFGKFLDPAEALGARLYDLKVSHKLLNPPEG
                     WLDKLFEELDLERKTRLMREVEVVRKLGFESYFYTVKRIVDIATQNGILIGPGRGSVV
                     GSLLAYLLGITSIDPISHNLMFERFLHEERREPPDIDIDVADEQRDKLLGLLKDAFPY
                     FAQISTFVTLTEKGLFNEVSRLKLDVSSNVTKALIGLPLRRSIHAAGIVLAAEPLNLP
                     LVPSSDQPVIEYDMDSLECIGVVKIDVLGLRTLTVLDKIRKRVNVKTMPFNDGATFEL
                     LGRGNTCGIFQLESETARNLCRLIRPSNLEELSVLLALNRPGPLAAKLEKTYAERKRG
                     CQRAEEDMFPETHGVIVYQEQVMRLAMRTAGFSAAEADLFRKAISEKDPRILEPALQK
                     FRDALHKRGYRPDFVEKLCDVLVKFAGYAFNKSHSVAYSHLSYELAYLKAHWPREFFD
                     VYVREHSSEQFKVFLAVQELRSLGYEVLPPNVNFGGSEDRIFRLPLEAVGGIGESSAR
                     ICRELAPFSNLKDFAERTRLPTSTIQRLVWAGAFDELYGSRSAALEDFEAFQKGHDPE
                     LSLVAAKVFGKQTERKQKLSYDEVDLAELEERAFGFALTPFAFENEKKFAPLAEVFAS
                     SRILPVAVRISKNFASDGYTIARLKDRLPDGYYALILAPDGRIVQHKKLDEVQRVVYK
                     IENCFDERDVERASELECVETVLCGKKITLFGLRPLVDWYRIEFI"
     gene            complement(365455..366372)
                     /locus_tag="AJ81_01970"
     CDS             complement(365455..366372)
                     /locus_tag="AJ81_01970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="AJC73172.1"
                     /translation="MTIKVNRNEAGERLDLFLLSKLPKIVSRSFLQKLIKDGQIKVND
                     RLEKPSYRVKANDIISLPDRPVPQQIEILPEPLELNVLYEDSDIIVVNKPAGMIVHPI
                     PSHTSGTLVNALLYHCKDLQGIGGELRPGIVHRLDKDTSGVMVVAKNDLAHRSLSQQF
                     KNREVFKMYLAIVQGKPNETEGEIQIKVARHPTLRVKMTVAAEGRIAVTSYRVLKSFD
                     DLASLVAAYPKTGRTHQIRVHIKYIQHPILGDRLYGRADPIYVERQMLHAAILQFRHP
                     KKNEQMRFIAPLPEDFKAALRRLHEVSSK"
     gene            complement(366347..366790)
                     /locus_tag="AJ81_01975"
     CDS             complement(366347..366790)
                     /locus_tag="AJ81_01975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001306234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="AJC73173.1"
                     /translation="MFWVTFVVLMDQLSKMLIERFLTIPTFVVPGILWFTYTKNTGIA
                     FGMFARSGWIVWVTFFATLFLALVPKFVKCSTLTKAGLQMIVGGAIGNVIDRFRLGYV
                     VDFINLRYFPAVFNVADLFITIGGILVLVSLLRGEQPLDNKGEQE"
     gene            complement(366791..367606)
                     /locus_tag="AJ81_01980"
     CDS             complement(366791..367606)
                     /locus_tag="AJ81_01980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="AJC73174.1"
                     /translation="MQDFLSQSSGELPIEDFQWFVKEVHRHFGLDLSGYKPHRMKRRI
                     EILIRKYRLSSYQEYLRLLLTNSSAKEEFLDKITINVTEFFRNPEKWWELRDKYLPEL
                     LSFSRSRFKAWSAGCASGEEPYSLAILLEELKAPAGAYVLATDIDDKALQEAKNGVYE
                     SRSMISTPKAYVDRYFEIVDGMYKVKDVVKKRVTFQKHNMLQDPFPQGLDLIVCRNVV
                     IYFEENAKAQLYQNFAKALRLGGLLFVGSTERIFNHAELGLKIVSPFFYRRVT"
     gene            complement(367575..368336)
                     /locus_tag="AJ81_01985"
     CDS             complement(367575..368336)
                     /locus_tag="AJ81_01985"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74644.1"
                     /translation="MRFCLASLLIFAFVGVASTVNFDYTLGSDAYFGMRIVPHVEFWR
                     VEALLDFPFGLKLAGGWFSPIVSPLESLKYLNVDLDPGGVRFNAPHLVQTSFANIDFH
                     ERSLVGWAFNGSLGAVVGPENALFFKTSFFNACIDSTGQHHVGLNFPIGSIELGGFTS
                     SRGYGFSVLVDPFMFFYIPESGFRFAVERKNVYLVGQYLDETFSVSMGWFGKEEWFLI
                     GTNGVEARLKFGELALVMKLQKERWYAGFSFPIVW"
     gene            complement(368333..369094)
                     /locus_tag="AJ81_01990"
     CDS             complement(368333..369094)
                     /locus_tag="AJ81_01990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AJC73175.1"
                     /translation="MSGHNKWANIKHRKMAQDAKRSQLFTKLIRELIVAAREGGGNPD
                     TNPRLRAAIERAKEASMPKENIERAIKRGTGEIEGAEFQEIIYEAYAPGGVALYIRAL
                     TDNKNRTAQELRHILSRHGGSLAEPGAVGWVFERKGIIQVPREQVANVEELMMMAIDA
                     GAEDIKDEEDPIRILTSPEDVMKVKDTLEASGYKVEATIGYVPKNTVRVTGKDAERLL
                     TLLNALEDMDDVQEVFSNFEMDDAEMEALLAQLGQ"
     gene            complement(369131..370477)
                     /locus_tag="AJ81_01995"
     CDS             complement(369131..370477)
                     /locus_tag="AJ81_01995"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74645.1"
                     /translation="MVDNFEALYEKLNRLAKMASDDRILSKKEMFGFLEQVLKQMDQL
                     REEYTKLLQDHLEELSRTYQEIATLFELNSMFANVVDPSEIFEPLTQTLRQTVAFKAI
                     MIELTILGNVLEYEKSFDRQNLIAQAKHLLKDFEGVVLIEPEHGMELKNLLSVPVRSG
                     GTEWGRITLIEKEDGIFTAADRKILEAVAFQMAATCERYTRLRREIERQRIREQLEIA
                     KRIQTSLLPKRLPRSHHFEIAAQMVPAIQVGGDYYDAILIGQCVLVTVADVSGKGIPA
                     ALLMTSLRSTLRALVKNAFGLSRLAEELNSVLCEDLEEDRFVTIVLMCLHENGEAHII
                     NAGHNPIVHVRNGQIDLLEARTLPMGIMKDVNYEETVLKLDPLDTLVIYTDGVTEARN
                     QAGEEFGFERLVKTVKKCWNKSADAVMKEIQDELRFFCGDAPQHDDSTLVVVKYFG"
     gene            complement(370467..370841)
                     /locus_tag="AJ81_02000"
     CDS             complement(370467..370841)
                     /locus_tag="AJ81_02000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="AJC73176.1"
                     /translation="MGCRVLVVDDSDVLRKIVSFNLTKEGYVVEEARDGLEGLEKMKS
                     NRPDLVILDVMMPHLNGFEVLKRMRADPELSNVPVIILTAKGGENDAKMALQSGANGF
                     LTKPFSPLKLLEEVRRVTQRGG"
     gene            complement(370823..371461)
                     /locus_tag="AJ81_02005"
     CDS             complement(370823..371461)
                     /locus_tag="AJ81_02005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73177.1"
                     /translation="MRAVVRYKKTGLLRFLSAIETANAIERNLRRAEAPLEFSRGFHK
                     KPKVSFLDPTPTGVFNLALYVTVHLQRYDENLLDRLRRTAVKGLEPVQLWWTDLDVNR
                     IVNGYLFRVLLLEDCVDPSRFDPQRQISILEKNKSGKLEDFFKHVHFEKVGKFFIVVY
                     YQNRENLVRARHLYQPILVKECPLVLVQRLEAICGESQLSEVLGAKSWAVEC"
     gene            371523..373019
                     /locus_tag="AJ81_02010"
     CDS             371523..373019
                     /locus_tag="AJ81_02010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent phosphohydrolase"
                     /protein_id="AJC73178.1"
                     /translation="MYHKVSRDPIHSEIFLYPLEILAIDTRPVQRLRQLSQLAGAEWV
                     YPGASHTRFAHSLGVMHIAGLYAERLFQEHSRRRIVRLAGLLHDVGHGPFSHQFDDVV
                     YRRMGLQDGHDGHRERILLELMPKEMFRAYEKMSDPGKKEAIRKDLKQTIGTEDVSIE
                     SLTHLMQEVNNVFKGEESGSAEYNVVQGPLGADRLDFLLRDAYYSGTTHFGVGAVDRI
                     IRNAYLKMKDSKTILCYHVKVLDQIYTSLFGRFMMYKNVYFHKTSRAVDLMIQEILSL
                     VYKPLTLPERVNELEKFLDLTDQSLLAEVKLEARKILEKHKVDSEAEIEIADLSDDEY
                     NLIEAYRILRRLETRDLWKVIVEIAFTAEGADPYVLSVGIVADTLQKIRLRLEKLVDS
                     KDVPDEDRKIMRRLLDDFEVVFKSDTPYKLSLVHPQEFVNSNVFLYDPQTDTIITLED
                     YVKSYPAYRLLASNLVQIVRIYVTEDVRELLTRYNVIPSAKLQLTTRW"
     gene            complement(373021..373893)
                     /locus_tag="AJ81_02015"
     CDS             complement(373021..373893)
                     /locus_tag="AJ81_02015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent enzyme"
                     /protein_id="AJC73179.1"
                     /translation="MKVGGQAVIEGVLMLGSRVSMAVRNKDGEIVLEDLSQGSVATKK
                     LFRVPFLRGFVSLYYSLYFGIKALNRSAEISSGESVKKSELLWTTLFAFGLAIGLFVL
                     LPMWITGLFDALRKNEVLFAVVEGALRLTFFVLYVWIISFFPDVKRLFQYHGAEHMVI
                     NAYENSEQLELENVKKYGTIHPRCGTSFIMIFLIFSVVVLSLASPIASKSFVWRLVSR
                     LVLLPLTAGFAYELLRVSSKNPTLLRILFYPGLFFQKLTTAQPDDSQLEVAIAALKRV
                     LPDSSKEEGPDYFG"
     gene            complement(373906..375201)
                     /locus_tag="AJ81_02020"
     CDS             complement(373906..375201)
                     /locus_tag="AJ81_02020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="AJC73180.1"
                     /translation="MFSTLKWKLTVIQTVLFSLVLGLGLLLTYNVTKQVHISRSVALL
                     RQAVSAYLRNPMRNAPRSGLPAGIAIISSTGEVIFGTIDTQHESFEKFLSHVLSVRKP
                     SYIKLGNDEYLVVKLSVQTFAGQSELFLLSPAGGMGDFLKLLSRMFLILWAIFSLASF
                     LLGHYFVNRSLAPMKRITEELRNISASDLSRRVYDPGTEDEVSNLAKTINDMLNRLQL
                     GFEMQNDFVNDVSHELRTPLTSIQGYAELIEKFSKNSEIVTESARTIRETVQQIIDLT
                     ENLLTLSRPVSKVELVRLDLRKFLHEEAEEFSRQFRDFTFEVEGEGEGCSDTRALRIV
                     LKALVENAVKFSTNDKRIILRCGDGWISVKDFGIGIEDSEKKKIFQKFYKSDRSRSTP
                     GYGLGLALADKLVRAIGGTIEVVSEVGKGSEFIVKLPKC"
     gene            complement(375185..375844)
                     /locus_tag="AJ81_02025"
     CDS             complement(375185..375844)
                     /locus_tag="AJ81_02025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator ArlR"
                     /protein_id="AJC73181.1"
                     /translation="MRLLIVEDDPKIARLLQILFESHGYEVRIARDGEEGWQLFHLFD
                     PVVVVLDLMLPGMDGFEVLEKIRSIDEEVGVVVLTARGEVENKIKGLKKGADDYVPKP
                     FHLDELLARVESVARRVRKKDIFHIGDVMFVPKMRKLSFPDGKEVSLSDREVAILELF
                     CEKKGSVVSREELLEKVWGDTYNISRNVVDVYVKYLRDKLGESAKFLKTVRGAGYVLD
                     T"
     gene            complement(375819..376361)
                     /locus_tag="AJ81_02030"
     CDS             complement(375819..376361)
                     /locus_tag="AJ81_02030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="AJC73182.1"
                     /translation="MRSLKWLTTLFLLQTFFVLAIEVPDWFAKLMVETRSKHGLLTDD
                     VYVASLYETILEVSEKYGVDRLLIIALIAVESEFRNVVGMHGELGLMQIKPETAEFVC
                     RIYGLDEPEEGWGRLLWDHKLNVELGTLYLKYQLERFSGSVLKALEAYNGGNSKSRYA
                     ARVVDRYRELMNHSLADRGG"
     gene            376410..377819
                     /locus_tag="AJ81_02035"
     CDS             376410..377819
                     /locus_tag="AJ81_02035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005471010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="AJC73183.1"
                     /translation="MEALYRKYRPKSFSQVIDQVQAKLVLQNAILTDRVSHAYIFSGP
                     RGSGKTTLARILAKALNCPNRKDFEPCCTCESCISIDKGNHPDVIELDAASNRGIDEI
                     RRIRDAVMFKPMMGMYKVYIIDEFHMLTREAFNALLKTLEEPPERVVFVLATTNLERV
                     PATIVSRCQLIEFRSFKENDILQQLKLVASKENIPAEEEALKIIAKRASGGMRDALTM
                     LEQVSSYALSDRITVETVERALGLAPSGAVEEYLHALMNGDATKVGEIVDRMYEEGYD
                     IEQFVQVCLERMEEEIASHPSTETISLARDLMNLASEMRFFENKRIACKLLSIDIAAR
                     RGTKVQPTQSAKEQAKSIEPIEQKDEAVKVQSDLSDQIDVSPLLDYLRNQGDMAMYVA
                     LVQANITKKDGTVEVSFLPSQRFQYEYLREKLFELEYLFKTQLKSNVTVELKVDEERE
                     KQLLEKLQKLFPGRIKIEE"
     gene            377825..378181
                     /locus_tag="AJ81_02040"
     CDS             377825..378181
                     /locus_tag="AJ81_02040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005471315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73184.1"
                     /translation="MKKIKGFGGRSYGAAKGEGKEIDLGSLQKVQQEMAKKLEQLEAS
                     FSQMEVTGTAGGGAIKVRATCDYRIVSIEYDDELLQNKDMLNDLIIAAVNEALREIQK
                     RRDEEMMRITQDQLRL"
     gene            378265..379266
                     /gene="gapA"
                     /locus_tag="AJ81_02045"
     CDS             378265..379266
                     /gene="gapA"
                     /locus_tag="AJ81_02045"
                     /EC_number="1.2.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659767.1"
                     /note="required for glycolysis; catalyzes the formation of
                     3-phospho-D-glyceroyl phosphate from D-glyceraldehyde
                     3-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="AJC73185.1"
                     /translation="MRVAINGFGRIGRLVFREILKRNSSNIEVVAINDITDAATLAHL
                     FKYDSVHKIYPGEVRTENDSIIIDGKAYKVFSEKDPAKLPWKDLGVDVVIESSGVFTD
                     REKASLHLQAGAKKVVITAPAKGEGVTTIVIGCNEDKLTAEHDIISCASCTTNSIAPI
                     IKVLHEKFNIENGFLTTVHAYTNDQRVLDLPHKDLRRARAAALSIIPTTTGAAKAVAL
                     VVPELKGKLDGVALRVPVPDGSISDFVALVSKETSIEEVNQVMKEACETRLKGIIAYN
                     TDPIVSCDIIGTSYSGIFDATLTNVKGKLIKVFSWYDNEYGYSCRVVDTVELLAKLL"
     gene            379305..380492
                     /gene="pgk"
                     /locus_tag="AJ81_02050"
     CDS             379305..380492
                     /gene="pgk"
                     /locus_tag="AJ81_02050"
                     /EC_number="2.7.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470627.1"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="AJC73186.1"
                     /translation="MKKMTIRDVDLNGKTVIMRVDFNVPVENGKVTDDTRIVAALPTI
                     KYAVEHNAKVILLSHLGRPKGVDPKYSMKPVAEHLKQISGLNVIFVPHVVGEEVKRAV
                     QEAKPKDVIVLENTRFHPGEEKNDPELAKAWAELADIHVNDAFGTAHRAHASNVGIAS
                     FIPSVAGFLMEKEIEFLNKVTYEPDHPYVVVLGGAKVSDKIGVITNLMNKADKILIGG
                     AMMFTFLKAQGLNVGSSLVENDKLDLAKQILEQAEQKKVKMVLPVDCVIAQKIEANAE
                     KKIVDLKDGIPEGWMGLDIGPKTVELFEKELEDAKTVVWNGPMGVFEIDDFAEGTKRV
                     ALAISRVKGTTVVGGGDSAAAVAKFNLESAYSHVSTGGGASLEFLEGRELPGIKSIAD
                     KKK"
     gene            380522..381250
                     /gene="tpiA"
                     /locus_tag="AJ81_02055"
     CDS             380522..381250
                     /gene="tpiA"
                     /locus_tag="AJ81_02055"
                     /EC_number="5.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659765.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="AJC73187.1"
                     /translation="MHKTNEEAKLFVNRLINDLAGKRFKIVVCPPFVSLTDVVEITRG
                     TNISIGAQNCHFERSGAFTGEVSAAMLKAIGIEYVIVGHSERRKYFNETDEMINRKVK
                     SVLSEGMKPILCVGETKEEREKGLTFCVVEMQIRHALYGLSRQEVENIVIAYEPVWAI
                     GTGVVAKPEQAQEVHRFIRKLLSELYDTKLAESIPILYGGSIKPDNFFAIMAQPDVDG
                     GLVGGASLDEQFVKLAQIVQSFAV"
     gene            complement(381213..381908)
                     /locus_tag="AJ81_02060"
     CDS             complement(381213..381908)
                     /locus_tag="AJ81_02060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002535323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-phosphosulfolactate phosphatase"
                     /protein_id="AJC73188.1"
                     /translation="MIDVIFVPKQKVKSDVCVLIDVLRATSVIVTALANGAVSVKPVS
                     NVRKALAEKTSNMLVCGERKSVKPRGFDLGNSPTEYSRERVAGKRIVLTTSNGTRAVE
                     KIECKILYAASFLNLSAVVQQLRRHRHFTLVCSGQNGGIAVEDVLCAGAIVAMCGAKE
                     KSDSALIAESVWKCSDSVFRSLCESKHGQELIEIGFLKDIEYCSQIDIHPIVPVFDGT
                     SFTLRKTAQSGQV"
     gene            complement(381913..382155)
                     /locus_tag="AJ81_02065"
     CDS             complement(381913..382155)
                     /locus_tag="AJ81_02065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_228837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YruB family glutaredoxin"
                     /protein_id="AJC73189.1"
                     /translation="MQHIKITIYTTPTCPYCARAKSYLRQLGLKFTEVDVSRDPVAAE
                     RLVKKTGQTGVPVIEIGNQIVIGFDKEKIDRILGVR"
     gene            complement(382160..382843)
                     /locus_tag="AJ81_02070"
     CDS             complement(382160..382843)
                     /locus_tag="AJ81_02070"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74646.1"
                     /translation="MAIKKRRTGLFWVLLAVLIAGAGFGLWFFLSLNSLKGSAEFTSP
                     VVHYAFILKDQQKAYFIRVDLSKRMIYVIELPQYAFNPLNNRLLDVQNPLEVFSFAES
                     MIELSSSFRYYAVVDSEQIKRFSKALLGNGAESFENLLRNLAVRKSNPFDHVLTRKWL
                     GEFRNENTMTVAALYKLVYESGRNALRFYTVKGVLEKPLTIIVDGKKYQRLYLNVESI
                     EAIKQDMRR"
     gene            complement(382847..383464)
                     /locus_tag="AJ81_02075"
     CDS             complement(382847..383464)
                     /locus_tag="AJ81_02075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="AJC73190.1"
                     /translation="MQHIVEELIQTLKLLVTPRRLRHIYSCCNFARKLAKLHRVDEQK
                     VTVACLAHDAFRDVPASKLLKIARAYGIEPNEMELAHPVLLHGKVAAEYLKRRFKIED
                     QEILEAVSAHTSGKPYMSEIAKIVFLADSLEETRVYEGVEDLRKLAEQDLDEAVIQTL
                     RNKICYAVKKEYLLFPQTVEMWNWLLWNKRPRPLTVNDQDGVEGG"
     gene            complement(383468..383749)
                     /locus_tag="AJ81_02080"
     CDS             complement(383468..383749)
                     /locus_tag="AJ81_02080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73191.1"
                     /translation="MHVAVVSFKIKLFGISSLKEKRSLIKRLMNELRSKYNVSVSEVG
                     MCDSKGWAEIGIAVVNSAKEVVDSTVEQISNVLESTYGLQIVELEREGW"
     gene            complement(383765..385825)
                     /locus_tag="AJ81_02085"
     CDS             complement(383765..385825)
                     /locus_tag="AJ81_02085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="AJC73192.1"
                     /translation="MAIAAEKKRNFVLIGHNGSGKSLLTSSMIKTAGLADRISNKLVD
                     VDPLEEAKGSSINSHVFTFMWKDHLLTAIDTPGFGDFIAEVINSIFVSENVVSVINAV
                     SGVEIQTERTWQIAQQMSKPIMVFVNQMDKERANFENVLESVKSAFECKIVPLVLPIG
                     SEANFKGIVDLVGMKAYVYEDGKSRAVEVPSDMAKQVEEAKLKLLEDIVESDDVLMEK
                     YLEGQEISEEELRTALVKAYKSGAIVPALCGSAEKGIGVDLLLDAIVDLGANPLEAKP
                     LKAVLESGEETLVSASETEPFCAYIFKNVVDPFVGRVSYIKIISGNARPGDNFVNANR
                     GTSDRISKLYWARGKEQVEIEAASCGEIVVLPKLKEASVSETLTHKDRRLKIVPPQFP
                     EPMFSRSVNPRSKTDIDKISNGLSRLSESDPTFKWEYDPETGETVVSGLGTIHLDVMI
                     EKLKNIFSVDVEVGKPKIAYRETITRKAVAEYKHKKQTGGHGQYGHVKIELEPLPRGA
                     GFEFVDKIFGGAIPKNFIPSVEKGIVEAMKRGSLAGYPVVDVRVTLFDGSYHEVDSSD
                     IAFQIAAIQAFRKGMEEARPVILEPIMEVEIFCPDEVAGDVMGEVTSRRGRPQGMEPA
                     GRGMSKIKAEVPLAEMLDFSGRLSGITSGRGYFTMKFLKYQEVPPNIQEKIIQERKQE
                     QQNA"
     gene            complement(385853..387499)
                     /locus_tag="AJ81_02090"
     CDS             complement(385853..387499)
                     /locus_tag="AJ81_02090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73193.1"
                     /translation="MRHLFFLVLVVVASCALGQILVGLQGKFVVLQESEGYVDVQGLQ
                     QLGLTFVLSEVSGRAYLIFEKKIILLNKDGTVSVDFLDVYEESAKFVGKRVFIKAELL
                     QNILGLKAYKTVSGQIVLLDSVPILVSAVFEKNQLKLRFAGFISEQMVSARTSKGKLT
                     VEISPCLSSAMSLEPVKILAEGTSVIIDVDLGVDVEPVMVMRMEASALVFELRMPMLG
                     KEWIANGVYWQQTSERIGNKELLVNYLWIDPSIVELKPAISSSGIGTMESVESMVARN
                     GAIAGVNASYFDPNTAIPIGLLIVDGKVLQSIYGDRPIFVYTYAGTAHIERFYFDLNV
                     RVGQLLFIVKGVNTVALGDVLIFTREFGLPIPKRDDTIYLVVEEGKVVSKGWTSKAPD
                     SGFVLAISNKYERYLQEVRPGDPVEYVVNTNFPYRIKHAVEAGPLLLYQGAPIPDRNQ
                     EKNRYGGNIARVNATRTLIATTQDGKVALIVISDQNGSGGVNYDELVDFCLSKGFYSA
                     MNFDGGSSSVMVIRDKIVSRTPTGWTRAVPVSLLVVEKSE"
     gene            complement(387496..388788)
                     /locus_tag="AJ81_02095"
     CDS             complement(387496..388788)
                     /locus_tag="AJ81_02095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine-nucleoside phosphorylase"
                     /protein_id="AJC73194.1"
                     /translation="MRMYDIIKKKRDGEELTTEEIRFVVHGYTRGEIPDYQMAAFLMA
                     VYFRGMNERETYDLTIAMLESGERLDLSSLKGVKLDKHSSGGVGDKITFVVLPIAASF
                     GVKIIKMSGRGLGHTGGTIDKLESIPGMKTSLTRDEFIRIVDEIGFAVASQTENLAPA
                     DKKIYALRDATATVENLSLIASSIVSKKLAAGADAIVFDVKVGSGAFMKNVDQARRLA
                     LLMLDIVKRNGRKARAVLSNMDQPLGRMVGNSLEVIEAVECLRGEGPEDVMQLSFTLV
                     KEMLDLAGVRVNLNDIESMVRSHEPLNRFKKFIERQGGDPSVVDDPSRLPISRDIVEV
                     RADRDGYVARLDAEAIGRACVLLGGGRSKKEDSIDHSVGIELLKKVSDHVKAGDVLAK
                     VYHSKRSDLNSALSLVQSAYVIFEHPVESPPTVLEVIG"
     gene            complement(388785..390038)
                     /locus_tag="AJ81_02100"
     CDS             complement(388785..390038)
                     /locus_tag="AJ81_02100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002941266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="AJC73195.1"
                     /translation="MIVLLIVAAVAAIGFFLYSLSLLKINKNLLRFFRRVAELADVVE
                     DSPPSYVLERLRKKLRTIEEELSIAQRSRENILTLLDNISDPIIFVEADGTITFANLA
                     AQKITRSEPIARKIYEAIEDYYVIEMFEETVRTWQAQESKIVLYVSDEKRYYSCNMIP
                     VILPRGERRVVIMMRDVTKEHELNELRKQFVSNVSHELRTPLTSIHGYAETLLSDPEM
                     DAETRKRFLTIIENESARMSRMINDLLDLERLESGEARFEFKETDLCVVVNYVLSIVE
                     PLANEHGVQVEIQCEPVSIWADQDRMVQMILNLVDNAIKYTSLKEIGDKRVKVRVTRE
                     GKHAIVAVSDTGPGIPKEALPRLFDRFYRVDKGRSRKMGGSGLGLSIVKSIVERHGGE
                     ISVNSEVGVGTTFIVKLPIEREVEA"
     gene            complement(390042..390761)
                     /locus_tag="AJ81_02105"
     CDS             complement(390042..390761)
                     /locus_tag="AJ81_02105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoP family transcriptional regulator"
                     /protein_id="AJC73196.1"
                     /translation="MAKKKILVVDDDPSIIELVSYNLAREGYDVLKAYDGEEALKVAT
                     NESVDMFIVDIMLPQMDGFELVRQLRAMEKYKNTPVIFLSAKGEEFDKVLGLELGADD
                     YITKPFSVREMIARVKAIFRRIQLSAQEREERPKKIVAKGLEIDVERYEVRVNGQKVA
                     LTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSN
                     PKYIITVRGKGYKFRDPGKEE"
     gene            complement(390861..391826)
                     /locus_tag="AJ81_02110"
     CDS             complement(390861..391826)
                     /locus_tag="AJ81_02110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73197.1"
                     /translation="MKRFMTLVWLLSFAVVFAWSAHETLTYLVVKSCLPNADDLVEIT
                     PYSYEEKRIYNTERLILDDVCGRFMVNFIPSWARFYPPDPAPIDGKVPVWQVLTVYSV
                     EPDLGMDEGLNLSPLQSIIGNSQGVRHMKYKLLFFDFFEGSESFLYFVEMSKQAFGRN
                     DRYWGYRFLARAIHHLEDLSMPYHNAPGRLGEVLESLLWNREKGMELAYRHFSYDDYL
                     AYLLYLEDEEVISSIVESQPKRARNMRELIQRVRLLGLRNLEAVDRIFSSVYSGLDRT
                     LSWNDFEASSEQLKELKSITKLIMKEFSGYLKGFLLDFLTQVGEI"
     gene            392039..393274
                     /gene="rocD"
                     /locus_tag="AJ81_02115"
     CDS             392039..393274
                     /gene="rocD"
                     /locus_tag="AJ81_02115"
                     /EC_number="2.6.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006527907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine-oxoacid aminotransferase"
                     /protein_id="AJC73198.1"
                     /translation="MRSQDYMDLEYNYGAHNYKPIPVVIDRAERVWVWDVEGKRYLDM
                     LSSYSALNHGHRHPKIIEALERQLQKVTLTSRAFYNSVLGLFEEKLAKFAGYEKVLPM
                     NTGAEAVESALKIARKWAYYKRNIPMNEGNIIALEGNFHGRTITIISFSTEHQYKDGF
                     GPYTPGFKIAPFGDARALENLIDDRTLAILVEPIQGEGGVRVPPQGYLAELRRIATKH
                     RILLMFDEIQTGLGRTGKMFAWQWEDAKPDVLILGKALGGGIYPVSAVLANNDVMDVL
                     TPGDHGSTFGGNPLAAAVGMAAIDVLVEEKLDERARTLGEYFMNQLKHIKSDYVKEIR
                     GKGLLIGIEIKKEFGTARPFCEKLAQMGILCKETHEQVIRFAPPLVIEKEEIDWALER
                     IERVLTEPVHVQAKIARSI"
     gene            393383..394090
                     /locus_tag="AJ81_02120"
     CDS             393383..394090
                     /locus_tag="AJ81_02120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005841926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="AJC73199.1"
                     /translation="MKPVIVLLSASERKYGSSSQLLHIAAEGVRDAQGEFEIVHLSDH
                     TIKSCIGCASDEEKFCKYPCLIQDDDFNMIASKLIQAQGFVIATPVYWYAPNGTLKHF
                     IDRLTSLENMIDHAGKSLLEGKVAGFIAAGLDSGVMMAISYLIVALNSMGVHIVPWSM
                     AYTHSQDPTEDLQAIMDAYNVGILVTKTARIFMNSEPVGYEPNVDVGRLKRKAEQIKR
                     EFEVQRKLRINSFEFSQ"
     gene            394103..395989
                     /locus_tag="AJ81_02125"
     CDS             394103..395989
                     /locus_tag="AJ81_02125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_623153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="AJC73200.1"
                     /translation="MWSVSSFAKLVVPTEVRMSPDGTWVAYTIKRIDPEKNRAIRQLI
                     LYNLKTRERFFLSEDTSKPRFSPTSKKLAYLKKEDDKSSLCIMELSNFSSYTLLTTPN
                     VSFFGWSHDERNLFVVTQKKRNDPDLYFETRIPVWFDAKGFLDDQRDVFHIFDVESRQ
                     ELTQFEEKNVAYAFWSKEGIVYTVFREEAPFTRFDIFLHSNGSKRTVLEDVGFIATSE
                     SQWGFILLGREKKNAFQHDYVYLLKNGQILPLTERYGLDNSGHISLEVWASDSEGYPI
                     AVGEWVYFKSGERGIVKLERMNLRSFAKETLFSEGAVSCFDASEDGKVAYVAVDDERG
                     AEVCILHDGKNERITSLNEQFLATVTVKRLNHFEYASFDGTKIDAWYLKPDSSPAPLI
                     VFVHGGPKGAYGRCLYFMGQLLAQEGFYVLYTNPRGSDNYDEGFALAVKERTGLEDFK
                     DILSGVEELKRREAVTDIGITGISYGGFMTNWAITQTDMFRAAVSENGISYWFTSYAF
                     SDIGFWFDKSLIGDDPLTNENYRKLSPLFHAKNVKTPLLLIHSLEDYRCPLDQSLMFY
                     HVLKDLGKEVYIAIFKKGAHGHSVQASYSHRLKRYKLIVEFFKQKLLLKSEIFDPEKC
                     FKLD"
     gene            complement(395976..396902)
                     /locus_tag="AJ81_02130"
     CDS             complement(395976..396902)
                     /locus_tag="AJ81_02130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="AJC73201.1"
                     /translation="MDRYNKLSEHLKRRYGARVHRLVIDAGFTCPNRQKNGPCIFCDP
                     TGSGFNTLRGLSIREQVLRQKEWASKKYGASKFIAYFQAFTNTYAPVDTLRERYSQAL
                     VDDSIVQLAISTRPDCVPEEVLNLLDEFKTRVDVSLELGLQTINSKTLRILNRGHGVA
                     EFVDAVLRAKEHGFEIVVHVIVDLPWDELEDVVDTAKTLSYLNVDGVKIHSLYVVEDS
                     PLGAMLREGKFQPVSLESFLERIVAFLEHLSPRIVIHRLVSDPPRVGTLFARWGLSKS
                     QLVNIVETELERRNTFQGAKFKPARGGQVNPA"
     gene            complement(396881..398122)
                     /locus_tag="AJ81_02135"
     CDS             complement(396881..398122)
                     /locus_tag="AJ81_02135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylhomocysteine deaminase"
                     /protein_id="AJC73202.1"
                     /translation="MRALLKNALLMCDVRSEPKVSDLLVEDGKIAGIGNFTEGATDEV
                     HDMSGKLIMPGFVNAHTHAAMTLMRGSAEDMRLQEWLLTKIFPIEEKLTPEDVYYGTM
                     VAQLEMARKGVVAYVDMYFHCDAVAQAVLDFGMKALITRGLTDHDGDNGRLKQNIEYF
                     ERWNGKEGLISIGFGPHAPYSCSLSYIDRIARVALELDAPITMHLFESSKENYSLKEI
                     MKTKLRECKVIFAHCVHIPEKDIELLSSENFFVAHNPTSNLKLGNGVAPLQKMIEKNV
                     QVCLGTDGAASNNTLDVWYEMRLASLLQKASDPRNISIQQALIMAIEQGAKAVGLTPG
                     RIEVGADADLIVIDLNKPWYVPLDRIKNHIVHSGNSLDVFATMIKGRWVYYDGEYPTI
                     DAKYVFEKCEEAIGRLIGTTS"
     gene            complement(398119..399552)
                     /locus_tag="AJ81_02140"
     CDS             complement(398119..399552)
                     /locus_tag="AJ81_02140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="AJC73203.1"
                     /translation="MILFGTGGVRGIMRDGEFDEKLIVDVSRAVALWMYEEKLDGVVI
                     AYDTRRNSNRFAKLAAQTFADCGIETYLFDAPTPTPLLSFAVRELRVGAGVVITASHN
                     PPQYNGYKVYTSDGVQAVPSHTEKISSLMGKSFRVNKTARVQPVPKQVEERYIERLVR
                     LVGKHVEGSTKIVYSPLQGTGARFVPKVLRELGCDVICVEQQMEFDPNFSKVASLNPE
                     DERAFDMVRRVCQEEKARFGIATDPDCDRVGLIVDGKRLSGNQVGVLLTEMLRHGANP
                     ESNLIKTIVTTDMVKPMCEELNLHVLETPTGFKYIGHLIETKSKEPSFSYFLAFEESC
                     GYLIGDLVRDKDGVLGSALIAGLCSKYDPIELLNSLYERYGYHIEELISMSFESPEQA
                     KQKYEVLKLNPPTRIADQEIVRIFDYENDPQMPNETLLFETGSVKIYVRPSGTEPKLK
                     IYVKVVGYDEHEARSILGSVRKAVTEL"
     gene            complement(399549..401096)
                     /locus_tag="AJ81_02145"
     CDS             complement(399549..401096)
                     /locus_tag="AJ81_02145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="AJC73204.1"
                     /translation="MILRFAGKNLLYFDSFDLEFSEGLNVITGETGAGKSILLKGLQA
                     LLGKRVELFDNDETWLEALVLIDAVDEELKELGIQRGEHIVSLSAGKRWIYRIDGRMY
                     PQSVVERMFENDVHFHQQNTHVNLLRKRYQLSLLDRFCDNPQLFSDYAEAYGRMIELR
                     KIVEELNVENLDQRIEELNRELALFEKYKPSEDEEKTLKERFERINKAKQIVALVEEI
                     LNALDEDLTTRVWRLSFSAEKMASLVPKGLPGLLRDIAEKSDEVRKLVTRFINEMQLE
                     DSREVEARLSVYNELKRRFGPDWEDIKKNWAKLEREKSELLSNKRQLELADRELRSIE
                     KRCWDLAEKLHDNRLKAAGEFEGFVRQHLQELAMSLKFSVKIGRLNQLTPSGISDVEF
                     VVEAGGEEKPLRDVLSGGELSRMVLAVHLSVANQAGNVFIFDEIDSGIGGMTGNVLGE
                     KLKSLSRTSQVIVVTHLPQIARYADTHFVVLKEDRSMRVKSLTPEERRYELLRMIGGE
                     DLWGDVM"
     gene            complement(401112..403001)
                     /locus_tag="AJ81_02150"
     CDS             complement(401112..403001)
                     /locus_tag="AJ81_02150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_229043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="AJC73205.1"
                     /translation="MKIDYLQELDEEQRKAVLESEGRSLVIAGPGSGKTRVITYKLLH
                     LLMNGVKPSQILLVTFTRAAANEMIERAKQVTGMDLEELTAGTFHHVCNLLLRRYANR
                     VGISPNFTILDEEDSLSLIKHVRTRVLDRIFQDEKEKHFPAPSILQKVFSYSVNTMSS
                     LRQALLTLYPKHAEFEKIIEEIYKEYTIEKRTQNCVDYDDLLSLTVFLLENDPQVRYR
                     EASKYRWLLVDEFQDTNILQLKMVDQLSSVHKNAFVVADDAQSIYSFRGARFENVKDF
                     ARSDAKIFKIQTNYRSTQRIVEFINAMIPRTSVPKLLRSVKPDGPKPKVVSTWDRASE
                     ASFVARQILKLIEFGYEPNQIGILYRSHSHSFDVQLELTRNQIAFRILSGLRFTETAH
                     VKDVLAFLRLLQNPKEKVSWIRVARLFPGIGAKTASAFADHASSVETMDFQEMFESFP
                     LKKPSLSRLREIFSELMKEEAVSKKIERLYESFYKEYLEENYSDYTERQLDIQRLIEM
                     AERYRSLERFLSDLMISEDVNQERGTNKVTLTTVHQAKGLEWDVVFVLSVNPGDFPSY
                     YAVIDGKLDEEERIFYVAITRAKELLYIMRQESVQRNYFSWMKLPDFIDGIPRELVEW
                     IDATD"
     gene            complement(403017..406319)
                     /locus_tag="AJ81_02155"
     CDS             complement(403017..406319)
                     /locus_tag="AJ81_02155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjgP/YjgQ family permease"
                     /protein_id="AJC73206.1"
                     /translation="MAILTKYLFKLSLGPVLIGLGGFIIFVSVEILYQLSDLIVRHRV
                     SFFVLLRILYYYLPYFTALGVPVGILLAVFWVLSKLSNDRELMAMQVHGISMKVLIVP
                     FLLIGAILSLAAYVLNDRIVPVFNQKADQVLSKYVYRKPEVFISENVLTKVDENQYFY
                     VKKYDRQNGVLENVVLFRNEPSEEEIITARRVTKEGNKWFMYDGRMYRVDKEGFLRFD
                     VSFSKVELDLKQDIESILRTGKTPRDMKSEELRERISTLRKLGIDPAPWVVELHSRYS
                     VALGPIIIALVGVPLSLMFNLRSKSWGVILTFVLIVLYQGSGAWISAMGKENLINPVL
                     AAWLPDLSFGVVGTVLFILLDTHVSYRLRELLTRFLAVLFVILLASHAQAATMQLKGG
                     NVVFEEGKLILSQGVEASYEDVFIQCSTLTAFLNDANEVEKILAEGNVSYNRKDTQIR
                     AQQLYYVFSEKLALIVEARGKTIFSDEEKVKHTIYFTAKSSQMKEGIGELRRSYLTTC
                     DLERPHYRLQATNVEIKENDYLAAYNVVLFVFDVPTVYFPVYFVSLREGPQPFSVKMG
                     YSKGEGFNIESVYNLTYPNGYVSARVGFREKGDKAGNYSQLTVNYKASEWELTSNLYN
                     LEGPNGKDYEINATLSVPSLYSKLTTYFSDERFSLQHTLNPAKDFVIQSSITKTQTVT
                     RWTLPSVSIKKFTVLKDPFSLIINSFSHVSSSEYTEGNLFDHLDEFYTFGRYSASMQF
                     KPAHVFKQIGVLLSGAYELSGTNITSNYSRNYFQIDSSLPFKTALLRGGWFDLSFDSS
                     LRVGVWLAQGMDPEYLFSQTSRTAFTIKPVDFFSASIGYQNRASLNNVFRSSLSDFSD
                     LSKATFSTNLKVPTSSVELSTSYDLIGYKWDDLLIKTSSTFDVFSLRWSIYTETVYQI
                     ENERFYKTDWDITMGLGSFSHETKFTYRYDRTIPVDVVENKLNIRGKSFLFMERPNLS
                     VRYNLSVQPFDLLTIQARGSFYTGPAKHAFSVTYTRSSYRLRASYELSNFDPSVKISF
                     SGRLEPFQINSLDLTMTKDLHCWGLVFETSFSTVGGFSLEKLSFKFFIKEFPKKSFSF
                     DPITGSIGADVF"
     gene            complement(406303..407010)
                     /locus_tag="AJ81_02160"
     CDS             complement(406303..407010)
                     /locus_tag="AJ81_02160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoU family transcriptional regulator"
                     /protein_id="AJC73207.1"
                     /translation="MKWLLDQKIERFKKALMKMGWFAEKMMIRVIESMESRQIVAAKQ
                     VVEDDDMLDAMEVELREEATVLLGTYTPTGFNLRFIVSSLEVANILEKIGDKTRRMAQ
                     LLISFYTEQSASIDPNIVRMAKNVATLFRETLGVVADMQSERAFEVCTRDEEIDELFE
                     EMRSELTNLLKEKPEQSERILCLLEIAQELEEVADLCTNVVESVLYAVSGSNYKCFRD
                     QMKLFKKGEGVLFGDSD"
     gene            complement(407007..407786)
                     /locus_tag="AJ81_02165"
     CDS             complement(407007..407786)
                     /locus_tag="AJ81_02165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic polyphosphate kinase"
                     /protein_id="AJC73208.1"
                     /translation="MSTCIVLYKSGKDKEAQELYERVKNQLNVLKVEELSCRRIETDC
                     DFAIVVGGDGTVLRAVKCVSVPIVGFKAGRIGFLTPYKIEEAEQFLTDLQDGSLVLEK
                     RWMLRIVMGEREFDAVNDAIVRAKTKPMSEFKVSIDSCSDLDFFADGVLVSTPTGSTA
                     YNLSLGGAIVIPSCEVVQIMPVAPYYLQNRSIVLPADRNIHIVSQLESELVVDGVCVG
                     TTKEIFVSRSSRSFSLLRPKRYDFFSVLKNKVGYGKGVNES"
     gene            complement(407783..408079)
                     /locus_tag="AJ81_02170"
     CDS             complement(407783..408079)
                     /locus_tag="AJ81_02170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73209.1"
                     /translation="MFVISNLLYAIAVVLQLFIYVEIFAVILSALLSWITPFRYSSFR
                     QFVDAVANIVLRPLRKFIPPIGPVDITPMIAIFVLVFLENFVVRTLFDLAVRLR"
     gene            complement(408082..408753)
                     /locus_tag="AJ81_02175"
     CDS             complement(408082..408753)
                     /locus_tag="AJ81_02175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005470653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="AJC73210.1"
                     /translation="MAMLQNILKIKERITQAAVRAHRDPNSVRLIAVVKEASLEQVKA
                     LVDLGLSDLAENYAQQLVKKFEIAPNATWHFIGRIQTNKVKYIVPRCEYIHSVCREEE
                     IVEIDRIASKLKKVQKILIEVNVSGEESKAGVEPEEISRLLNFAKNFSSIEVVGLMTM
                     APLVEDAEQVRWVFRKLRQMRDEIAKEWPSVVHLSMGMTNDFEVAIEEGATMVRIGRA
                     ILKGG"
     gene            complement(408683..409732)
                     /locus_tag="AJ81_02180"
     CDS             complement(408683..409732)
                     /locus_tag="AJ81_02180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="AJC73211.1"
                     /translation="MKEVESILNFRPNNLDEYVGQEEVKRRLRIALEAAKLRAEPLDH
                     ILLAGPPGLGKTTLAHVIAKELRKNIYVTSGPVIERGGDIAAMLSSLEEGDVLFIDEI
                     HRMNKTAEEVLYSALEDFQVDVMIGKGPTARSVRIRLKPFTLIGATTRSGLLSSPLRN
                     RFGMIFELDFYTVKELTLIIKRACEIMNMFIEQKAAELIAQRSRGTPRIALRLLKRVR
                     DVATVRGEETITQSIVLKTMDILEIDALGLDEMDRKILRTIIEIYEGGPVGLEALAAT
                     LNVEVDTLKEVYEPYLLRTGLLVRTSRGRVASDLAYRHLGYESRVRGGLFDGYVAEHS
                     EDQREDNSGGSQGSS"
     gene            complement(409732..411030)
                     /gene="asnC"
                     /locus_tag="AJ81_02185"
     CDS             complement(409732..411030)
                     /gene="asnC"
                     /locus_tag="AJ81_02185"
                     /EC_number="6.1.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659735.1"
                     /note="catalyzes a two-step reaction, first charging an
                     asparagine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginyl-tRNA synthase"
                     /protein_id="AJC73212.1"
                     /translation="MKWVYVEDLKNHINEEVELRGWVWNLRSSGKIHFLQFRDGTGFV
                     QVVVERSTVPEDVFEVAGKLRIESSVIVRGLVKEDKRSPYGVEVLATDIAAVQIPKEP
                     YPISKKDHGIDFLMSCRHLWLRSRRQFHILRVRDAIIWAIRKFYKDRNFVLIDTPIFT
                     GSIGETAGNLFELDYFDYGKVYLTQTGQLYLEAACLAFGKVYNLGPTFRAEKSKTRRH
                     LIEFWMHEAEVAYYEHEDNLRLQEELVSHIVKYVLENASDHLLALGRDISKLEKVTVP
                     FERISYDEAIKFLQSKGVDIQWGDDFGGDEETLIASQFEKPVFVTHYPRKAKAFYMQP
                     DPSRPEVVLCADLLAPEGYGEIIGGSQRIHDYDLLVERLKEFNLPIDKYQWYLDLRKW
                     GSVPHSGFGLGIERTVAWICGLEHIREAIPFARTLYRVYP"
     gene            411628..411703
                     /locus_tag="AJ81_02190"
     tRNA            411628..411703
                     /locus_tag="AJ81_02190"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:411661..411663,aa:Cys,seq:gca)
     gene            411755..413152
                     /locus_tag="AJ81_02195"
     CDS             411755..413152
                     /locus_tag="AJ81_02195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-splicing ligase RtcB"
                     /protein_id="AJC73213.1"
                     /translation="MDIKRIDKYIFSIKGKNVDAIVFTDQETINDPEFKEALQQIVNV
                     THMPGIVAALAMPDIHWGYGFPIGGVGVFDAKDGVISPGGIGFDINCGVRLMLTSLTF
                     EEIKPQLRRLVEAIYDAVPVGVGASGAVKVSAKTLRKVCIEGAHWAVENGYGFKEDLE
                     RIEDTGKLSPANPDHVSSKAFERGLDELSTLGAGNHFIEIQKVERIFDPKVAEAFGIF
                     EGQVAISVHCGSRGFGHQIATDYIQIMRDKLAHHNKDLPDKQLINAPFEHPIGQQYFS
                     AMNCAANYAFANRQMIGHAVRMALLKIFPTAQVWLLYDVAHNIAKVEVYNNRKLIVHR
                     KGATRSLGPKNPLLPSLYSDVGQPVLIPGSMGSASYVLVGTKKAEEMSYGSTAHGAGR
                     TLGRRAALRSLSYEQVLNELKQKGIEVMSKGKKTLVEEAPETYKDVDRVVEIVDQVGL
                     SRKVARLVPLGVVKG"
     gene            413149..414513
                     /locus_tag="AJ81_02200"
     CDS             413149..414513
                     /locus_tag="AJ81_02200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002533644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="AJC73214.1"
                     /translation="MKFYLNLEGVASTLYILLTQGAIFTGLAIAFNLDEFLIGVTASF
                     PMVAQIFQILSPLVVEKFPKRRTLVNIFNLLSRLPWALLLVFLAFERRSPMFFVLIFA
                     VSQIFGTLAGNAWTSLVRDLIPESERGTFFGRRNVYVSLTSLVFFYVYSLLIDQLKDP
                     LGYQLAIAIGMFGTFLSFWAMLKVPEVPLKSSSASAEVKFVFQDRNFMKLCSFYFVWN
                     VVIAFTSPFFTYHLLKNLQVPFSYIGFTGVLSSIVAIIFYFIWGRLSDNIGHKSVAMV
                     GVLIVSFLPPMWFFMNTFTYRYLMIADAVITAIGWSAINLSFLTLPMEVAQSSSSAYF
                     ATYAALGGIGGLIGALSGGTIAKLLANVHLGTSNLPIYGIQLMFLASGLLRAFTLRLL
                     GRVGTRRYVPLRTLIASALFLSREGGLTRSNGSNVYEVLRIVKKKLEEKEDETIPWRV
                     KRWW"
     gene            414489..414938
                     /locus_tag="AJ81_02205"
     CDS             414489..414938
                     /locus_tag="AJ81_02205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma E positive regulator RseC/MucC"
                     /protein_id="AJC73215.1"
                     /translation="MARETMVVKTILNDDVVLERDRTSMCGKCPANMLCTGEAQKVRL
                     VVERNGLDLAEGDVVLVETPAVSATRTAFLVYTAPTILFIFAVVLTVKKLGELTAFFF
                     GISLVAAYFFLLRLYDKRFRKKFRPRIVGIVKRARPEDPSDGASLLI"
     gene            complement(414886..415335)
                     /locus_tag="AJ81_02210"
     CDS             complement(414886..415335)
                     /locus_tag="AJ81_02210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rubrerythrin"
                     /protein_id="AJC73216.1"
                     /translation="MVNLSELLSIALNIEAEGYAFYTNLASAQTDEQSKQLFQNLAQQ
                     EREHQEIFKKLINEFSQPDSSKDNWVSEEVAGYLKSYANMSIFPTMTKMKQMSSTEAL
                     KLAVEVEKDSIIFYSELLPYAGNERETIKKVISEEKRHLMDLLALLS"
     gene            complement(415352..416511)
                     /locus_tag="AJ81_02215"
                     /note="2-oxoglutarate ferredoxin oxidoreductase subunit
                     alpha; disrupted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(416504..416731)
                     /locus_tag="AJ81_02220"
     CDS             complement(416504..416731)
                     /locus_tag="AJ81_02220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="AJC73217.1"
                     /translation="MKKQYDIHINYEWCKRCGICYSFCPTGALAKGELLKPIVTDRNK
                     CIGCLMCENLCPDFAIAIKQLEVVQGSVDNA"
     gene            complement(416745..417863)
                     /locus_tag="AJ81_02225"
     CDS             complement(416745..417863)
                     /locus_tag="AJ81_02225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004659597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaconyl-CoA decarboxylase subunit beta"
                     /protein_id="AJC73218.1"
                     /translation="MLQGILEMLKQTAFAHFTFGNLLMFGVAAALLYVAVKKDAEPLL
                     LVPISFGIILGNVPPQLTGILNEGGLLWYLNYGVIKGIYPPLIFLGIGALTDFSFMLS
                     YPITIFLGGAAQIGIFTAFMLARTLGFTLKQAGTIGVIGGADGPTTIYVASRFAPEIL
                     SAVAIAAYSYIALIPILQPPVSKLLTTKKERMIRMGPPRKVSKFERIVFPIVVTIVSA
                     ALVPQSLSLVGMLMLGNLLREVGNVKRLVEAASRFILDTVTIILMVCVGASARADIFL
                     KPESLKIFSLGAFAFVCSLTGGILFAKFMNLFLKEKINPLIGAAGVSAVPDSARVAQK
                     LASEVDPTNFILMHAMSPNVAGVIGSAVAAGVFLTLLK"
     gene            complement(417889..419526)
                     /locus_tag="AJ81_02230"
     CDS             complement(417889..419526)
                     /locus_tag="AJ81_02230"
                     /EC_number="4.2.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002247355.1"
                     /note="catalyzes the formation of
                     4-imidazolone-5-propanoate from urocanate during histidine
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urocanate hydratase"
                     /protein_id="AJC73219.1"
                     /translation="MRAPRGNTLTCKSWQTEAAMRMLMNNLDPEVARDPANLIVYGGT
                     GKAARNWECFYKIVETLKKLENDETLLVQSGKPVAVFKTHEWAPRVLIANSLLVPKWA
                     TWEYFRELEERGLIMFGQMTAGSWIYIGTQGILQGTYETFYAVAQKYFNGTLRGKFVL
                     TAGLGEMGGAQPLAVTMNDGVMLAVEVDKRMIDRRLKTGYLDTWTDDLNEALRLVKEA
                     QKEGKPLSVALLGNAAEVHPKLVKMGIIPDVVTDQTAAHDPLNGYVPKGLSVEEAAEL
                     RKKDPQDYLERVYESVVEHVNAILEMKKQGAKVFEYGNNIRRLAYDHGVKDAFQIPGY
                     VPEYIRELFAQGKGPFRWVALSGDPEDIYATDKKVLELFPEDEHLRKWIEMAHEKVKW
                     QGLPARICWLGQGERTLMGLAMNEMVKRGELKAPIVIGRDHHDTGSVASPYRETEAMK
                     DGSDAIADWPILNALLNTASGATWVSVHHGGGVGIGYSIHAGMVIVADGTDLARQKLE
                     RVLTNDSGIGVIRHLDAGYEIALETAKKKGLRYPMMG"
     gene            419625..420467
                     /locus_tag="AJ81_02235"
     CDS             419625..420467
                     /locus_tag="AJ81_02235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001410041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="AJC73220.1"
                     /translation="MLLIKHEELVGKISQKIIEANNIMREEIFQQVLSYEGPFCDVLR
                     RNAEVARTKDLPLCQDTGFVEFFIFIPFNAIFERPIQESCDEAVKKVYSSKPYRHSIV
                     TDPLYERKNTRTNTPSICHIFHWDEEKVQIRLLIKGGGSENLTTLFMLSPTAGEEELM
                     GKIIEHVARHGSKGCPPLRVGVGVGGSADKAMLLSRLALTYSLSDVNPDPRYESLERR
                     ISEKLNQLRIGFQGLGVGPTIFSVHVLQAPTHIANLPVAVSFDCYLSRIGVVEVEPVR
                     IESR"
     gene            420439..420957
                     /locus_tag="AJ81_02240"
     CDS             420439..420957
                     /locus_tag="AJ81_02240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002941774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="AJC73221.1"
                     /translation="MNLLELKAGERINYTGAMIVMRDAAQKRIEMLLRKGSNVPIDLK
                     GKIVFYAGPTRIVDGRFSIGPTTSERMDRYVKMLFELGVLATVGKGQRSEIARKLCRE
                     YRRIYFVAPSGAAAALSEHVENIELLAFEDLGTEAVYEIQVKDFPLIVAIDSEGSDIF
                     ELIKSTNGGDRT"
     gene            420954..422447
                     /locus_tag="AJ81_02245"
     CDS             420954..422447
                     /locus_tag="AJ81_02245"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74647.1"
                     /translation="MRLVIITVAAVGVVSVLWGFPSSQFVVAGCFVALAVVSMIHRIR
                     HTENVTQDTNNERVFEEIFTSADTLKQDAHELGDISKQAQTMSADLSVQSKKISQLIQ
                     SLTAALEETSSSASEIARTAKVVGEDTQRMRQDFSSFELEVKQIHDALLELSKENIET
                     FEKLNELLSSMENLREKTGAIVQAVQLIRNISEQTNLLALNAAIEAARAGEHGRGFAV
                     VAEEVRKLAEQSKQFAGSIIENVQAVEQAVTDSVKKNEEVARTMKETAQTSQTFAEKL
                     GKFKEQAGSFARTLEEIVHSIESQVTSTREIELAVNSNTNAASQLMEFSMEMEKNATS
                     LEKVASQLAEKAQILTLRSLKLRSLAGARSWIMQRVKELSELFAKPECQKLDWNAFEP
                     IAKRFLAEKQGIYEAAFIADSEGNFITTTGTKGSIKDRNYFHRLRNSDLEWTMSDPIR
                     SRATGNMVITIAFAIRENGRFKGIAGVNLNVAKLEEQVEFSTAQAQK"
     gene            complement(422432..423391)
                     /locus_tag="AJ81_02250"
     CDS             complement(422432..423391)
                     /locus_tag="AJ81_02250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="AJC73222.1"
                     /translation="MAVLLKVEGLKKYFEIRKSMFSRPIYVKAVNDVSFEIQKGSIFA
                     VVGESGSGKSTLGRTVIKLIEPTSGKILYDGRDITQIEKKDFLEFRRRMQIVQQDPYN
                     SLHPRKLVKDIVGEGLKIHFKMRSDEIYVRIKEILELVGMREEHMFRYPHEFSGGQRQ
                     RIAIARALVLRPEFLVLDEPTSALDVSVQARVLALLKELREKFGLTYMFITHNLAVVD
                     HMATHVVVMYLGKIMEMGSKQDIFERASHPYTKALLDSIPSFGTGRRIRSIPRGEIPN
                     PANPPSGCVFHTRCTQAVEMCKVEEPKLVEVSPGHFCRCHFCA"
     gene            complement(423369..424361)
                     /gene="dppD"
                     /locus_tag="AJ81_02255"
     CDS             complement(423369..424361)
                     /gene="dppD"
                     /locus_tag="AJ81_02255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660134.1"
                     /note="DppD and DppF are the ATP-binding components of the
                     ABC dipeptide transport system DppABCDF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="AJC73223.1"
                     /translation="MRGSLLNVENLRVVFYTYRGVIKALNGVRLWLNEEERLAVVGET
                     GCGKSVTALSIMRLIEPPGEITSGKVEFLGEDLLSLPEEEMEKVRGKSISMIFQEPVA
                     ALNPVFKVGFQIAEAIAHSQNIPIKDAYQLVPEALTMVGLDWKRTMNLYAHELSGGMA
                     QRVMIAMALAVKPKLLIADEPTSALDVTIQAQILELLDNLVRVGKNAVIFITHDLAVA
                     SEFCDRVAVMYAGNVVEVAKSDEIFARPLHPYTVGLIDSIPLVGQRKELKGIAGVVPD
                     LVDPPSGCRFHPRCQKAFERCKVELPDLIEVSENHFVACHLYAAGDQNGSVAES"
     gene            complement(424368..425267)
                     /locus_tag="AJ81_02260"
     CDS             complement(424368..425267)
                     /locus_tag="AJ81_02260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C550"
                     /protein_id="AJC73224.1"
                     /translation="MVSLENMQVEKTEISRWKPIIEDWKHSLYLWRRTKLAMVGTFIV
                     IGFLIMALLAPVLAPYDPVKVDLVNRLKPPSRQFLFGTDQFGRDILSRVLYGARIEVW
                     IILLVTVISGTIGTAIGIVAGYFGGWIDEVLMRITDIFLAFPRLILAMALSAVLGRGL
                     TNAIIAISLVEWTVIARLARAEAMRVKSQPFVEAAKAVGASDLRILLFHVLPMCVSPI
                     LVQLTMRMGTIILTAAGLGFLGLGAQPPTPEWGAIVSDGRSYLINHWWIATFPGLFIA
                     LVVLGFNLLGDGIRDILDPRLRR"
     gene            complement(425271..426281)
                     /locus_tag="AJ81_02265"
     CDS             complement(425271..426281)
                     /locus_tag="AJ81_02265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="AJC73225.1"
                     /translation="MKLASFIIKRLFLMLLVLFGVSVLVFVISKVIPADPVGAILGGN
                     APVELVEDLRRRLGLDKPLINQFYDYMSGLLRGDLGTSLKTNRPVVKDIAEFFPATLE
                     LAISATLLSIVLGILLGILSAVYRNKFIDHFSRVFSILGVSMPVFWTGLLLLLLFYFR
                     LGWLPGGGRLSLFVTPPTKYTGLLVLDSLLSGNMEAFKDALAHLVLPTIVLGYSATAS
                     IARITRASMLDVLRQDFIRTAKAKGIGKRLVIYRHALRNALIPVVTIVGLTFGGLLEG
                     AVLTETIFSWPGLGRYIVNALLVLDYPAIMGGTLFVAIIYSLVNLVVDIVYAVLDPRM
                     RI"
     gene            complement(426347..427921)
                     /locus_tag="AJ81_02270"
     CDS             complement(426347..427921)
                     /locus_tag="AJ81_02270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_006443944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="AJC73226.1"
                     /translation="MKRFLVLALVALTLFVAYAKTPKDTLVIAANTEIFITLDPAVCY
                     ETFAAAVVTAAYSGLTKIEPVNGVLTPVPELAERWEVSPDGTVWKFYLRKGLKFSNGD
                     PLTAEDVVFSFRRVLKIRKSPAWLFEELGLTAENMEETIYAEDDHTVVLKTKPLAANI
                     VLSIIAPPWGGIVNKKLVLANEVNGDLGEAYLTDKSIGAGAGPYVVTEWKRREMITME
                     ANPNYWRGQPPLKKIIIRDVPEETTQFLLVQRGDVDVAWNITTEQAAQLRDSKPSNIR
                     LVTTPEQSNEYIAMNVGWGPFKDERVRLAIKYAIDYDAIINSVMRGFAVLNQNFMPIG
                     YFGYIELNPFKRDVEKAKQLLAEAGYPNGFEVELITSTTEIRRNEAVIVQANLAEIGI
                     KANISLMPSGEMYKKYRQQGHQMIIAGWGIDYPDPDALAKPFANYRVKQLAWRNMWYD
                     DYAADLAEKAGIEQDPEKRAQLYKELQEYWIYKSPFVMLYQPVGFWAVSNDVVGFEEA
                     CEGYTLVFDFTKIRKK"
     gene            complement(428123..429697)
                     /locus_tag="AJ81_02275"
     CDS             complement(428123..429697)
                     /locus_tag="AJ81_02275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="AJC73227.1"
                     /translation="MKKYLLLTLVLFVLVVGYAKTPKDTLVIAGNTGIFTTLDPAACY
                     EGFAIQIVRAAYAGLTKLQVVDGVITPVPDLAERWEVSPDGTIWTFYLRDGLMFSNGD
                     PLTAEDVVFSFKRVLTIRKSPAWLFEMLGLTAENMNETIVAVDGRTVVLKTKPMAPNI
                     LLSVIAPPWGGIVNKKVVLANEIDGDLGESYLQDKSVDAGAGPYVILGWKRNEVVTMT
                     ANPRYWAGSVRIKNIVIRDVPEESTQFLLVQKGDVDVAWNITTEQAAQLRDNPLPNVR
                     LVTTLSQTSEYLGMNAGWGPLADERVRLAIKYAIDYDAIINNVMRGFAVLNQNFVPIG
                     YFGYVEMNPYKRDLEKAKQLLAEAGYLDGFEVELLIAPYDFRKNEAVVIQSNLADINI
                     KVNITIMPASEMYAKYRRQGHQLVLAGWPPDYPDVDNLAKAFANYRVKQLAWRNMWYD
                     DYAADLAEKAGIEQDPEKRAQLYKELQEYWIYKSPFVMLYQTINFWAVSKDVLHFEEA
                     CQGYPMIFDFIKIEKQ"
     gene            complement(430110..430235)
                     /locus_tag="AJ81_02280"
     CDS             complement(430110..430235)
                     /locus_tag="AJ81_02280"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74648.1"
                     /translation="MVEFFNHGNFPFGMWGCVFSFEEATAVDSVTKPQKMDILIH"
     gene            430553..431158
                     /locus_tag="AJ81_02285"
     CDS             430553..431158
                     /locus_tag="AJ81_02285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="AJC73228.1"
                     /translation="MKIFLVRHARTDWNDLGLWQGNCDVPLNRAGFEEARKIAERFSK
                     QNVQIVYSSPLSRAHQTAKVISEMLKVPVVLDERLKECEISLWNGLTMQETLQRFERE
                     YLIWSTDPAAQIDGVESLQNVQNRIVQFFNELLQKSFESVVVVSHALSLRTLICWVLR
                     LSLTEHRNFKLDNGSVSLIEFQDRIRLVYLNDTCHLDQNNL"
     gene            complement(431143..431832)
                     /locus_tag="AJ81_02290"
     CDS             complement(431143..431832)
                     /locus_tag="AJ81_02290"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74649.1"
                     /translation="MRIENGTVRLTVRGQERIYKLHELDGEFFNWQIQTRTKSLKIFL
                     GLEKGVPNFSPHTVVMSTFSDEEEFPINSCIKGLGLVPKEEHLARLASRAMELIDLAR
                     QKGVNETFRERVNFLLELYENPDVFDRSVLSIIEMFYKRSYKNVLKDPRATLLFYDQM
                     SGYSVMFNVIVELVPRGTDFYNYVTAVHDLFHVPRDPSVRTDRYEYVYRFWPTEAYDK
                     TPGPKASQRLF"
     gene            complement(431834..432511)
                     /locus_tag="AJ81_02295"
     CDS             complement(431834..432511)
                     /locus_tag="AJ81_02295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:NP_577921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide transporter"
                     /protein_id="AJC73229.1"
                     /translation="MGTDWYGVDIFSQIVYGARTSLTVGALTAVGVTVIGGFLGVTAA
                     TFGRGVDVLIMRIVDFVMVLPGLPIMIMIMTYLGSSFWTLVFVLVVFGWAGISRVVRA
                     IVLSEKRRGYVEAAICAGASKWYILKKHLLPASYSVLVVNAAFSAAGAMLAEAGLSFL
                     GFSDPRVVSWGKMLSLARTCNALVLGAWWWILFPGLAIFLASFSIMSLGVASERILNP
                     KISNRRE"
     gene            complement(432691..433653)
                     /locus_tag="AJ81_02300"
     CDS             complement(432691..433653)
                     /locus_tag="AJ81_02300"
                     /inference="EXISTENCE: similar to AA
                     sequence:GenBank:AFV12677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="AJC73230.1"
                     /translation="MSFSYLVKRIIQMLLTILVAVTVSFILIRALPGDPAERFYGDPR
                     IPEEVKQEIKAAFGLDKPVLIQYLSFLKQFLKGDLGVSYTYNRRVVGVVLERLPWTLL
                     LTAVPTILGMITSLSLGVYIGCKRNSFVDKLVRYVAFALHSVPTFWFALLLVLLFSFK
                     LGWFPLQGMIDPSAKGFSSFVSLLRHAFLPWLVIFVVNVPGFAVYVRNMVISILNEEF
                     ILTAKAKGLTERQIRKRHILRNALGPLFSMLTLRIAGMLGGAVLIETIFSWKGMGLLV
                     LEASRNSDYPLLQATIIITIVSIIVANFLADVLQAAFDPRVRFE"
     gene            complement(433658..435193)
                     /locus_tag="AJ81_02305"
     CDS             complement(433658..435193)
                     /locus_tag="AJ81_02305"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74650.1"
                     /translation="MRRFLFLALVVLISAFVFSSQLNVAVLGEVRSLNPFLVKSAAER
                     IVVGYLYETLLTQRSGQVVGALAEDFQVDFSDNSLILKLRDRKFHDGSPVSADDVVFS
                     FNYILQKRLPLGPILAYFTGAEKIDEKTVKLKFRTMNVSMLSFAPMAIPIIPKSVWEK
                     IEKPLEFPNIERPIGSGVLMFEKLTPQSVVMKFFKDHPDAPKQLDGMVFHIVQDETMG
                     FLGLVKGDYDYLFWNLDPELAKQIMENPNKYPNVKVALIEGGVVNVILFNHRKLPMDD
                     VNFRKAVLHALNYRELVEKVYSGLADVASLGLIPKRAKAVYDESVGPVQQNVSMAKEL
                     LKKSNYDGKKLTLLVSSDRKAMDMAEYIKLYLKNVGIQVELDVQGPEGLTTKLKKADF
                     DLALYSYSLGSHPEMVFYHLHSSRGEMKNGQVVGFNYGGVNIPELDSALQAIWMAFSE
                     KDRVEAFSRLQKLLAEVVPVVPLLVPVDIEAYSVKNFTGWVVSPTEGVMNVETLKSLK
                     PAR"
     gene            435251..435664
                     /locus_tag="AJ81_02310"
     CDS             435251..435664
                     /locus_tag="AJ81_02310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002251002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="AJC73231.1"
                     /translation="MQTEWLGKMTFLAHTDSGRQVLMDAKKESGGLSAGPSPMELVLV
                     ALTGCTGMDVVSILSKMKVLDEVESFRMEVSSERAQDHPKVYTKIHLKYIFKFKNQPF
                     KEQVEKAVQLSQEKYCSVAGMLKKAAELTYEIVYE"
     gene            435673..436227
                     /locus_tag="AJ81_02315"
     CDS             435673..436227
                     /locus_tag="AJ81_02315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Appr-1-p processing protein"
                     /protein_id="AJC73232.1"
                     /translation="MLLKSFTFQGTVIEIVQDDITKQDTEAIVNAANSYLKHGGGVAA
                     AIVRAGGEEIQRESDEYVKTHGPVPVSQVAVTKAGRLKAKYVLHVVGPRWGEGNEHEK
                     LYMAVQNVLKKAEELSLSSISIPAISSGIFGFPKDQCAEVFCRAIRDFLEEHQNTSLK
                     LVRLCNIDEETSKIFLSVFEKYWR"
     gene            436232..436528
                     /locus_tag="AJ81_02320"
     CDS             436232..436528
                     /locus_tag="AJ81_02320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004661013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73233.1"
                     /translation="MQEEEKETVKLSMEQLIILFFNTIAARCWARLGLTRDEYGELRQ
                     DLKEARLGIDVLDAVLRVIEDELDDEIKRELEGVVANLKLNYVNQYSKSKEAKS"
     gene            436525..437610
                     /locus_tag="AJ81_02325"
     CDS             436525..437610
                     /locus_tag="AJ81_02325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004661012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="AJC73234.1"
                     /translation="MKKAGIVGLPNSGKSTLFNALTNQNVPAEKYPFCTIDPNVGVLV
                     VEDERLNKLAQLEGSKDKVHPFFHIVDIAGLVKGASKGEGLGNQFLDHISKVDMIFHV
                     VRCFKIDDVSHPMGSVDPARDIEVVEIELMLKDLETVNRRIEKIAKQAKTGDENARFE
                     LYFLERLKHHLESGKPARTLERNEQEQIVLDSLFLLSEKPVIYVANVDEWGLEQELDK
                     IVEKMAKERSSEAIVVNAQVECEVRELPFDEAKELLSAYGFEEGLKKRFLDHIKRALR
                     LICFLTATKNEARSWLIPEGTTAYDAAGLIHSDIQKGFIKAEVIAFEELLRYSSFKEA
                     REAGAVKFHGKDYVIREGDVVHFLFHA"
     gene            437585..437962
                     /locus_tag="AJ81_02330"
     CDS             437585..437962
                     /locus_tag="AJ81_02330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001470598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase"
                     /protein_id="AJC73235.1"
                     /translation="MSIFCSMLDLFKNTPLVATVLSFLTAQLIKIITHRSLKAFKKYG
                     GMPSGHAAAMSGLAFTLGRCVGYSSPITAVAVALLMVVVSDAVNLRPYVREDLGHSWI
                     EAFAGIGVGFLVSHLLPARIPLW"
     gene            437975..439480
                     /locus_tag="AJ81_02335"
     CDS             437975..439480
                     /locus_tag="AJ81_02335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001665260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="AJC73236.1"
                     /translation="MPAKLSSATLVGLNVSLVEVEVDIDKKSVIHDVDIVGLGDTAVK
                     ESKKRIKSALKNSGFDFPHGKIVVNLAPADLKKEGSLLDLPMAMGILQACGHLNECDF
                     LCVGELSLDGHIRKVKGVLTILAQLSKEGFSKPIVVPKENETEAKMVKNLKVFCFEHI
                     KELVEFMNGLVKYEPVKFEGLPPFSYDEDVDFADVKGQTLAKRALEVAAAGAHNVLMK
                     GSPGAGKTMLARRICTILPPLSDEEALEVLTIYSAVGQADIKKLSRPFRAPHHTASTV
                     AIIGGGNDARPGEISLAHNGVLFLDEFPEFRRDVIEALRQPLEEGFVTVARAKTTVTY
                     PSRFMLVAAMNPCPCGNYGDPKAVCNCSPYDIVRYNKKVSGPILDRIDILVQLPRLEP
                     EEYFSKNSSEKSERIRERVIKAREIQKRRYREIGISTNSQLNAKLIKRFVQLDEKTEE
                     LLKLTVSRYNLSARSIDKILKVARTIADLEGSEALNYKHVAEAIQYKLQQE"
     gene            439503..439946
                     /locus_tag="AJ81_02340"
     CDS             439503..439946
                     /locus_tag="AJ81_02340"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74651.1"
                     /translation="MDWMIVYFTRTGNCERIAKKLAETTGYPALRMIDDVNWSGFFGF
                     MKAGFYALTGKRTKIKVEGKLESDRIVLITPIWAGSITPAAKSFLDHFDPSKVLLVTV
                     SEVTKPQDVYRSLKRKYNLLGVHGFNRQVDEDKSIKELAEKLQRV"
     gene            440015..440090
                     /locus_tag="AJ81_02345"
     tRNA            440015..440090
                     /locus_tag="AJ81_02345"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:440048..440050,aa:Lys,seq:ttt)
     gene            440093..440180
                     /locus_tag="AJ81_02350"
     tRNA            440093..440180
                     /locus_tag="AJ81_02350"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:440127..440129,aa:Leu,seq:tag)
     gene            440185..440259
                     /locus_tag="AJ81_02355"
     tRNA            440185..440259
                     /locus_tag="AJ81_02355"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:440217..440219,aa:Gly,seq:gcc)
     gene            440394..443162
                     /gene="uvrA"
                     /locus_tag="AJ81_02360"
     CDS             440394..443162
                     /gene="uvrA"
                     /locus_tag="AJ81_02360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660214.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrA is an ATPase and a
                     DNA-binding protein. A damage recognition complex composed
                     of 2 uvrA and 2 uvrB subunits scans DNA for abnormalities.
                     When the presence of a lesion has been verified by uvrB,
                     the uvrA molecules dissociate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="AJC73237.1"
                     /translation="MNSIRIKGARVHNLKSIDVEIPKNTITVITGVSGSGKSSLAMDT
                     IYAEGQRRYLESLSAYARQFLGELKKPDVDNIEGLSPAIAIDQKSASHNPRSTVGTTT
                     EIYDHLRVLFAKIGEPHCPSCGRSVEKKSIDEIVKDVFSRFPQSSRIYVLSPIAIDKK
                     GTFKKELQNLASKGFVRVEVDGQLFRIEEVGELDKNKRHTIKLVVDRLVLEETERHRI
                     ADDIEIAFRESNGFVEIRNVDTNESLMFSEHMMCPVCGIGLPEINPKLFSFNNPYGAC
                     PNCHGLGYNLQIDPSLVVNENLSIEEGALLPFGQSEYYMPILRKIVKMFGASSKVPFK
                     ELPTIVQEALLYGYADFEGAVNFLERRYEQTASEDIKQWIEKNFIVQKVCPVCNGNRL
                     KPEALAVTIRGLNIIDVTNLTIEKAYSFFEELQNSLTDRETKIVGDLLIEIKKRLQFM
                     LDVGLGYLTLSRPVNTLSGGEAQRIRLATQIGSGLTGVTYVLDEPTIGLHQRDNLRLI
                     NTLKKLKDLGNTVIVVEHDEEIIRSADYIVDLGPYGGERGGKVVFAGTVQRLIDNPDG
                     SLTGQYLAGIKKIEHPVARRKGNGKFLTIVGARHNNLKNITVSFPLGTFICVTGVSGS
                     GKSSLIIDTLYPALMNAIYRTKLFVGEHDRIEGLENVDKVIAIDQSPIGRTPRSNPAT
                     YTKVFDDIRELFAMTPEAKARGYTKSRFSFNLKGGRCEACQGHGLVKIEMLFLPDVYV
                     ECDVCKGKRYNEETLQVRYRGKNIHEVLEMSVEEALEFFRNVPTIYRTLSLLNEVGLG
                     YIKLGQPATTLSGGEAQRIKLASELRKIATGKTIYILDEPTVGLHFEDVKKLINVLHR
                     LVDKGNTVIVIEHNLDVVKNADYIIDLGPEGGDDGGYVIACGTPEEVAKVEGSHTGRF
                     LRKVLNAG"
     gene            443168..444892
                     /locus_tag="AJ81_02365"
     CDS             443168..444892
                     /locus_tag="AJ81_02365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002533606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="AJC73238.1"
                     /translation="MRKIFLFVLLSLTIFVFAYNFYFANIHAHTSYSDGVGTPLEAFQ
                     HARRYVHVQAITDHAYYFEQKLNGLDKLLLTKEQAMKSTKIGEFVALWGFEWTGGVGH
                     INVYCTDEWISRNQVDLKGLYRWIVEKRALAQFNHPISTFGTFNEFEYDPLVDDFMNL
                     IEVGNGSWRGRTITDEMLSNYQLALKKGWHLGATANQDNHRAEWGSANDTRTVVLAEE
                     LSFEAIMEALWSRRVYASEDKNAKLIFECNSHPMGSILFGEKSLNFKIVLKDTESFDE
                     IRLISKHGVERVWKVNEKEFQIDLVLEPKEINEWYYVLAVQCDGDRIVSSPIWVKQSL
                     VYVVNERTRVQGNTVGIFFDLVNYSSDASDVRLTVKVGGLEKNFEERITGKEKKSFAV
                     DFSGLDVGKHSVTILVNDLIGWKSEVEIKKEPVLIDISHENDHPQFLQTVKAYLERKG
                     YQVVLNNRYFKRVPQAILVILPFPKKGAFAETSDLNDFEIDVLVDYVSAGGKILLLAL
                     PNSFVPRGFEELCKRLVPDAKLIQEDDRILVSREGQTLDSLQERGLIFLSIDSVERIL
                     ERLEDTLE"
     gene            444889..445554
                     /locus_tag="AJ81_02370"
     CDS             444889..445554
                     /locus_tag="AJ81_02370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002335060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M22"
                     /protein_id="AJC73239.1"
                     /translation="MKIFALDTSTEAICVGYTDGQNFYSMNYFGVEKHAVKLAPLVND
                     FLKLCDVKVSDIDVFGCGIGPGSLTSLRIGLAFVQAMACVTSKPIVPVVSSKVVAMNL
                     SGCEQDVVIVKKAREGFVYISCYRSLQEVLAPSVLEIEKAFDILRNFKDPVVVGDAAH
                     MFESVALVGKKELQYPRGEFLLHEVMQNFKANVVRKPHEVEPLYLQKSIAEMNLEKRL
                     KGQ"
     gene            complement(445548..447914)
                     /locus_tag="AJ81_02375"
     CDS             complement(445548..447914)
                     /locus_tag="AJ81_02375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="AJC73240.1"
                     /translation="MEISYRDLIYRLDHMPSFKTTEEIEPAHGFIGQDKARRAIDQAL
                     EIKGKGFNVFVVGLPGTGRRSFVNSYLRQIAANMPTPKDWVYVYNFSNPSEPEAISLE
                     AGRGKIFKQDMQRLADEVMEALEKIFESDEYARRKSELEDEYMQKKTQLWEELKQKAS
                     ELGFAVQIAPTGVVTVPVYEGKLLTPDAFEALPDEVKQVFNENSRKLKLIVEGTLYKS
                     RRLDREYKEKLMALDKDAALFTVGAMFEELKNQYESNPHIVRYLSNVQNDILENLAQL
                     RSGDEEVRQAFKKRYSVNLIVDNSAVVGSPVVFERNPTYANLAGKVEYYSKGGMLFTD
                     FTMIKPGAFHRANGGFLILEAENVLRYAYAWEYVKRCLMTDQIVVENLETALGLSSIV
                     SLRPQPIPLNVKVFLICSPRLYYLLQMYDEDAEKLFRIKSEFDWEMDASRENIQKYLG
                     FVASTCCRLNAPHLERQAVEKLMWYSARLAGDRNKLSMRLGEISSLVREACTVAMKRG
                     SNVVKREDMVEAIRQREERVNLLQTKYDEHIKNRDLMIETKGSRVGQINGLTVIDLHD
                     HSFGVPVKITAKVHVGERGVIDIHREVDLSGSIHNKAVLTIEGFFRERYSKHVHFSLN
                     ATLSFEQVYSVVEGDSASVAEVLALISAIANVPLRQDIAVTGSMNQHGEVQPVGGVTE
                     KVEGFYRACKLRGFTKTQGVVIPKANLKNLILKDEVLESVKKGEFHIWTVEHIDEAIE
                     LLTGKKAGRTTKTGGFEKGSVNYLVVQALKRAERMKEAKKTKRKKKSH"
     gene            complement(448204..448959)
                     /locus_tag="AJ81_02380"
     CDS             complement(448204..448959)
                     /locus_tag="AJ81_02380"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74652.1"
                     /translation="MRRFFVSTLITVLSLALIVFMYGNSSSRVYRDGTFTAVSQGDKY
                     GYAMVTVTLENDKIKSVAIKEFDGFGVEKLYEVYGQFFPAIREAHETLAKRIVEANSY
                     QVDVFTGATGTSKKVMEAVKFALEKAKIEPSKTKYLDGTFMGVSDFTARGHAVAWVTI
                     ENDTIVKVVLEETTPSVKDGKTVVDAAGRTVWVFKGGDYPWPEFHEAKTAITKAVIEK
                     QTYQVDVYTGATSSSNKFIQAIQRALEWAKARQ"
     gene            449265..450608
                     /locus_tag="AJ81_02385"
     CDS             449265..450608
                     /locus_tag="AJ81_02385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="AJC73241.1"
                     /translation="MKVKVKLDIKSFIERGDFRTLKVILSQQEPADILEMIEELPPDE
                     KIVVFRLLPKDQAALVFSELEADDQIALIELFKEEKLKEIISSMSPDDRAELLEEMPA
                     NVVNRLLSYLTPEERKETLALLNYPENSAGRLTTPKCVELHPEMSVKEALEKIRREGR
                     DKETIYLMPVIDHQRKLLGVVTLEDLIFSDPDMLVEQVMDDQPVYVYATTDQEEVAQI
                     MRKYDLVAVPVVDSEQRLIGIITIDDVVDVIDEEATEDIQKMSSIVVTEQSYFHTSSW
                     QFFINRLPWLAALLLLGTLSSGIIARFEHLLASLPIIAAFMPAMVDTGGNIGSQISAL
                     VIRGMALGEIDQKDWWRVLTRELLIGAMLASTLAVAVLLRVVFVTRVTHIMLAVSTAL
                     FVVVIVSNIIGALLPFIAKSLKIDPAIMAGPLLTTIVDLLGIAIYFSVVNFMLSV"
     gene            450687..450887
                     /locus_tag="AJ81_02390"
     CDS             450687..450887
                     /locus_tag="AJ81_02390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001471006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="AJC73242.1"
                     /translation="MRGTVKWFDPKKGYGFITKKEGGDVFVHWSAVEMEGFKTLKEGQ
                     EVEFEIQEGPKGPQAAHVKVVK"
     gene            complement(450945..451475)
                     /locus_tag="AJ81_02395"
     CDS             complement(450945..451475)
                     /locus_tag="AJ81_02395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73243.1"
                     /translation="MRRLVVMAVLVVSALALAAVNLDVFGNYHFTLSATPTAAASISY
                     LSFGLQVGYEVTEGVQIGGGVGLAYFLPDATAATAFLGVASPTQWTLDLTVSAKYAIP
                     INDFSAVVVKGYGGLSIPGFTGFDKLGYIVGAKVLYVFDMVDFNVGFGAGIEMRTYGT
                     SSITTVPVGVLANIKF"
     gene            complement(451514..452965)
                     /locus_tag="AJ81_02400"
     CDS             complement(451514..452965)
                     /locus_tag="AJ81_02400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucosidase"
                     /protein_id="AJC73244.1"
                     /translation="MAPVKISIIGAGSAVFSMRLVNDLCKTKGLAGSLVSLMDVDEQR
                     LNGVHELASRYVRELGADLRFEKTTSLETCLHEADFVINTALVGGHAYLNKVRAIGEK
                     HGYYRGIDAQELNMVTDYCTITNFNQLKFFVDVARLMEKICPNAWLLQTANPVFEGTN
                     LISRCSNIKVVGFCHGHYGVIEMAEALGLDENKMDWQVAGFNHAIWLNRFIYDGRNGY
                     ELLEKWIQEGNLEKWRPKNPFDLQMSPAAIDMYRFYGIMPIGDTVRNSTWYYNKDFET
                     KKKWYGEPWGGPDSEEGWKWYEQQLKTTTDAIDFLSKNRTLKLLSLNTYLKFLPKGAV
                     PVEMKKEVEVFSSPDKLSGEQHIPFIDSLVNNNARRFVINVPNEGYIEGVPNGVFVEV
                     PAIVDKDGWHVEKIEPKLTDKVLRFYLWPRMMRMEWALHAIMNGDKAALIEFLMRDPR
                     TKTLEQAKAVIEEILNLPENQQMKTHYEKGLKL"
     gene            complement(452979..453680)
                     /locus_tag="AJ81_02405"
     CDS             complement(452979..453680)
                     /locus_tag="AJ81_02405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_005471681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATPase"
                     /protein_id="AJC73245.1"
                     /translation="MLEVEKLCVRYGKIAAVNGVSFSLNEGELLAIVGANGAGKTSVL
                     NAIMGLVKVHSGRIVFDGVDITHLEPWKRARMGIVIVPEGARPFADMSVMENLEVAAM
                     NIDKAEMKRKMEWVFELFPRLAERKKQPAKTLSGGEKQMLAIARALVGPVKLLIMDEV
                     SLGLMPRLVTEMFKVIERLKREKLTMLLAEQNTKKALQVADKVCVMQNGSIVLEGKPQ
                     DLLDSEEIKRAYLGV"
     gene            complement(453673..454425)
                     /locus_tag="AJ81_02410"
     CDS             complement(453673..454425)
                     /locus_tag="AJ81_02410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_003589240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="AJC73246.1"
                     /translation="MTLLSVRNVSKRFGGLQALKDVSFDVDAGEIRAIIGPNGAGKTT
                     LFNIINGFLRPDSGSVVFDGKNIVGMRPSKITKIGLGRTFQIVKVFASLSVLENVLAG
                     LGVDIYPNMDAFLRSPFEREYIRQAWRIIEMLGIEKYAFAAAGTLPLGLQRKVEIARA
                     LAVKPKLLLLDEPVSGLNDLETQEMIDVVKKINQSGVTILFIEHDMHFTVKVAQRITV
                     LDYGVKIAEGTPEEVTKDPKVIEAYLGSEEVA"
     gene            complement(454367..455272)
                     /locus_tag="AJ81_02415"
     CDS             complement(454367..455272)
                     /locus_tag="AJ81_02415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:ZP_08088631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="AJC73247.1"
                     /translation="MDYFLTVSVFTMINMILALSLNILTGYAGQVSLGHAAFFGIGAY
                     TSAVLTVKLGMGYWPALLLSVLISGLVGLLLGLPALRVKEDFLVLATIGVNFVVVSIF
                     NYVQFFGGPYGILGLPRPSLFGHAFTTKEYALYVLVWTLVVVFFVKYLSNTYSKLGFD
                     ALREDEDAAESVGVSSPRYKMYAFAIAGLLAGLAGNLWAHYMTVVFPDNFSFPVSIGI
                     LTMVVIGGVGTLVGPMIGAVIVTVLPEVLRFARDYRMLIYGLIIVFTMFFMPKGIVGS
                     IKGLMFGDTPLGKKRVEKIRRIAST"
     gene            complement(455275..456141)
                     /locus_tag="AJ81_02420"
     CDS             complement(455275..456141)
                     /locus_tag="AJ81_02420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004932852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="AJC73248.1"
                     /translation="MEVLQNIVNALVLGSSYVMIAVGLTLVYGILKILHIAHAGIYAF
                     GALFAVYLCELGLPLVFAIVLSLIFSSLLGAFIYKGFYKHVLDRGRIVPLVMSVGLFA
                     TLEDLYRLIWGPYKRPFDAYIGLPDVMSPTLYLSSKGVLMLIVTAVVIVLLYLLLMRT
                     KLGKSLRACSNDLSLAGAFGINTDRSVTFAFLIGSSLAALGGILVGLYDNTVYPTMGS
                     VPSYKAFVVVVLGGFGSIKGAVLASYILALVETFVVYYFGFLLPRDAIAFLTMILLLM
                     FKPEGLFGKVRR"
     gene            complement(456196..457341)
                     /locus_tag="AJ81_02425"
     CDS             complement(456196..457341)
                     /locus_tag="AJ81_02425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004340634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="AJC73249.1"
                     /translation="MVVKRLFVVMLLVVSLLSFAAVKIGFFAPLTGPAAADGASALHG
                     AQLAVEYINARGGVLGEPVELVWYDDNFKADQAVSIAYKLVQQDRVAVVVSGSYSGMT
                     RAAAGIYQQLKVPMIAAYAVHPDIVATGEYIFRVGTLATVQGRAGAHLAVEKLGAKKI
                     AILTIDNDFGVSLTAGFKEEAIKLGAEIVFEQKYPLGETDFRPLLTRIRSARPDVIYA
                     TGYFSEAARLVTQARQMGIFIPIIGQEGYDSPQFAKLAEAGAANGVVITTDLDRDSEK
                     PIVRWFIEEYAKRYGLDADMVAASAFDAVMAAAKAIQIAGSYDPAKIRDALATIKAGD
                     EELEDFVTGFRGFTEKRESLRTVTCQIYLGNRFHWFWEVKDPKIVTP"
     gene            457496..458338
                     /locus_tag="AJ81_02430"
     CDS             457496..458338
                     /locus_tag="AJ81_02430"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC74653.1"
                     /translation="MRTVLIFLVLIIVSSLVLPKRGEVDEILLYLKLLDFGFRVLMVY
                     IVYGYRYVPMKIGMSLISFSALINFLDSYLILPASELIETLSSLSGCFVVAISLLWLF
                     KDFISEEFHRLLYTDYLTGVLNRQTFMKLASRKLQSLKENETACLLYLDLDGFKKVND
                     EFGHSFGDKLLQAAAKRIKSSIRSSDLLGRIGGDEFVLFLAGADVRMAEEVLERINEK
                     LKEPFGIDGVRIELSLSAGTAVYPKDGESLEDLIEASDKAMYRAKSMKRGKERVRGSE
                     EIVG"
     gene            458307..458951
                     /locus_tag="AJ81_02435"
     CDS             458307..458951
                     /locus_tag="AJ81_02435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_004660600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="AJC73250.1"
                     /translation="MFEEAKRSLVEYGRRLLESNMVGGTAGNLSVRVSEELFAITPSG
                     MPYNEIECDDVPILDMTGHVVEGSRKPSIEFRLHLQIYKNFSDVQAIVHAHPIYCGVL
                     SILRLPLPALNETMLMYSVFVPVSEYANSGTEQLARNVVSAMRQSRAVIMANHGLVCA
                     GESLKEAFDMCETIERTAKMYVLALSTGKTIFTIDEKDALEAMEFLRKNYGQRS"
     gene            complement(458923..459633)
                     /locus_tag="AJ81_02440"
     CDS             complement(458923..459633)
                     /locus_tag="AJ81_02440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002333935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="AJC73251.1"
                     /translation="MIVYGDSRWGNATHRRLVEMMDRYKPSIVVHLGDMVNSGDNREE
                     WEIFFEITSPLRSYAFFQPVKGNHEKPDVYYRQYFGLYNYWARVGNYVLIFLDPDVGV
                     KGCESFLRSVDLSNKIPIVFSHYPIFSGGPHGTTQTVKNLQALHDVLRELKVPLVFGS
                     HDHNYQRVVRDGVTYVVTGGGGAPLYRVNPIEGLLVSAVVHHFVKVRLEEDRIECEAI
                     SIDGKIIDSFTISVRSSF"
     gene            complement(459768..460238)
                     /locus_tag="AJ81_02445"
     CDS             complement(459768..460238)
                     /locus_tag="AJ81_02445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_003012635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AJC73252.1"
                     /translation="MANAKRVGLLFGIVFTILGVVLLTKLSANYFWSIFLILLGLLFE
                     FGVLGRGAGSFVPAGILLVIGSVLLVCNIFGYDKMNYLWPAFVLAPGFGLFQAYLVKK
                     SKGLLTASIVLIVLSAILFMATFFHVSWARVLFGIVLIIFGVVILVKSLRRKVE"
     gene            complement(460243..461052)
                     /locus_tag="AJ81_02450"
     CDS             complement(460243..461052)
                     /locus_tag="AJ81_02450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_002940813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="AJC73253.1"
                     /translation="MKVGVVGVGNIGGIIANRLVESGLFEPRQVFLSNRTSEKLRSFI
                     EKGYSVASTSQMGTLCDVIFLCVKPQDSERMFAELGKVEDKMLISTMTAVSIERISKR
                     TGAKRIVRIMPNVPAMIGKGLVGACRSVHIDDGTWQTCLKLLSCLGTVVEVKEEQMEA
                     VTALSGSAPAFIFVIVEALIDAGIRMGLSYEKSRLMVLETMAGSAELLLKLDNHPGEF
                     RHVVTSPAGTTIEGIYRMEREGVRGALMKTIQETYLRALQLRKELNDQFGG"
     gene            461154..462140
                     /locus_tag="AJ81_02455"
     CDS             461154..462140