LOCUS       CP002026             4765023 bp    DNA     circular BCT 28-JAN-2014
DEFINITION  Starkeya novella DSM 506, complete genome.
ACCESSION   CP002026 ADBQ01000000 ADBQ01000001 ADBQ01000002 ADBQ01000003
            ADBQ01000004 ADBQ01000005 ADBQ01000006 ADBQ01000007 ADBQ01000008
            ADBQ01000009 ADBQ01000010 ADBQ01000011 ADBQ01000012 ADBQ01000013
            ADBQ01000014 ADBQ01000015 ADBQ01000016 ADBQ01000017
VERSION     CP002026.1
DBLINK      BioProject: PRJNA37659
            BioSample: SAMN02598514
KEYWORDS    .
SOURCE      Starkeya novella DSM 506
  ORGANISM  Starkeya novella DSM 506
            Bacteria; Proteobacteria; Alphaproteobacteria; Hyphomicrobiales;
            Xanthobacteraceae; Starkeya.
REFERENCE   1  (bases 1 to 4765023)
  AUTHORS   Kappler,U., Davenport,K., Beatson,S., Lucas,S., Lapidus,A.,
            Copeland,A., Berry,K.W., Glavina Del Rio,T., Hammon,N., Dalin,E.,
            Tice,H., Pitluck,S., Richardson,P., Bruce,D., Goodwin,L.A., Han,C.,
            Tapia,R., Detter,J.C., Chang,Y.J., Jeffries,C.D., Land,M.,
            Hauser,L., Kyrpides,N.C., Goker,M., Ivanova,N., Klenk,H.P. and
            Woyke,T.
  TITLE     Complete genome sequence of the facultatively chemolithoautotrophic
            and methylotrophic alpha Proteobacterium Starkeya novella type
            strain (ATCC 8093(T))
  JOURNAL   Stand Genomic Sci 7 (1), 44-58 (2012)
   PUBMED   23450099
REFERENCE   2  (bases 1 to 4765023)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D.,
            Goodwin,L., Pitluck,S., Davenport,K., Brettin,T., Detter,J.C.,
            Han,C., Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ivanova,N.,
            Beatson,S., Kappler,U. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2010) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     URL -- http://www.jgi.doe.gov
            JGI Project ID: 4084204
            Source DNA available from Ulrike Kappler (u.kappler@uq.edu.au)
            Organism available from DSMZ: DSM 506
            Contacts: Ulrike Kappler (u.kappler@uq.edu.au)
               Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Starkeya novella DSM 506
            Culture Collection ID :: DSM 506, ATCC 8093, CCM 1077, IFO 12443,
                                     NBRC 12443, NCIB 9113
            GOLD Stamp ID         :: Gi02557
            Greengenes ID         :: 4661
            Funding Program       :: DOE-CSP 2008
            Sequencing Depth      :: 21x
            Isolation Site        :: Soil
            Temperature Range     :: Mesophile
            Temperature Optimum   :: 26 - 30C
            Gram Staining         :: gram-
            Biotic Relationship   :: Free living
            Diseases              :: None
            Habitat               :: Soil
            Energy Source         :: Chemolithotroph, Heterotroph
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..4765023
                     /organism="Starkeya novella DSM 506"
                     /mol_type="genomic DNA"
                     /strain="DSM 506"
                     /isolation_source="soil"
                     /type_material="type strain of Starkeya novella"
                     /db_xref="taxon:639283"
     gene            169..450
                     /locus_tag="Snov_0001"
     CDS             169..450
                     /locus_tag="Snov_0001"
                     /inference="protein motif:PFAM:PF01381"
                     /note="PFAM: helix-turn-helix domain protein;
                     KEGG: bvi:Bcep1808_0172 helix-turn-helix domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="ADH87338.1"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /translation="MCWATLGAGVRVTRETRGHGVREAAAAAGVSAATVSRCENGREL
                     SFDSLARLSAYVGLHPHAYTVKPFPDPGSTGNTHCNSLKTQEAPHDRHG"
     gene            434..1672
                     /locus_tag="Snov_0002"
     CDS             434..1672
                     /locus_tag="Snov_0002"
                     /inference="protein motif:TFAM:TIGR00362"
                     /note="TIGRFAM: chromosomal replication initiator protein
                     DnaA;
                     PFAM: Chromosomal replication initiator DnaA; Chromosomal
                     replication initiator DnaA domain;
                     KEGG: azc:AZC_1014 chromosomal replication initiation
                     protein;
                     SMART: Chromosomal replication initiator DnaA domain; AAA
                     ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="ADH87339.1"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="InterPro:IPR018312"
                     /db_xref="InterPro:IPR020591"
                     /translation="MIDMGDALPPGVHTAADLMRHYEEVRRRMKAQTARRRGPPVPPP
                     VTAAVVPAVPVAPSVVEPPSFSPRDAALTFARYCVGECNRLAHAAACDVAASAPGLMP
                     RFNPLFVHGGTGLGKTHLLQALAQAAEESGRRVAYLTAERFMFGFVAAMKTGTTEDFR
                     ARFGEIDLLLLDDVQGLHGKSVQQAFSSALNALMDAHRQVVIAADRHPGDLDAFDERL
                     RSRLGAGLVIELRSLDDEVRAAIIAAQAERAAVLSPGFALPVDVARFLASDGRMNARD
                     LAGAVNRLLAPHQFGGVEITMDMAQAVLRDVIRTGEPRRVRVDDILRVVTKQFGVTLA
                     DILSQRRTANVVRPRQIAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKMDGLRSH
                     DAKLRAELDDLEAKIMERVA"
     gene            1669..2010
                     /locus_tag="Snov_0003"
     CDS             1669..2010
                     /locus_tag="Snov_0003"
                     /inference="similar to AA sequence:KEGG:Avi_6150"
                     /note="KEGG: avi:Avi_6150 bacteriophage protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage protein"
                     /protein_id="ADH87340.1"
                     /translation="MSAYPFSNLPARLAALVLVCPERGCWIWQGATSGRGRGGGYGRV
                     KWDGVTQAVHKVVWRIAGRRPLRRGEQLDHECRVRACCNPAHLKPMYQPKNMRLAYAR
                     RRAAFRAEAVQ"
     gene            2010..3509
                     /locus_tag="Snov_0004"
     CDS             2010..3509
                     /locus_tag="Snov_0004"
                     /inference="protein motif:PFAM:PF01555"
                     /note="PFAM: DNA methylase N-4/N-6 domain protein;
                     KEGG: bbt:BBta_6611 site-specific DNA-methyltransferase
                     (adenine-specific)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase N-4/N-6 domain protein"
                     /protein_id="ADH87341.1"
                     /db_xref="InterPro:IPR001091"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002941"
                     /translation="MTPETFLDGRVTLYCGDSRDALDLIEPNSVDNCVCDPPYALVSI
                     GKRFGKEGAAPAKGGVYQRASGGFMGQSWDTGEVAFDAKFWRKVFRALKPGGHVIAFG
                     GTRAYHRLAVAIEDAGFEIRDSIGDLISLDPMVRAFVDSLDEAQLDAFLRIADLIGFE
                     GLLAWVYGTGFPKSHDVSKAIDKMAGAERPVVGFDPVAAKRTSKFGTNSYGDFKGQNG
                     DVTAPATAAAAAWQGWGTALKPAWEPIVLARKPLIGTVAENVLEHGTGALNVDGCRVG
                     DEVRTAAFTSLAPCHGNALGAAGTAEACRGTQGEPKEYVGRHPANIIHDGTDEVVSAF
                     PETESGAGAVKRATAAGHQGNALGRESRPAGTPMISHGDSGSASRFFYSAKADADDRL
                     GSKHPTVKPVDLMQWLVRLVTAKGGTVLDPFAGTGTTGEAAWREGCNAVLIERNPPYQ
                     ADIRRRMALCTAGSATRKRAARLARAEAEGKAPEFGPLFGGLTGPEAAE"
     gene            3506..3820
                     /locus_tag="Snov_0005"
     CDS             3506..3820
                     /locus_tag="Snov_0005"
                     /inference="similar to AA sequence:KEGG:Nham_2399"
                     /note="KEGG: nha:Nham_2399 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87342.1"
                     /translation="MTREVLPARRFAENVSFFLGKILYSVTLGFYDDGRVGEVFIGGP
                     KTGSDAETNARDAAAILSIAMQYGVPPSAFSTAVQRDSSGVPLGPIGAVVDLLAPQDG
                     GA"
     gene            3820..4539
                     /locus_tag="Snov_0006"
     CDS             3820..4539
                     /locus_tag="Snov_0006"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87343.1"
                     /translation="MNTHSLERREPLHDGSAVLGHPLYPGGQIEQLHSSARVRPFQVF
                     EPEFGREQLQLPPQRSRGLNRGSYPNDVGEWKRFECQLGVARRYLNAIVFLKFNYRRV
                     GRRSIIKALGCGELLCSGPDLGGIHQNNCAIADKAIDPIFSILLGEPSALGDITIYCN
                     DRCCRRQHREHSADSRARETEPVSCISSGQYTFSCRDNGRTKNHPEEDAGDADGKRVP
                     EASFHASTLIKRPLFVERALS"
     gene            4536..5234
                     /locus_tag="Snov_0007"
     CDS             4536..5234
                     /locus_tag="Snov_0007"
                     /inference="similar to AA sequence:KEGG:Rsph17029_3297"
                     /note="KEGG: rsh:Rsph17029_3297 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87344.1"
                     /translation="MTGIVVDRFAGHNPAPMRILIGCETSGVVRRAFAAYGHDVWSVD
                     LLPAEDRSNRHIIGDIRDYLGEGWDLLAVMHPPCTRLCNSGVRWLRKAPPGRTLEEMW
                     ADLEEGAALFSDCWNAPIERICVENPVMHRYARERIRNWAKPQTVQPWWFGESAFKAT
                     GLYLRGLPPLVPTRKLVPPKKGTDEHKSWSKVHRASPGPERWKDRSRTYDGVAEAMAA
                     QWTAAWAREREAAE"
     gene            5231..6295
                     /locus_tag="Snov_0008"
     CDS             5231..6295
                     /locus_tag="Snov_0008"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mno:Mnod_7350 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87345.1"
                     /translation="MSNYAQGWVENLDVVLGSSTRFVLMALANYANDANLAWVSRSTI
                     VKYTELSPATVTRALRDLEARGLIEREERFRDNGSRTTDMIRLLVGCTPRPATPPDHS
                     DEGGTDHHDEAPSSPRAGPLITVMRPEPSLEPSIEDSPQAPQGAGVGISKSDGEGEGG
                     APDTQFDVFWAQYGADPTASKAKALRSWARLGASERAQALALLPRFLDHCRAKSRRIC
                     DPSTYIAERRWEGLANVPAPAARAEEAPARPVEADPVKRAVLWALNDKADRGEWHFVE
                     QGSDAWEAWRQAFGAAGFGHRWMAGRVVREPAPGGGIVQRLGRSFPLRYPPKADGSGT
                     GPPDGTVTADEMAEFVNSGG"
     gene            6307..6900
                     /locus_tag="Snov_0009"
     CDS             6307..6900
                     /locus_tag="Snov_0009"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rle:RL1123 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87346.1"
                     /translation="MGMVGRPRIETRERYACGKAKSKPEVASPAMVRRIINEARRGAA
                     DPALGSVIGQLRLRDIIDTRQMSAGLRYAELCADFDRMKGIPRRSAASPSYQAGLRRT
                     GGNDAEDEGIVAELLRNGGDVRELAKKNARLRALVRIVTAHEAAQKALLECGQPVWRL
                     VREVAIYDRTIDAWHRPQLIRGLDALLAHFDLTGFRK"
     gene            6984..7343
                     /locus_tag="Snov_0010"
     CDS             6984..7343
                     /locus_tag="Snov_0010"
                     /inference="protein motif:PFAM:PF01844"
                     /note="KEGG: rsq:Rsph17025_1748 HNH endonuclease;
                     PFAM: HNH endonuclease;
                     SMART: HNH nuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="ADH87347.1"
                     /db_xref="InterPro:IPR002711"
                     /db_xref="InterPro:IPR003615"
                     /translation="MARLTTLPPRLSALPPRLAVQTHTGPDRDRVRMAGAPWRAWYKT
                     ARWRALRLRVFTRDLFACQMKDCGRVEADTSLLVCDHIHPHRGDEHLFWDEGNLQTLC
                     KPCHDSVKQAEERRGGW"
     gene            7443..7940
                     /locus_tag="Snov_0011"
     CDS             7443..7940
                     /locus_tag="Snov_0011"
                     /inference="similar to AA sequence:KEGG:Rsph17025_1749"
                     /note="KEGG: rsq:Rsph17025_1749 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87348.1"
                     /translation="MSDEKSEAPGEVDLFGMPVRPIRDRRGRPCFKKDKENQDFVAVR
                     IAAGWSQARIAEDMGIDEKTLRKHFSRELENGRVFVEGLVLDVLLKQTREGKSPAIRQ
                     LREMLEAAGPQAPRGRSKPKSDEEEEDEDGKAAPVGKKEQQMQDAQVVPPEYGDIFDR
                     IDRRH"
     gene            7940..9658
                     /locus_tag="Snov_0012"
     CDS             7940..9658
                     /locus_tag="Snov_0012"
                     /inference="protein motif:PFAM:PF03354"
                     /note="PFAM: Terminase;
                     KEGG: rsq:Rsph17025_1750 phage terminase"
                     /codon_start=1
                     /transl_table=11
                     /product="Terminase"
                     /protein_id="ADH87349.1"
                     /db_xref="InterPro:IPR005021"
                     /translation="MLPVLFACPDWFEKLQAGATPIPDLPIDPVLAECAVELFNKLRV
                     PDVPGMPTMAEAAGEWMRDIVRVAFGSVDRETGQRFVGEIFNLVPKKNGKTTNAATLG
                     LIWLMMNRRPNVDGIIVGPTQEVAEKCFEQASLMIAADEYLARRFKVIDHKKTIIDRH
                     IDRDTGIRRNAKLKIKSFDPKVVTGSIPAFAILDELHVMAHANFASRVVGQIRGGMIT
                     NPESLLIIITTQSEVPPFGIFKQELDYARKVRDGEVTEDVRMLPILYEFPEAMQLATD
                     KPWLDPKNWPLVLPNLGRSLTIDRLQKEWRTAQQKGEGAAREWASQHLNVQIGTAMHG
                     DRWVGVDYWDAAADDRITLDYIKENSDVVVTGGDVGGLDDLWGLAVLGRHKETRHWML
                     WAKAWAQRIVLERHKEVAERLRDFEREGSLVICDRVTQDAEEAAAIIVSLRDAGLLPE
                     TGGVGLDPAGVTALLEELALYEVGSPCVAAVSQGYRLSAAIFGTERKLADGTMKHCGS
                     LLLNWCAGNLMAEMRGSNVYMQKRTASAKIDPMMAAFNAVEMMSRNPVAANGPSVYEG
                     RGILMV"
     gene            9663..10994
                     /locus_tag="Snov_0013"
     CDS             9663..10994
                     /locus_tag="Snov_0013"
                     /inference="protein motif:TFAM:TIGR01537"
                     /note="KEGG: bmj:BMULJ_04637 bacteriophage portal protein;
                     TIGRFAM: phage portal protein, HK97 family;
                     PFAM: portal protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage portal protein, HK97 family"
                     /protein_id="ADH87350.1"
                     /db_xref="InterPro:IPR006427"
                     /db_xref="InterPro:IPR006944"
                     /translation="MRILDFFRRSEPAAAAGAHVSPQASGSGFLSLDDPRVIEFLRFG
                     DVTATGITVNVERALKNPAMFRAVSIISFAIGMLPLQLIHEETKKKATDHPLYRVLHR
                     RPNGWQSAFDFRTLMQLRALVKGNGYALVLRSTDLRNRGAEKVGGLVPLDPDRMEPKQ
                     LDDWSVVYDYQPKTGARRRYQARDILHLRGLSLDGITGLSTVKQAAEPIALALAAELA
                     AGRVFKNGALVSGALKHPGKLSDPAFERLKASLAEKEGAENAGKNLILEEGMDWASVS
                     SSAKDAQLIEIRKMQIEEIGRATGVPRPLLMMDDTSWGSGIAELGRFFVQFALTPWFE
                     AWQQACERTLLSDAEADALTVKFNAGALLRGSVKDQGEFFAKALGAGGQPGFMTQNEV
                     RDMLDMPRVEGGDELSKGAMGHNGGPALDDPEDDTAPKPKRSPKKDEGDED"
     gene            10984..11865
                     /locus_tag="Snov_0014"
     CDS             10984..11865
                     /locus_tag="Snov_0014"
                     /inference="protein motif:PFAM:PF00574"
                     /note="PFAM: peptidase S14 ClpP;
                     KEGG: dac:Daci_1633 peptidase S14 ClpP"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S14 ClpP"
                     /protein_id="ADH87351.1"
                     /db_xref="InterPro:IPR001907"
                     /translation="MKTDRPRVMAAARPDAMPLPIRQDVHAFTKPEVFDRWSDTAAGV
                     RALTVGDNVITMFDVIGEDYWSGGGVTAKKVASQLKAIGDRPVEVQINSPGGDMFEGI
                     AIFNVLREHPQDITVKVMGMAASAASIIAMAGDHVEMGAASFLMIHNCWVLAIGNRHD
                     MRETAEWLEPFDQAMVDLYAARTSQKPADIAKWMDAETYMSGSQAVERGFADALLASD
                     QITTDEKAQSADRNINELRAMELQLVSAGMSRSAARARINKIKGTPGAAPNDPTPGAG
                     EDDWSGIADLIATLRTS"
     gene            11875..13257
                     /locus_tag="Snov_0015"
     CDS             11875..13257
                     /locus_tag="Snov_0015"
                     /inference="protein motif:TFAM:TIGR01554"
                     /note="KEGG: bmj:BMULJ_04635 bacteriophage major capsid
                     protein;
                     TIGRFAM: phage major capsid protein, HK97 family;
                     PFAM: major capsid protein HK97"
                     /codon_start=1
                     /transl_table=11
                     /product="phage major capsid protein, HK97 family"
                     /protein_id="ADH87352.1"
                     /db_xref="InterPro:IPR006444"
                     /translation="MRTFLYVALACAAVLALGHILPADASPLTHGVAMAVFAMPAAKP
                     RLPRIAVETTMLRPVPRAVKAMPRADVSDPKAMIAALQKAFDDFKAANDEKLKGKADV
                     VLDEKVDRINSAVDGFQKAIDDLNAKLAAQAAGGSVIGDLPADPEYVAAFKAHMRKGD
                     VQAAISKGVDSEGGYLAPVEWDRTITGKLKEVSPIRDNARVMSITTSGFKKLFTDRAV
                     GSGWVGETAARPATSTPAFAILDFVPGEIYANPAITQQALDDAAIDLEQWLAGEVNTE
                     FARQEGIAFLSGNGTNKPFGILTYVTGAANAAKHPWGAIEVVNSGAAAALTSDGFISL
                     FYSVPTAYRSGAKLYTNRQTMAAARKLKDGQDNYLWQPSYAQGQPATLAGEPIVEIPD
                     MPAVAADAIAALYGNMEETYLVVDRIGIRVLRDPYTNKPFVHFYTTKRVGGGVFNPEP
                     MRALKIAAAA"
     sig_peptide     11875..11952
                     /locus_tag="Snov_0015"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.994 at
                     residue 26"
     gene            13324..13587
                     /locus_tag="Snov_0016"
     CDS             13324..13587
                     /locus_tag="Snov_0016"
                     /inference="similar to AA sequence:KEGG:100021428"
                     /note="KEGG: similar to neurotactin; K05508 C-X3-C motif
                     chemokine 1; K05508 C-X3-C chemokine 1-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="neurotactin"
                     /protein_id="ADH87353.1"
                     /translation="MAVKKAGTARTVPVTVAAPQQAATIPAATSFAPSGAPEQTVPDV
                     DPKHAAIDDNPRANTSVEQNRIDFNDPTLSGSEAVANNLKGEG"
     sig_peptide     13324..13392
                     /locus_tag="Snov_0016"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.702) with cleavage site probability 0.689 at
                     residue 23"
     gene            13591..13908
                     /locus_tag="Snov_0017"
     CDS             13591..13908
                     /locus_tag="Snov_0017"
                     /inference="protein motif:TFAM:TIGR01560"
                     /note="TIGRFAM: uncharacterized phage protein (possible
                     DNA packaging);
                     KEGG: bcm:Bcenmc03_1290 phage protein DNA packaging
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="uncharacterized phage protein (putative DNA
                     packaging)"
                     /protein_id="ADH87354.1"
                     /db_xref="InterPro:IPR006450"
                     /translation="MPNVVVTETGPLLSLEEVKQHLRVDHGDDDALITTYMDAAVLHV
                     LMYCNLSLVPLGAEAQFKVAALMTAADFYDNRAEVAPGPVASVPLPASARRLVDPYRH
                     LRV"
     gene            13911..14261
                     /locus_tag="Snov_0018"
     CDS             13911..14261
                     /locus_tag="Snov_0018"
                     /inference="protein motif:TFAM:TIGR01563"
                     /note="KEGG: ara:Arad_2301 hypothetical protein;
                     TIGRFAM: phage head-tail adaptor;
                     PFAM: putative head-tail adaptor protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage head-tail adaptor"
                     /protein_id="ADH87355.1"
                     /db_xref="InterPro:IPR006453"
                     /db_xref="InterPro:IPR013045"
                     /translation="MPAAGDLRERVHFQSREMIDDGYGNEQSGPWTTRFTVAAGFRPL
                     RGGEAVMASRLESRQPYIVTVRQSSDTRGVSTDWRIVDARNTGRVFAISAAPTDPDGK
                     RAWLEILAIEGMPS"
     gene            14261..14455
                     /locus_tag="Snov_0019"
     CDS             14261..14455
                     /locus_tag="Snov_0019"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87356.1"
                     /translation="MPWVRFIADFDFKPKPAITIAYRAGFVGLVSRSCAAKAKARGLA
                     IPVSRPGSRRNDEVAADGKV"
     gene            14442..14912
                     /locus_tag="Snov_0020"
     CDS             14442..14912
                     /locus_tag="Snov_0020"
                     /inference="protein motif:TFAM:TIGR01725"
                     /note="KEGG: avi:Avi_1977 hypothetical protein;
                     TIGRFAM: phage protein, HK97 gp10 family;
                     PFAM: TP901-1 ORF40 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage protein, HK97 gp10 family"
                     /protein_id="ADH87357.1"
                     /db_xref="InterPro:IPR010064"
                     /db_xref="InterPro:IPR011693"
                     /translation="MARSSIVGLAKLHRKIAKLPEQARTDIRAAMEKVAEQIVDLARS
                     LVPTVSGDLRDSIGWTWGRPPRGSISLGTVARAKLGASMTITIYAGNDEAFYARWVEF
                     GTAAHVNGGLFAGTRNPGTQARPFFYPAFRAHRRIARREVRKAIRSAARKVAKQ"
     gene            14909..15331
                     /locus_tag="Snov_0021"
     CDS             14909..15331
                     /locus_tag="Snov_0021"
                     /inference="similar to AA sequence:KEGG:Avi_1978"
                     /note="KEGG: avi:Avi_1978 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87358.1"
                     /translation="MIDPVLELQGVITARLKANDDLRALIDRRVYDSVPRDRDGGVTA
                     KFPYVSFGPTTELQDDADCIAATEFTLQIDAWSREPGFPEVRRIAKAVKAALHEQEIT
                     LAENALATFEWWRADVIRAPDGITSHAAITFRGVIEQS"
     gene            15389..15835
                     /locus_tag="Snov_0022"
     CDS             15389..15835
                     /locus_tag="Snov_0022"
                     /inference="similar to AA sequence:KEGG:Avi_1979"
                     /note="KEGG: avi:Avi_1979 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87359.1"
                     /translation="MAKPTTMKGGQVRVLIGNDEDPIVYAAPCGFTERSVTLSKNLEE
                     VVIPDCDDPDAVDWVGRDASSLSMAISGEGVMAEQSVETWLDAWENPNSVPVKVEWGF
                     PNKTITWTGLMHVESIEATGANGQRVRKSISMQSDGEMARVVTPNA"
     gene            15828..16394
                     /locus_tag="Snov_0023"
     CDS             15828..16394
                     /locus_tag="Snov_0023"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: smd:Smed_1323 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87360.1"
                     /translation="MRDASLTLDWADGTYAFRLGWAELEKLQEACDAGPYVVLQRLRT
                     GTWRVGDVAHVVRLGLIGGGMTPVDALKKARAYVEARPPAENLLPAQAILSAGVVGAP
                     EEDDGSDRPAPNDADRVDDLPNGKIRMATVYGLGAAMGFTPQQVGAMSLWQFMAAVKG
                     YAKANNPDDGKSLTAAEEDALWAVVAEG"
     gene            16398..18404
                     /locus_tag="Snov_0024"
     CDS             16398..18404
                     /locus_tag="Snov_0024"
                     /inference="protein motif:TFAM:TIGR02675"
                     /note="TIGRFAM: phage tape measure protein;
                     KEGG: avi:Avi_0873 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage tape measure protein"
                     /protein_id="ADH87361.1"
                     /db_xref="InterPro:IPR013491"
                     /translation="MATDIEKLVVQMSADIKGFERELRKAQGIGERRATAIERRFQQM
                     NKRISASLGSSVSLGGLAGAVGLGISIADFVETTKRIDSLRQSLKAITGSEAEAAREM
                     QFVTETAEKLGLELLSTGEAYASLMAATKDTTLEGEATRDIFVAVANAMSTLGKSSAD
                     TEAALLAVQQMVSKGKVSAEELRGQLGERLPGAFKAAADALGITTAELDEMLQKGQVT
                     AEVLLPRLAKRLEELYSVDRKSTLTAEINRLNNAVTDLYRTLADTGAIGLVTSALKDL
                     ANIIKEIAAYSQLVGQGRFGEAFAVDPAGAARMKLRLGQGTALTDDQSAAWDQAFGMT
                     GSAPSTVTVNKPAPPAFAPAAEKQRLDSYQRLTAAIKERTGAIEAETAAQASLNPLMN
                     DYGFAVEKARAEYDLLTAAQEAGLSITPELRAQIDTLATAYANASAASEQLRESQGRL
                     QQAAADFNEMGRGVLSGFIADFTNAETRADALNNAIGRIVDSLAEMALSSVFKPQGSG
                     SGGLFGAFFSALTGGTSGTTSGYAGASALYDEGGYTGDGGKHDVAGAVHRGEYVFSKA
                     AVQRLGADNLEMLHLMGKKGYADGGFVGGLSMPRISRRGGASRGAGAVLSFSPVTNID
                     ATGSQVSRQEIAGMLAQRDKALMAGVQRAMPGWIVSARKRNVGI"
     gene            18407..19057
                     /locus_tag="Snov_0025"
     CDS             18407..19057
                     /locus_tag="Snov_0025"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: smd:Smed_1878 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87362.1"
                     /translation="MAITYPRSLPACGARRVALELFDPVVSAASKRGLVINRTQVVDP
                     LWRLRAETHMLRQPAEWIAWGASLGGGLRTFLASDSRYRQPLAYPNAGVPGDVAAGWD
                     GTADVTALGSGGALSLALLPSSYQITAGDRIGLEQGSPLRRGYYMALEDVTASAGGVA
                     TVTVTPFLHTAIFTAAATARLWRPSAEFVLDPSTWPENPGALPRWSSFSFEAWQTI"
     gene            19054..19680
                     /locus_tag="Snov_0026"
     CDS             19054..19680
                     /locus_tag="Snov_0026"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rsp:RSP_2992 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87363.1"
                     /translation="MITLPSDVLALLDAGRISIRGMIRFDLGTGTYGFIRSVQPLTWS
                     GVTYLPGGLISVSDLSASMDGSAQAFTVKLAASADDGLTPEVLLTIEAEDYRDRPVTI
                     YDAYFHPDTGALLHVQALKRGYIDTIDHIDDPEDGYTLEAKCESRALDYTRTNGRRRT
                     VVDQARRAPGDLFFEHTAMRGREEIFWGREKAAAPPPQVPRSTTPRRR"
     gene            19697..20101
                     /locus_tag="Snov_0027"
     CDS             19697..20101
                     /locus_tag="Snov_0027"
                     /inference="similar to AA sequence:KEGG:Rsph17025_2086"
                     /note="KEGG: rsq:Rsph17025_2086 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87364.1"
                     /translation="MRIKGWERELRLVVEKHIALPSAYGISDCYIIADDAVEAVTGKR
                     MFTGARGYRTAAGAAKKLRKRGFLTVADAFAARFAEIPAMMAQRGDIGVIHQPNGDVT
                     GGVFTGLGFFTRDGDRAVFLPCTDVARAFRVD"
     gene            20105..22708
                     /locus_tag="Snov_0028"
     CDS             20105..22708
                     /locus_tag="Snov_0028"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rsq:Rsph17025_2085 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87365.1"
                     /db_xref="InterPro:IPR000560"
                     /translation="MPFIAPIIGAVGAAIGAVGSFVGSLGIVGQALLGIGASVLSSVI
                     QKETAGKAEKQPGGVQFERQYGGDVPRQVACGLVGIAGHDTYVNTFGPANGILQQIYT
                     LSDFPCHGLSRVAINGKWVTLGPVGEDGMRKVTSGEYADLIRVQFVDGTQTAALAGLV
                     NSANPSDRWTANHIGAGVAYVYIALAFTEPLTNFPDFFFEFYGARFYDWRKDSTVGGS
                     GGHRWGNYATYEFTENPVVIEYNYRRGIAWNGDMFCGMAMPAADLPLAKWTAAANICD
                     ETTDYGTRYRCSIMLDCTAMHGENITSLQLSCGAKKVDAVDGSWPLVGHDQAVVATIT
                     DDDLIVGVRGRWTARRSMSDLVNRVYGTFPNPDNLWSPADYELQGGGALVVLDRRDRD
                     VPLDFPMVRVPGQAAQLARIYLEENRYEATGDEVWRPRFQVLEPGDWIRRIGRTHGDR
                     IYQITGLSLASHDADGPRNVSVSLQEVDGAIYDGITAPPIVVPMPPGAPVLLNEVQDF
                     DLAPVTVLGDDGRLLPAIRASWASITDVTVAYVDLQYWPTAQPTSVFTKRVPATETIT
                     VLAEGVVRATEYTVRTRLVTQPPRVTVWSAGETVTTTAIPDTEIDVYLANIKGDAYDA
                     LRRMREDLTANVQRMDMFVRDTSVGLGRQVTSTSVATRLGKANATAIQSVQSSVQDLG
                     DQVLAMAEIIDAVNASIESINGTLAGQASAMTALTARVTASEGGINALAASTTTLSAT
                     VGDLSASGLLRIEARAGSGDVSARLVVLMRATTGSVWREVGTIWETGFTGGNPALPFA
                     RIANYADQFVIISPIDDGRLPPFVVDTGLGQVIITEALIKRLMVNNFTLTGAGSKLLI
                     TSNPARIRATS"
     gene            22708..24039
                     /locus_tag="Snov_0029"
     CDS             22708..24039
                     /locus_tag="Snov_0029"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: gvi:gll0645 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87366.1"
                     /translation="MPVSLTVTGGAMRLRTALPGHDPEDENTDERYLTFDSFWGGTLR
                     LLANNVVSAASLANLTVTYPAGADGPITRRCKVLPSAGENATRPTLAWARRGAGSVTY
                     RSGGVDTPTGYQRGYRQCGVTLRTNSILLSPQLAGVDYVYFVFGNNGTAAEGSGGNGV
                     IIGDHDLHGVGLHASRLGFNVDTATLAEMAVSTRKNVFQIFETGTVTLTGTALTDPLA
                     DPNVNSFALPAAFVDLAGSYPHYPPVIAYSVGNSEQVNCSVFWINASRLLILGTADFS
                     TPVRFAVVASDPAYQGGVDSATGIVRLDITGDYVRVSKHNIGIDAAGIADLVFDSDRL
                     TPRLKGFSAVGASQGSGFFNLPSPPPVGAGPPFNFFILWDPQIGEWWCGCGNVAYFDV
                     LGFFQTVGVWGYSGHAPAGWVANRTQCGWFRPGSWGSAPGFTATMNVSDFS"
     gene            24049..25224
                     /locus_tag="Snov_0030"
     CDS             24049..25224
                     /locus_tag="Snov_0030"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: smd:Smed_1872 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87367.1"
                     /translation="MPTSPSVFRAGVVAVTAGSPIVLGTGTGFLLNGVTGGMFSLAGH
                     AVPVLSADSETQLTLAYDWPGATASGVADYAISLESALAADATFVHNRLVSVLDAIGA
                     IENARPNYEVLSVGSNAPPGSPVVGGLYVVGTVPNGAWVGQANNLAQWTGAAWLFTAP
                     ERGTTVVSAATGIVSIWNGTTWGAYVAPSSFIATLMDDASASAALSTLGVSDFAKTIL
                     DDTTAAEARTTLGATAFRALGTLTGAAGSFARFTGAGGADAVMQAIVGTVSQSAGVPT
                     GAIVEAGSNGNGNYVKFADGTMVCWATFAVRAINIASSAVIGGFRSAAIIPTFPIAFA
                     AVPAIVTFATGGSGASGSAITACDSSAPTTGNFSFYLAASVNTTAAGAGYVAIGRWY"
     gene            25243..26691
                     /locus_tag="Snov_0031"
     CDS             25243..26691
                     /locus_tag="Snov_0031"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: ach:Achl_0059 agmatine deiminase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87368.1"
                     /translation="MPTPSTVIALGARGTVHEVTEDANFYYFRSDSMGCATLPFKMKK
                     TAFTDLAKIVDGHTGTRCYVGYGQSWRTMSGGAIKSWVAGYSAEPESALTFHQTNSAG
                     ARSVLGPTVGVYWPGSTFVDDICGMSLNEPITLDRVAAVARARWRRKRVIRQFSDFHF
                     TFGYPSSGWDWGGSGGAGLNENSPSWANGIAALNRLRTILTGYGLSVALAPLSWTQGG
                     DPNKNLAGNLDDLAQLRHHWGEDAAGGAAQPLFIGIAPGGSSTTEMPVGAKAQIQYCR
                     DNVGSGIHLTFPWYMLRLTSTGPGDDGSIHFDSAGMVRYGAVEGYVQAIVEAGVVWTP
                     FWLTRDVDPVRVDGQEVVVTFDAPPGGDFDRKAPRVITRDDEPDLPGLAESHGFRVKR
                     AGTFLTLGTPTYGLNASGKPEARLPVVETLVSGDALEVSYCAYGTGSVPFGHSGVWGN
                     VILRGPRCPVRKDVPDPFVDMPLVPFIAASTA"
     gene            complement(26770..26967)
                     /locus_tag="Snov_0032"
     CDS             complement(26770..26967)
                     /locus_tag="Snov_0032"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: pfs:PFLU0319 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87369.1"
                     /translation="MRFSAEWWTGFGLVFAALGAITVLFCWWMDRRIARFAAGDAEAH
                     ERLSRSAGNNVVEMKKPPEGG"
     gene            27003..27236
                     /locus_tag="Snov_0033"
     CDS             27003..27236
                     /locus_tag="Snov_0033"
                     /inference="similar to AA sequence:KEGG:Rleg2_0750"
                     /note="KEGG: rlt:Rleg2_0750 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87370.1"
                     /translation="MRLIPNWRKVLLRAWSVRLGLIAGLFEGLNVVLQITVDRLPDVS
                     LGLRLAAGGCACLALVSRFIAQPKTIGESHADH"
     gene            27223..27813
                     /locus_tag="Snov_0034"
     CDS             27223..27813
                     /locus_tag="Snov_0034"
                     /inference="protein motif:PFAM:PF00959"
                     /note="PFAM: glycoside hydrolase family 24;
                     KEGG: rlt:Rleg2_0751 glycoside hydrolase family 24"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 24"
                     /protein_id="ADH87371.1"
                     /db_xref="InterPro:IPR002196"
                     /translation="MPITKLRPTGRARAAIAAVMALAISIGGIWYVPTSSGKQYPAAV
                     VLAAEHIIKGWEGLRLIAYRDIVGVWTICYGETKGVRAGMRKTAAECEALLYERVYRD
                     FYIPMSACAAPAFVQAPVPVQAAMLGGGYNFGVGGWCGSTTARYIRAKLWRQACDAQT
                     AWNRAGGKVVQGLVNRREMGDASRIGEGELCVTGLQ"
     sig_peptide     27223..27336
                     /locus_tag="Snov_0034"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.712) with cleavage site probability 0.570 at
                     residue 38"
     gene            27813..28172
                     /locus_tag="Snov_0035"
     CDS             27813..28172
                     /locus_tag="Snov_0035"
                     /inference="similar to AA sequence:KEGG:Rleg2_0752"
                     /note="KEGG: rlt:Rleg2_0752 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87372.1"
                     /translation="MLGLLDTIKIGAGLIAGVSLTWAAQTAYDRLVDDPAVAAAAREG
                     YVQIAEKTALQAQLAELSRQRAASDEALRAALARAENAKQEAARAQAQYDDLVVQDSG
                     ADGARVDGSDVQWLRDY"
     sig_peptide     27813..27884
                     /locus_tag="Snov_0035"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.602) with cleavage site probability 0.525 at
                     residue 24"
     gene            28147..28425
                     /locus_tag="Snov_0036"
     CDS             28147..28425
                     /locus_tag="Snov_0036"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rlt:Rleg2_0753 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87373.1"
                     /translation="MCSGCATTERRLTVAAGTTGRIAASVDLPDLPAECRAHMARVVP
                     KEGEKWRWVQKRWEIVADTEDKRTARCAAFYDDVAEGFEVTGVAGDAE"
     gene            28415..28699
                     /locus_tag="Snov_0037"
     CDS             28415..28699
                     /locus_tag="Snov_0037"
                     /inference="similar to AA sequence:KEGG:BBta_5763"
                     /note="KEGG: bbt:BBta_5763 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87374.1"
                     /translation="MRNEPNKSVVLSISRDELREEMEKAVRRGLEDVGLYTEDAEDRR
                     ETREDMRFVRRLRRATDGIAAKVGYTVLAIVTGGFLVVIWAGIKVHVLKQ"
     gene            28683..28892
                     /locus_tag="Snov_0038"
     CDS             28683..28892
                     /locus_tag="Snov_0038"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87375.1"
                     /translation="MCSSNERPRRAAFHEPTGRLLINFDHQSGIGTLEEWETYVRFIQ
                     REVTRQRERQYQAAHPWHWRPEPEF"
     gene            29186..30901
                     /locus_tag="Snov_0039"
     CDS             29186..30901
                     /locus_tag="Snov_0039"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: azo:azo0386 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87376.1"
                     /translation="MTNRISRIAAAETLLFILIIAVISFKHFVLIVPHGPSVFMDELW
                     YKDNIISLLSNAIAYKAHYPPVYSAVLMPAFIFENWYEALVGLNAIYTSLCIAVVYFV
                     ARSFVRRLLALVAALAAALLPWQAVYPLYIMSENVAVLLFVLSVFLASRGVTDRPGEA
                     LIFGALLSTLYLTKYLALPALPMLFLAWMVGPFLQRCRYSLSAYVTSIAACALGMSII
                     LGGWAAYCLSRGIPLLKAFGLAFVDKYIDAAPQSSQFMWLIVYAADAALSVAPFILFV
                     ALWVTSHSFKKQVRELKFTQDSVFIILSACVAAGYCVLSARHSFIVPYNRPNPSHMQG
                     RYMMQIGPMFIIAGVISFERLIMDGRLGSGRMRWWMAPPLVVAAVVLSWGILFRDFVW
                     SFPAWFASMAHVSPSVFPYNNQKVAILCIALVVIMALIVMIARASGTIWRIAVPSAIV
                     VAICWQAALFWGGVEYVRALRNTQHGRYIAAEVLSGRVSPNCYEDIVIDVPFLTPTML
                     KNQLSFWGIDGNKYDIKISVLDEKKEEKDDIYMLLGAAGRNAVAVANYSLDGQQYTAY
                     CINPD"
     gene            complement(30969..32477)
                     /locus_tag="Snov_0040"
     CDS             complement(30969..32477)
                     /locus_tag="Snov_0040"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rop:ROP_06080 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87377.1"
                     /translation="MLNPKYDQQVQSQIGQYSTVENMHNAAAAANWFNSRFLRPRMRQ
                     VSGTESVAEFYAVHIAEAVARTGLDVAVSLGAGYGSLEIDIINLARSRGLPAFHLKCF
                     ELSPVLVDRANRAIREQGLEDFVSAQVVDLNVDLPLAGNVAAFMAHHSLHHLVELERI
                     FDQVNSYLPPEGAFITMDMIGRNGHMRWPETLGIIRELWPALPDRLKWDHQLSRFDRW
                     FENWDCSIEGFEGIRSQDILPALLERFKFERFLAYGGLSEIFTDRSFGPNFDPNNPPD
                     ANFLSQIKALEDDLIRAEQVKPTQLIAVMRPLRSHDCPGEAICFEGLTPTKAVRSADR
                     QDFGAPHLGNTSFVSPFPAPDEEPAIPMVACGAPIHFVPGGNGAALTRWGWAEPDPDF
                     TWSVGLASALRFRAAEGAAGILLKFVDVRPPTTERRFLTLRLNDREVASIELDGIEAV
                     REISAAFPDSLSPGDEALLEIELTRPLRPDVDDSVDRRPLGIGLISMSLAPA"
     gene            complement(32885..33166)
                     /locus_tag="Snov_0041"
     CDS             complement(32885..33166)
                     /locus_tag="Snov_0041"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87378.1"
                     /translation="MGITHTAAMQPYEIIRKNITKVGPDWQIAPDQPPVDMRVWSGFV
                     AFVPGDRAEIKKRVDAVRISFTADLLPAEGGVWVLAGYSDLAKILKALR"
     gene            33273..33494
                     /locus_tag="Snov_0042"
     CDS             33273..33494
                     /locus_tag="Snov_0042"
                     /inference="similar to AA sequence:KEGG:Xaut_3742"
                     /note="KEGG: xau:Xaut_3742 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87379.1"
                     /translation="MTDKPSPHDPTDLIEITDADVDEAIAVCSGDMRATIRALLIANT
                     FTEQMLELARREASPGFLRRRPVKRAQNG"
     gene            33487..33882
                     /locus_tag="Snov_0043"
     CDS             33487..33882
                     /locus_tag="Snov_0043"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mes:Meso_0687 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87380.1"
                     /translation="MDELRVICVECTCGRRWWGRSSEVGFRSIQDLAGRMVCRGCGAR
                     NVSVAYADHVAVPAPEPNELWASVEIWDDAGIRIQETMARVGNLGVGVAAYERTLLER
                     PNRNVTLRDRARIIRSTARDRERRGKRLD"
     gene            complement(33874..34557)
                     /locus_tag="Snov_0044"
     CDS             complement(33874..34557)
                     /locus_tag="Snov_0044"
                     /inference="protein motif:PFAM:PF02586"
                     /note="PFAM: protein of unknown function DUF159;
                     KEGG: bja:blr6107 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF159"
                     /protein_id="ADH87381.1"
                     /db_xref="InterPro:IPR003738"
                     /translation="MCNLYSHHSNVEAIRDLVGTLRNLAGNLAPQTGIFPDYPAPIVR
                     TGADGERELAMARWGMPSPPQFGGPPVTNIRNVASPHWRRWTGPASRCLVPMTSFSEY
                     APEPNPVTKRKDVVWFALSEERPLTFFAGIWTPWDGVRGTKANPVLGPHDLYGFLTCE
                     PNAVVKPIHPKAMPVILTTAEEREVWMRAPWSEACALQRPLADDGLTIVARGAAKEDP
                     PVEDLRLLV"
     gene            complement(34564..34791)
                     /locus_tag="Snov_0045"
     CDS             complement(34564..34791)
                     /locus_tag="Snov_0045"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: pmj:P9211_02281 putative kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87382.1"
                     /translation="MMGQMMTTKPDHYPLPWTVNMTSDEDGLPLFGVLDAEEGYVCYS
                     HDDKVSRAIAAHAEKIKETMAALPPASFGEG"
     gene            complement(35168..35593)
                     /locus_tag="Snov_0046"
     CDS             complement(35168..35593)
                     /locus_tag="Snov_0046"
                     /inference="similar to AA sequence:KEGG:Mrad2831_3935"
                     /note="KEGG: mrd:Mrad2831_3935 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87383.1"
                     /translation="MKTTAIILGAALASMSTVAFAGPCTERISALEKSLSTSDAGSGP
                     TKSTDAMTAAPNPGVPKAGETPGTGGTAGMNATVGSKATSPADVRSQTSGGATAAQGG
                     ASSSQQVSAAMSRAKAADQSGDAAACGRALDEAQQLLKG"
     sig_peptide     complement(35528..35593)
                     /locus_tag="Snov_0046"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.988 at
                     residue 22"
     gene            complement(35683..38481)
                     /locus_tag="Snov_0047"
     CDS             complement(35683..38481)
                     /locus_tag="Snov_0047"
                     /EC_number="2.7.7.59"
                     /inference="protein motif:TFAM:TIGR01693"
                     /note="SMART: metal-dependent phosphohydrolase HD region;
                     TIGRFAM: protein-P-II uridylyltransferase;
                     KEGG: azc:AZC_0338 PII uridylyl-transferase;
                     PFAM: GlnD PII-uridylyltransferase; DNA polymerase beta
                     domain protein region; metal-dependent phosphohydrolase HD
                     sub domain; amino acid-binding ACT domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP-GlnB uridylyltransferase, GlnD"
                     /protein_id="ADH87384.1"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR010043"
                     /db_xref="InterPro:IPR013546"
                     /translation="MTDTRRRRRTDHPFKELFDIDVLREELTALARQVLDNGKAGREI
                     ELRGQMARRLKLAYQQGHKTAERWLMEEGSGRRCAERLSRLQDEIIALVHELAVKFLY
                     PSDNPSTAERMAIVAVGGYGRGLMAPGSDTDILFLLPYKQTAWGESVAEAILYVLWDM
                     GLKVGHATRSVDECIRQARADMTIRTALLEARLLLGEKSLFEELTVRFDKEVVQGTAV
                     EFVAAKLAEREDRLKRAGQSRYVVEPNVKDGKGGLRDLHTLFWIAKYVYRVHETRDLV
                     AKGVFTPEEAVVFRRCEDFLWSVRCHLHFLAGKAEERLSFDLQREMAERLGYTAHPGL
                     KDVERFMKHYFLVAKDVGDLTAIVSAALEERHDKPVPRLNRVIARLRRSPRRALKEST
                     DFIVDNDRINVADASAFGRDPVNLIRIFHLAGKHGLAFHPDAMRLATRSLKLIDQRVR
                     ENPEANKLFLEILCSRETPEIVLRRMNETGVLGRFIPEFGRVVAMMQFNMYHSYTVDE
                     HLIRAIGVLGQIERGDRPDLGLANELVQQIKNRTLLYVAVFLHDIAKGRPEDHSIAGA
                     RVARKLCPRFGLSPVDTDTVAWLIEQHLTMSTIAQSRDLSDRKTIENFASVVQNLERM
                     KLLLILTTADIRAVGPGVWNNWKSQLLRTLYYETEPVITGGFSESNRNQRVARAQAEF
                     RAAMADWPPEEIEAYLSRHYQTYWLQTDREQQAEHARFIRAAEAEGRALATTAHTDAA
                     RGVTELTVFAPDHPKLLAVIAGACASAGAHIVDAQISTTTDGRALDTISLTRAFEQDS
                     DELRRTERIAAAIQKSLAGEIRLPEIVAKRIPKRPRAFTVEPEVTLNNSWSNRHTVVE
                     VSGLDRPGLLYGLTQTLSRLNLNIASAHIATFGERAVDVFYVTDLMGAKIIGAARHSA
                     IRRALLQVLDADDEANAA"
     gene            complement(38689..39270)
                     /locus_tag="Snov_0048"
     CDS             complement(38689..39270)
                     /locus_tag="Snov_0048"
                     /inference="protein motif:PFAM:PF05239"
                     /note="PFAM: PRC-barrel domain protein;
                     KEGG: atc:AGR_L_1375 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PRC-barrel domain protein"
                     /protein_id="ADH87385.1"
                     /db_xref="InterPro:IPR007903"
                     /db_xref="InterPro:IPR011033"
                     /translation="MTSKLATLTAAAALALAPAVAFSQSPAPESTTPPAASPMAPDAG
                     TPQAPASEMPNTNTPSATPTTPPSGDTAAAKPAPSTPKFVSTQSSGQWLGSDLIGTAV
                     VTSTDEKLGSISDLVLERDGSVIAAVIDVGGFLGIGAKPVAVSFDSLTPTPTDDGQKI
                     VVALTKEELNSAPEFKSLEQMRSETSDAGAKTN"
     sig_peptide     complement(39199..39270)
                     /locus_tag="Snov_0048"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.953 at
                     residue 24"
     gene            complement(39424..39855)
                     /locus_tag="Snov_0049"
     CDS             complement(39424..39855)
                     /locus_tag="Snov_0049"
                     /inference="similar to AA sequence:KEGG:Dmoj_GI18025"
                     /note="KEGG: GI18025 gene product from transcript
                     GI18025-RA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87386.1"
                     /translation="MAGVVSTAFKGSAYLLGAVTGAALMVPVTAGALSAGAIARITPH
                     PVAIEMMGPPANLRAPVVNRAAKGPRLDSGPAGTPAAVAPAGAATRPVVDSATPAPAS
                     PPRVMRTPKGCLSAMGVTKSNLATEELTVCVADASIVNSLN"
     sig_peptide     complement(39763..39855)
                     /locus_tag="Snov_0049"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.762) with cleavage site probability 0.429 at
                     residue 31"
     gene            complement(40077..41405)
                     /locus_tag="Snov_0050"
     CDS             complement(40077..41405)
                     /locus_tag="Snov_0050"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="KEGG: rru:Rru_A0741 signal transduction histidine
                     kinase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: HWE histidine kinase; PAS fold-4 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="ADH87387.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR011102"
                     /db_xref="InterPro:IPR013656"
                     /translation="MPPLTLDLIDDAARWVTILSSLAIAVGLVRLLQLRPDFSGRTRL
                     LTALLVALVSMFALLMLLAIFNGSRMSPDWLQSAVRIGIAALSAVGATALWINFRALV
                     NMPSPGHVASEQRRLTLELATALQRYEMALRGSKVAIFTQDRDLRYTSVSKPLFGYPV
                     EQVLGSTDADLLGDAQSQPIALIKRESLAASAARKGETEVNEDGGRFWYDIHIEPLRD
                     LSGATVGLTGAVVDVTERKENEQHLRLLMRELTHRSKNLLAVIQAMARQTARHAGSID
                     EFVEIFSARLQALSRSHDLLVQESWHGAALIDMVRSQLGHHIDRENSQVSVTGPNIFL
                     KPEAAQNIGLALHELSTNAAKYGALSVPSGHVDITWARRMAEAGGGFELSWRESGGPP
                     VTVPSGRGFGSLVIERNLARALDGEVDLDFAPAGLVCHVTVPEHHLTAGR"
     gene            complement(41413..42216)
                     /locus_tag="Snov_0051"
     CDS             complement(41413..42216)
                     /locus_tag="Snov_0051"
                     /inference="protein motif:PFAM:PF00072"
                     /note="KEGG: met:M446_2725 two-component response
                     regulator;
                     PFAM: response regulator receiver; Sigma-70 region 4 type
                     2;
                     SMART: response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="ADH87388.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR014605"
                     /translation="MSTSQLVAQHLPFLRRYARALSGSQSAGDAYVTAMLETLIADPA
                     ILDRDADPRVALYRLLTRLWDSVSLNAKVDQTPAAIQGEHRLGHITPVVRQAFLLVSL
                     EGFTEEDAAQVLEIDVPTLRNLVEDAGRELAAEIATDVLIIEDEPFIALDLEGLVESL
                     GHRVTGIARTHTEAVELARRKAPGLILADIQLADGSSGLDAVNELIAKVEVPVIFITA
                     YPERFLTGVRPEPAFLIAKPFQPSTVAAVISQALFFERRARPREQRATA"
     gene            42422..42661
                     /locus_tag="Snov_0052"
     CDS             42422..42661
                     /locus_tag="Snov_0052"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rpe:RPE_1750 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87389.1"
                     /translation="MNDDQSEGQSATADTLSHTPIRGARTTALGSDIQAKIGQHLRAM
                     YDDVVRQGVPDRFMDLLSQLDKNAGPKTSEDGGSR"
     gene            42658..43209
                     /locus_tag="Snov_0053"
     CDS             42658..43209
                     /locus_tag="Snov_0053"
                     /inference="protein motif:TFAM:TIGR02937"
                     /note="KEGG: nwi:Nwi_2773 RNA polymerase sigma factor;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
                     PFAM: Sigma-70 region 4 type 2; sigma-70 region 2 domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
                     /protein_id="ADH87390.1"
                     /db_xref="InterPro:IPR000838"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR013324"
                     /db_xref="InterPro:IPR013325"
                     /db_xref="InterPro:IPR014284"
                     /translation="MSQFDPALRDEIIAAIPNLRAFAISLSGSVDRADDLVQETLLRA
                     FANISSFRPGTNLPAWLFTILRNLFRSEYRKRRREVPDSDGAFAATLTTNPDQATHLD
                     FEDFRTALDKLPPDQREALVLVGASGFSYEEAADICQCAVGTIKSRVNRARKRLGELL
                     AIEDVEDFGPDKTTRAVLAAERA"
     gene            complement(43315..43494)
                     /locus_tag="Snov_0054"
     CDS             complement(43315..43494)
                     /locus_tag="Snov_0054"
                     /inference="protein motif:PFAM:PF07043"
                     /note="PFAM: protein of unknown function DUF1328;
                     KEGG: mno:Mnod_4397 protein of unknown function DUF1328"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1328"
                     /protein_id="ADH87391.1"
                     /db_xref="InterPro:IPR009760"
                     /translation="MLGWALTFLVIALIAAVLGFGGIAGTAIEIAKIIFFVAIILFLV
                     SAVVGLLRGRSGPVP"
     sig_peptide     complement(43414..43494)
                     /locus_tag="Snov_0054"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.975) with cleavage site probability 0.400 at
                     residue 27"
     gene            complement(43695..44594)
                     /locus_tag="Snov_0055"
     CDS             complement(43695..44594)
                     /locus_tag="Snov_0055"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: mno:Mnod_0259 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87392.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /translation="MIDRFELLLALAKERHFGRAAESCGVTQPTLSAGLKQLEEQLGV
                     RLVERGSRFIGFTPEGERALQWARRVIGDVRAMRQEIAGMRKGLSGHLRIAGIPTAMP
                     MLSELTTPFHEKHGDVRFTLMSASSNEVLRLIENLEADAGVTYLDNDPLGRVKTVPLY
                     QEGYRFLTAVDAPLGDRAKVTWEEIGQVPLCLLTPDMQNRRIVDKQLTEAGHAVVPML
                     EANSTLALLSHVRTGKWASVVANTLADVFAFPENIRSIPIEGPEVLHQMGLVVLDREP
                     LTPIVTALMAEARAIAPELAARM"
     gene            complement(44858..46054)
                     /locus_tag="Snov_0056"
     CDS             complement(44858..46054)
                     /locus_tag="Snov_0056"
                     /inference="protein motif:PFAM:PF02646"
                     /note="PFAM: protein of unknown function DUF195;
                     KEGG: xau:Xaut_3306 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF195"
                     /protein_id="ADH87393.1"
                     /db_xref="InterPro:IPR003798"
                     /translation="MDQVLFVVGTHPVTLAQAIAGAAALGFLLLVLVLRAVSRNARQS
                     ALEADEQARRADELETRLVELARTQAETVGRVQSMAEVLAQRQGELARAVAERLDATT
                     HRMGESLARSAEATHENLAKLNERLALVDQARLSLGELSGQVMSLRETLANKQARGAF
                     GEGRLQALVSDGLPRDSFAFQHTLANGRRADCAIFLPGDKRPLLVDSKFPLEAVTAFR
                     EAQTDDARKQAQTRLKGDVGKHVKDIAERYLVSGETQDIALMFVPSESVYAELHEHFD
                     EVIQQAFRARVVIVSPSLLMLAVQVVQAICKDARMREQADLIRAECGKLVADVIRLRD
                     RVGNLQKHFGQVNEDVAQALTSADKIAKRGARIEQLEFEGEAIPATEPELPDTLPMLG
                     LRGAAE"
     gene            46166..46714
                     /locus_tag="Snov_0057"
     CDS             46166..46714
                     /locus_tag="Snov_0057"
                     /EC_number="3.5.1.88"
                     /inference="protein motif:TFAM:TIGR00079"
                     /note="TIGRFAM: peptide deformylase;
                     KEGG: xau:Xaut_3305 peptide deformylase;
                     PFAM: formylmethionine deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="ADH87394.1"
                     /db_xref="InterPro:IPR000181"
                     /translation="MSIRPLVIIPDSRLRLISDPIVRVDARVRAIVEDMFETMYDAPG
                     IGLAAVQVGIPERIITVDVVRREEGEEEGAEEKKNPIALINPEIISSSEEISVYSEGC
                     LSIPEYYADVERPARVKVRYMDLNGETQEIDADGLLATCVQHEIDHLNGVLFIDHISK
                     LKRDRVMKKFTKIAKEKERDGV"
     gene            46760..47677
                     /locus_tag="Snov_0058"
     CDS             46760..47677
                     /locus_tag="Snov_0058"
                     /EC_number="2.1.2.9"
                     /inference="protein motif:TFAM:TIGR00460"
                     /note="TIGRFAM: methionyl-tRNA formyltransferase;
                     KEGG: xau:Xaut_3304 methionyl-tRNA formyltransferase;
                     PFAM: formyl transferase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="ADH87395.1"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /db_xref="InterPro:IPR011034"
                     /translation="MRIVFMGTPDFAVSTLAEIVGSGHEVVAAYTRAPAASGRRGLEL
                     VPSPVHRAAEKLGVPVLTPSTLRTEEAAETFAAHEADVAVVVAYGRILPQMILDAPKL
                     GCLNLHASLLPRWRGAAPIQRAIMAGDAESGVAVMKMEAGLDTGPVGLVERVAIGADM
                     TAGELHDRLMIVGADLMGRALAALERGALNFTPQPEAGVTYAAKIDKGETRIDWSKPA
                     KQVHDHIRGLSPFPGAWFEFDGVRVKVLRSTLVAGAGRPGEVIDDQLTIACADGAVRL
                     TEVQKAGSKAMGAADFLRGNELTRGTVLA"
     gene            47674..48123
                     /locus_tag="Snov_0059"
     CDS             47674..48123
                     /locus_tag="Snov_0059"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: bbr:BB0221 acetyltransferase (GNAT) family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="ADH87396.1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /translation="MTTIRRVEEADHAVWLPLWQGYLTFYEAELPAAVTRTTWQRLLD
                     PAEPVHGALAFDEDGRAVGLAHWLFHRSTWSEGNSCYLNDLFVDPGLRGKGVGRALID
                     HVHADAAAKGSPKVYWLTHETNTTAQRLYNAVAERTGFMQYRKMTGC"
     gene            complement(48256..48891)
                     /locus_tag="Snov_0060"
     CDS             complement(48256..48891)
                     /locus_tag="Snov_0060"
                     /EC_number="1.11.1.7"
                     /inference="protein motif:PRIAM:1.11.1.7"
                     /note="KEGG: xau:Xaut_2363 peroxidase;
                     PFAM: alkyl hydroperoxide reductase/ Thiol specific
                     antioxidant/ Mal allergen; Peroxiredoxin-like"
                     /codon_start=1
                     /transl_table=11
                     /product="Peroxidase"
                     /protein_id="ADH87397.1"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017936"
                     /db_xref="InterPro:IPR019479"
                     /translation="MTIRLGDVVPDFEAETTEGPIRFHEWLGNSWGVLFSHPKNFTPV
                     CTTELGQVARLKPEFDRRNVKVIGLSVDPLDAHAKWSEDIAETQGYAPNFPLIADQDR
                     KVSDLYDMIHPNASDTMTVRSVFIVGPDKKLKLSLTYPASAGRNFDEILRVIDSLQLT
                     ATHAVATPANWKNGDDVIIVPSVSDEAAKEKFPEGWKTLKPYLRVVPQPGK"
     gene            49112..49369
                     /locus_tag="Snov_0061"
     CDS             49112..49369
                     /locus_tag="Snov_0061"
                     /inference="protein motif:PFAM:PF05433"
                     /note="PFAM: 17 kDa surface antigen;
                     KEGG: rlg:Rleg_3913 17 kDa surface antigen"
                     /codon_start=1
                     /transl_table=11
                     /product="17 kDa surface antigen"
                     /protein_id="ADH87398.1"
                     /db_xref="InterPro:IPR008816"
                     /translation="MLRIVAISAVALSLAACTTTQQRTAGGALIGAGTGAVIGGIAGG
                     GTGAAWGAGAGAVAGGVIGAATSPGDCYTYDRYGRRIAVRC"
     sig_peptide     49112..49189
                     /locus_tag="Snov_0061"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.996) with cleavage site probability 0.495 at
                     residue 26"
     gene            complement(49475..50095)
                     /locus_tag="Snov_0062"
     CDS             complement(49475..50095)
                     /locus_tag="Snov_0062"
                     /inference="protein motif:PFAM:PF00717"
                     /note="PFAM: Peptidase S24/S26A/S26B, conserved region;
                     KEGG: nwi:Nwi_0466 peptidase S24"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage repressor"
                     /protein_id="ADH87399.1"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR011056"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019759"
                     /translation="MLTHAQIWRAIDQLAERHGLSASALAKRAGLDPTTFNRSKREQP
                     DGRARWPSTESIAKILAATGASLDDFMALIGGGTRRAIPLIGFAQAGRGGYFDDAGFP
                     VGGAWDEIEFPNVGDEHAYALEIAGDSMLPLYRDGDVVVVSPAAATRRGDRVIVKTRE
                     GEVMAKELKRRTAKTVELRSLNPEHADRVFQEGEIAWIARVLWASQ"
     gene            50227..51660
                     /locus_tag="Snov_0063"
     CDS             50227..51660
                     /locus_tag="Snov_0063"
                     /inference="protein motif:PFAM:PF00282"
                     /note="PFAM: Pyridoxal-dependent decarboxylase;
                     KEGG: smd:Smed_4423 pyridoxal-dependent decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyridoxal-dependent decarboxylase"
                     /protein_id="ADH87400.1"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /translation="MLAKNEEREATRALLASAARHASAFRAADPLRHAPSFTYEEAVV
                     AFDGALSEEGEPAGEVLDDLVRRAGPGLSATTGPRFFGWVIGGSHPVGLAADWLTAAW
                     GQNAANHVAAPAAAAAETVAARWLLDVLRLPEEASVGFVTGATMANFVGLAAARGEVL
                     RRVGWDVEEDGLAGAPPVRVVIGDDAHASVFSALQYLGFGRSNLIRVATDAQGAMRAD
                     AFERALPESGPVIVVTQAGQINTGAFDPHEAIVPLAKARGAWVHVDGAFGLWARACPK
                     KADLAAGVELADSWATDGHKWLQTPYDCGYAIVRDAEAHRRAMTIAASYLPPVSGTER
                     DPSHYVPELSRRARGFATWALLRHLGRAGVAAMVAANCEQARLMAELLRAEPGIAVLN
                     EVVLNQVLLRFGAEADDAAGDALTLATISAIQAEGTCFAGGAKWRGRWAMRISVSNAV
                     TTQEDIRLSAEAIIRCWRSVASSAARG"
     gene            51701..52054
                     /locus_tag="Snov_0064"
     CDS             51701..52054
                     /locus_tag="Snov_0064"
                     /inference="protein motif:PFAM:PF06108"
                     /note="PFAM: protein of unknown function DUF952;
                     KEGG: mrd:Mrad2831_0548 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF952"
                     /protein_id="ADH87401.1"
                     /db_xref="InterPro:IPR009297"
                     /translation="MTDSLIYKIAPRALWQAAEAAGRFEGAPVDVADGFIHFSTSAQV
                     AETAAKHFAGQDDLLLVAVRTERLDPALLRYEPSRGGDLFPHLYGPLDLQAVAWVREL
                     PLGPHGRHLFPAFEG"
     gene            52058..53149
                     /locus_tag="Snov_0065"
     CDS             52058..53149
                     /locus_tag="Snov_0065"
                     /EC_number="1.3.98.1"
                     /inference="protein motif:TFAM:TIGR01036"
                     /note="TIGRFAM: dihydroorotate dehydrogenase;
                     KEGG: rpb:RPB_4622 dihydroorotate dehydrogenase 2;
                     PFAM: dihydroorotate oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="ADH87402.1"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005719"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /translation="MSALFDLALPFARLMDPENAHRLAIRALACLPPRAPEPDDARLK
                     VEAFGLRFPNPVGLAAGFDKEAEVPDAMLGAGFGFVEVGTITPRPQSGNPRPRNFRLT
                     EDRAVINRYGFNSGGHGPAKARLIARKGKSRNSAGIVGVNVGANKETVDRAADYVAGI
                     EAFAGLGDYFTVNVSSPNTPGLRDLQEETALDDLLARCVEARDRHAPGVPLLLKIAPD
                     LALPHLDGVVEVAHRRRVDGLIVSNTTISRPPGLRSPHKGETGGLSGRPLFALSTRML
                     AETYVRADGAFPIIGVGGIDSAETAFAKIEAGASLIQLYSGLVYEGLGLVPRIKAGLL
                     ARLAKEHATLAEITGRRARQVVAEPFPGA"
     gene            complement(53146..54471)
                     /locus_tag="Snov_0066"
     CDS             complement(53146..54471)
                     /locus_tag="Snov_0066"
                     /inference="protein motif:TFAM:TIGR00797"
                     /note="KEGG: rpe:RPE_0723 MATE efflux family protein;
                     TIGRFAM: MATE efflux family protein;
                     PFAM: multi antimicrobial extrusion protein MatE"
                     /codon_start=1
                     /transl_table=11
                     /product="MATE efflux family protein"
                     /protein_id="ADH87403.1"
                     /db_xref="InterPro:IPR002528"
                     /translation="MELALPGRVEVTSRRFLAIALPATLAQMTTPLLGLVATGAIGRL
                     GDAVLLGAVAVGALLFDFVFWIFGSLRMGTAGLTAQALGRGETVELRAVLIRALLISA
                     AIGIALILVHLPLAHVAFLAMGASAGVHEAAALYFSVRILSAPFAIGNFAVLGWLVGI
                     ARTDIGLGLQILIAGVNAAATALLVLYWDFGIAGAAAANVLAEFVGMLFGFGAALRLL
                     GRDWHVPWRTVLDRARLIETVAVNSDIMIRTGLLMLVLVFFTAQGARQDDVTLAANAV
                     LYNMVMVSAFFLDGFATAAEQICGQSIGAQDRPGFRRAVRMVLFWGFGFAAPASLLLL
                     FGGGGLIDLLSANPEVRLVGREFLPLAAATPLLGVAAFAYDGIYSGSTWARDMRNLMV
                     PAVLLFFLAWWLTLPLGNTGLWLAYLSFMAGRGIFLALRLPALERRTFA"
     gene            complement(54477..54746)
                     /locus_tag="Snov_0067"
     CDS             complement(54477..54746)
                     /locus_tag="Snov_0067"
                     /inference="similar to AA sequence:KEGG:Xaut_1466"
                     /note="KEGG: xau:Xaut_1466 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87404.1"
                     /translation="MAENQFSRWMGGSPFWVLLRLIALSVVVGVILSALGLDPMNILS
                     SLERLVRHLFNFGFDTVERLWRYFLLGAAIVIPLWLITRLANRGR"
     gene            complement(54751..56457)
                     /locus_tag="Snov_0068"
     CDS             complement(54751..56457)
                     /locus_tag="Snov_0068"
                     /inference="protein motif:PFAM:PF01068"
                     /note="PFAM: ATP dependent DNA ligase; ATP dependent DNA
                     ligase domain protein;
                     KEGG: azc:AZC_0393 putative ATP dependent DNA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP dependent DNA ligase"
                     /protein_id="ADH87405.1"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /translation="MNRFAALLDRLAYEPRRNGKIRLIADYFAHTPNPERGWALAALT
                     GALSFRNAKPGLIRQLISERTDPVLFALSYDYVGDLSETVALMWPAPHGLNDTEPPAL
                     SAIVHAFTHMGKAELPSVLASLLDRLDETGRWALLKLITGGLRIGVSARLAKTAVAAL
                     GERTPDEIELVWPGLEPPYEALFAWAEGRGERPETDDPAPFRPVMLSHPLEDTDFESL
                     DPAQFRAEWKWDGIRIQAVRGAGADGRHVTRLYSRTGEDISSAFPDLAEALAFDGAVD
                     GELLILREGRVQSFNVLQQRLNRKVVSPKLILEFPAHIRAYDLLFEAGEDLRDLPFEA
                     RRARLEALIAAHPQDGRLDLSPIVPFESWDDLASARADPAAHGAGDDAEAVEGVMLKR
                     VDSFYVPGRPKGPWWKWKRDPHSVDAVLMYAQRGHGKRSSFYSDYTFGVWTGEKSGEG
                     ELVPVGKAYFGFTDAELMEIDRFVRRNTVNRFGPVREVVHTPTEGLVLEVAFEGLARS
                     TRHRSGLAMRFPRIARLRWDKPPGEADRLETLERMIGDEGRAPRQPSAVIGKAPSSAE
                     GA"
     gene            complement(56454..57512)
                     /locus_tag="Snov_0069"
     CDS             complement(56454..57512)
                     /locus_tag="Snov_0069"
                     /inference="similar to AA sequence:KEGG:Xaut_1471"
                     /note="KEGG: xau:Xaut_1471 putative mRNA 3-end processing
                     factor"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mRNA 3-end processing factor"
                     /protein_id="ADH87406.1"
                     /translation="MRPEELLHSTPQGLYSPAGDFFIDPTRPVPRALITHGHSDHARA
                     GHGAVMATRQTLDIMAIRYGEGFAGTTQAAEYGERVEVNGVGVTFHPAGHILGSAQIA
                     LDHKGCTIVASGDYKPGADPTAAPFEPIRCTIFISEATFGLPVFRHPDPAEETAKLTA
                     SLALFPERAHLVGAYALGKAQRVMALLRAAGHEKPILIHGAMERLTDYYQSQGIDLGD
                     IRLAREVKPAELAGSVVICPPSAMTDLWSRRFPDPVTAFASGWMRIRARARQNGVELP
                     LIISDHADWDDLQDAILATGCEELWVTHGQEDALVHWALLAGLRARPLHMVGYGEEEA
                     ETTAAPDTSATESPEAQP"
     gene            57591..58526
                     /locus_tag="Snov_0070"
     CDS             57591..58526
                     /locus_tag="Snov_0070"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: Methyltransferase type 11; Tetratricopeptide
                     TPR_2 repeat protein;
                     KEGG: azc:AZC_0395 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase type 11"
                     /protein_id="ADH87407.1"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR013216"
                     /translation="MSAGRLILSSGDPTVDRRIEWARALMEEGKAADAAELLGEAMER
                     AGAYAPGWFLLGEAREASGDIAGALDAYRQAQALDAGDRLGSGLRLARLGGASDAEAG
                     MSEAYVRTLFDQYAGRFDAALARLDYRGPELIDDALAAACVALGRAYAFARGLDLGCG
                     TGLVALRLAEHVGALEGVDLSPNMIAEAKKRGVYEVLVAGEMVAFLAGRPSEDADLIF
                     AGDAFCYLADLHPILAETRRVLEPGGLIAFTVETHEGEGILLRDTLRYAHAESYVRAA
                     LAAAGLELVSCVAESTRKEKEQPVPGLVVVGMRAD"
     gene            58653..58763
                     /locus_tag="Snov_0071"
     CDS             58653..58763
                     /locus_tag="Snov_0071"
                     /inference="similar to AA sequence:KEGG:OCAR_5169"
                     /note="KEGG: oca:OCAR_5169 metallophosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="ADH87408.1"
                     /translation="MKQKTVMAGLDPAIHVFLPAPGPKAWMPGSSPGMTV"
     gene            58816..61347
                     /locus_tag="Snov_0072"
     CDS             58816..61347
                     /locus_tag="Snov_0072"
                     /inference="protein motif:PFAM:PF08494"
                     /note="KEGG: azc:AZC_0109 helicase;
                     PFAM: DEAD/H associated domain protein; DEAD/DEAH box
                     helicase domain protein; helicase domain protein;
                     SMART: DEAD-like helicase; helicase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/H associated domain protein"
                     /protein_id="ADH87409.1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR013701"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="InterPro:IPR017170"
                     /translation="MDAARDDHLPEPFRSWFAGRGWAPRAHQLELLAKAREGRSTLLI
                     APTGAGKTLAGFLPSLVELSERPRARNSVRPPGIHTLYISPLKALAVDVARNLERPAD
                     EMALPIRIETRTGDTPASRRQRQRRDPPDILLTTPEQIALLLASADAEHLFGDLRRIV
                     LDELHALAGSKRGDLLSLGLARLRCLAPQAQTVGLSATVADPETLRRWLVPQAGDGAM
                     GDVVIAEAGAAPDLSMLDSVAQVPWAGHTARHSLKEIYALIEANTTTLVFVNTRMQAE
                     LLFQELWRINDANLPIALHHGSLDVSQRRRVEAAMGEGRLKAVVCTSSLDLGIDWGAV
                     DLVINVGAPKGSSRLMQRIGRANHRLDEPSRAVLVPANRFEVLECRAALEAVRAGAQD
                     SAVERSGALDVLAQHVLGMACAGPFASDELYAEVTSAEPYAGLLRTDFDDVVAFVATG
                     GYALRAYERFARIRKMKDGRWRVTNPMVAQQYRLNVGTIVEATMLKVRLASAKSRYGG
                     RVLGEVEEYFAEQLSPGDTFVFAGEVLEFLSIVEDEVRATRTSASEPKVPSYEGGKFP
                     LSTFLASRVRALLAEPDRWSSLPGQVHEWLDLQKLRSRLPGRADLLVETFPRGGRHYL
                     VAYPFEGRLAHQTLGMLLTRRLDRARLRPLGFMANDYALAIYGISDMSRAIQQGRLDL
                     DELFDADMLGDDLEDWLAESSLMKRTFRKCAVIAGLIERRFPGKEKNSRQVTMSTDLV
                     YDVLRRHEPGHVLLRAARQDAATGLLDIRRLSDMLTRIRGRIDHVALPRVSPLAVPVM
                     LEIGREMVAGEAHEALLAEAEDELVREAMDGADVSWDGAGGDRRG"
     gene            61340..62026
                     /locus_tag="Snov_0073"
     CDS             61340..62026
                     /locus_tag="Snov_0073"
                     /inference="similar to AA sequence:KEGG:AZC_0115"
                     /note="KEGG: azc:AZC_0115 metallophosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="ADH87410.1"
                     /translation="MAEDGLVIAGARLVLDPAGALWWPAERMLIVADLHLEKGSSFAA
                     RGVPLPPYDTRATLALLTQIVARRNARTIVALGDSFHDRRGADRLGEEERASIAALMR
                     GREMIWVAGNHDPNPMPGLGGVHVDELRAGPLTLRHEPSGDGAGEIAGHFHPVARLVV
                     RGRGLRRRCFATDGARLVMPALGAYAGGLNIRDAALARLFPGAYAAHLVGGARIYRIA
                     HHACLPDRAG"
     gene            complement(62137..65139)
                     /locus_tag="Snov_0074"
     CDS             complement(62137..65139)
                     /locus_tag="Snov_0074"
                     /inference="protein motif:PFAM:PF08238"
                     /note="KEGG: bja:bll1155 hypothetical protein;
                     PFAM: Sel1 domain protein repeat-containing protein;
                     SMART: Sel1 domain protein repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain protein repeat-containing protein"
                     /protein_id="ADH87411.1"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /translation="MSEAAQRAGMPLEEWLKSQLFGTMAAAAPAPGAPDPVGSVADLQ
                     RRIEQLSGQIEQMGGAAAAPAEPPPAPAPVKVDDRLETTIRELNERLEALNLMPPRAE
                     APATRAADPVEMAVAEIAARQHELDSEITRRRTPPAFEPPPRPASSAAPRESVARDSI
                     RDRFIRDPFAGGPFPTRANPVPPSPVPPSHPVAPSIAPSAPSRSPINEALSALQGELG
                     DMRQSLGMLAPRRAVDELQRVVQQLADRVERSGTRDEELRATLLALRDMIGGLKLPEH
                     PALLLGRIDSLERKLDIVNAKAVDGATIARLQAQATEIRDLLARTLSADSVRLLAEQV
                     SLLATKVSEMAANEDRVIRSAVGSLERRLDTLADRIASQPAPVLPLNDLIGRLDSIQS
                     SLASARHEMPPGLEAMLRGLADRMERIERPEENLRLDVLGRQISELTQKIEKAVAGAE
                     IAGQLASIERVVNDLFIQMEETRATFLATGSRPRPPAGGNPNGGATRIKREIAALEAE
                     REAPPAAPVATAIMAPVEAAAPAVPEAVFSPPPASIPKPFEPQLMRAALEELSRSADV
                     AALRGETAPAPEAAAAPEQVATTPIDDEFDFRPVDLDAQAAANAAARGNAPTVPNVVH
                     PAAPAAAPGAPNRAAFIAQARRATLPAGAGTPELRSHITERNRRPPTRWLARIRAMLL
                     IGLCGSALAYGSWHFLAQMREQQLRAAAPAVSNTAKLPPAAKPTPPGSLPAPEDITGS
                     VGKSAPRPQPPAPAAAPEATPDAMPPAPAPIGPSSMSLPTELPGGIASQTLRAAALAG
                     DPAAAFEIARRYTDGEGVPASPARAAEWLAYAAKNGSMPATYRLGTIYEKGMDGVPRD
                     PAKARQLYEQAANAGNVAAMHNLGVMLASGAIGQPDYRTAVTWFTLAAERGVRDSQYN
                     LAVLYARGFGVTANPAEAWRWFALAAARGDGEAALKRDEMAVKVDAKTLATLRSTVDS
                     WAPLMVDAKANDMPSVSWDEVPRKTASR"
     gene            65627..66055
                     /locus_tag="Snov_0075"
     CDS             65627..66055
                     /locus_tag="Snov_0075"
                     /inference="protein motif:PFAM:PF09278"
                     /note="KEGG: azc:AZC_0511 regulatory protein;
                     PFAM: Transcription regulator MerR DNA binding; regulatory
                     protein MerR;
                     SMART: regulatory protein MerR"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MerR family"
                     /protein_id="ADH87412.1"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR015358"
                     /translation="MDFTSFEAERTADTHAAPSGENAFFTIGDLAREFGVTLRALRFY
                     EDKGLLAPRREGLTRLYSPAERSRLAIILKGKKLGFTLAEIKAMVALREGTAPAGGLA
                     LTREKCVEQLALLETQKTEIEEAIGELRQMVAAFSSRSAA"
     gene            66179..66793
                     /locus_tag="Snov_0076"
     CDS             66179..66793
                     /locus_tag="Snov_0076"
                     /inference="protein motif:PFAM:PF01323"
                     /note="PFAM: DSBA oxidoreductase;
                     KEGG: azc:AZC_0543 2-hydroxychromene-2-carboxylate
                     isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="ADH87413.1"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014440"
                     /translation="MSRSIDYYFSIASPWAFIGHSPFLDVAKRHGARINFRPVFLGEL
                     FADTGGLPLARRHPARQRYRLVELKRWREARGLDFHLSPAHWPLDPAAADRLVIAAQI
                     AGHDVAPLVSRLTSGVWQRQENMADPAALGVVLAELGLPAELLEASAGDRTAVIYKAN
                     HDAAVEADVFGSPAYVLDGEVFWGQDRIDMLERALSSGRAPFTP"
     gene            66822..67376
                     /locus_tag="Snov_0077"
     CDS             66822..67376
                     /locus_tag="Snov_0077"
                     /inference="similar to AA sequence:KEGG:Nham_0271"
                     /note="KEGG: nha:Nham_0271 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87414.1"
                     /translation="MRLTLIGAGLALAMLHPAQAQAPNIPPNGPPEAARFTMQPVEGG
                     LMKLDTSTGAMSFCSAKAGAWVCEAVPEDRAALEAEIARLQARIAVLEKSRAGTGTGG
                     TGTGVPDIMAPPSAEAPKDTPKDEPLGPPDAAKPAPKSEQELSEEARKRLDQAMDMVE
                     QVFRRFFDMVDQLRREEGAQDQKL"
     sig_peptide     66822..66884
                     /locus_tag="Snov_0077"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 21"
     gene            complement(67381..68373)
                     /locus_tag="Snov_0078"
     CDS             complement(67381..68373)
                     /locus_tag="Snov_0078"
                     /inference="protein motif:PFAM:PF07859"
                     /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
                     KEGG: xau:Xaut_1452 alpha/beta hydrolase domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Alpha/beta hydrolase fold-3 domain protein"
                     /protein_id="ADH87415.1"
                     /db_xref="InterPro:IPR013094"
                     /translation="MSSPLPETRASSAAPLVVDPALFEEAAITPETRAINAGIVKALG
                     AVPDRWVFPMAMLRKLRLEGKGPFPLAPESSYAQVIEIDGPHGPVPLRILTPPTPPKG
                     VYLHIHGGGWCLGSARENDGLNHRFVERTGFAVVSVEYRLAPEEPWPRGPDDCEAAAL
                     WLMHEGPARFGTDRFAIGGESAGANLSVAVLLRLRDKHGLTPFRAANLTAGAYDLGLT
                     PSARQWGDEPLVLNTRDINVFVGHYLREGGDIALPDISPLQANLKDLPPALFTIGTRD
                     ALLDDTLFMAPRWLKAGNAAELAIYPGGCHVFIGFPGSLADQALARSHAFVSAC"
     gene            68490..68954
                     /locus_tag="Snov_0079"
     CDS             68490..68954
                     /locus_tag="Snov_0079"
                     /inference="protein motif:PFAM:PF01894"
                     /note="PFAM: protein of unknown function UPF0047;
                     KEGG: rpb:RPB_4567 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0047"
                     /protein_id="ADH87416.1"
                     /db_xref="InterPro:IPR001602"
                     /translation="MARISRGELRESTVTRRFTAMLAVDTPGRGFTDITGAVADFLIA
                     AGASEGEVSVFCRHTSASLAIQENADPDVRVDLLTALDRLAPEDAGWAHDMEGPDDMP
                     AHVKAMLSGISLSVPVIGGRMALGTWQGLYLIEHRARPHQRELVVAFVGEAY"
     gene            69087..69755
                     /locus_tag="Snov_0080"
     CDS             69087..69755
                     /locus_tag="Snov_0080"
                     /inference="protein motif:PFAM:PF00196"
                     /note="KEGG: azc:AZC_0572 regulatory protein;
                     PFAM: regulatory protein LuxR; response regulator
                     receiver;
                     SMART: regulatory protein LuxR; response regulator
                     receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, LuxR
                     family"
                     /protein_id="ADH87417.1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /translation="MDTTTSFRLVIADDHPLFRGALREAVSRQFPQAELFEAGGFEDL
                     QALLEREGDLDLILLDLTMPGVRGFSGLMYLRAQYPGIPVVVVSANEEAGVIRNCMEF
                     GASGFIPKTSAVETMREAVAAVLEGQTWTPPEVDLSGTSDKETQALVARLATLTPQQV
                     RVLMMLSEGLLNKQIAYELGVSEATVKAHVSAILQKLGVESRTQAVIAASKIEGGTWS
                     QTAG"
     gene            complement(69762..73334)
                     /locus_tag="Snov_0081"
     CDS             complement(69762..73334)
                     /locus_tag="Snov_0081"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: azc:AZC_3923 response regulator receiver;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein; PAS fold-4 domain protein;
                     response regulator receiver;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein; response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor hybrid histidine kinase"
                     /protein_id="ADH87418.1"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR013656"
                     /translation="MLQAWTIIAVALVYIGFLFAVASFGDRRLPRSRRRGRPYIYSLS
                     LAVYCTSWTFFGSVGLATTQGVNFLTIYIGPIFVFALGTPFLLRMVRLAKGQNITSIA
                     DFVAARYGKSQGVAALVACVAIVGSLPYIALQLKAVSASLLAMLGDFDGLGLPYPVVG
                     DLALTIAVAMAVFAVLFGTRHIDATEHQEGLMLAVATESIVKLVSFLAVGLFVVFGMF
                     SGPFDLLDQAAEKGVLPVLTQGISVGSWAAMTLLSALAILLLPRQFHVAVVENTSEQE
                     IRTASWLFPLYLVLINLFVIPIAIAGLVAFPPGFIDGDMYVVTLPLSAGSHVMSLVAF
                     VGGLSAATAMVIVETVALAVMVSNDIFMPLMVRGRRLRDAAEANRAAADGPPDTGADG
                     QTDGHADMGRRLLTVRRIAIFAILLLAYLYYRVTGEAQLAQIGLLSFAAVAQFGPALL
                     LGLVWRRGTALGALAGIAAGIALWAYTLLLPSLVDAGLFTHALLQEGPFGLSMLRPQT
                     LLGVQASPLVHGVLWSLTINVLVFLAVSLMRKPTPIERLQASVFVESDHAPSAPSFRL
                     WRSPVTVGELVSTVARYLGEERTRASFESISAMRGISLEPSREADFQLIRYAEHLLAS
                     AIGAASSRLVLSLMLRKRTVSTKAALKLLDDASAAIQYNREILQTALDHVRQGIAVFD
                     RDLRLITWNRQFGEMLELPPEILRIGVSIDQIIRFNATGGQFGPGPVEEIVREKLDRY
                     ARRNVVFQERLTPRGVVMEVRVNTMPDGGVVVTFTDITPSVEAAEALERANETLERRV
                     RERTKALEKLNTQLAQAKSEAEEANISKTRFLAAASHDILQPLNAARLYATSLVERSV
                     AGEETRLARNVDASLEAVEEILAALLDISRLDAGALKPDIAPFRLDEIFQQLELEFAP
                     MAKEKGLELTFVPSAAAVRSDRRLLRRLLQNLVSNAIKYTHKGRVLIGVRPRRGKLRV
                     QVLDTGVGVPPGKQKLIFKEFQRLDEGAKAARGLGLGLSIVERIARVLDHPISLSSTS
                     GKGSVFTVELPAAPAMPARGQPSPRPAAPVATLQGLSVLCIDNDPAILDGMETLLTGW
                     GCEVLKAPGLTEALAMLREHRAPPDVLLIDYHLDKGDGIDAAKQLRWKLGHSLPAVLI
                     TADRSKRVRDTARATEMEVLNKPVRPAALRALLAACRATRAAAE"
     gene            73483..73911
                     /locus_tag="Snov_0082"
     CDS             73483..73911
                     /locus_tag="Snov_0082"
                     /inference="protein motif:TFAM:TIGR00220"
                     /note="KEGG: xau:Xaut_0055 large conductance
                     mechanosensitive channel protein;
                     TIGRFAM: large conductance mechanosensitive channel
                     protein;
                     PFAM: large-conductance mechanosensitive channel"
                     /codon_start=1
                     /transl_table=11
                     /product="large conductance mechanosensitive channel
                     protein"
                     /protein_id="ADH87419.1"
                     /db_xref="InterPro:IPR001185"
                     /db_xref="InterPro:IPR019823"
                     /translation="MSKVLTEFREFAVKGNVVDLAIGVIIGAAFGQIVTSVVSDLFMP
                     VVGAIFGGLDFSNYFVGLSSQVTANNLTAAREQGAVFAYGHFLTVVINFLIVAWILFL
                     VVKGINRLRRNAANEPPPPAPPTKEEVLLTEIRDLLAKKV"
     gene            74140..74721
                     /locus_tag="Snov_0083"
     CDS             74140..74721
                     /locus_tag="Snov_0083"
                     /EC_number="5.1.3.13"
                     /inference="protein motif:TFAM:TIGR01221"
                     /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase;
                     KEGG: xau:Xaut_3548 dTDP-4-dehydrorhamnose 3,5-epimerase;
                     PFAM: dTDP-4-dehydrorhamnose 35-epimerase related"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="ADH87420.1"
                     /db_xref="InterPro:IPR000888"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /translation="MVAFTRLAIPDVVLVQPVRHGDGRGYFCETYKKPAFDAFGIDLA
                     FVQDNESLSRPVGVVRGLHFQTPPMAQAKLVRVLRGAIFDVAVDIRRGSPSYGKWVAA
                     TLTAEEGNQLFMPHGFAHGFCTLEPDTLIAYKVDAPYSRPNDAGIAWDDPDLAIDWPV
                     TTETAVLSDKDRVQPRLRDYASPFAYAPETVRA"
     gene            74724..75788
                     /locus_tag="Snov_0084"
     CDS             74724..75788
                     /locus_tag="Snov_0084"
                     /inference="protein motif:TFAM:TIGR01181"
                     /note="KEGG: azc:AZC_1833 dTDP-D-glucose-4,6-dehydratase;
                     TIGRFAM: dTDP-glucose 4,6-dehydratase;
                     PFAM: NAD-dependent epimerase/dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="ADH87421.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005888"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTSIAQRVLVTGGAGFIGSAVVRRLVRQGRQVLTYDKLTYAGNL
                     ASLAEVHNLPGHSFLQADICDGRAFREALESFRPDLVMHLAAESHVDRSIDGPGDFIA
                     TNIVGTYTLLDEALRYWRGLDAAAQKRFRFHHISTDEVFGTLGEDGLFREDTPYQPNS
                     PYSASKAASDHLVRAWFHTYGLPVVMSNCSNNYGPYHFPEKLIPLTILNALEGAPLPV
                     YGKGENVRDWLYVEDHAAALELIATRGRLGESYNVGGSNERRNIDVVRTICAIMDRVV
                     PDAKIGPRDALIRFVTDRPGHDARYAIDASKLKTELGWVPEHDFESGIEKTVRWYLDN
                     AAWWEPLKARYNRARLGVAK"
     gene            75785..76678
                     /locus_tag="Snov_0085"
     CDS             75785..76678
                     /locus_tag="Snov_0085"
                     /EC_number="1.1.1.133"
                     /inference="protein motif:TFAM:TIGR01214"
                     /note="TIGRFAM: dTDP-4-dehydrorhamnose reductase;
                     KEGG: azc:AZC_1832 dTDP-4-dehydrorhamnose reductase;
                     PFAM: dTDP-4-dehydrorhamnose reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="ADH87422.1"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTRVLLLGAGGQVGREIAALAPGRVESLTALDHAGLDITDASAL
                     KAALEQYRPQVVINAAAYTAVDKAESEPEKANLINAVAPGLIAQACASHGAGLIHIST
                     DYVFDGTKAGAYVESDPVAPLGVYGASKEAGERAVRDSLDRHLIVRTSWVYGVHGANF
                     LKTMLRLAETRDRLTVVADQTGCPTATRDIAEGLLTAAMQLATADVTPGTYHLAGTGV
                     TTWHGFASVIVAHAARHTGRHVEVAPITTADYPTPARRPANSELSSALFARTVGYEAA
                     PWQLRAAEVVDALFAAKQEAP"
     gene            76675..77547
                     /locus_tag="Snov_0086"
     CDS             76675..77547
                     /locus_tag="Snov_0086"
                     /inference="protein motif:TFAM:TIGR01207"
                     /note="KEGG: azc:AZC_1831 glucose-1-phosphate
                     thymidylyltransferase;
                     TIGRFAM: glucose-1-phosphate thymidylyltransferase;
                     PFAM: Nucleotidyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="ADH87423.1"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR005907"
                     /translation="MKGIILAGGSGTRLHPITLVVSKQLLPVYDKPMIYYPLTTLMMA
                     GIREILIITTPHDSALFRKLLGDGSQFGLSLSYAVQESPRGLADAFIVGRDFVGDERV
                     ALVLGDNLFFGHGLPELLGAAVARETGATVFGYPVKDPERYGVVEMTAAGRVTSIEEK
                     PAKPKSNLAVTGLYFYDNRVVDIAANLKPSPRGEIEITDVNRAYMEWGELNVSLMGRG
                     FAWLDTGTPDSLLEAAQFVQILETRQGLRIAAPEEVAFRAGFIDAAQLTKLGEAQSKS
                     NYGAYLMKLAEDGF"
     gene            77672..78880
                     /locus_tag="Snov_0087"
     CDS             77672..78880
                     /locus_tag="Snov_0087"
                     /inference="protein motif:PFAM:PF00155"
                     /note="PFAM: aminotransferase class I and II;
                     KEGG: xau:Xaut_0300 aspartate aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class I and II"
                     /protein_id="ADH87424.1"
                     /db_xref="InterPro:IPR001176"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /translation="MPASLAPSFTPSPLVDHVRPQALALPESGIVEVFNYGRTREGLI
                     PLWAGEGDLPTPSFIAEAATRSLAAGETFYTWQRGIPDLRAAIASYMTRLYGVAEDPE
                     RYFVTGSGMHAVQVALALTVSAGEEVIIPSPEWPNIAAAAEAAGARPVYVPFSFDAGR
                     GFRLDLDRLESAVTPRTRAIFINTPANPTGYVASLDELRGVLDIARRHGLWIIADEIY
                     GRFYYAAGEGGLAPSFHSIMEPEERILFVQTFSKNWAMTGWRVGWLEAHPSLGDVIEN
                     LIQYSNSGVAAFMQRAGVAALERGESFVAHQIERAKRGRDIVAEGLASSNRVRFAQPE
                     GAFYMFFGVEGEDDTRQLALKLVDEANIGLAPGTAFGPGGEEYIRLCFARGEAQVAEA
                     TDRLVRWLKR"
     gene            78943..80094
                     /locus_tag="Snov_0088"
     CDS             78943..80094
                     /locus_tag="Snov_0088"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region ATPase domain protein; PAS fold
                     domain protein; histidine kinase A domain protein;
                     KEGG: mea:Mex_1p1833 PAS/PAC sensor signal transduction
                     histidine kinase (fragment);
                     SMART: ATP-binding region ATPase domain protein; PAS
                     domain containing protein; histidine kinase A domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="ADH87425.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR013767"
                     /translation="MREFSSPPGPLPPPTVSEARLLSVLDTAADGIIVIDEHARILIF
                     NKACEKMFGIAAAEAIGQNVRIVMPIEYAREHDEYLGSYIRTGVKKIIGIGREVRGRH
                     IDGTIFPLELSVGEAATPDGRQFIGILRDLRPRKESEQRLADLQSELVHLARVSAIDE
                     MGAAIAHELNQPLTALMLYLQAIRRAHAKGVDIVKVVGEILDKAAGEAERAGHIIQRM
                     RQFVEKREPERHVRELDPLIDEAIDLTLLGQRHRIRIDRKQGTNLPPVSVDPVQVQQI
                     VVNLVRNAIEAAAGMTDPAIHIRTRSADGTVVLEVQDNGPGIAPEALSKLFEAFASSK
                     RRGMGLGLAISRTIAQNHGGDLLVDPGGNGRGACFSLVLPAAAAPAEVG"
     gene            80106..80723
                     /locus_tag="Snov_0089"
     CDS             80106..80723
                     /locus_tag="Snov_0089"
                     /inference="protein motif:PFAM:PF00072"
                     /note="KEGG: bbt:BBta_0530 two component LuxR family
                     transcriptional regulator;
                     PFAM: response regulator receiver; regulatory protein
                     LuxR;
                     SMART: response regulator receiver; regulatory protein
                     LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, LuxR
                     family"
                     /protein_id="ADH87426.1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /translation="MAQLGEVFIVDDDSAVRDALSLVLSLEGYHVRSFSDGAAFLSVA
                     RTHVPACIVLDVHMPGRSGLDILKELEADRYPAPIFIISGQGDIPMAVDAIRHGALDF
                     IEKPFDADTVVERVRDAIEAHSRRGSSEPGDLLTAHFPGHEMLTPREREVLVQIASGA
                     SNKEAGRKLGISPRTIEVHRARIMEKLGAKNAADLVRIVLKDMRA"
     gene            80824..81171
                     /locus_tag="Snov_0090"
     CDS             80824..81171
                     /locus_tag="Snov_0090"
                     /inference="protein motif:PFAM:PF00072"
                     /note="KEGG: met:M446_6109 two component LuxR family
                     transcriptional regulator;
                     PFAM: response regulator receiver;
                     SMART: response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="ADH87427.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /translation="MRVHVVEDDAGVSDSLSLILGNVGHKVIAYPDAESLFKAPPPEG
                     RDAVIVDLSLPGIPGAQLVRWLLNLATPPRVMVITGQSQSFIDHQLRGLKPTWLVRKP
                     LDADTITRVLPAE"
     gene            81267..81908
                     /locus_tag="Snov_0091"
     CDS             81267..81908
                     /locus_tag="Snov_0091"
                     /inference="protein motif:PFAM:PF00325"
                     /note="KEGG: oan:Oant_2634 CRP/FNR family transcriptional
                     regulator;
                     PFAM: regulatory protein Crp; cyclic nucleotide-binding;
                     SMART: regulatory protein Crp; cyclic nucleotide-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, Crp/Fnr family"
                     /protein_id="ADH87428.1"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001808"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012318"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018335"
                     /db_xref="InterPro:IPR018490"
                     /translation="MRQIVEERTGSPTRQPSYAEPHHPGLRVATHVTVLHEGDPARRI
                     MEVVEGAVMLTKLLPDGRRQVVELLGPGDVFGLAHDDAYACSAETLTPATIATHERSA
                     LERDPVLASRLLRRFEAQLCVMHSHALVLGRMSALERVAFFLLRLMPEGMVGGTLHLS
                     MTRQEIADFLGLTLETVSRAFSELKRRGFVALQRADEVRIQDRGSMRRLAGAL"
     gene            complement(82017..83336)
                     /locus_tag="Snov_0092"
     CDS             complement(82017..83336)
                     /locus_tag="Snov_0092"
                     /EC_number="1.3.99.22"
                     /inference="protein motif:TFAM:TIGR00538"
                     /note="SMART: Elongator protein 3/MiaB/NifB;
                     TIGRFAM: oxygen-independent coproporphyrinogen III
                     oxidase;
                     KEGG: mno:Mnod_2110 oxygen-independent coproporphyrinogen
                     III oxidase;
                     PFAM: HemN domain protein; Radical SAM domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /protein_id="ADH87429.1"
                     /db_xref="InterPro:IPR004558"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /translation="MHSSTLLHAERAVPRYTSYPTAPHFTGDVGPQNHAAWLSTLDTG
                     ANLSLYLHVPFCPALCFYCGCTTKATRRPEPVAAYVARLEREIEFVAAHAGGRTVTHI
                     AWGGGTPSLVGGKALRRLYDRISEAFDLDRLTEHAFELDPREVDEEIADALAAIGVDR
                     VSLGVQDFSAHVQRAIGRVQPFGTVERAVRLLREAGVSSVNLDLMYGLPHQSERDVRR
                     TARLATLLGPERLALFGYAHVPWMRPNQKMIDEKDLPGAAERLQQAEAAREVLLANGY
                     AAVGLDHFARPNDPLARAAAAGHLHRNFQGYTVDAADALIGLGASSISRFPQGFTQNA
                     PDAASYMRAVDAGRFATARGIAFTPEDVARGAYIERLMCDLQVDLDTPTFDEAAPRLA
                     SLAADGLVTIEGHHVAMTATGRPFVRLAAAALDARLQQTTARHSAAV"
     gene            83438..84550
                     /locus_tag="Snov_0093"
     CDS             83438..84550
                     /locus_tag="Snov_0093"
                     /inference="protein motif:TFAM:TIGR03082"
                     /note="KEGG: xau:Xaut_0301 putative ammonia monooxygenase;
                     TIGRFAM: membrane protein AbrB duplication;
                     PFAM: putative ammonia monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein AbrB duplication"
                     /protein_id="ADH87430.1"
                     /db_xref="InterPro:IPR007820"
                     /db_xref="InterPro:IPR017516"
                     /translation="MLLPPFLTRLTPTRRLVWLAATLVIAFAGGGFFAWLAMPAGWLS
                     GALVATGIAALAGAPVGVERNIRLATYILLGTSMGSAVTPDTLHGITTWPVTMLVLIV
                     SVPVMMVAVVFYLERIAGWDRRSAFFAAAPGALSTVLVMAETSGADTRRVVFGQSIRL
                     FILVTLLPPTLGGFGHEPAGTLPINPVVPDLATALLSIGVGIAGAFIAERIRFPGGAM
                     VGAMLASALVHGFGLIEGRLPDIFLIIGFVVLGANTGSRFAGTKIRTLRHFLVDSMVA
                     LAIATLVALAFAFLGSWLAGEPFTKVLLAYVPGALEAMTIMAFVLGLDPAFVAAHHLT
                     RFLGLALAIPLVTRMFFGRAAIPSENVEIDQTEPKD"
     sig_peptide     83438..83548
                     /locus_tag="Snov_0093"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.935) with cleavage site probability 0.417 at
                     residue 37"
     gene            complement(84554..85780)
                     /locus_tag="Snov_0094"
     CDS             complement(84554..85780)
                     /locus_tag="Snov_0094"
                     /EC_number="2.3.1.37"
                     /inference="protein motif:TFAM:TIGR01821"
                     /note="TIGRFAM: 5-aminolevulinic acid synthase;
                     KEGG: xau:Xaut_2126 5-aminolevulinate synthase;
                     PFAM: aminotransferase class I and II"
                     /codon_start=1
                     /transl_table=11
                     /product="5-aminolevulinic acid synthase"
                     /protein_id="ADH87431.1"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR010961"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /translation="MDYARFFQNAVDTLKQERRYRTFAEIERDSARFPHAVWHSPQGA
                     RDIVIWCSNDYLGMGCHETVVEAMCATARQAGAGAGGTRNISGNSHAIVELEAELADL
                     HGKDAALVFTSGYVSNQTGISTLAKLIPDCLVLSDALNHNSMIEGVRQAGRDKQIFRH
                     NDLAHLEELLKAAGDRPKLVVFESVYSMDGDVAPIGAICDLAERYNAMTYLDEVHAVG
                     MYGPRGAGVAERDGVMHRVDVIEGTLGKAFGVVGGYITASRAIVDAVRSYAPGFIFTT
                     ALPPAVAAAAAASVRHLKASGTERTRQQAQVAKVKRALDLAGLPQIVTDTHIVPVMVG
                     DAEACKAASDMLLADHGIYIQPINYPTVPRGSERLRITPGPFHDDALVAQLAHALVDV
                     WSRLGLPFVTRAEAAE"
     gene            complement(85930..86433)
                     /locus_tag="Snov_0095"
     CDS             complement(85930..86433)
                     /locus_tag="Snov_0095"
                     /inference="similar to AA sequence:KEGG:NGR_b03860"
                     /note="KEGG: rhi:NGR_b03860 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87432.1"
                     /translation="MHRGHDHHHHDHGAGGHSHSHSHSHAHHAAPNHGHSPRPAAQWQ
                     TPHLPEPPEDSDHAHVETDIDLVEKAFVEGFAGASDPTSFLRLANVPFDAITTDGTRV
                     SLLRVETDEVTDVGAVMPHLGGGSFRYDPLPAQMVSRRKRLRFVYFDGRQTLPLTLAE
                     VRTLAQT"
     gene            complement(86575..87795)
                     /locus_tag="Snov_0096"
     CDS             complement(86575..87795)
                     /locus_tag="Snov_0096"
                     /inference="protein motif:PFAM:PF00491"
                     /note="PFAM: Arginase/agmatinase/formiminoglutamase;
                     KEGG: rhi:NGR_b03870 putative SpeB,
                     arginase/agmatinase/formimionoglutamate hydrolase,
                     arginase family"
                     /codon_start=1
                     /transl_table=11
                     /product="Arginase/agmatinase/formiminoglutamase"
                     /protein_id="ADH87433.1"
                     /db_xref="InterPro:IPR005924"
                     /db_xref="InterPro:IPR006035"
                     /translation="MRHFPEPTAPQRSTRVAGLRPAPSRLRRHHPNFEIREMQGWRSL
                     EAEEKLSENGWRKEQQWALDMGLPGADSITDKSIPTFARGELPHFAGINTFLKAPYVE
                     NVRDVGKYDAAVLGIPFDSGTTYRPGTRFGPQGIRRISALYTPYNYELGIDLREQMTL
                     CDAGDVFTIPANLEKSFDQISKGVSHVFSSGALPIMLGGDHSIGFPCVRGIAECTSKR
                     IGIIHFDRHIDIQEKDLDERMHTTPWYWATNLPNVSPKNLVQLGIGGWQVPRYGVQEA
                     RKRGTNVLTIDDIEKIGLEKTAEIALELAWKDADAVYISFDVDSIDCGFVPGTGWPEP
                     GGFLPREALKILGLVAAEGLCGLEVVEVSPPYDTSDITALFGLRVVVEALGSMVAHGK
                     LGSHRHMIDKPVSF"
     gene            complement(88095..88718)
                     /locus_tag="Snov_0097"
     CDS             complement(88095..88718)
                     /locus_tag="Snov_0097"
                     /inference="protein motif:PFAM:PF04955"
                     /note="PFAM: HupE/UreJ protein;
                     KEGG: msl:Msil_3747 HupE/UreJ protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HupE/UreJ protein"
                     /protein_id="ADH87434.1"
                     /db_xref="InterPro:IPR007038"
                     /translation="MSNFVPSGVRRHATRGALAALLALSPSLAFAHPGHGGAVGFSHG
                     FLHPIGGLDHVLAMVAVGIFAANLGGRALWAVPATFVALMATGGALGMYGVAVPFVEI
                     SIAASVIVLGSAVALGWKNWPLGAAMALVGFFAVFHGHAHGAEMPADASALTYAAGFM
                     LATALLHVAGIGAGIAIGKAGANAPRLTQALGAVVAVAGVGLLTGVI"
     sig_peptide     complement(88623..88718)
                     /locus_tag="Snov_0097"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 32"
     gene            complement(88875..89540)
                     /locus_tag="Snov_0098"
     CDS             complement(88875..89540)
                     /locus_tag="Snov_0098"
                     /EC_number="2.4.2.9"
                     /inference="protein motif:TFAM:TIGR01091"
                     /note="TIGRFAM: uracil phosphoribosyltransferase;
                     KEGG: hna:Hneap_0843 uracil phosphoribosyltransferase;
                     PFAM: phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="ADH87435.1"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005765"
                     /translation="MNAPTVLTDVALPPTTIVVDHPLIQHKLTLMRRSRTPANEFRLL
                     LREISMLLAYEVTRDMPTELIEIETPLATMQAPILSGKKLCLVSVLRAGGGILEGMLE
                     ILPAARVGHVGLYRDPVSLQAVEYYLKLPRDISERTAIVLDPMLATGNSAVAAVSEVK
                     AAGCQSIKFVCLIAAPEGLKVMHEAHPDVTVYAAAVDSHLNDHGYIVPGIGDAGDRIF
                     GTK"
     gene            89756..91024
                     /locus_tag="Snov_0099"
     CDS             89756..91024
                     /locus_tag="Snov_0099"
                     /inference="protein motif:PFAM:PF00925"
                     /note="PFAM: GTP cyclohydrolase II;
                     KEGG: reh:H16_B1597 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="ADH87436.1"
                     /db_xref="InterPro:IPR000926"
                     /translation="MSVNANAGGRSRNHIVLTSHGAPTGVAADAPSLNWGAPTPAERG
                     PVVATLTDPKRRNAIGAHAGGYSVYRALAIAAGALPADFRADLTNTAPSDAIGPHPQW
                     GDPKAIVSLDPYGHMVGEAFAGEIAAGLDVRPTIAITRAHIDMPEIRDAIRAGRLAID
                     GDIIGPKGDVRVTKAAIEPVWYLPGIAERFGVSEGALRRALFEHTGGMFPELVTRGDL
                     KVFLPPIGGMTLYMFGDPSKIGDGITPLACRVHDECNGSDVFSSDICTCRPYLAHGIE
                     ICVEMAQKGGVGLVVYNRKEGRALGEVTKFLVYNARKRQEGGDLPETYFKRTECVAGV
                     QDMRFQELMPDVFHWLGIKRIDRFASMSDMKFNALARAGIEVVERVPIPDELIPSDAR
                     VEMEAKVSAGYYGVGFQSQFDATQGRALEE"
     gene            91184..92413
                     /locus_tag="Snov_0100"
     CDS             91184..92413
                     /locus_tag="Snov_0100"
                     /inference="protein motif:PFAM:PF07958"
                     /note="PFAM: protein of unknown function DUF1688;
                     KEGG: bja:blr7238 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1688"
                     /protein_id="ADH87437.1"
                     /db_xref="InterPro:IPR012469"
                     /translation="MTPPELVALRSPAAVRARCHQVLDYVRVGHSPHFTVDEAALDGV
                     ADYVAQVTRQAYPTLDIPYHSRWRHFDAGGVDRWAALEGRLEGADKAERARVMIDLAV
                     VSVLLDAGAGDAWRYREEATGLTVTRSEGLAVASLRMFEVGGFSSDPKVPLRADAKAL
                     IGLDAATLAKQFQVSDDNPLVGVSGRVALINRLGNALAARPDLFGTEVPRPGGLYDAL
                     LPKAKIGRLPAPAILGALLDGLSSIWPSGLDVEGVALGDVGRHPAVRVADLSDQLVPF
                     HKLSQWLTYSLLEPFEAAGLAVTELDELTALPEYRNGGLLVDLEVIVPRQPIDPAQKH
                     PVSSELVVEWRALTVALMDLLAGRVRERLGLDASQFPLAKLLQGGTWSAGRRIAAERR
                     PPAGPPPIAIDADGTVF"
     gene            complement(92417..93379)
                     /locus_tag="Snov_0101"
     CDS             complement(92417..93379)
                     /locus_tag="Snov_0101"
                     /inference="protein motif:PFAM:PF03401"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: ret:RHE_CH03508 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87438.1"
                     /db_xref="InterPro:IPR005064"
                     /translation="MHRVLFAAAAAVLLSLSSAGAQDFPNRPVTLDIPFPAGGSTDLV
                     GRLIGEGMSADLGQPVIIENRGGGGGSLGTAHLAKQPPDGYAVMMGTVSTHALNPALY
                     RNLPFDPVKSFAPVSLLVIVPNALVVHPSFPANTVEEFIALLKANPGKYSYASAGNGT
                     PGHLSGELFKTMAGVDMQHIPYQGAGPALVDVISGQVPIMFDNLPTASGYIKSGKLKT
                     LGVTTLKRAPSFPDLPAVAETLPGYETYSWNALFAPAGTPPAIVAKLNQAANKALATP
                     KVQARLADFSAVSVGSTPQELEAHVKAELAKWAPIVKASGAQLD"
     sig_peptide     complement(93314..93379)
                     /locus_tag="Snov_0101"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.974 at
                     residue 22"
     gene            complement(93631..94593)
                     /locus_tag="Snov_0102"
     CDS             complement(93631..94593)
                     /locus_tag="Snov_0102"
                     /inference="protein motif:PFAM:PF03401"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: ret:RHE_CH03508 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87439.1"
                     /db_xref="InterPro:IPR005064"
                     /translation="MLRSLFAAAVTAVLAAGGAAAQDFPTRPITMVIPFPAGGSTDLV
                     GRLIAERMTAELGQPVVVENKGGAGGNLGAAQVAKASPDGYTILMGTVATHALNPALY
                     KKMPYDPVKSFAPVSLLAIVPNVLVVNPEFPAKTTEELIALLKANPGKYSYASSGNGT
                     PLHLSGELFKSLAGVDMQHIPYQGAGPALIDVISGQVPIMFDNLPSSSGHIKSGKLRA
                     LGVTTAKRAPSFPDLPAIAEVVPGYETYTWNALFAPAGTPPEVVAKLNAAANKALTDP
                     KVQARFNDFSATPVGSTPEELGEHVKKEIAKWAPIVKATGAQLD"
     sig_peptide     complement(94528..94593)
                     /locus_tag="Snov_0102"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 22"
     gene            94956..96062
                     /locus_tag="Snov_0103"
     CDS             94956..96062
                     /locus_tag="Snov_0103"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: mlo:mll8445 ABC-transporter ATP-binding
                     protein;
                     PFAM: ABC transporter related; Transport-associated OB
                     domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87440.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008995"
                     /db_xref="InterPro:IPR013611"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSKGADIELIQVTKRYGTALAVDAVSLKVPAGTYCCLLGPSGCG
                     KTTTLRMIAGHESITEGDIRLGASVVSDLPPAKRGTAMMFQSYALFPHLDIVDNVAFS
                     LKMKGVDKATRRAKALEMLKLVQMDHLAERRPAQLSGGQQQRVALARALITDPQALLL
                     DEPLSALDPFLKVKVRQELKKLQLQLGISFIHVTHSQEEAMALSDLVVVMNGGRIEQA
                     ATPREVFNRPATAFVARFMGDHNVIAGRVTEAGSETVTFEVPGGASFKAPRTSQFAPG
                     LEPGAPVEIAVRTDRVKLGAGLEPGCGLTGLVQNIEYHGQKVQVALAAPGIDEFSVQV
                     PETAFFAAPLSVGDAVPLTWTPQDVHILEASPSA"
     gene            96119..97426
                     /locus_tag="Snov_0104"
     CDS             96119..97426
                     /locus_tag="Snov_0104"
                     /inference="similar to AA sequence:KEGG:NGR_b12830"
                     /note="KEGG: rhi:NGR_b12830 ABC transporter, binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, binding protein"
                     /protein_id="ADH87441.1"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /translation="MSKNTSDRIGASGAKGISRRNVLKGAAAFSGVAAGSGAITGFPT
                     IWAQNPITLRQFGTGVSNLNAIAEKCKADLGITLQMTALDSDAVSQRVVTQANSFDIA
                     DIEYWICKKVFAAGTLQPMDVKKIKYYDQIVPIFTTGKLTPESKIAQGTAPSTVGFVE
                     GPDSKKFAKEPTQWMTLIPTIYNADTLGIRPDLVGRPIKNWKDILDPAFKGKTSILNI
                     PSIGIMDAAMICESAGLIKYADKGNMTKKEIDFTIDFLIKTKKAGQFRAFWKTFDESV
                     NLMASGEVVIQSMWSPAVAAVRSKGIPCVYQPLEEGYRAWGGGLGMAKHLKGAQLDAA
                     YEYINWYLSGWVGAYLNRQGYYSAVLSTAEKNMTPDEWAFWMLGQPAKADILSPEGKV
                     MYTAGAVRDGGSFEQRMGAVACWNSVMDEDRYMVRRWNEFIAA"
     gene            97580..98431
                     /locus_tag="Snov_0105"
     CDS             97580..98431
                     /locus_tag="Snov_0105"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: avi:Avi_6277 ABC transporter membrane spanning
                     protein (spermidine/putrescine)"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87442.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MTLSRIAPYLQAAPLTLILTAFLVLPIATIVMVSFWDYDSIQIF
                     PAFVFTNYEETITSPVTWNTYLNTLKYTGIVWAVTLFIGFWVAYYLAFHIRSATTQMV
                     LFLVCTIPFLTSNIIRMISWIPFLGRNGLLNQTLMTMGVIDQPLEFLLFSDFAVVLAM
                     VHLYTLFMVTPIFNTLMRIDRALIEAARDAGANALQILTNVIIPLAKPGIAIGSIFVV
                     TLVMGDFITVRFMSGGQSASVGLMMANQIALLQYPAAAANAVILLVLVLLLVGGILRI
                     VNIRREL"
     gene            98435..99265
                     /locus_tag="Snov_0106"
     CDS             98435..99265
                     /locus_tag="Snov_0106"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: atc:AGR_L_3448 hypothetical ABC transporter permease
                     protein YdcV"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87443.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MNSEKRGPGFYVLTAFFVLFVLFLYGPLTTIFILSFQGPNGGLT
                     FPMNGVSLRWFNNLLFEQQAVGDFGGAFTRSLVLGIMTMLTTVVVSLLAGLAFRRRFL
                     GSGPLFYLTIASLIVPSILISLGIGLAFNVLGLETAWYSSAFGAHLTWTLPFGLLIMF
                     AVFNRFNPAYEEAARDLGASPWQTFAHVVLPIILPSLIGVGLFGFTLSYDEFARTLMT
                     SGTFNTLPLEIYGMTTNVTTPVLYALGTVTTVFSMGVIILALVTIAVLRKRRARRVAG
                     "
     gene            99431..99652
                     /locus_tag="Snov_0107"
     CDS             99431..99652
                     /locus_tag="Snov_0107"
                     /inference="similar to AA sequence:KEGG:SPO2955"
                     /note="KEGG: sil:SPO2955 magnesium transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="ADH87444.1"
                     /translation="MNICTTDRTICDLLKEVAKDDRKHALTIKLRSGDLVTAYGPIEV
                     ADRFMLCRLHDNNYDGSQLIALDTIEFIR"
     gene            99700..100014
                     /locus_tag="Snov_0108"
     CDS             99700..100014
                     /locus_tag="Snov_0108"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87445.1"
                     /translation="MRPTVSVPQNGGIRWLGMSTRDTPEARRKIVRLYLLLALPAFAF
                     CYVLAAIQGANGRLSALLGTIALAGCLVCAAAYHLLGPSSKQLLYVAAGVLALVTFFV
                     AR"
     gene            100172..101230
                     /locus_tag="Snov_0109"
     CDS             100172..101230
                     /locus_tag="Snov_0109"
                     /inference="protein motif:PFAM:PF00165"
                     /note="KEGG: rpf:Rpic12D_4103 transcriptional regulator,
                     AraC family;
                     PFAM: helix-turn-helix- domain containing protein AraC
                     type;
                     SMART: Helix-turn-helix, AraC domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="ADH87446.1"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /translation="MTETANSELLAPIAADPRVQHIVMDSGTLPQKEAIALWQESLGV
                     FYDVRLRNKADRFSFRADAYHLGEILLTGYSCVAQSFDRTRARIGRDGLDHITLQVCL
                     RGSHGRRDGGAADQANAGDLIIADLAQAQATATTDHDSLSLTIPRRLLAPLLKTPDEH
                     NLRRIPGNAPLAALLRNHLTGLYAGAGAMTADEAEAIVRPTIELAAAALNASISEESA
                     ASVQLVLTRQISRHIDQHVLDPALSGESIAAAFGISTRKLYYLFEAHGGVAAYVTRGR
                     LQLARAMLADPTQQGRSIADVAELHGFAYRTNFVRAFRREFGVTPREVRAHAAEGRRL
                     FERPGDDTTMWHWVRQLK"
     gene            101478..104981
                     /locus_tag="Snov_0110"
     CDS             101478..104981
                     /locus_tag="Snov_0110"
                     /inference="protein motif:TFAM:TIGR01414"
                     /note="KEGG: rlg:Rleg_0480 outer membrane autotransporter
                     barrel domain protein;
                     TIGRFAM: outer membrane autotransporter barrel domain
                     protein;
                     PFAM: Autotransporter beta- domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane autotransporter barrel domain
                     protein"
                     /protein_id="ADH87447.1"
                     /db_xref="InterPro:IPR005546"
                     /db_xref="InterPro:IPR006315"
                     /db_xref="InterPro:IPR011050"
                     /translation="MTRVKLGISSGRAAEAGNGRSGRTRHAALLATTAVIALAYASPV
                     SAQTLWTGTNSNNWFDPGNWSAGLPNNVTDAEVDNIAVNAPAVFAIGANARDLTIGNS
                     AVGSLTVQGAGVLLTTNGYIGRGLGSTGTVVVTGTDSVWANTGDFYVGDQGSGSLTIA
                     NGGQVISNDSFVGNVGSGLVTVTGTDSTWTVTDPLIVGNFGSGMVNVDTGGTVETERV
                     TVGAANGSEGFLDISGGTTSWIASSEFIVGEEGSGTVTVSDGATVESQTLAVGFGPTG
                     FGQVTITGVGTTWTTTASTGIGSDGVGHLLIEAGAAFNTVGVSLGTGSGTVTGAGSSL
                     TASGQIFVGAGGESTFTVSDGASVTSVGANIALGGTGTATVTSGANWTSSSTFIVGHS
                     GLGTLNVTDGGTVNTLDSVLGRFAAGVGILNVEGEGASFVNTGNMGIGNEGTGALSVT
                     AGGTAEAQSVLLGMEANSGGSASISGAGSSLTSNEFLFVGLEGNGVMFVEDGAQVNSV
                     VAGIGASTGGIGEATVSGATWLNSSDLFIGADGTGVLTIADGGRVEVGGAVEIAAGAG
                     SSGTLNIGAGEGLAAAAPGTLAAGEIVFGPGTGAIVFNHTSTNYQFSAGMTGTGTIDL
                     FSGTTVLTGNSSGFTGATTLHGGTLAVNGTLGGTLDVLAGRLQGTGTVGSTTIAGGAV
                     IAPGNSIGTLNIAGNATFAAGSAYELELDPNSSNGDLIHATGTVAIEGGTVEHIGLAG
                     AYSPLRTYTIVTADGGVDGEFAAVTSDFAFLDPTLSYDPNNVYLTLIRNDVDFGAVGL
                     TPNQIATGNGTESLGLGNPLYDAVLGLSAAQARGAFDLLSGEIHASAKSVLIDDSRFV
                     REAAIDRVRAALGGVGASVSPVMAYGEGGPQSAAPTTDRFAIWGQGFGSWGQIDGDGN
                     AAQINSSTGGFFLGADAPIFETWRLGVIAGYSRTNFDVDARASSGSSDNYPLGIYTGT
                     QWGNLGFRSGLAYTWHEIDTSRSVAFPGFSESLTSSYDASTFQAFGELGYRIDVQAVA
                     FEPFANVAYVSFDSDGFTEQWGAAALYAGGQTTDTTFTTLGLRVAAGLGLAGADVTLR
                     GTLGWRHAFGDVTPLSTQAFAGGDPFTIAGVPIAENAAVVEAGLDWNLTPQATLGVAY
                     NGQLASDAQQNGFTARLTVEF"
     gene            complement(105011..106201)
                     /locus_tag="Snov_0111"
     CDS             complement(105011..106201)
                     /locus_tag="Snov_0111"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: bid:Bind_3072 monosaccharide-transporting ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ADH87448.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MSDTALKDKPRHAGFVKNNLREYGMLISLFAIMIFFQVVTDGTL
                     LRPLNLTNLVLQNSYIVIMALGMLLVIVTGHIDLSVGSVAGFIGAVAAVLMVKFGMPS
                     ILAVLICLALGGLIGAAQGYWVAYFKIPSFIVTLAGMLVFKGLALAILAGQSVGPFPP
                     AFQKLSSGFIPELVPGAGTLYPTSLAIGAVLALVLVWQNFRSRARQEAHHIETEPYGF
                     FLVKNLLFFAVIVYFAYLIASHRGLPNVLVIMTALIALYAFVTTRTTIGRQIYAVGGN
                     EKAAKLSGIKTERLTFLTFVNMGVLAALAGLVFAARLNTATPKAGLGFELDVIAACFI
                     GGASAYGGVGRVGGAVIGALIMGVMNNGMSILGIGIDYQQVIKGLVLLGAVCLDVYNQ
                     KRSA"
     gene            complement(106198..107730)
                     /locus_tag="Snov_0112"
     CDS             complement(106198..107730)
                     /locus_tag="Snov_0112"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: bid:Bind_3073 ABC transporter related;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87449.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSALLEMRGISKHFTGVKALNDVSFEVEPGEIHALVGENGAGKS
                     TLMKVLSGVYPHGSYDGSIMFDGEERRFRDIIDSEALGIIIIHQELALIPLMSIAENI
                     FIANPPARFGVIDRGAVHRRTRELLAKVGLNEEPDTLVTDIGVGKQQLVEIAKALSKK
                     VRLLILDEPTASLSEKDSAALLDLLREFRAQGISSILISHKLNEVSKVADRITVLRDG
                     RTVDTMDCHEGAVEEDRIIRKMVDRDLEHRFPKREPKIGETIFRVADWSVHHPLHADR
                     QVIKDVDFEVRRGEIVGIAGLMGAGRTEFAMSIFGRSWGQKIGGRAEIEGREADLSTV
                     RRAIDAGLAYVTEDRKELGLLLNEDVRKNVTLANLAAVSSAQVIDDVRELAVASDYRG
                     RMRIRSHSVYQEAGKLSGGNQQKVVLSKWLFTDPKVLILDEPTRGIDVGAKYEIYCII
                     NELADAGKGVVVISSEMPELLGICDRICVMNEGAFVGEFPAAEATQEKIMRAIMRKGD
                     RS"
     gene            complement(107802..108872)
                     /locus_tag="Snov_0113"
     CDS             complement(107802..108872)
                     /locus_tag="Snov_0113"
                     /inference="protein motif:PFAM:PF00532"
                     /note="PFAM: periplasmic binding protein/LacI
                     transcriptional regulator;
                     KEGG: bid:Bind_3074 multiple sugar-binding periplasmic
                     receptor ChvE precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="ADH87450.1"
                     /db_xref="InterPro:IPR001761"
                     /translation="MKRLTTTLSAFALGALALSFAVPASAQDKGTVGIAMPTKSSARW
                     IADGDNMVKVLKERGYDTDLQYAEDDIPNQLSQIENMVTKGAKVLVIASIDGTTLSDV
                     LKQAQAQGIKVIAYDRLIRDTPNVDYYATFDNFQVGVLQAQSLLKGLGYPENKGPFNI
                     ELFGGSPDDNNAYFFYDGAMSVLKPLIDNGTLKVASGQMGMDKVSTLRWDGATAQARM
                     DNLLSAYYNDKRIDGVLSPYDGLSIGILSSLKGVGYGSGGMKMPVVTGQDAEVPSMKS
                     ILAGEQYSTIFKDTRDLAKVTADMVDASLSGKEVTVNDTKTYNNGVKVVPSYLLKPVV
                     VDKGNWEKVLVGSGYYKADQIN"
     sig_peptide     complement(108792..108872)
                     /locus_tag="Snov_0113"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 27"
     gene            complement(108969..109898)
                     /locus_tag="Snov_0114"
     CDS             complement(108969..109898)
                     /locus_tag="Snov_0114"
                     /inference="protein motif:PFAM:PF08450"
                     /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
                     KEGG: bid:Bind_3075 SMP-30/gluconolaconase/LRE
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SMP-30/Gluconolaconase/LRE domain protein"
                     /protein_id="ADH87451.1"
                     /db_xref="InterPro:IPR005511"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /translation="MTITSAQAPATTEPTLETLPVAVLCEERCHLGEGPSYDAARDTA
                     WWFDILEKRLCEARLAGGAVTVHSLPFMASALAMVDDRRQLLLTENGLVLRDIAGGRL
                     EPVADIEAGNPATRSNDGRVHPSGTFWISTMGRHAEREAGTIYAYRDGAVAPLFPGIT
                     IPNAICFSPDGTLGYFADTKANRLHRVRLDPATGLPLESPSVLRVHTGAGGFDGAVTD
                     AEDLVWCAIWGGGRLEAYTPAGDLVRSVAVPARQTSCPVFVGPAFDRVLVTSAFENMD
                     EAARAADPHHGKTFLLDIGVRGHAEPRVRLGGA"
     gene            complement(109885..111690)
                     /locus_tag="Snov_0115"
     CDS             complement(109885..111690)
                     /locus_tag="Snov_0115"
                     /EC_number="4.2.1.9"
                     /inference="protein motif:PRIAM:4.2.1.9"
                     /note="KEGG: atc:AGR_L_3190 putative dihydroxy-acid
                     dehydratase;
                     PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydroxy-acid dehydratase"
                     /protein_id="ADH87452.1"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="InterPro:IPR020558"
                     /translation="MHGKTQKTDRTLRSRAWFDNPANADMTALYLERYLNYGLSQEEL
                     QSGRPIIGIAQTGSDLSPCNRHHLELAKRVREGIREAGGIAIEFPVHPIQETGKRPTA
                     GLDRNLAYLGLVEVLYGYPLDGVVLTIGCDKTTPACLMAAATVNIPAIALSVGPMLNG
                     WYKGERTGSGTIVWKARELLATGEIDYQGFVKLVASSAPSTGYCNTMGTATTMNSLAE
                     ALGMQLPGAAAIPAPYRDRQEAAYRTGLRIVEMVHEDLKPSDILTREAFLNAIRVCSA
                     IGGSTNAPVHLNALARHVGVELSIDDWQAHGEDVPLLVNLQPAGAYLGEDYYRAGGVP
                     AVVNQLMAQGLVHEDAVTANGRSIGENCRDSAIADEDVIRPYDRPLKEKAGFRVLRGN
                     LFSSAIMKMSVISPEFRARYLSNPDDPEAFEGRAVVFDGPEDYHARIDDPALAVDEMT
                     VLFMRGAGPVGYPGAAEVVNMRAPDYLIKAGIHSLPCIGDGRQSGTSGSPSILNASPE
                     AAAGGGLAVLRTGDRVRIDLKRNSADMLVPEEELERRRQELVAQGGYHYPAHQTPWQE
                     IQRGLVGQLETGAVLEPAVRYQRIAQTKGVPRDNH"
     gene            complement(111706..112791)
                     /locus_tag="Snov_0116"
     CDS             complement(111706..112791)
                     /locus_tag="Snov_0116"
                     /EC_number="5.1.3.3"
                     /inference="protein motif:PRIAM:5.1.3.3"
                     /note="KEGG: bid:Bind_3076 aldose 1-epimerase;
                     PFAM: Aldose 1-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="Aldose 1-epimerase"
                     /protein_id="ADH87453.1"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /translation="MHAAAHASPLLREPFGTLSDGRAVERIRLAGEGGFEVAIITHGA
                     AVQALHVPDRDGRLADIVLGHDDLAPYEAHRRYFGAAVGRYANRIAGGRFPLDGTTCQ
                     VPANNGANALHGGPDGFDRRLWSVEALADGSVPSVTLGLTSPDGDQGFPGELDVRVTY
                     ALTGPRELSIAFEATTSRPTIVNLTHHGFFNLAGVEAGGDVLGHELTLHADAYLPIDA
                     AAIPVGGPTPVAGTPFDFRIPRLIGGRIREAHEQLRLGRGYDHNFCVAGGRTAEPRLA
                     ARVEHPASGRVLELLTDQPGLQFYSGNFLDGTTEGKFRRLHRQSDAFCLEPQAWPDTP
                     NRPNFPSARLDPGETYRHVSLYRFSTV"
     gene            complement(112794..113720)
                     /locus_tag="Snov_0117"
     CDS             complement(112794..113720)
                     /locus_tag="Snov_0117"
                     /inference="protein motif:PFAM:PF01408"
                     /note="PFAM: oxidoreductase domain protein;
                     KEGG: bid:Bind_3077 galactose 1-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase domain protein"
                     /protein_id="ADH87454.1"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /translation="MAPIRLAIVGLGKIARDQHIPAIAATEGIELAAVASRNAALDGV
                     AHFATLDDLLADSADIDAVALCTPPQVRRAQAEAALAAGKHVLLEKPPGATVSELGPL
                     VAAAEASGRTLFATWHSRFAPAVEPARTFLAERAIRSVIIEWKEDVRVWHPGQEWIWE
                     PGGLGVFDPAINALSILTQILPRPVFVTKAHLAFPTNRDAPIAAELGLSDVAGIPIRA
                     ELDFLQTGPQTWDIRIETEAGQIVLSSGGARLVHDGAVLVDEKEAEYRGIYARFVELV
                     RGGRSDVDLAPLALVADAFLLGRRSIAEPFEY"
     gene            complement(113723..114655)
                     /locus_tag="Snov_0118"
     CDS             complement(113723..114655)
                     /locus_tag="Snov_0118"
                     /inference="protein motif:PFAM:PF00701"
                     /note="PFAM: dihydrodipicolinate synthetase;
                     KEGG: xau:Xaut_1021 dihydrodipicolinate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="ADH87455.1"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /translation="MTTSSAAGPYKGVFPVAPTVFDADGRLDLDGQKRAIDFMIDAGS
                     HGLCILANFSEQFVLTDEERDLVMETVLEHVGGRVPVIVTTTHFATHVCAERSRRAQE
                     MGAAMVMIMPPYHGATFRVPEGAIYDFYRAVCDAIDIPIMVQDAPIAGTPLSVPFLAR
                     MAKEIEHLAYFKIEVPQAAAKLRALIEAGGDAIVGPWDGEEAITLMADLDAGATGAMT
                     GGGYPDGIRQIIDPYVAGDREAAVDAYMRWLPLINYENRQCGLAACKALMQEGGVIAH
                     ETLRAPLPTLHPATRAGLIEIARRLDPLVLSWGR"
     gene            complement(114665..116425)
                     /locus_tag="Snov_0119"
     CDS             complement(114665..116425)
                     /locus_tag="Snov_0119"
                     /EC_number="4.2.1.9"
                     /inference="protein motif:PRIAM:4.2.1.9"
                     /note="KEGG: xau:Xaut_1022 dihydroxy-acid dehydratase;
                     PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydroxy-acid dehydratase"
                     /protein_id="ADH87456.1"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="InterPro:IPR020558"
                     /translation="MSDDSDHGSKKPGSGRPLRSQAWFGRQDKMGFYYRSFLKNSGQP
                     QDRFDGRPVIGICNTWSELTPCNGHFRDLAEHVRYGVLDAGGYPLEFPVSSLGEVTMR
                     PTAMLFRNLASMDVEEAIRAHPLDGVVLLMGCDKTTPALLMGAASADLPAIGVSGGPQ
                     LRGVYRGQIIGSGTNIISMSEQLRAGEITLAEFHEAEAAMNRSAGSCMTMGTASTMAS
                     MVEALGIGLPENAAIPAADARRNLLARMAGRRIVEMVKEDLKPSDILTREAFENAIRT
                     LAAIGGSTNAVVHLLAIAGRVGVELTLADFDRLGRNIHCLVDLMPSGRFLMEDFYYAG
                     GLPAVLRALGERGLLHKDALTVNGSSIWENVAAAQCWNAEVITPFDAPFKAEAGIAIL
                     TGNLAPNGAVIKPSAASPELMQHTGRAVVFESVEEMHHAVNDEALDIDADCIMVLKNC
                     GPKGYPGMAEVGNMPLPAKLLRAGVRDMIRISDARMSGTAYGTVVLHVAPEATAGGPL
                     ALVQNGDLITLDVPARSLHLHVDEAELAARRAAWVAPEPHAARGYQRLYVNHVLQADR
                     GADFDFLVGRSGSPVARDNH"
     gene            complement(116437..117159)
                     /locus_tag="Snov_0120"
     CDS             complement(116437..117159)
                     /locus_tag="Snov_0120"
                     /inference="protein motif:PFAM:PF07729"
                     /note="KEGG: bra:BRADO1811 GntR family transcriptional
                     regulator;
                     PFAM: GntR domain protein; regulatory protein GntR HTH;
                     SMART: regulatory protein GntR HTH"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR domain protein"
                     /protein_id="ADH87457.1"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /translation="MTSQIIVIPARRAHSNHAEVARTIGIDIIAGRYGEGAKLPGDAE
                     LTLIFGVSRPVLRESVKTLVAKGLLSTKARVGTVVRERAAWNMFDPDVLAWHLDAGIN
                     KQFLRDLAEIRLAVEPRAAALAAERRTENDLEVMRRAVARMADEPGASSGFAEADLAL
                     HVAVAAASGNPFMRSIGAVIEAALRASFVLSAPVDAREHGIAVAAHERIVETIADKDA
                     EAAAAAMTNVIFNGLRRQGATG"
     gene            complement(117156..118151)
                     /locus_tag="Snov_0121"
     CDS             complement(117156..118151)
                     /locus_tag="Snov_0121"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: bbt:BBta_2130 inner membrane ABC transporter
                     permease protein YjfF"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ADH87458.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MTRSLNRLMPVFATTAVFLAGFLICSLAYPNFASLRVVMNLLTD
                     NAFLGIVAVGMTFVIISGGIDLSVGSVIGFTTVFLALAIERWGVPPFAAFVVILLLCA
                     AFGAAMGATIQYFELPPFIVTLAGMFLARGLSFLMSTDSIPITADLYANLSDHAIRLA
                     GGARLTVPAMIMLAIVAAGMALLHLTRFGANVYALGGSRAATGLMGINVARTTVLIYT
                     LSSVLAGLSGIVFSLYTSSGYSLSAVGVELDAIAAVVIGGTLLSGGYGFVFGSFLGVL
                     IQGLIQTYISFDGSLSSWWAKIATGLLLFAFIAFQQITLHMARRSRLRPAGVAKP"
     sig_peptide     complement(118065..118151)
                     /locus_tag="Snov_0121"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.761) with cleavage site probability 0.655 at
                     residue 29"
     gene            complement(118162..119160)
                     /locus_tag="Snov_0122"
     CDS             complement(118162..119160)
                     /locus_tag="Snov_0122"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: bja:blr3202 sugar ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ADH87459.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MAIRLPRIGTSQVAALILILLANWMVSPQFFDFHIRDGRVFGSV
                     IDVLNRGAPVALLSIGMVLVIAMRGIDLSVGAVMAICGAIAASLADSHALPVVLAAAL
                     GAGLLCGLWNGLLVAMLGIQPIVATLILMVAGRGIAQLITEGRIVTFSSPDLALLGGG
                     GSVLGLPTPVVLTFGMLALTLLIVRGTALGLMIEATGGNPRASALAGIGTKLITVAVY
                     MWSGLCAALAGIVAAADILGADANNAGLWLELDAILAVVIGGTSLFGGRFSVVLAVVG
                     ALIIQAMNTGILLSGFPPETNLVVKAVVVLAVLLAQSPRVAGHFAGLGVLLNRSRS"
     gene            complement(119172..120704)
                     /locus_tag="Snov_0123"
     CDS             complement(119172..120704)
                     /locus_tag="Snov_0123"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: bbt:BBta_2128 putative ABC transporter
                     ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87460.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MHPTDGSLLELTGFSKSFTGLMALDKVDFTLRRGEIHALLGENG
                     AGKSTLIKTMTGVVTRDAGTMRLEGAEIAPRSAGEATKLGIATVYQEVNLAPNLSVAQ
                     NLFLGRQPTRLGFVREGEMRRRAQALLAEFGLSIDVAAPLETYSVAIRHIVAIARAVD
                     QSARVLILDEPTASLDAHEVEVLFTVMRQLKARGIGIVFVTHFLDQVYAICDRITVLR
                     NGRLAGTAPIAELPRIDLVRMMLGRELSAATAQRPPRTAAAEAEPVAAFEDFGKAGYV
                     APFDLTLRAGHVVGLAGLLGSGRTETVRLVFGAERADSGTAEVGGARVVLSSPHEAMR
                     LGFGYCPEERKTEGIVADLTVRENIVLALQAKRGPLKPLPRREQDDIAAKFIRLLDIR
                     PPDPERPVGLLSGGNQQKVLLARWLATAPRLLILDEPTRGIDVGAHAEIIGLIRDLCA
                     EGMALLVVSSELEEIVTYADEVVVLRDRAHVARLTGDEVDVPAILAAIAADAPASVAA
                     PM"
     gene            complement(120812..121777)
                     /locus_tag="Snov_0124"
     CDS             complement(120812..121777)
                     /locus_tag="Snov_0124"
                     /inference="protein motif:PFAM:PF00532"
                     /note="PFAM: periplasmic binding protein/LacI
                     transcriptional regulator;
                     KEGG: bja:blr3200 ABC transporter sugar-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="ADH87461.1"
                     /db_xref="InterPro:IPR001761"
                     /translation="MNFKALLLATAFSGALVSAGAQAADLTIGFSQIGSESGWRAAET
                     TVSKAEAKKRNINFKIADAQQKQENQIKAIRSFIAQGVDAIFLAPVVSTGWDSVLKEA
                     KEANIPVVLLDRDIDPSGKDLYLTAVTSDSVHEGRVAGQWLVKTVGAKPCNVVELQGT
                     VGASVAANRKKGFEEGIASAPNVKIVRSQTGDFTRAKGKEVMESFIKAEGGGKNICAV
                     YAHNDDMMVGAIQAMKEAGLKPGSDVLTVSIDAVPDIFKAMAAGEANTTVELTPNMAG
                     PAFDAIIAYKAKGTVPPKWIQTESKLYTAADNPQAVYDSKKGLGY"
     sig_peptide     complement(121706..121777)
                     /locus_tag="Snov_0124"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 24"
     gene            complement(122154..122229)
                     /locus_tag="Snov_R0001"
                     /note="tRNA-Phe1"
     tRNA            complement(122154..122229)
                     /locus_tag="Snov_R0001"
                     /product="tRNA-Phe"
     gene            complement(122403..122624)
                     /locus_tag="Snov_0125"
     CDS             complement(122403..122624)
                     /locus_tag="Snov_0125"
                     /inference="protein motif:PFAM:PF03884"
                     /note="PFAM: protein of unknown function DUF329;
                     KEGG: azc:AZC_3144 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF329"
                     /protein_id="ADH87462.1"
                     /db_xref="InterPro:IPR005584"
                     /db_xref="InterPro:IPR013088"
                     /translation="MSADAPSSADKNTGTCPICGKPSVEKYKPFCSSRCADVDLHRWL
                     TGAYAIPVTEDDDEDGEEPSLAPKPPRKA"
     gene            complement(122646..123269)
                     /locus_tag="Snov_0126"
     CDS             complement(122646..123269)
                     /locus_tag="Snov_0126"
                     /inference="protein motif:TFAM:TIGR00172"
                     /note="KEGG: rpd:RPD_4276 Maf-like protein;
                     TIGRFAM: maf protein;
                     PFAM: Maf family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="maf protein"
                     /protein_id="ADH87463.1"
                     /db_xref="InterPro:IPR003697"
                     /translation="MSARPTLVLASGSPRRLALLAQAGIEPDALLPADIDEAPERGEL
                     PRRLALRLAQQKLAAADARRKAGNEHEGAYLLAADTVVAVGRRILPKPDLSEEAADCL
                     RLLSGRAHRVYTGLALMTPKGGVRTRLVETRVRFKRLSREEMDGYVASREWLGKAGGY
                     AIQGLAGVFVVKLVGSYTNVVGLPLAETVALLAGERFPVYQRWGNPE"
     gene            complement(123386..123877)
                     /locus_tag="Snov_0127"
     CDS             complement(123386..123877)
                     /locus_tag="Snov_0127"
                     /inference="protein motif:PFAM:PF01451"
                     /note="KEGG: xau:Xaut_1233 protein tyrosine phosphatase;
                     PFAM: Protein-tyrosine phosphatase, low molecular weight;
                     SMART: Protein-tyrosine phosphatase, low molecular weight"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein-tyrosine phosphatase, low molecular
                     weight"
                     /protein_id="ADH87464.1"
                     /db_xref="InterPro:IPR017867"
                     /translation="MATSAQSSLLVGPAVPGRKERPQSVLFMCGQNSVRSPMAAVLAK
                     HLFGRSLYVGSAGVAKGEPDPFVTAAIDEVGLDLHRHRPQTLEELEENEGLAFDLVIT
                     LSPDAHHRALELTRTNAIDVEYWPTPDPTLVAGNREQQLDAYRAVRDELEARIRARFQ
                     RHV"
     gene            complement(123880..124389)
                     /locus_tag="Snov_0128"
     CDS             complement(123880..124389)
                     /locus_tag="Snov_0128"
                     /inference="protein motif:PFAM:PF06793"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: azc:AZC_3148 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87465.1"
                     /db_xref="InterPro:IPR008321"
                     /translation="MAEGQDPDKDPHAASRRLCAVTLDGASIGRSNIDVEHERAVAIY
                     DLIEENTFAPLGDAAPGPYCLAISLAEGRLVLDVTRKDGAPVVQHLLSLSPLRRVVRD
                     YFLVCESYYSAIRTASPSQIEAIDMGRRGLHNEGSELLRERLKDKIALDFGTARRLFT
                     LVCALHWKG"
     gene            complement(124399..125691)
                     /locus_tag="Snov_0129"
     CDS             complement(124399..125691)
                     /locus_tag="Snov_0129"
                     /EC_number="1.1.1.23"
                     /inference="protein motif:TFAM:TIGR00069"
                     /note="TIGRFAM: histidinol dehydrogenase;
                     KEGG: rpb:RPB_4350 histidinol dehydrogenase;
                     PFAM: Histidinol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="ADH87466.1"
                     /db_xref="InterPro:IPR001692"
                     /db_xref="InterPro:IPR012131"
                     /db_xref="InterPro:IPR016161"
                     /translation="MPLRLDTASPEFKARFTAFLGTKREVSQDVAQAVARIIDDVRAR
                     GDDALIDFSRQFDRVDLGALGIRVTDTEIDAAEKAADPAAREALAFAHERIRSHHQRQ
                     LPESGRYVDAAGVELGHRWTAVDAVGLYVPGGTAAYPSSVLMNAVPAKVAGVKRVVMV
                     VPAPDGQINPLVLAAAKLAGVDEVYRVGGAQAVAALAYGTQTIAPVAKIVGPGNAYVA
                     AAKRHVFGTVGIDMVAGPSEVLVIADGAQNPDWIAADLLAQAEHDTAAQSILMTDDAA
                     LADAVVYAVERQLTMLPRRDIAAASWAEFGAVIKLKSLDEAPALADRIAPEHLEIMAA
                     DAEALAERIHHAGAIFLGAHTPEAIGDYVGGSNHVLPTARSARFSSGLSVLDFMKRTS
                     ILKCGPEQLRALGPAAIALGEAEGLSAHARSVAIRLNL"
     gene            complement(125805..126311)
                     /locus_tag="Snov_0130"
     CDS             complement(125805..126311)
                     /locus_tag="Snov_0130"
                     /inference="similar to AA sequence:KEGG:AZC_3150"
                     /note="KEGG: azc:AZC_3150 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87467.1"
                     /translation="MAGLKLIALDAEDLAVLSVHLQDAVVSVGEMTFLPKEHRFVLLA
                     NRFDWEKAIQAEAMADIDTFPAGPGLAFAAAPVAAATPCVRRRSGLRFERVLNARVRG
                     IDLTKKQGVLNLLALKFDEIDAPSGTVTFLFSGGGEVQLDVECMEAGLEDLGPAWDAK
                     GTPCHDVE"
     gene            complement(126458..127747)
                     /locus_tag="Snov_0131"
     CDS             complement(126458..127747)
                     /locus_tag="Snov_0131"
                     /inference="protein motif:TFAM:TIGR01072"
                     /note="KEGG: azc:AZC_3151 UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase;
                     TIGRFAM: UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase;
                     PFAM: EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase)"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="ADH87468.1"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR005750"
                     /db_xref="InterPro:IPR013792"
                     /translation="MDRIRIVGGNPLTGSIPISGAKNAALPLMIAGLLTDEKLVLHNV
                     PRLADVSQLQRILGNHGIDITVNGKRRGDDPYSGQTMEIDARVIVDTTAPYELVSKMR
                     ASFWVIGPLVARMGEAKVSLPGGCAIGTRPVDFHLDALRALGAEIEIDAGYVLARAPK
                     GLKGAHILFPKVSVGATHTAMMAASLAEGETILENAAREPEIVDVADCINAMGGRIEG
                     QGTSTIRITGVPRLKGAHHSVLPDRIETGTYAMAVAMTGGDVMLSGARADLLDSALDT
                     LRECGAEVTVSNEGLRVKRNGAGISPVEVTTAPFPGFPTDLQAQLMALTTRARGTSKI
                     TETIFENRFMHVQELARLGARIHLDGEIATIEGVEKLKGAPVMATDLRASVSLVIGAL
                     AAEGESMIHRVYHLDRGFERLEEKLSACGAEIERLAG"
     gene            complement(127955..128173)
                     /locus_tag="Snov_0132"
     CDS             complement(127955..128173)
                     /locus_tag="Snov_0132"
                     /inference="similar to AA sequence:KEGG:Mpop_1943"
                     /note="KEGG: mpo:Mpop_1943 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87469.1"
                     /translation="MSSADDAARAERLAAALRENLKRRKAQMRGRQAESMEPARPNEA
                     PVPDAGSANKDAPDAAPQASAPKPNRSG"
     gene            128392..128466
                     /locus_tag="Snov_R0002"
                     /note="tRNA-Thr1"
     tRNA            128392..128466
                     /locus_tag="Snov_R0002"
                     /product="tRNA-Thr"
     gene            complement(128515..129408)
                     /locus_tag="Snov_0133"
     CDS             complement(128515..129408)
                     /locus_tag="Snov_0133"
                     /inference="protein motif:TFAM:TIGR03418"
                     /note="KEGG: rlt:Rleg2_5789 transcriptional regulator,
                     LysR family;
                     TIGRFAM: choline sulfate-utilization transcription factor;
                     PFAM: regulatory protein LysR; LysR substrate-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87470.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017786"
                     /translation="MAERLLDLGWVRIFEAVGRLGSLTAAAHELGLSQPAVSYTVRNL
                     ERQLGTPLLERGHRGSTLSPAGERLHRAASAAVAELDAGARAIRRMSRRPVVRLFTDY
                     GFASFWMMPRVAQFRLVHPDTEVHIIASAAADPGTDEAEDVAVLFGTQSDFGAGATQL
                     FEECVYPVCSPHFAARHGLTDDPRAIVGLPLLHLDSTPHPRWFVWSDWFAAMHVAREP
                     GPGDLSLNTYGLVVQAAIADQGVALGWAGLIDGAIADGTLVAAGPALSRAESGYWMRP
                     GREPSAPALDLIEWIIGDVRR"
     gene            129558..130499
                     /locus_tag="Snov_0134"
     CDS             129558..130499
                     /locus_tag="Snov_0134"
                     /inference="protein motif:TFAM:TIGR03414"
                     /note="KEGG: oan:Oant_3324 substrate-binding region of
                     ABC-type glycine betaine transport system;
                     TIGRFAM: choline ABC transporter, periplasmic binding
                     protein;
                     PFAM: Substrate-binding region of ABC-type glycine betaine
                     transport system"
                     /codon_start=1
                     /transl_table=11
                     /product="choline ABC transporter, periplasmic binding
                     protein"
                     /protein_id="ADH87471.1"
                     /db_xref="InterPro:IPR007210"
                     /db_xref="InterPro:IPR017783"
                     /translation="MNRFVRAACALSLFLSAGAAVAADAPACKTIRMSDPGWTDITST
                     NAIAGVLLSGLGYTQDVKTLSVPIGYESMKNGNLDVFLGNWMPAQRKFMDALNEAKAV
                     EVLATNLTGAKFTLAVPNYVAEAGVKDFKDLVANADKFGSQIYGIEPGAPANANIQKM
                     IDANDFGLKGWKVVESGEQAMLAQVKRSGNGKGWIVFLAWAPHPMNETFDITYLSGGD
                     AYFGPNFGGADVRTLARVGWAAQCPNAATFFKNLKFDLPLENAMMGKILDEGLEPAAA
                     AKAWLKAHPAALEPWLAGVTTFDGKPGLPAVKASLGL"
     sig_peptide     129558..129626
                     /locus_tag="Snov_0134"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 23"
     gene            130569..132083
                     /locus_tag="Snov_0135"
     CDS             130569..132083
                     /locus_tag="Snov_0135"
                     /inference="protein motif:TFAM:TIGR03417"
                     /note="KEGG: rle:pRL110429 putative choline-sulfatase;
                     TIGRFAM: choline-sulfatase;
                     PFAM: sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="choline-sulfatase"
                     /protein_id="ADH87472.1"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017785"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /translation="MMRPNILVLMVDQLNGTLFPDGPADFLHAPHLKALAARSARFAN
                     AYTASPLCAPARASFMSGQLPSRTRVYDNAAEFTSDIPTYAHHLRRAGYHTALSGKMH
                     FVGPDQLHGFEERLTTDIYPADFGWTPDYTKPGERIDWWYHNLGSVTGAGVAEITNQL
                     EYDDEVAYHAGRKLYDLARGHDERPWCLTVSFTHPHDPYVARKRFWDLYEDCPALDPV
                     VAPIPFEAQDPHSQRLMLASDHAASHVTDEDVRRSRRAYFANISYIDEKIGELIDIVE
                     RCRMADDTVIVFVSDHGDMLGERGLWFKMNFLEGSARVPLMVAAPGLPAGQIDRPVST
                     LDVLPTLAHLAALDLSGIMPWTDGESLVPLARGDGSRSAVPMEYAAEGSYAPLVALRD
                     GPWKLSLCELDPPMLTNLDEDPHELANRAQDPACADIMARMTTAMRSRWDLARFDAEV
                     RSSQARRHVVYEALRNGAYYPWDFQPLQKASERYMRNHMDLNILEESQRYPRGE"
     gene            complement(132101..132790)
                     /locus_tag="Snov_0136"
     CDS             complement(132101..132790)
                     /locus_tag="Snov_0136"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: xau:Xaut_0380 ABC transporter related;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87473.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSGAPVLSVRELSRHYATGGGMVRALDGVSLDVAAGELVGVFGP
                     SGSGKSTFLMLAGLLENPTSGEVWLAGERVSHAGADLDALRETRRKRIGFVFQKANLI
                     PFLSAVENVALSLELADVAPADARAHGRRLLATLDLAHRADNLPAKLSGGEQQRVAVA
                     RALANAPPLILADEPTAALDSVRGRQVMEIFRRIAGTRGAAVLVITHDPRSTDLFDRI
                     VHFEDGRMVPD"
     gene            complement(132787..133950)
                     /locus_tag="Snov_0137"
     CDS             complement(132787..133950)
                     /locus_tag="Snov_0137"
                     /inference="protein motif:PFAM:PF02687"
                     /note="PFAM: protein of unknown function DUF214;
                     KEGG: rle:RL3603 putative transmembrane transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF214"
                     /protein_id="ADH87474.1"
                     /db_xref="InterPro:IPR003838"
                     /translation="MNLALKDTLHAPTRFALTALGVAFLVMAVIGMTGLYRGIVEDAL
                     LILDRIDADLWVVQGERAGPFAEGSAVASDMDRRVEGVPGVADVRRFTQFSQQFSFAG
                     ASRRATVTGVDVPRDDGRWLPLAEGRWLGGSRYDAVADASTGLKVGDRIQLARDVYTV
                     VGLTRQMVDSAGDGLLFVGINDAAVIARRRTSEEVHLARAAGSGGGAVSADASSVAQE
                     SKISAVLVRLDPAADAARVIATMQRWGDVRVMTMGEQRDLMLNARLWKLRLQILTFTG
                     MILVITAIVVSLIVYTMTIEKLHEIALLKLMGARESVVVGLIGQQAALIGIAGYVLAI
                     GLSGLIFPLFPRRVVMLPADLAQVALALTLVCAAAAWVGIARASRVGAREVLS"
     gene            complement(133947..135149)
                     /locus_tag="Snov_0138"
     CDS             complement(133947..135149)
                     /locus_tag="Snov_0138"
                     /inference="protein motif:TFAM:TIGR01730"
                     /note="KEGG: rle:RL3602 putative efflux RND transporter
                     protein;
                     TIGRFAM: efflux transporter, RND family, MFP subunit;
                     PFAM: secretion protein HlyD family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux transporter, RND family, MFP subunit"
                     /protein_id="ADH87475.1"
                     /db_xref="InterPro:IPR006143"
                     /translation="MNVQPGLDQFLSLEAPLPRPRRRRGLRLAALAAAVLAIGFVGVR
                     YFYPHAVEGEVLRPGMLDVELQGPGTLSALTEASVGSRIQARIEELAVDRNDVVAKGE
                     TLARLAFDDLSGEFDAAEASAHAAERTVSVAQAERDRAVATLEKARATHERQVALLAK
                     GVASEAGLEDALATRRQAEADLARAGRAVEQAEAERDAATARIAVARAQLDDSVLRAP
                     ISGVVVSRTHHVGEVLTPGSEVLHLVDPASLVLTARLDESVISAVLPGQAARVTFTRA
                     EDPISGHVLRLRREVDEETREFEIDITLDTLPANWALGQRAMARIMIERRGPVLTVPT
                     SFLVWCDGRPGVWVATRARARWREVTLGEAGAKRVEIRRGLDAGQKILKPGDLYPFMR
                     VRLAGPAT"
     gene            complement(135204..135476)
                     /locus_tag="Snov_0139"
     CDS             complement(135204..135476)
                     /locus_tag="Snov_0139"
                     /inference="similar to AA sequence:KEGG:Xaut_3450"
                     /note="KEGG: xau:Xaut_3450 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87476.1"
                     /translation="MDRAFFLRAGLVLAFATLLGAAFARAASAQNMSRAQAQAVRSAC
                     EADIRATCPGVQPGGGRLLQCIKANPDGISQPCKDALVAARAAPAQ"
     sig_peptide     complement(135396..135476)
                     /locus_tag="Snov_0139"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.522 at
                     residue 27"
     gene            135737..136456
                     /locus_tag="Snov_0140"
     CDS             135737..136456
                     /locus_tag="Snov_0140"
                     /inference="protein motif:PFAM:PF00072"
                     /note="KEGG: ara:Arad_0228 two-component response
                     regulator protein;
                     PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     SMART: response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, winged
                     helix family"
                     /protein_id="ADH87477.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /translation="MTAARVLLVEDDRDIRSLLVDFLGGEGYDVEAVGSGALMDRALM
                     RGMPDLVILDIMLPGEDGLSICRRLRTKSRVPILMLTAKHDDIDRIVGLEIGADDYLG
                     KPFNPRELLARIRALLRRASGPLSAGVPERRRRRFAGLVADLDARTVVDDGGQRVNLT
                     TAEFDLLTCFLERPGRVLSRDQLLDWTRGRAGGDPFDRTIDVTVSRLRGKLSRCIGEA
                     EQPITTVRNVGYLFSADVREA"
     gene            136468..137793
                     /locus_tag="Snov_0141"
     CDS             136468..137793
                     /locus_tag="Snov_0141"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: ara:Arad_0229 two-component sensor histidine
                     kinase protein;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase HAMP region domain protein; histidine kinase A
                     domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase HAMP region domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="ADH87478.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /translation="MRLGLLARIILIVAVALFAIQLLALFFYFGAGEGRRTLGEGSPS
                     LSRQVASLVLLVDKVPADLRPALLEAFSENGRTATIVPALPDDFTRTNGLIRIERSIR
                     AALALRGAEGRQVWARLEGRSESGRGDTLSVYVELADGGYLWLDVEDRVTVRLLGVPI
                     GFFAGLFGVIVALAALVAVAREMRPITRLAREVDRVGEGIDPVAIPERGAPELRKLIR
                     AVNAMQKRIAALVRNRTLTLGAISHDLRTYLTRLRLRVEMMPESRHRAGAIADVEAMQ
                     ALVADTLDFAQDSFVPTEPVRADLATALRRYAAEQNDARIVLDVPDGPVHVAMGDKAL
                     GRVVANLVGNALRYGERAFAGIKTGGARVVLVIEDEGPGIPAEERERVFEPFHRLEAS
                     RNRDSGGTGLGLTIVRRLVERHGGSIELGTSRRGGLAVRVMLPRTEPPA"
     gene            137877..138461
                     /locus_tag="Snov_0142"
     CDS             137877..138461
                     /locus_tag="Snov_0142"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: pde:Pden_3440 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87479.1"
                     /translation="MRKIFPSTLSTRIAGGAVVLALVAAGAVPTLGIAQDLAGPLAAP
                     AGAAGPWACEVPPFAAGPGPAIDPAAARLIAGMLLSAQETALGIRTDQMDAWRGYTTA
                     LIALLPSGERLGRWTDEKKRAEAQAFDLAQDIAGAAIERAEKARALQDAVSKLKTVLT
                     PEQMSMAKQMQEKLVERIVRFVQWRRGEGSGVPL"
     sig_peptide     137877..137981
                     /locus_tag="Snov_0142"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.998) with cleavage site probability 0.567 at
                     residue 35"
     gene            complement(138523..139197)
                     /locus_tag="Snov_0143"
     CDS             complement(138523..139197)
                     /locus_tag="Snov_0143"
                     /inference="protein motif:PFAM:PF08239"
                     /note="KEGG: rle:RL3605 putative transmembrane protein;
                     PFAM: SH3 type 3 domain protein;
                     SMART: SH3 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SH3 type 3 domain protein"
                     /protein_id="ADH87480.1"
                     /db_xref="InterPro:IPR003646"
                     /db_xref="InterPro:IPR013247"
                     /translation="MLRKMIFAAALTLAAAPAASAATTAVAVTNVNLRAGPSTVYPAV
                     TVVPTGAAITTFGCVSGYSWCDIGFGPYRGWVAASYIQVVYRGAPVVLTAPLAPTIGI
                     TVVSFNRAYWDRYYVAYPWYGRWAAYPSYAAPRVTSANRSVTCAGSACVGVRGATGVY
                     GGSTAQTRVCTGGACTSTRITEGPNAGMAARTRNCAAGQGCTTNRAVIGPGGGVHTGS
                     RSFQRW"
     sig_peptide     complement(139132..139197)
                     /locus_tag="Snov_0143"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.863 at
                     residue 22"
     gene            complement(139464..140150)
                     /locus_tag="Snov_0144"
     CDS             complement(139464..140150)
                     /locus_tag="Snov_0144"
                     /inference="protein motif:PFAM:PF00571"
                     /note="KEGG: nha:Nham_1933 CBS domain-containing protein;
                     PFAM: CBS domain containing protein; transport-associated;
                     SMART: CBS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal transduction protein with CBS
                     domains"
                     /protein_id="ADH87481.1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR007055"
                     /db_xref="InterPro:IPR017080"
                     /translation="MKARDVMTSPVITAKATDLVVQIAKTLLERRISGMPIVDDKGKM
                     VGIISEGDLIRRAEAGTERRRSWWLQAFVDDGTLAAEYVKAHGRTAADVMHRDPVTAG
                     PDTPLHEIAALMESHGVKRIPIVEKGHLVGIVSRSNLIQAVAGTKMGLEIPLSDSAIR
                     EKVMERLNQQPWANTWRLNVTVDDGVVNLWGIANADTERQALRVVAETTPGVRAVNDH
                     LMKEPMGSWA"
     gene            140430..140528
                     /locus_tag="Snov_0145"
                     /product="hypothetical protein"
                     /pseudo
     gene            140730..141770
                     /locus_tag="Snov_0146"
     CDS             140730..141770
                     /locus_tag="Snov_0146"
                     /inference="protein motif:PFAM:PF01594"
                     /note="PFAM: protein of unknown function UPF0118;
                     KEGG: azc:AZC_4415 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0118"
                     /protein_id="ADH87482.1"
                     /db_xref="InterPro:IPR002549"
                     /translation="MSARTNRILLGICTVVLAGGAIFLARPVIAPVAFALFVMALVWP
                     LQDRLQRRLPGLAAMAITLAVTILAVFVVGYATVWGLSQTGRWLVTNAGRFQALYAET
                     AAWLEGHGLYSAGTLADTFSASWLIGTFQGLAGRVNGMLGFAVVTMIYVMLGLLEADI
                     VRDKLLAAGEAGGRLVRASAATAAKFRTYMMVRTVMSVLTGLFVWAVTAALGLDLALA
                     FGVMAFALNYIPFIGPLVATLLPTFFALAQFGSWEAAVLVFVAMNVIQFFSGSYIEPR
                     VAGRALAMSPFLVLLSVFFWAFMWGIAGAFIGVPLVIAALTFCEEREETRWIAQLLSG
                     REEKPPVPAGVS"
     gene            141865..143082
                     /locus_tag="Snov_0147"
     CDS             141865..143082
                     /locus_tag="Snov_0147"
                     /inference="protein motif:PFAM:PF05990"
                     /note="PFAM: protein of unknown function DUF900 hydrolase
                     family protein;
                     KEGG: bms:BR0328 putative lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF900 hydrolase
                     family protein"
                     /protein_id="ADH87483.1"
                     /db_xref="InterPro:IPR010297"
                     /db_xref="InterPro:IPR014586"
                     /translation="MRLVVLLLASLLTAGCAGRPVGVLTPVEAAVPEATKVDLLVATT
                     RAPSPDAGIRYTGERGQGVSLSAFTVSIPPDSRREVGQVQWPRSLPPNPETDFATLNV
                     QPLPSVKAAKGWLDSHLPPSRRVLIFVHGYNNRFEDSVYRFAQIVHDSRSEVAPVLFT
                     WPSRARVFDYLFDRESTIFSRDAFEEAVWQVASDPRVEDVTVMAHSMGAWLAMEGLRQ
                     MAIRRGKLPAKISNVILASPDVDVDVFASQWRALNGPKARFTLFVSQDDRALQVSRRI
                     AGGVDRLGLIDTQKYYAELEKSGIVVIDLTKMRGGDALNHDRFASSPEVVQLIGTRLV
                     NGQTVTDSEVSIGDRIAAGAMGVGQTVGSAAGLAISAPIAVVDPATRRTYQGQMESFG
                     RTMSGTVEDPGAD"
     gene            complement(143105..143437)
                     /locus_tag="Snov_0148"
     CDS             complement(143105..143437)
                     /locus_tag="Snov_0148"
                     /inference="similar to AA sequence:KEGG:RALTA_B0044"
                     /note="KEGG: cti:RALTA_B0044 conserved hypothetical
                     protein; putative exported protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein; putative
                     exported protein"
                     /protein_id="ADH87484.1"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /translation="MLSRRSLFKGLLAAALAAPAGAALTSTADAQWGVPGPRMAPPPP
                     RREPRPRPRRGYTWVPGHWNWSARRGWVWAPGHWEENRRGFTYVGPRWVFRRGQWVFE
                     PGRWVRSW"
     sig_peptide     complement(143345..143437)
                     /locus_tag="Snov_0148"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.504 at
                     residue 31"
     gene            complement(143459..144664)
                     /locus_tag="Snov_0149"
     CDS             complement(143459..144664)
                     /locus_tag="Snov_0149"
                     /inference="protein motif:TFAM:TIGR00210"
                     /note="KEGG: msl:Msil_1050 sodium/glutamate symporter;
                     TIGRFAM: sodium/glutamate symporter;
                     PFAM: sodium/glutamate symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/glutamate symporter"
                     /protein_id="ADH87485.1"
                     /db_xref="InterPro:IPR004445"
                     /translation="MASIQVSGLLTFTVAILVFFAGSGLNRLIAPLRAWNIPEAVTGG
                     LLAATVTLLAYRLLGAEISFALQARDMLLLYFFTGIGLNARLDDLISGGRPLIILLAL
                     TVVFLVIQNFIAIGAVAALGLPEGLTVFLGSASLIGGHGTTIAWAPLISQRFGVPNAM
                     EIGIASATLGLVLASLAGGPIARHLIGRYKLHGPAYGDAAVGLPAKAENSPADDIGHV
                     SLLRTVLVLNVAILIGFGLEGVVEETGIKLPMFVVCLLVGIVLTNTVPRLFSRLLWPT
                     RTRALALVSDLSLNIFLAMSLMSMQLWTIGGLGLALVIVLAVQTVAAVAYIIFVVFPL
                     MGRDYQAAVIAAGFTGISLGATPTAIANMTAITKTHGAAPRAFIILPLVSAFFIDIIN
                     AAAIGFLAR"
     gene            complement(144696..146147)
                     /locus_tag="Snov_0150"
     CDS             complement(144696..146147)
                     /locus_tag="Snov_0150"
                     /inference="protein motif:PFAM:PF03600"
                     /note="PFAM: Citrate transporter;
                     KEGG: msl:Msil_2569 citrate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Citrate transporter"
                     /protein_id="ADH87486.1"
                     /db_xref="InterPro:IPR004680"
                     /translation="MGLIGILLGLGLLIWFAYRGWSVLLLAPLSALIAALLSNEPLLA
                     NWTQTFMGSAASFVGQFFPLFLLGALFGKLMEDSGSVTAIAEFMTEKLGAERAILAVV
                     LAGAIVTYGGVSLFVALFVLAPMAEALFRVADIPRRLMPPAIALGTFTFTMMALPGTP
                     AIQNAIPMPFFGTTPFAAPGLGIIASLIMLGFGLWWLSRAEASARRAGEGFDGIGPDL
                     HAVVTDPVLRERATVTREFDPAEIEHGHLSVERPSIALAALPLVLVIVVNLLMSFVIL
                     PRLDFSFLAEPRWGGVTFSGVSGVWSVAVALIVAILATIAINRRRLPKLRETMDAGAN
                     ASVLPIFSVASLVGFGAVVAALPAFALVRDWVLSIGGGPLVSLAVATNILAALTGSAS
                     GGLTIALDALGATYLQRAGELGIDPALLHRVAVMSAGTLDSLPHSGAVVTLLAVCGVT
                     PKQSYLDIVMVAIVGAIVALVAVIALGSVAGSF"
     gene            complement(146151..147257)
                     /locus_tag="Snov_0151"
     CDS             complement(146151..147257)
                     /locus_tag="Snov_0151"
                     /inference="protein motif:PFAM:PF01734"
                     /note="PFAM: Patatin;
                     KEGG: azc:AZC_1304 putative esterase"
                     /codon_start=1
                     /transl_table=11
                     /product="Patatin"
                     /protein_id="ADH87487.1"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /translation="MPRPTSATRARRPSGADNAPSPNAEPATDARRAPVLIDLALQGG
                     GSHGAFTWGVLDRLLEEEWLRIDGVSGTSAGAMNAAVMADGYAAGGAAGARAALDAYW
                     RHVAEAARFSPFQRGPLDVLFGRWTLDHSPMFIAMDLMSRLYSPYDLNPAGTNPLRDI
                     LEKAIDFDRLKTSPIKVFITATNVRTGRGRVFRNAEITPDVLLASACLPTLFQAVEID
                     GESYWDGGYAGNPTMTPLVRELDSDDTILIPINPIERPGTPRSAAEILNRLNEVSFNS
                     ALLKELRMIALLRQVADPGHSEGAQWAKMRIHLVRNEIMATLGYSSKLNAGWDFLSML
                     REEGRKAAQAFLDADADNIGKRSSVDLDVLLEGV"
     gene            147567..149000
                     /locus_tag="Snov_0152"
     CDS             147567..149000
                     /locus_tag="Snov_0152"
                     /inference="protein motif:PFAM:PF00324"
                     /note="PFAM: amino acid permease-associated region;
                     KEGG: mlo:mll6735 arginine/ornithine antiporter"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease-associated region"
                     /protein_id="ADH87488.1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /translation="MADPQAGKLPLPTLTAMVVGSMVGAGIFNLPGRFATATGPFGAI
                     IAWLIAGTGMYMLARVFQALAEKRPDIDAGVFAYAKAGFGDYMGFLSAFGYWLGSCLG
                     NVFYWVLIGSTLGRFFPDIFGDGSSATAIIVSLVGIWAFHFMILRGVEQATFINTIVT
                     IAKIVPILVAVLAFVFFFNYTQFSENFFGGVGMPEKTLVAQVRDTMLITVFVFIGIEG
                     ASVYSRYAKKRSDVGAATILGFVAVTGLMVAVTLLPYATAPRAAIAGVQNPSLAGALE
                     LVVGHWGAVFISVGVLISVLGAYLAWSLICAEVLFAAAKSSDMPRLFAAQNANRVPAN
                     ALWLTNIVVSLFVISTYWSRDAFNFMLDMTSVTSLLPYLLVAGYGVLLARSGVGYEAT
                     PGERGRDQIFAWIAIVYTLFMFVAAGLKYVLLVTVLFVPGTILYFWARREQQARLFTP
                     VELVVFIITLVGGAVGAYGLATGLITP"
     gene            149028..150263
                     /locus_tag="Snov_0153"
     CDS             149028..150263
                     /locus_tag="Snov_0153"
                     /EC_number="3.5.3.6"
                     /inference="protein motif:TFAM:TIGR01078"
                     /note="TIGRFAM: arginine deiminase;
                     KEGG: mlo:mll6733 arginine deiminase;
                     PFAM: amidinotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine deiminase"
                     /protein_id="ADH87489.1"
                     /db_xref="InterPro:IPR003198"
                     /db_xref="InterPro:IPR003876"
                     /translation="METSFGVHSEVGQLRKVLVCAPGRAHQRLTPSNCDALLFDDVLW
                     VDVAKRDHFDFITKMRDRGIEVVEMHNLLTETLAVPEAKKWILDNQVAPNQIGLGFVE
                     EVRSYLEGLPNRQLAETLIGGLSTYEFPETIGGETLALIRDAAGVNEYLLPPLPNTLY
                     TRDTTCWIYGGVTLNPLYWPARHEETILTSSIYKFHPDFAGKVNVWWGDPTKDWGLAT
                     LEGGDVMPIGKGNVLIGMSERTSRQAISQAAAALFEKGGAERVIVAAMPKLRAAMHLD
                     TVFTFADRDCVLIYPDIVDKIECFSYRPDGKGGVELSRDKGLIETVKEALGLKEIRVV
                     ETGGNDYMRERTQWDSGANLVCASPGVVFAYDRNTYANTLLRKAGIEVITIDGSELGR
                     GRGGGHCMTCPIIRDAVDF"
     gene            complement(150280..151305)
                     /locus_tag="Snov_0154"
     CDS             complement(150280..151305)
                     /locus_tag="Snov_0154"
                     /inference="protein motif:PFAM:PF02615"
                     /note="PFAM: Malate/L-lactate dehydrogenase;
                     KEGG: pde:Pden_4855 malate/L-lactate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Malate/L-lactate dehydrogenase"
                     /protein_id="ADH87490.1"
                     /db_xref="InterPro:IPR003767"
                     /translation="MDEPVRLSLAEVHVLCRDTLVAAGLGEEHAQAIARSITRAEADE
                     CHSHGLYRLIGYVASVRSGKAERHALPALARATPAVLRVDAKHGFAPLAVETGVPALI
                     AAAKEIGIAALAIHDCYHFSALWADIEPAVEAGLAAWCFTVGQCCVAPAGGTTPLLGT
                     NPFAFGWPGPSGRPFIFDFATSAAARGEIELKRRGGEKIPPGWAVGPDGAPTTDPAAA
                     LAGALLPFGGHKGSALSMMVELIAGPLIGDLTSRQSKAVENGDGGPPLGGELFIAIDP
                     AVFGTGNLSSRLADADELFALAKAQPGVRLPSERRYQARERSRTNGIAVPAALFAELQ
                     ALGPRGS"
     gene            complement(151308..152345)
                     /locus_tag="Snov_0155"
     CDS             complement(151308..152345)
                     /locus_tag="Snov_0155"
                     /EC_number="5.1.1.4"
                     /inference="protein motif:PRIAM:5.1.1.4"
                     /note="KEGG: rlt:Rleg2_2641 proline racemase;
                     PFAM: proline racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="Proline racemase"
                     /protein_id="ADH87491.1"
                     /db_xref="InterPro:IPR008794"
                     /translation="MRSSKVIHVVGCHAEGEVGDVIVGGVAPPPGETVWAQSRFVASD
                     NTLRNFVLQEPRGGVFRHVNLLVPPKNKEAVAAWIIMEPEDTPPMSGSNSICVSTVLL
                     DTGIVPMVEPETHMVLEAPGGLIEATAYCKNGKAERIRVKNHPSFADKLDAKLELEGY
                     GTLTVDTAYGGDSFCIVDAHALGFSIKPDEAKDFADLGMKIVKAANQQLGFQHPTNKD
                     WSHISFCQFAAPLTDDNGTPSGANAVAIRPGKIDRSPCGTGCSARMAVLHAKGILKVG
                     DAFVGRSIIGSRFDCRVEAETSIGGRPAIVPSIMGRAFITHTAQLMVDPDDPWQTGYR
                     LSDTWPVWKQD"
     gene            complement(152482..153585)
                     /locus_tag="Snov_0156"
     CDS             complement(152482..153585)
                     /locus_tag="Snov_0156"
                     /inference="protein motif:PFAM:PF02746"
                     /note="PFAM: Mandelate racemase/muconate lactonizing
                     protein;
                     KEGG: mlo:mll7353 muconate lactonizing enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="Mandelate racemase/muconate lactonizing protein"
                     /protein_id="ADH87492.1"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /translation="MKITGIKAWKVGLPLKEGRYNWSNGNFVEVFDSTVVAVETDAGI
                     TGYAECCPLGSAYLPAYAHGVRAGLEEIGPKVIGLDPTDLNVLNRHMDSVLRGHPYVK
                     APIDIACWDILGKVSGLPVYKLLGGAAQEKVALYRAISQEAPEAMARKIAGYKAEGYT
                     KFQLKVGGDADQDIDRIRVTREILDATDTLVADANTGWTRAEAARIAAEVGDLDVYIE
                     QPCPTYEECLSVRARTARPFVLDEVIDGVGTLMKALADDAMDIINLKISKVGGLTKAR
                     LMRDICVASGTPMTIEDTWGGDIVTATIAHLARSTPEEFSFSATDFNSYGTVDIAKGA
                     PKRVNGFMTASDAPGLGIEPIFEVLGEPVVVIG"
     gene            complement(153692..154693)
                     /locus_tag="Snov_0157"
     CDS             complement(153692..154693)
                     /locus_tag="Snov_0157"
                     /EC_number="5.1.1.8"
                     /inference="protein motif:PRIAM:5.1.1.8"
                     /note="KEGG: sme:SM_b20268 hydroxyproline-2-epimerase;
                     PFAM: proline racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyproline epimerase"
                     /protein_id="ADH87493.1"
                     /db_xref="InterPro:IPR008794"
                     /translation="MARHSFFCIDGHTCGNPVRLVAGGGPNLQGANMIEKRAHFLAEY
                     DWIRTGLMFEPRGHDMMSGSILYPPTRPDCDVAILFIETSGCLPMCGHGTIGTVTMAI
                     EHGLVTPKIPGVLMLDTPAGVVKAEYRQEGQYVEEVRITNVPAFLYARGLTAECPGLG
                     EVMVDVAYGGNFYAIVEPQEHFRDMADFTAGELIGMSGALRKALNAKYEFVHPEKPEI
                     RGLSHILWTGAPKHAEAHARNAVFYGDKAIDRSPCGTGTSARIAHWAANGKLKVGDDF
                     VHESIIGSLFKGRVEATARVGNVDAIIPSIGGWARMTGYNTIFIDDRDPFAHGFVVV"
     gene            complement(154706..155959)
                     /locus_tag="Snov_0158"
     CDS             complement(154706..155959)
                     /locus_tag="Snov_0158"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: bmc:BAbS19_I16830 TrkA potassium uptake protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="ADH87494.1"
                     /db_xref="InterPro:IPR006076"
                     /translation="MSDRADSGEIAVIGAGIVGLACAFHLLGEGHRVRLVERGGVAEG
                     ASFGNAGAFAFTDILPLASPGMLLKAPKWLFDPLGPLSIPPRYLPQITPWLIRFWRAS
                     LPDRYRHSLVAQGSLMRFAAQAMESMVAAAGLSSHVRRDGNLQLYESEAELAASQPGW
                     DARAKEGVEFEHVRGSRLAELQPGVAPRFVAGTFTPRWQTVDDPHHFALALFQAVMAR
                     GAAITHGEVKAVEPAESGVRLRLADGSQLAVGRAILAGGAWSRPLARELGDAIPLETE
                     RGYNTTLPPGAFALHRQLTFGGHGFVVTPLSTGIRVGGAVELGGLKAAPNFRRSEVML
                     RKAAAFLPGLNTEGGTQWMGFRPSLPDSLPVIGTSRASNRVLYAFGHGHLGLTQSAAT
                     GRLVADMVAGRTPSITLDPFRPDRF"
     gene            complement(156098..156994)
                     /locus_tag="Snov_0159"
     CDS             complement(156098..156994)
                     /locus_tag="Snov_0159"
                     /inference="protein motif:PFAM:PF00701"
                     /note="PFAM: dihydrodipicolinate synthetase;
                     KEGG: mlo:mll3981 dihydrodipicolinate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="ADH87495.1"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /translation="MWQGIYPAVTAKFNEDDSLDHKEMEKSFAFQIEAGVDGLIVNGS
                     LGEGPMLSHDERLAVLKTAKSVAGKKPVLMTIADSSTRDCASLAKRAAAAGADGLMTV
                     PSLVYHTNPKETVAALSAVAQAADLPVMIYSNRLAYRVDVTVEIMAELAKDKRFVAVK
                     ESSDDIRRTIDIFNAFGDRYDVFTGVDNLAYEALAVGAVGWVAGLVVAFPHETVAIYK
                     LMKAKRYDEALAIYRWFRPLLDLDVSTYLVQNLKLVEALVTGTTERVRSPRLMLEGEQ
                     RAKVEKIVAEALATRPALAKAA"
     gene            complement(157031..157756)
                     /locus_tag="Snov_0160"
     CDS             complement(157031..157756)
                     /locus_tag="Snov_0160"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: pae:PA1256 amino acid ABC transporter ATP
                     binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87496.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSILIDDVHKSFGSLEVIKGVTMTVEKGEVVSVIGGSGSGKSTL
                     LMCINGLEPINSGRILVDGTDVHARGTDLNKLRRKIGIVFQQWNAFPHLTVLENVMLA
                     PRKVLGKSKAEAQAVAVEKLTHVGLAEKLNVYPSKLSGGQQQRMAIARALAMSPDYML
                     FDEVTSALDPQLVGEVLDTMRLLSKEGMTMIVVTHEIAFAREVSDRVAFFHKGRIHEI
                     GPPSQVIGNPQQPETVAFLKSVL"
     gene            complement(157766..158431)
                     /locus_tag="Snov_0161"
     CDS             complement(157766..158431)
                     /locus_tag="Snov_0161"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="KEGG: atc:AGR_L_403 probable permease of ABC
                     transporter;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="ADH87497.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /translation="MFSSLLDTSFSLGDLWFMLKGAGVTLALTAWAVLGGTLLGVLFG
                     VIRAISPWWINAPIGAVLDVFRSVPLLIQLVLANSFKTIVGINWAPFTVSCVVLALYM
                     SAYCTEIVRSGFLAVPSTTRRAARSLGMTWRQDLTDIVFPIALRVALPSWIGLTLGVM
                     KDTAMVWWIGVVELLRSSQVIVTRIQEPLFVLSIAGLIYFLMSFPIARLGARLEARWR
                     END"
     gene            complement(158444..159106)
                     /locus_tag="Snov_0162"
     CDS             complement(158444..159106)
                     /locus_tag="Snov_0162"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="KEGG: pap:PSPA7_4134 ABC transporter permease;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="ADH87498.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /translation="MHYTFHWLPAFRALPDMLWGALVTLEIAVLSMLLGVFFAVLLAV
                     ASGSQYRALRALASTWVELARNTPALFQIYMAYFGLGSLGIHLDSFPALLAGITFNNA
                     GYLAETFRGGLRAVPPTQVRAARSLGMGQIQAFRLIVMPQMFRVVFYPMTNQMVWAIL
                     MTSLGVIVGLNNDLTGVTQELNVRSFRTFEYFALAAVIYYLLAKLVTLSARLMAWRLF
                     RY"
     gene            complement(159399..160211)
                     /locus_tag="Snov_0163"
     CDS             complement(159399..160211)
                     /locus_tag="Snov_0163"
                     /inference="protein motif:PFAM:PF00497"
                     /note="KEGG: atc:AGR_L_407 probable binding protein
                     component of ABC transporter;
                     PFAM: extracellular solute-binding protein family 3;
                     SMART: extracellular solute-binding protein family 3"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 3"
                     /protein_id="ADH87499.1"
                     /db_xref="InterPro:IPR001638"
                     /translation="MAKGIGILAAAALTLAAAMPAQADKLDDIIASGTLRCAVVLDFP
                     PMGSRDASNNPIGFDVDYCNDLAKVLGVKAEIVETPFPDRIPALVSGRVDVGVASTSD
                     TLERAKTAGFTIPYFAFKMVVLTKDGLGIKDYDSLKGKKTGSVSGTFEALALEKDVKA
                     WGTGSFRGYQTQADVFLALAQGQIEATVVTSTVAAAIVKEGKYKGLMMGGDAPYDIDY
                     VALIALRNEQGLINYLNLFINQQVRTGRYKALYEKWVGLGEAPNLTVPGVYR"
     sig_peptide     complement(160140..160211)
                     /locus_tag="Snov_0163"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 24"
     gene            complement(160351..161160)
                     /locus_tag="Snov_0164"
     CDS             complement(160351..161160)
                     /locus_tag="Snov_0164"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87500.1"
                     /translation="MRLSPRRLLRPRALKEADQRDTGAENVLAGEPGGLVGVAGDAGF
                     QYALVLAARARHAVGQHELGTQVAVDAVQRGADGLQVVGPRGRLVERIVEAAVELAPV
                     RGIRLRGECIGEALGVLEPLVRDALHRIAQDFRLQQGAEFEDLADLVGRERGDHGAAV
                     ALRRHQALLLETRQRLAHRDAADVEQAGDVVLPKGLAFGNVALGDGLAQRVENDVRRG
                     CHLRDVRCLNLHLVSPPGFAADRLKSPIRCRQVLCAACGFGGRRARGATAQ"
     gene            complement(161157..162602)
                     /locus_tag="Snov_0165"
     CDS             complement(161157..162602)
                     /locus_tag="Snov_0165"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: ccs:CCNA_01239 two-component sensor histidine
                     kinase;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase HAMP region domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase HAMP region domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="ADH87501.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /translation="MMGARFPVLRRAPLAARMSILLIIVVAAVQLINLALVVLVPPPS
                     EETYSAAQFAAALKGEDAGTDFSLRRFQDSEMRPQHPALVPIRDQLATYFGVPPEQVR
                     VEVAGAAPDTPRQDKGLLDGSVILKFASLEASSFDGQKALFQGLFKVGLRQGDGSWLV
                     ARPTGALHALWKQRALLWLLSTIVVAIPCAYLVAHKLAEPIRRFGAAAEELGRNPGAP
                     PIDTSGPKEIAAAASAFNDMQRRLNRYVDDRVMMMGAIAHDLRTPLMRLAFRLEEAPP
                     TLAGKAREDIDEMKAMLAAVLSYVRSVQSERPRERHDLRSLVLSIADELADLGHDVSV
                     EDGDDVVVTGDGLGLKSLFANVIGNAAKYGGSARVRLAAEDGHVTIIVDDDGPGLPSD
                     ELERVFEPFYRHETSRNRATGGVGLGLATARSVAIAHGGSIRLDNRAHGGLRATVVLP
                     LVPAAEPAPAEACGCSISSLLPRPGREPHTA"
     gene            complement(162599..163297)
                     /locus_tag="Snov_0166"
     CDS             complement(162599..163297)
                     /locus_tag="Snov_0166"
                     /inference="protein motif:PFAM:PF00072"
                     /note="KEGG: pzu:PHZ_c1903 response regulator(with
                     CheY-like receiver domain and winged-helix DNA-binding
                     domain);
                     PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     SMART: response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, winged
                     helix family"
                     /protein_id="ADH87502.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /translation="MATPTILVVDDDAGIRSLVSESLSLHGFSVLEARDTRAMDRALA
                     ANAIDLIILDVLMPGEDGISACRRLAGRAGPPVVMLSAMDQPTDRVVGLELGADYYLG
                     KPCDPRELLAVVRATLRRRGADEDTDSRARYRFLGWTVDFAAYELRDGAGALVHLTDG
                     EFAVLRSFVQRPRRVLTRDQLLEAARGPDSEALDRAVDVQVSRLRRKLRADSDLIRTI
                     RNEGYMFVPAVQKL"
     gene            complement(163391..163993)
                     /locus_tag="Snov_0167"
     CDS             complement(163391..163993)
                     /locus_tag="Snov_0167"
                     /inference="protein motif:PFAM:PF00398"
                     /note="PFAM: ribosomal RNA adenine methylase transferase;
                     KEGG: mes:Meso_0915 methyltransferase type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA adenine methylase transferase"
                     /protein_id="ADH87503.1"
                     /db_xref="InterPro:IPR001737"
                     /translation="MSRTATSFVDQISFLANWAGDPLRVGAIAPSGRSLADIITRGIS
                     PADAPVIELGAGTGAFTRALIARGVPEDRLVLIELGADFARMLKRRHPEASVLQINAA
                     ELANMELFGSERAGAVVSGLPLLSFPQIAVVRILKGAFAHLREEGGFYQFTYGPVCPV
                     PRPILERFGLRATKVGRTLANLPPATVYRISRRPGEALRF"
     gene            complement(164015..164575)
                     /locus_tag="Snov_0168"
     CDS             complement(164015..164575)
                     /locus_tag="Snov_0168"
                     /inference="similar to AA sequence:KEGG:AZC_2752"
                     /note="KEGG: azc:AZC_2752 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87504.1"
                     /translation="MRITPALIAAALFGVLAATAVPAAESGKPENHRAGEARKDDRPR
                     EPAETKLAICLAPRLPGPLELASRLDAYETFVGIRPAQIDAWRDYTDALQAMTVGAEA
                     ERRELPATGLTDGDALSQSATLAGAVIATGERATRLLASVDALRAVLSEAQKARLDEA
                     GPLFPPKCAGTLAEAGTPADAAAAPH"
     sig_peptide     complement(164513..164575)
                     /locus_tag="Snov_0168"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.738 at
                     residue 21"
     gene            complement(164820..165488)
                     /locus_tag="Snov_0169"
     CDS             complement(164820..165488)
                     /locus_tag="Snov_0169"
                     /inference="similar to AA sequence:KEGG:Arad_8431"
                     /note="KEGG: ara:Arad_8431 isoprenylcysteine carboxyl
                     methyltransferase protein"
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase
                     protein"
                     /protein_id="ADH87505.1"
                     /translation="MVSYLLQCMAWTVFMAALVLLPAGTLDYPGGWAFIVLFAVGGLA
                     MVLWLGKYSPSLLRERMSAPWQREQKGWDKVWLTAFMLAFLAWLVFMAWDAGRTRFIA
                     MPAWLQVVGFLIALAYMAGVWWTFRENAFAAPVVKIQEGQKVIDTGPYAYVRHPMYTS
                     ALLFFISLPLILGSWWGLLLAVPFVLGVAWRAVHEEEALRVGLPGYDAYAARVRYRFV
                     PMVW"
     gene            complement(165497..165925)
                     /locus_tag="Snov_0170"
     CDS             complement(165497..165925)
                     /locus_tag="Snov_0170"
                     /inference="similar to AA sequence:KEGG:Mvan_4730"
                     /note="KEGG: mva:Mvan_4730 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87506.1"
                     /translation="MSTTSSDTAAARTRAFSRVIGPWLVIIPGLVMLREPEMGTIAAA
                     FFANPALVWLAGGLMLFGGLLIIAFHPYWSGLAAVIISALGWLLVLRAVAVLAAPTLF
                     EQAAMASAGAAMTVRLIFGLLVVAGLYLTYVGWLARPVTD"
     gene            165987..166451
                     /locus_tag="Snov_0171"
     CDS             165987..166451
                     /locus_tag="Snov_0171"
                     /inference="similar to AA sequence:KEGG:bll3994"
                     /note="KEGG: bja:bll3994 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87507.1"
                     /db_xref="InterPro:IPR011991"
                     /translation="MQNKANHEPTTAERRFIEDTARLLVPWGVPQTAARLYGFLLIHA
                     KPVSLDAIAEGLEISKSSASVAARLLEKYTLAHRHGVRGSKRALYGVSDNYAAMLAEQ
                     NRLLDALAALMRSGARGVRSEGARDRLTEMADFYAAIRQGMEATLARLRAKE"
     gene            complement(166481..167734)
                     /locus_tag="Snov_0172"
     CDS             complement(166481..167734)
                     /locus_tag="Snov_0172"
                     /EC_number="3.5.1.87"
                     /inference="protein motif:TFAM:TIGR01879"
                     /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
                     KEGG: mrd:Mrad2831_5813 allantoate amidohydrolase;
                     PFAM: peptidase M20"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase, hydantoinase/carbamoylase family"
                     /protein_id="ADH87508.1"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /translation="MSPLAKAIALTEQLFEELRAHTTDEPGITRAAYGEGEEFAHAVV
                     RRVGRELGLNEAVDAAGNLYLTLEGEDPTLPSWIIGSHIDSVPHGGNYDGAAGVFAGL
                     ALVHALRTEGRRLTRNLTIMVIRAEESTWFPVSYLGSRAAFGLLPADALETRRADTGL
                     TLREHMAALGLNPDAVARGETYLDPASIHGFVEVHIEQGPVLEREDAPIGLVTGIAGS
                     FRYRKGRVLGQYGHSGAVPRAYRQDAVIGFADLVAALETTWDGLERDGERATITFGEV
                     GTDPTQHAFSKVPGEVGFCLDVRSESPMVLERIHAELFAHAAIIEQRRGVRFDFGEQS
                     GSTPAVLDAGQRAGLKAAAACEGIRAIEMPSGAGHDTATFAGRGVPASLIFVRNQNGS
                     HNPFEAMRIEDFACAVRTLLSFLKV"
     gene            complement(167731..168720)
                     /locus_tag="Snov_0173"
     CDS             complement(167731..168720)
                     /locus_tag="Snov_0173"
                     /inference="protein motif:PFAM:PF02826"
                     /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
                     catalytic region;
                     KEGG: mrd:Mrad2831_4405 D-isomer specific 2-hydroxyacid
                     dehydrogenase NAD-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding protein"
                     /protein_id="ADH87509.1"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /translation="MSSLCLILQRIHDAGVEHLLAAGHEVRLATSLEPGALLAEIAPA
                     RAVLTRDARVDGPLMDAAPDLKVIGVHGAGVDNVDIAAATARGIPVVNTPGANARSVA
                     EHALALAFHLAKALGPGERAARASDGSFKYRARMIELDGAVFGLVGFGAIGRETGRLA
                     RALGMEVIVWTRRPDDPAVAAAGFTHVADLNELLARADIVSLHLPGGAQTRHLIGAPE
                     LARMKDTAYLINTARGTIIDEAALVEALREGRIAGAGLDVFETEPMPPSSPLIGFDNV
                     VLSPHVGGSTQAALRRTAVALAEQVNDVLAGRRPAHLVNPEVWPIAAIAEAGA"
     gene            complement(168734..169513)
                     /locus_tag="Snov_0174"
     CDS             complement(168734..169513)
                     /locus_tag="Snov_0174"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: rsp:RSP_3440 putative short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87510.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MDLGLKGRTALVLGANRGLGNAIARTLAKEGAAVILAGRNEAAL
                     EEEAAAIRKDGGEARIQKLDLGDRASVLAALDVLEGETIDILVNNSGGPPPGPVAAVT
                     PDVWSAQFETMVSAIFLVTSRLLPGMRARKFGRIVNIASSGVTQPIPNLGISNALRAS
                     IIGWAKTLAAEVAADGVTVNSVLPGRIHTQRTDQIDAANAARSGQSVDQVSAASRATI
                     PMGRYGTPQEFADVVAFLASERASYVTGSTLRVDGGAIRSI"
     gene            complement(169529..170458)
                     /locus_tag="Snov_0175"
     CDS             complement(169529..170458)
                     /locus_tag="Snov_0175"
                     /inference="protein motif:PFAM:PF00701"
                     /note="PFAM: dihydrodipicolinate synthetase;
                     KEGG: bbr:BB4720 putative dihydrodipicolinate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="ADH87511.1"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /translation="MAEKINETTRGVYIIAPTPFTQTGEVDFASTDSLIDFYFETGVT
                     GMTILGVLGEASKLAPTESRAFLEHVMKRVDGRKPVVVGASNPGTDNLVRFARQAMDL
                     GAAGLMIAPQPFLKTDDQVFGYWAEVLTRLGPDIPVCYQDYPQTSNTVSSVSVLHRLI
                     DAFPNFVMLKHEEGSGLPKITKMRERSDKGEGRRVSILVGNGGLYLPQELRRGVDGAM
                     TGFAYPEMLVGVVEKFHAGDLEGAEDLFDTYLPILRHEQQLGFGLAIRKEVLKRRGII
                     ACSDTRHPGPKLTARDHQELGELMSRLTAKLHG"
     gene            complement(170468..171148)
                     /locus_tag="Snov_0176"
     CDS             complement(170468..171148)
                     /locus_tag="Snov_0176"
                     /inference="protein motif:PFAM:PF07729"
                     /note="KEGG: mrd:Mrad2831_5808 GntR family transcriptional
                     regulator;
                     PFAM: GntR domain protein; regulatory protein GntR HTH;
                     SMART: regulatory protein GntR HTH"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ADH87512.1"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /translation="MSVPVRRKAVADPLEEREESLSQMAYNALLDQLIKREIPVGSVL
                     QERRLAEALAISRTPVRDALNRLESEGFITRKPGGVLVVKEFSTRELIETLHVRQILE
                     TEGARLATGRIPVAELDEVEAEIRALLAAPAPNAEKDWEVDCRFHSMIAARSGNAVLA
                     KHIHDLRLKTHMFNMDRVPERFEIGHREHLSIIDALRREDREAARAGLYAHIENVKLS
                     IIEKLRAI"
     gene            complement(171223..172023)
                     /locus_tag="Snov_0177"
     CDS             complement(171223..172023)
                     /locus_tag="Snov_0177"
                     /inference="protein motif:PFAM:PF00497"
                     /note="KEGG: ara:Arad_7980 amino acid ABC transporter;
                     PFAM: extracellular solute-binding protein family 3;
                     SMART: extracellular solute-binding protein family 3"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 3"
                     /protein_id="ADH87513.1"
                     /db_xref="InterPro:IPR001638"
                     /translation="MRLNLLPVLAAALVGGLVTGGLSAPANAQQLELVKPGALLVATE
                     GTYPPFSMRTPDGQLDGLEIRVAKEIARRLNLTYEPVVIKWEALLVGLAADQYDFASA
                     AMDITAERQKQVMFADGWLESGGRVVTQKGSPIKTPADIKGKTVGVLVSSTWQKLAEE
                     RGATVKAYKAESDAIQDLVNGQIDAVITDSIAAAYAIEASKLPLVMVDDYLSHIQKGF
                     PFKKGKPNLVKAVNKALADMIADGTYAKLTTPLIGYSPAPKDPIKTIF"
     sig_peptide     complement(171937..172023)
                     /locus_tag="Snov_0177"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 29"
     gene            complement(172122..173066)
                     /locus_tag="Snov_0178"
     CDS             complement(172122..173066)
                     /locus_tag="Snov_0178"
                     /inference="protein motif:TFAM:TIGR01230"
                     /note="KEGG: rsp:RSP_3743 agmatinase;
                     TIGRFAM: agmatinase;
                     PFAM: Arginase/agmatinase/formiminoglutamase"
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="ADH87514.1"
                     /db_xref="InterPro:IPR005924"
                     /db_xref="InterPro:IPR005925"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR020855"
                     /translation="MSVLPIDSLETPRFCGVPTFMRLPQATTLKGLDAAIIGLPSDSG
                     APFRTGARFAPNAVRAMSIMLRPINPYRNINVFERLACADAGDAAVVPGYEIESLERL
                     ELAVRAVVDAGVTPFGIGGDHSVTLAGLRAVAAKHGPLALIQFDSHSDTWDKYFAGQR
                     YSAGTPFRRAVEEGIVDPARSIQIGLRGSLFKPDDVSQSVELGFEVVTTDGMFEMGIP
                     ALAARIAERTGSHPAYLTFDLDFVDPAYAPAVETPEAGGPSAREALDLLRRIEGVNLV
                     GADVVELCPPYDGSSQISALLAATVMAELLALKASTES"
     gene            complement(173079..173747)
                     /locus_tag="Snov_0179"
     CDS             complement(173079..173747)
                     /locus_tag="Snov_0179"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="KEGG: rsh:Rsph17029_3475 polar amino acid ABC
                     transporter, inner membrane subunit;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="ADH87515.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /translation="MIEKIAVWWEGFAPYVPGFLAASWLVLVLSLLAILVSWGCGLIA
                     ALGKVSRFAALRKASEFYIWFIRGTPTLIQIFIIYFGLPQLGLRLSPFVAGVVALGFN
                     GGAYVAEIVRAGLSAIPKGQTESAQALGMGRWQMMTRIILPQVFRVILPPVTNEAITM
                     VKNTSLLSTITVVELTLYSQTIIATTFRPFEFYIATALIYLVMTSLISQAAAHAERHY
                     ARSL"
     gene            complement(173744..174553)
                     /locus_tag="Snov_0180"
     CDS             complement(173744..174553)
                     /locus_tag="Snov_0180"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: mrd:Mrad2831_5811 ABC transporter related;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87516.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MDGEPLIRIRDLRKSFGAHEVLKGVSLDVHAGEVVSIIGASGSG
                     KSTFLRCINVLEKPTGGTMDFGGFHFDYEQGARLQPTAAQLRELRARIGMVFQSYNLW
                     PHMTVLENVIEAPIRVKGETPAEARDKAEALLARIGLAEKRHAYPSKLSGGQQQRVAI
                     VRALAMQPKLMLFDEVTSALDPELVGEVLSLMASLAAEGMTMLLVTHEIGFAREVSNR
                     VIFFDQGVIAEDGHPREVLRQPRSERLQQFLRRVLHEDAYHAAPLTEGAAS"
     gene            complement(174553..175182)
                     /locus_tag="Snov_0181"
     CDS             complement(174553..175182)
                     /locus_tag="Snov_0181"
                     /inference="protein motif:PFAM:PF09347"
                     /note="PFAM: Domain of unknown function DUF1989;
                     KEGG: rsp:RSP_3746 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1989"
                     /protein_id="ADH87517.1"
                     /db_xref="InterPro:IPR018959"
                     /translation="MDYRLDDSLVLPAGRGWAVKMKAGQRLKLTNPHGTQAVDFWAFA
                     ERDIYEFTSMDHFRSFHSTIHVTKDTPVVSTKRRPLASIVEDTSSGKHDTLLCPCNAA
                     LYRQLGAEGHHRSCADNLHEGLAELGINLPFTPASVNLFMCVAVRADGSLDRLLPASA
                     PGSYVVIEAEDNIVMAFSCCPQDITPINGEDRTPRDCLIDIYSPIREAA"
     gene            175542..176282
                     /locus_tag="Snov_0182"
     CDS             175542..176282
                     /locus_tag="Snov_0182"
                     /inference="protein motif:PFAM:PF02682"
                     /note="KEGG: mrd:Mrad2831_5815 allophanate hydrolase
                     subunit 1;
                     PFAM: Allophanate hydrolase subunit 1;
                     SMART: Allophanate hydrolase subunit 1"
                     /codon_start=1
                     /transl_table=11
                     /product="Allophanate hydrolase subunit 1"
                     /protein_id="ADH87518.1"
                     /db_xref="InterPro:IPR003833"
                     /db_xref="InterPro:IPR010016"
                     /translation="MKTGPAPAPRLLDAGESGLVVEFGDAIDETINRQVIALADALAA
                     RELAGVREVVPTYRSLLVLFDPLVLAREDLREEVLALWPPPADAGEAHGIWRVPVLYG
                     GEHGVDLEHVAHVHGLTTQEVIDLHSGADYRVYMIGFAPGFAYLGGLPEAVHTSRRTG
                     PRMGTPPRSVSIGGKQTAVSPPLSIPSAWHLLGQTPVRSYDPARAERPFLFAAGDTIR
                     FVPIKAGEYERLCRAAEAGEIVAEWEPA"
     gene            176282..177319
                     /locus_tag="Snov_0183"
     CDS             176282..177319
                     /locus_tag="Snov_0183"
                     /EC_number="6.3.4.6"
                     /inference="protein motif:TFAM:TIGR00724"
                     /note="SMART: Allophanate hydrolase subunit 2;
                     TIGRFAM: urea amidolyase related protein;
                     KEGG: mrd:Mrad2831_5816 UreA amidolyase related protein;
                     PFAM: Allophanate hydrolase subunit 2"
                     /codon_start=1
                     /transl_table=11
                     /product="urea amidolyase related protein"
                     /protein_id="ADH87519.1"
                     /db_xref="InterPro:IPR003778"
                     /translation="MAAHLVIDRPGLFSSLQDFGRFGYQRFGISASGAMDSLALLAAN
                     LLVGNARGEAAIELTMLGLSATVEGGPLRMALAGADMPFSINGAAAEGWRAYELTPGD
                     RIDIGAARAGMRGYLAIAGGFDIAPTFGSLSTHSRSAIGGLEGRALRTGDRLPVRGAA
                     AGPLLTLARAHRPRGEGAVRVVLGPQDDLFTAKGIETFLSSDYRVTDKADRMGAQFDG
                     PEIEHADDFNIVSDGIMNGSVQVPGNGRPLVLLADRQTTGGYPKIATVIGPDLWRLGQ
                     ARPGDILRFAAISPEAAQAAALAHEKAIMTMAGQMTEVIRPGAALTSEWLLTHNLIDG
                     ICSATDPELSF"
     gene            177333..178103
                     /locus_tag="Snov_0184"
     CDS             177333..178103
                     /locus_tag="Snov_0184"
                     /inference="protein motif:PFAM:PF03746"
                     /note="PFAM: LamB/YcsF family protein;
                     KEGG: mrd:Mrad2831_5814 LamB/YcsF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LamB/YcsF family protein"
                     /protein_id="ADH87520.1"
                     /db_xref="InterPro:IPR005501"
                     /translation="MKTIDLNCDMGEGFGVYSLGDDKAMLDIVTSANIACGFHAGDPL
                     VMADTLASAKARGVGCGAHPSFMDLWGFGRRPILGQSVGEIEKQLIYQIGALQALAHA
                     QGFKLAHVKTHGSLGNMANEDIELARAVARAIKAVDPGFIFIVMPGLPTERAGEEMGL
                     KVAREIYADRAYADNGNLASRKLPGAVLHDAEAAAERVLRIVESGEVVSISGARIPVR
                     ADTVCVHGDTADAVAMARAVRTRLEGAGYGVRPMAEWL"
     gene            178254..179339
                     /locus_tag="Snov_0185"
     CDS             178254..179339
                     /locus_tag="Snov_0185"
                     /inference="protein motif:PFAM:PF01408"
                     /note="PFAM: oxidoreductase domain protein;
                     KEGG: lin:lin2932 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase domain protein"
                     /protein_id="ADH87521.1"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /translation="MRQVEVAVIGTGWCGGIRAETLSRSALVDRLHICEIRPERLEEV
                     RALTNPATATLDYQDIVHNDAIQVVYISTTPESTHFPIARDCLRAGKHVLLEKPIAME
                     LWEANELIELSRRNGVKFTIGYSQRFNPKIAYARKSIAEGTLGRVVNVMVSRHLSRNL
                     GKKIASRVKLSPAAMESTHDLDFVFWLLEPAKPVRVYSQGAYGYMQEINGSYDCMWST
                     VTMDNGALVVVGGGWNLPPAYPNYCGTWIEITGTEGALILDDTQRDNWLSTVSEGTRF
                     PMSTMPGEQVDHVFAGQMGPETIHFLESVLRDRPVMVEPEHARMVMQTYMAADLSAAI
                     NEPVDLPLSNQSIARIGDLNAAAIAAS"
     gene            179360..180115
                     /locus_tag="Snov_0186"
     CDS             179360..180115
                     /locus_tag="Snov_0186"
                     /inference="protein motif:PFAM:PF00392"
                     /note="KEGG: bxe:Bxe_A4083 GntR family transcriptional
                     regulator;
                     PFAM: regulatory protein GntR HTH; UbiC transcription
                     regulator-associated domain protein;
                     SMART: regulatory protein GntR HTH"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ADH87522.1"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011663"
                     /db_xref="InterPro:IPR011991"
                     /translation="MSDADPAVPEKPGRAARYSEIEAALRAEINAGTHPVGAHLPTEH
                     ELCARFAASRFTIRQALAGLREEGLIDARAGVGTIVLASRRRETFVHRLSSIEELLQY
                     PSETRRQHIRTDALAASPELAMLLKCRVGQPWVRLKALRLTQASLAPIAYFDIYVLPE
                     HAGVFDLPNPEGVSVLRQLEEMLNVRAAHAQVEIFVGHVTAELAEPLMARQDDPALVI
                     IRRYRGQDGAVFLVTYSVHPENRFTLNIEFERR"
     gene            180301..181437
                     /locus_tag="Snov_0187"
     CDS             180301..181437
                     /locus_tag="Snov_0187"
                     /inference="protein motif:PFAM:PF01408"
                     /note="PFAM: oxidoreductase domain protein; Oxidoreductase
                     domain;
                     KEGG: ypg:YpAngola_A2081 oxidoreductase, NAD-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase domain protein"
                     /protein_id="ADH87523.1"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /translation="MPRKSPRGIGLAIVGAGRVGLFRGAVAARHPAVEWIGLAEIDAE
                     KGRRIGAEIGADFVTTSHRELLKRPEVTAVIVATDEHLHVDPVMAALERDLPMLIEKP
                     LATHLDDSARVLREIEASGVDAVVGYTQRFRRRWLAAKEKVRTGALGDVTMVTSRAFM
                     NRLVAIDNYRRSNAPETISPMVISGTHALDIVMWYLEAKTPVEVYARSVDKVLGPDWR
                     GIDGTAGMIMMSDGSLYHLNISWALPVTWPGAVYSLEVGIVGTTGVLTIDDTHRDIVL
                     AVSAPQEEGYLPDKTRLVDFMGSYPPGDMALGELRGPMRTETESWLNRIALDLPTQHA
                     TAAEAHNRLMLTKALDLSAKLKRPVKLPLEVEGERELMREAAMA"
     gene            181505..182503
                     /locus_tag="Snov_0188"
     CDS             181505..182503
                     /locus_tag="Snov_0188"
                     /inference="protein motif:PFAM:PF03401"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: dia:Dtpsy_2869 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87524.1"
                     /db_xref="InterPro:IPR005064"
                     /translation="MNAAVTFTRRAGLALLAGATLAAAVPAHAQSDYPNQPITVIVPF
                     APGGASDFAARLLQPKLSEILGQQIVVENRDGAAGNVGMDLAARAKPDGYTLFLGNVG
                     TVSINPYIFSSLRVKPLQDFAPISIVADTPGLMIANPKFPPNNVKELVEYVKARPGQV
                     NFASPGTGSVNRLEMEAFRREAGLDMIHVPYKGGAGPAAADVMGGHVSLMFVTISSGI
                     NHVKGGRLKALGVTTKERVAQLPDVPTMTEQGFPKSVSSSWQGLLAPAGTPQPIIDKL
                     HAAVVEAMKDPTIRARMAESGVIAVSSPSPAEFKAYIKADADKWSGIIKEIGAKAD"
     sig_peptide     181505..181594
                     /locus_tag="Snov_0188"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 30"
     gene            182626..183072
                     /locus_tag="Snov_0189"
     CDS             182626..183072
                     /locus_tag="Snov_0189"
                     /inference="protein motif:PFAM:PF07331"
                     /note="PFAM: protein of unknown function DUF1468;
                     KEGG: mms:mma_0471 small permease component of tripartite
                     tricarboxylate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1468"
                     /protein_id="ADH87525.1"
                     /db_xref="InterPro:IPR009936"
                     /translation="MDIRISSDFLTGLLFCGLGAVAIIIGSDYPIGTAARMGAGYFPL
                     LVSSGLILLGGVLIIRSFVTETEEVGSIDIRPLALLIGSILLFGLLIEDWGFPVAGLA
                     VVIGARIAGRQYKPLETILLAVGLVGFCLVLFSYGLGLHLPATHLW"
     gene            183083..184591
                     /locus_tag="Snov_0190"
     CDS             183083..184591
                     /locus_tag="Snov_0190"
                     /inference="protein motif:PFAM:PF01970"
                     /note="PFAM: protein of unknown function DUF112
                     transmembrane;
                     KEGG: xau:Xaut_1332 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF112
                     transmembrane"
                     /protein_id="ADH87526.1"
                     /db_xref="InterPro:IPR002823"
                     /translation="MELFNELMLGFSVALTPANLLYGFLGVLLGTVIGVLPGLGPVAT
                     ISILLPVTFALPAPAALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTAIDGYQMAR
                     KGQAGLALATAALCSFIAGTLATLVIAVAAPALAEVALDFGPADYFSLMLFGLVAAVI
                     LAHGSIVKAIGMILVGILLGTIGIDANTSVERFTFGVPAFGDGIDFAVIAMGMFGIGE
                     TISNLEHKDSGRSFVKEVRGLWPGWADIKRFIGPALRGTALGGCLGLLPGGGPVLASF
                     STYALEKKLSKTPGEFGHGAIQGVAGPEAANNAAAQTAFIPMLTLGLPSSAVMALMIG
                     ALMMQGLSPGPQLMNQRPDLFWGLIASMWLGNLMLVVLNLPLIGIWVKLLSVPYRMLY
                     PAIMLFCCIGVYSINNNALDVVMAAVFGGFGYMMRRLHCEPAPLLLGFILGPMIEETL
                     RRALLISHGDPMVFIERPISLSFLVLTFLLLIVLVAPMIRVTRQRAFEESTD"
     gene            complement(184670..185629)
                     /locus_tag="Snov_0191"
     CDS             complement(184670..185629)
                     /locus_tag="Snov_0191"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: dac:Daci_4360 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87527.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /translation="MELRSIEAFVRVAELGSITRASRDLGIVQPALSRHIQRIETEIG
                     TPLLVRLPRGVQLTLAGRRFLQHSRRILQEVARAAEEMNIGGDCLSGRVVVGISPTLS
                     SLLTPGLIERCASTYPAINLTIVEEFTRRLQTDLVNGQVDLALLTNPPPNRALRFTAV
                     LTEPIVVVMPRHSRGVSPVVTLDELASTPMLVTRGIRAMVDEQLAPHGVCIEVDCEID
                     AVEAIRRMLLRGRGASIMPISAFRKEIDDGLLTGLAVGGVNLSRTIMLSHVGDKVSAA
                     AHAVMGLLRAEIDSLAQRGLFSALPDTSSHWAQPQQRGLAGAA"
     gene            complement(185693..186238)
                     /locus_tag="Snov_0192"
     CDS             complement(185693..186238)
                     /locus_tag="Snov_0192"
                     /inference="protein motif:PFAM:PF02627"
                     /note="PFAM: Carboxymuconolactone decarboxylase;
                     KEGG: bpy:Bphyt_5467 carboxymuconolactone decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Carboxymuconolactone decarboxylase"
                     /protein_id="ADH87528.1"
                     /db_xref="InterPro:IPR003779"
                     /translation="MDDLTAAPRYRELDPAHLDPAQRRIFEEIGRPRAGAVPAPFHIY
                     VESPELAETAQALGAFCRYRTGLPPRLSELAILTTAAHWGAEYEFGVHAREARKAGVP
                     EAEIEALAAGRRPHFTDPDAALVHDFAGAVYREKDVPDELFAAAVERFGRRTVIELTG
                     LLGYYSMIAIALRVFRVPPPA"
     gene            complement(186248..187270)
                     /locus_tag="Snov_0193"
     CDS             complement(186248..187270)
                     /locus_tag="Snov_0193"
                     /inference="protein motif:PFAM:PF01408"
                     /note="PFAM: oxidoreductase domain protein; Oxidoreductase
                     domain;
                     KEGG: jan:Jann_2956 oxidoreductase-like"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase domain protein"
                     /protein_id="ADH87529.1"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /translation="MIRAAIAGLGWWGKHMIRRMADSDELRIVAAIDTSDAQGAFAAE
                     HGIPLTTDWDDVLNDPSIDAVILCTPHSLHTAQVAMAARAGKHVFCEKPLALTRADAE
                     RSVAACRAAGVKLGIGHERRYEPAMLEIKRLVQSGALGTIMHVEANFSHDKLAAVPKT
                     DWRASTVDAPAAGMTAMGIHLTDGFIELFGPIDEVYASTATRATDRPNGDVVSVHTRF
                     ASGATGYLNAILVTPLYIGITVFGTDAWVEARNHTHPDTPGPTTLTLQHKDGRREVRD
                     YEWTDTVRANLEAFARSIESGTPYVFTDEQKVGNIAVLEAICRSVATNAPVKVEADRP
                     ALAASA"
     gene            complement(187317..188417)
                     /locus_tag="Snov_0194"
     CDS             complement(187317..188417)
                     /locus_tag="Snov_0194"
                     /inference="protein motif:PFAM:PF00296"
                     /note="PFAM: Luciferase-like, subgroup;
                     KEGG: jan:Jann_2939 luciferase-like"
                     /codon_start=1
                     /transl_table=11
                     /product="Luciferase-like, subgroup"
                     /protein_id="ADH87530.1"
                     /db_xref="InterPro:IPR011251"
                     /db_xref="InterPro:IPR016048"
                     /translation="MKLGFFTMPIHPLHRPLAETLQEDREFCLIAEKLGFCEGFFGEH
                     ITDGAETITSSLIFIAWLLNETSTIKLGSGTINLPNQHPARVAGEVAMLDHMAEGRYL
                     MGISPGGLLSDAEVFGNLDKDRTEMFVEAIDHVLAIWSEEPPYKRVGKHWTITTERTN
                     IPALGQGAIHKPYQRPHPPIVVTAVAPFSKGVTEAAIRGWDPISANFLLPVWVKTHWP
                     KYVEGCEKGGRPADPANWRVAKSIFVADDLATARRYATEPGSPYYAYYNSLATKLVGN
                     GRANLFKRDQSAPDSSVTVESVLADLVIWGTPDKVADELAAFEDEIGEFGTLLYAGHD
                     WADRGLAIRSLELMAEKVMPAVNAGRRSAAAE"
     gene            complement(188414..188971)
                     /locus_tag="Snov_0195"
     CDS             complement(188414..188971)
                     /locus_tag="Snov_0195"
                     /inference="protein motif:PFAM:PF01613"
                     /note="PFAM: flavin reductase domain protein FMN-binding;
                     KEGG: nfa:nfa12490 putative oxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase domain protein FMN-binding
                     protein"
                     /protein_id="ADH87531.1"
                     /db_xref="InterPro:IPR002563"
                     /db_xref="InterPro:IPR009002"
                     /db_xref="InterPro:IPR012349"
                     /translation="MSEHVIDFRSSDDHGHFRRALGRFATGVTVVTTRTADGKLEGLT
                     ANSFSSVSLDPPLVLWSLRRQAPSLSSFTAAGHFAVNVLGTHQKHLCRHFATPHADKF
                     DVVPHRIGDHGAPLIEDAIARFECRTEQVIEAGDHLIFLGRVLRATHRDGEPLIFATG
                     ALCSPALLPSDPPINDHSANRERAS"
     gene            189042..190016
                     /locus_tag="Snov_0196"
     CDS             189042..190016
                     /locus_tag="Snov_0196"
                     /inference="protein motif:PFAM:PF00126"
                     /note="PFAM: regulatory protein LysR; LysR
                     substrate-binding;
                     KEGG: jan:Jann_2940 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87532.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /translation="MAMSTTLRDVRLFVAAYEERSFTAAAERENATQSGVSQHIRKIE
                     DRFGVKLFARGGGSVQPTPAGESYYRHCIELLRLNEMANRSVGRFGAGLDGEMVVGLM
                     PTMTRSVLAPALARFVALHPNVGVRIWEAYSANLTQQVRAGELAFAIVPASTGTVGVK
                     TTRFAYTPEVLVSGAAAGREHMKALRLVDLGPLKVVVPSAQNARRASIETYLASNGVA
                     VERRLELDAMMGTLDFVASTDWVAILPGLMMAEEAARPVSPGTLRRFTVNPIADPPLG
                     MDLVRIEPARRPLSPAAAAFLDVLADETARVGGVWGERAGLYEEAGVS"
     gene            complement(189992..190450)
                     /locus_tag="Snov_0197"
     CDS             complement(189992..190450)
                     /locus_tag="Snov_0197"
                     /inference="protein motif:PFAM:PF07883"
                     /note="PFAM: Cupin 2 conserved barrel domain protein;
                     KEGG: mms:mma_0820 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin 2 conserved barrel domain protein"
                     /protein_id="ADH87533.1"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /translation="MSAPAATERGTINEGAFKAGDGAYLFQLDALSAIEGGPGYSTAI
                     GSVVEGIRTQCGLMRKARGTGARPHSHPNEQWNYVVQGRLRVNIEGEPERIAGPGTLI
                     YFPPNVTHYTIALPEEDVVFFVVKDTTHGIAGKAADGTMSGGHYDTPASS"
     gene            complement(190469..191563)
                     /locus_tag="Snov_0198"
     CDS             complement(190469..191563)
                     /locus_tag="Snov_0198"
                     /inference="protein motif:PFAM:PF02615"
                     /note="PFAM: Malate/L-lactate dehydrogenase;
                     KEGG: dsh:Dshi_2546 malate/L-lactate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Malate/L-lactate dehydrogenase"
                     /protein_id="ADH87534.1"
                     /db_xref="InterPro:IPR003767"
                     /translation="MNAAVKPEPGAAASLPSAALEGLIADAMRACDLPPEDARGVARL
                     MVEADLTGADGHGIFRLPQYVRRLKGGGVNPTPRIEVERAAPGVALVDGDNGMGHLVM
                     SVAVEHAVALAREIGVAWVGVRRSNHAGPAALYVDMLARRGMVGIYSVVASSNHMAIW
                     GGTSSLLGTNPLAIAIPAGEDAPPVLLDIATTVVSYGTVKKHVLNDIPLPEGWLVSKQ
                     DGSAITDPKRSGEGLLLPIGGHKGSGLALMLGLLAGTLNGAAFGSEVVDFNADSSTET
                     NTGHFLLALDVARFMRPEAFAALLAQQLNGLRADAPLPGTEGVRIPGDRRAALRETRA
                     RDGVPIAPPLRRQLDELATSLAIPPLDDRL"
     gene            complement(191560..191970)
                     /locus_tag="Snov_0199"
     CDS             complement(191560..191970)
                     /locus_tag="Snov_0199"
                     /inference="protein motif:PFAM:PF07883"
                     /note="PFAM: Cupin 2 conserved barrel domain protein;
                     KEGG: rhi:NGR_c25840 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin 2 conserved barrel domain protein"
                     /protein_id="ADH87535.1"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /translation="MSNAAILRPDQLPVTERGGGARTVRLVTAELGSQKLLNGITRFG
                     PGASIPLHSHNCEESVIILEGDAVFEIDGVTHELKTHDTTWIPPDVPHRFRNASDSAP
                     LAIFWTYADVAATRTMAATGETRSIASEHAGNGR"
     gene            complement(191967..192992)
                     /locus_tag="Snov_0200"
     CDS             complement(191967..192992)
                     /locus_tag="Snov_0200"
                     /inference="protein motif:PFAM:PF04909"
                     /note="PFAM: amidohydrolase 2;
                     KEGG: swi:Swit_1683 amidohydrolase 2"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase 2"
                     /protein_id="ADH87536.1"
                     /db_xref="InterPro:IPR006992"
                     /translation="MNAPVIDVHAHILTEEMMARMRREAPEIGPTLSEVDAEGGVLKV
                     GDIVQRPFPRGGWDLDRRFADLDHAGFDLQVLSNCPQTFLYEREAALTAALCQIQNEA
                     IADLVRRHPSRFLGIATLPMQDPARAANELRRAVTRLGLKGAQIGSHIEGRNLDDPAL
                     EPLWATAEELGAFILIHPQKTAAGERTKEFYLKNLIGNPLETTIAAASLVFGGVLERY
                     PDLRICLVHGGGFLPFQTGRMIHGWKERPECRRLIKESPEVSIRRLYFDTLTHFGPAL
                     RYLTDTFGAGHVLLGSDYPFDMGTLEGARQVRAAGLAPAEEAAILGGTAAGWFGLSAA
                     ERKAVRA"
     gene            complement(193002..194531)
                     /locus_tag="Snov_0201"
     CDS             complement(193002..194531)
                     /locus_tag="Snov_0201"
                     /inference="protein motif:PFAM:PF01970"
                     /note="PFAM: protein of unknown function DUF112
                     transmembrane;
                     KEGG: ach:Achl_0355 protein of unknown function DUF112
                     transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF112
                     transmembrane"
                     /protein_id="ADH87537.1"
                     /db_xref="InterPro:IPR002823"
                     /translation="MDALASLAHGFSVAMTPTNLLFVLIGVTLGQLIGALPGIGPSAG
                     MALLLPVTFGLEPVTALVMLSGIMYGGMYGGTLTSVLVNVPGEAASVMTAVDGNQLAR
                     QGRAGQALAAAAIGSFLAGIGAVTALAFLTPILSAFALGFSAPEYFLLALLGITATAS
                     LGTGSAVKAMIGATLGLMIALVGTDPIQGTSRLTFGSLELLEGIDFLPVAIGVFGIAE
                     ILVSMEQTQASRAVRTRLRDMWLTGKDWAECRMAMLRGGLVGFVIGLMPGAGPTVAAL
                     LAYIVEKKVSPHPEKFGHGALDGVAAAESANNSAAHGAMVPMLALGIPGSASTAVLLA
                     ALVLLGIRPGPMLLTEQADLVWGLIASMFVGNVILLVMNLPLAPLFASVLRIPYSYLA
                     PGILVVSLVGAYAISLSLFNVGLTLFFGMVGYLMIRADIPRAPLVLAVVLAPLMESSL
                     RQSLMLSEGSPAIFVERPLSAVLALLVLVSLALPLFNFLLARRAARRAGVEEALSHSS
                     D"
     gene            complement(194547..194999)
                     /locus_tag="Snov_0202"
     CDS             complement(194547..194999)
                     /locus_tag="Snov_0202"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: ddr:Deide_3p01370 hypothetical protein;
                     putative membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87538.1"
                     /translation="MRVTNFIVALALFALSAGVLLGTWDLPYWADFAPGSAFAPFWVA
                     TIGIILAIALFVATLAEDGSEPHQFPDRRGIARVTALVAGLWLMVLLIPLIGFLSASA
                     LLCLLLLLGIERRPVVPSLFATAVVISLVYGVFIAWLGIALPAGPFGI"
     sig_peptide     complement(194931..194999)
                     /locus_tag="Snov_0202"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.629 at
                     residue 23"
     gene            complement(195082..196104)
                     /locus_tag="Snov_0203"
     CDS             complement(195082..196104)
                     /locus_tag="Snov_0203"
                     /inference="protein motif:PFAM:PF03401"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: mms:mma_1291 tricarboxylate binding receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87539.1"
                     /db_xref="InterPro:IPR005064"
                     /translation="MIQPCAARPFHLQLKHSVLAAALGIALAAAPAALHAQTAPTGPI
                     EITTGTSPGGTPDVLMRRAAKILNEQKIVTNPLVVQNRTGGSWMVAANFVMGKKGDRN
                     VVLCIAQPILTTPITQGLPTLYDKLTPISMFIQGDLVLVVQPDSPVKDLKQLIEQAAK
                     RERSVKVAGAQSGSTDHMVAGLVEKAGKVKLNYVPFDGGGAAQAAFLGGNVELMTLTP
                     SEALPLVKSGKARILAILSSERSTAPELKDIPTAKEQGYDIVWGQAWGIAGPPGLDAD
                     TVKFWDDAIAKLVANPEWQASLKENFLRSRLIPAAEVKPYMQKLHDEHLALLRDLGLA
                     KQPAVQ"
     sig_peptide     complement(195994..196104)
                     /locus_tag="Snov_0203"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.993 at
                     residue 37"
     gene            196199..196372
                     /locus_tag="Snov_0204"
     CDS             196199..196372
                     /locus_tag="Snov_0204"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87540.1"
                     /translation="MKGIIETYIYRNGIPIIHIGMDKVFVSLYTEKYAARGAPARHVS
                     HWEVHVIGVYVLK"
     gene            196500..196619
                     /locus_tag="Snov_0205"
     CDS             196500..196619
                     /locus_tag="Snov_0205"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87541.1"
                     /translation="MSYILTYIRRYIRICFTQSGYVYCIHNPDNLDQMRGDER"
     gene            complement(196629..197636)
                     /locus_tag="Snov_0206"
     CDS             complement(196629..197636)
                     /locus_tag="Snov_0206"
                     /inference="protein motif:PFAM:PF02492"
                     /note="PFAM: cobalamin synthesis protein P47K; cobalamin
                     synthesis CobW domain protein;
                     KEGG: rce:RC1_0589 cobalamin synthesis protein CobW,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin synthesis protein P47K"
                     /protein_id="ADH87542.1"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /translation="MAIPVVLITGFLGSGKTTLLNHLLWDPEMGDTAVIINEFGDVAI
                     DHLLVESAIENAVVLQSGCICCTVRGDLVDTLDDLCAKVARGELPPFSRIAIETTGLA
                     DPASLVRTFLTERLLADRFTLRAVVTTVDAVNGAVQLDEFEEARHQAALADVIVLTKS
                     DLASPEAVASLTARLKEANPSAAIVPVVHGAIAPDTLFALVPAHPSRADDEVLAWLNS
                     EAFEETDGHAHSHHDSSIKPFAVTLDRPVTREALRSWLRSILSLRGADLLRMKGIVAL
                     KGEAAPIVVHAVQNALYPPVQLAAWPSDDHTTRIVFITRDIAPEALRNSLEVLASRSA
                     A"
     gene            complement(197658..198896)
                     /locus_tag="Snov_0207"
     CDS             complement(197658..198896)
                     /locus_tag="Snov_0207"
                     /inference="similar to AA sequence:KEGG:Avi_5158"
                     /note="KEGG: avi:Avi_5158 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87543.1"
                     /translation="MLDHTKAADVKIDLISGMKLIAHDPLAGFGGVGEGMSLQKAPDG
                     RRILWLAHEGPPKNFTGVDVTDPSRPKVIVQTDLPHNKVRSNSLETTGDVMAVAYQTY
                     QPGLQPAGIELFDISVPENPRSISFFDCSGPHSRGVHQVWFVDGEFIHCAAGAADFTP
                     RNPLDDQAYRIVDVRNPSKPVEAGRWWMPGTAEGDDAPPPERLKIDSGFRCHNTNVYP
                     ARPDRAYVGYIDGGFYVMDISDKSRPTVISRFNPNPPFPGFAHTLLPLFGRDLAVATH
                     ECIHDDGFDWPKLTWLLDIRREDNPVPLSTLPMPSFEEYSRKGGRFGCHNVHENPPRD
                     TALQSEALIFSTLFNGGLRVHDISDPLAPREVAAFVPSAPPGARVPAIQINEVYVDEN
                     GIVYCADRHAGGLYILELDI"
     gene            complement(199037..199780)
                     /locus_tag="Snov_0208"
     CDS             complement(199037..199780)
                     /locus_tag="Snov_0208"
                     /inference="protein motif:PFAM:PF07729"
                     /note="KEGG: azo:azo2437 transcriptional regulator;
                     PFAM: GntR domain protein; regulatory protein GntR HTH;
                     SMART: regulatory protein GntR HTH"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ADH87544.1"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /translation="MSLQPVVTNDDDATTLGIEIYARLRRDLIAGHHKPGERLRFRQL
                     SAAYSVGIAPLREALSRLVSDQLVRFEGHRGYTVAPLSLSDLNDLCALRTELSCNALR
                     RSIAQGDEDWEAEILAALHRLERAPLPHSVEDRKTVDEWEQRHDRFHYSLIAACGSPW
                     LLHFCGALSDHFQRYRRAVIVVTSSSEALLKRVREQHRTVAEAAIARDAERATTVLAE
                     HFRGSVEVVIRNYEEVSRSLSAGNGDDGR"
     gene            complement(199880..200572)
                     /locus_tag="Snov_0209"
     CDS             complement(199880..200572)
                     /locus_tag="Snov_0209"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: jan:Jann_2950 TetR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="ADH87545.1"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /translation="MAGRSSTSLAAGAKPPAPRRTRNKPEERHREFVRKAVELFAEVG
                     FEAGTRELAQRLGVTQPLLYRYFPSKDDLIAAVYQEIYVNRWKPEWREGLIDESRPIR
                     DRLIAFYEDYTETIFTPEWLRIYLFAGLRGVDINRRYAATVEAEILRPITVATRKSFG
                     LGDDDPPTPEEVELSWTLQGGIFYYGVREIVYRFPRTVDRATMIRNAVDTFLAGVGSV
                     MKRLAERESDPA"
     gene            complement(200607..201827)
                     /locus_tag="Snov_0210"
     CDS             complement(200607..201827)
                     /locus_tag="Snov_0210"
                     /inference="protein motif:PFAM:PF08028"
                     /note="PFAM: Acyl-CoA dehydrogenase type 2 domain;
                     KEGG: bja:bll6096 putative pigment protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase type 2 domain protein"
                     /protein_id="ADH87546.1"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013107"
                     /db_xref="InterPro:IPR013786"
                     /translation="MSHTIPLAAPRTIRSAAEQRHDELLQRATDLATAFAERAPRAEE
                     LSRLPPENERDLHESGLYRMLQPEAVGGSEVGYESLITIGAALAAGCASTAWNLTNLA
                     SHHWMLAMFAPAAQDRIWREDPDALIASSFVFPAAKVTKAPGGYVLSGRWPFSSGVDV
                     CSWNMLAGIVRAEGEAPDHRVFLVPRSDYRILDTWHVTGLKGTGSNDVQCEEVFVPEE
                     MSVSVEHLKGGLTPGSERHPAPLYRLPVFALFPAILSGVGLGNGEGALTAYVAATRKR
                     SANYTGARLAELQSIQIHIGNAATRLAHARRVMLAICEEAMRDAERGHVPDMVTKFAY
                     RRDLAYATKLTTKAVDEINAGSGAQALYLSGSQQRRFRDAHAISAHIAFSTDVANAAF
                     GRLALGLEVDNPVV"
     gene            complement(201840..202319)
                     /locus_tag="Snov_0211"
     CDS             complement(201840..202319)
                     /locus_tag="Snov_0211"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: glyoxalase/bleomycin resistance protein/dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="ADH87547.1"
                     /db_xref="InterPro:IPR004360"
                     /translation="MRATGLNHLSIGAKDVDASVRFYVEMFGMEVIPTYNFGFRTQYL
                     RCGDQQLHIFGLPDATPHYQHFAINVDDFMGVYERARDAGLIDHATFGNGVNEMPDGT
                     VQLYLRDPGGNLVEVDWPDVSSLDTGRIPELKRLADRFEQVGENLEATLFLDRRRRA"
     gene            202488..203804
                     /locus_tag="Snov_0212"
     CDS             202488..203804
                     /locus_tag="Snov_0212"
                     /EC_number="1.1.1.23"
                     /inference="protein motif:TFAM:TIGR00069"
                     /note="TIGRFAM: histidinol dehydrogenase;
                     KEGG: mno:Mnod_4267 histidinol dehydrogenase;
                     PFAM: Histidinol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="ADH87548.1"
                     /db_xref="InterPro:IPR001692"
                     /db_xref="InterPro:IPR012131"
                     /db_xref="InterPro:IPR016161"
                     /translation="MARHLKTARSVEERADADAQVRATVETILAEIEAGGDAAVRAYS
                     ERFDTWSPASFRLSEREIEKALSQVSKSDLDDIRFAQAQVRNFAEKQRACLTDLEVET
                     LPGVILGHKNVPVERVGCYVPGGKYPMVASAHMSVVTAKVAGVKSVVAAAPPFRNGPH
                     PAIVAAMHFAGADEILVLGGVQAVAAMALGTETIAPVDMLVGPGNAYVAEAKRQLYGR
                     VGIDLFAGPTETLVIADETVDAEICATDLLGQAEHGPTSPAILLTNSEKLARETMAEV
                     ERLLAILPTGEIASVAWRDFGEVIVCDDVEEMVREADRIASEHVQVMTADPDYFLANM
                     RNYGALFLGPRTNVAYGDKVIGTNHTLPTRRAARYTGGLWVGKFLKTCTYQKVTSDAA
                     SAEVGEYCSRLCVLEGFLGHAEQANVRVRRYGGGNVDYATAARRAG"
     gene            204067..204711
                     /locus_tag="Snov_0213"
     CDS             204067..204711
                     /locus_tag="Snov_0213"
                     /inference="protein motif:PFAM:PF07729"
                     /note="KEGG: met:M446_0530 GntR family transcriptional
                     regulator;
                     PFAM: GntR domain protein; regulatory protein GntR HTH;
                     SMART: regulatory protein GntR HTH"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ADH87549.1"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /translation="MKLVRNRVYEMVRREILSCAIVPGAELREADLAERFGVSKSPIR
                     DAMQKLELEGLVEIEPRRGHRVMPVSISDAADMLELRLILETAGVRKVALVATDAELA
                     GLDNFRDADTSSIPVFTEYNRRFHHHLAALARNRRLAEEMSRVMDLYERLCMVSLSAV
                     TAHGRNEGPLREHNDIIDALQARNGNAAARMLKRHIGRSQSQILRALESRPIVA"
     gene            204887..205687
                     /locus_tag="Snov_0214"
     CDS             204887..205687
                     /locus_tag="Snov_0214"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: ABC transporter related protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87550.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MNAIASQLVAASTSHIDPDIVISARDLVKAFNSEVVALDRASFD
                     IKRGSFVSLVGPSGCGKSTLLRLVAGLIGKSAGELSVLGHGVTGPSHDVGMMFQRPTL
                     LEWRTAVENVLLPTEVQGATTDADRRRAIELLQLVGLRDFEFSFPRQLSGGMQQRVAL
                     ARLLQTGANILLLDEPFGALDEFTRERLNLELLRIVDDVEATVLFVTHNISEAIFLAD
                     QVMVMTPRPGRLAKIVDVSFERPREIALMQTPEFNRLVGEVRSILGGH"
     gene            205689..206564
                     /locus_tag="Snov_0215"
     CDS             205689..206564
                     /locus_tag="Snov_0215"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: mno:Mnod_2985 binding-protein-dependent transport
                     systems inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87551.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MSLATDGNLSMTDVARERGGLAGRVMRHVALFLGVMLVWELASY
                     YQFVDPLILPRPTAIAAALVNMVLYQGTVWFHLGVTLWEAVAGFVIGSAIGIGLAVAA
                     GLNESFRRYISPYIIALQVTPRIALAPIVIAWLGFGMMPKIAIGALICFFPPFINTLT
                     GLLNVDEDANEMFRSLGARKRQIFFSLMLPNAMPIIMAGLKTAISLALIGAIVGEFIS
                     ASEGMGVLMQRYTFALNMASSFAVLVILTAMGYVLFLLMEWADNWLVYWRHDARMTAI
                     SRKKARAWGGVTGRR"
     gene            206673..207749
                     /locus_tag="Snov_0216"
     CDS             206673..207749
                     /locus_tag="Snov_0216"
                     /inference="protein motif:PFAM:PF09084"
                     /note="PFAM: NMT1/THI5 like domain protein;
                     KEGG: dsh:Dshi_2543 NMT1/THI5-like domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NMT1/THI5 like domain protein"
                     /protein_id="ADH87552.1"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="InterPro:IPR017909"
                     /translation="MLTDNIAFSRRNCLGLMAGTAAGLALGPFATRAARAQGLRAINV
                     IMPLPRSANFYPLIAGEALGYFEKEGVKVNLLPSSTTVPYVAFVQNGQAELAMLDAPQ
                     TFQSVQAGIPIKVVYEGMQRAPEGIAVSADSPITSVEQLKGTTVGLVSDRDRTTLAIA
                     LDTKGISIDDVKTVVVGEAGPTLANAFRKQTVSAISGAVPDWLSLQANGMKIRLITPS
                     EVADTPANSFVVNAARIDELRQPLIGFFRAWSKGMVVGKIDVETLAVMCRKAVPEEWE
                     NPTFGREFLDASIPMNYSVTPKLGDLQPEVWKRVQAPMVKLGELQKEIDPATFLDRSL
                     IDPANDFSREQVAADVAAWKAKSM"
     sig_peptide     206673..206783
                     /locus_tag="Snov_0216"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.973) with cleavage site probability 0.600 at
                     residue 37"
     gene            207812..208903
                     /locus_tag="Snov_0217"
     CDS             207812..208903
                     /locus_tag="Snov_0217"
                     /inference="protein motif:PFAM:PF04909"
                     /note="PFAM: amidohydrolase 2;
                     KEGG: pat:Patl_0847 aminocarboxymuconate-semialdehyde
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase 2"
                     /protein_id="ADH87553.1"
                     /db_xref="InterPro:IPR006992"
                     /translation="MDHSIIDTRTLGGSVNRYGPTSARAPAATPARLDTVTVDIHAHI
                     AVPEAHAYVAPHLDVGQIAMVKYSSDETRMVNQRQDQDRASTMVDMDDRLKVLDKLGI
                     DIQVVAPPPFQCYYTVDAEHGVKANRMVNDGIAAFVARRPDRFAGLGTLAMQDPASAP
                     AELERCVRVLGLKGVELLTNVNGRELSSPEYEPVFAKAEELGALLMIHPNGFTGGERF
                     TRFYFSNVIGNPLETTVALHYLIFDGVLERHPKLKLLAVHGGGFLPAYSGRIDHAWGA
                     RKDSNGGLPKPPTEYLRRVYFDSVVFTPHQLEYLVNTYGADHIVMGTDYPYDMADYDP
                     VQHVLSVESFDDETRAKVAGGTAAALLGL"
     gene            208906..209820
                     /locus_tag="Snov_0218"
     CDS             208906..209820
                     /locus_tag="Snov_0218"
                     /inference="protein motif:PFAM:PF01522"
                     /note="PFAM: polysaccharide deacetylase;
                     KEGG: jan:Jann_2944 polysaccharide deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="ADH87554.1"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /translation="MGLLSERAPYLAFPDRPRLHLPGEARVAVWVIVNVEEWSIARAM
                     PRTVLPPPMGQPLMPDLPNWAWHEYGMRVGFWRLLKAIEQRGLRATFAVNGHVCRSYE
                     RVARAARDAGWEFMGHGYVQQPMHNTEDQRAAIFDTVAAIRDFTGRPPPGWESPGLTE
                     NNETLDLLKEAGIGYVANWVIDDLPLELDTPHGPILSVPYSVETNDIVVHAVQHQPSD
                     AFNRRCVDQFDRLWEEGGDNAKVMAISTHPYLTGVPHRIGYFEQLLDYVCSRDQVALM
                     TGEEIAGWYRGEQARLGSERREARAARG"
     gene            complement(209785..210456)
                     /locus_tag="Snov_0219"
     CDS             complement(209785..210456)
                     /locus_tag="Snov_0219"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: aav:Aave_0904 methyl-accepting chemotaxis
                     sensory transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87555.1"
                     /translation="MIALAGPAPWPVPYGIDKMPTGPTSLDRFPRVLLHPGKVLRLND
                     EAFELPPPAIGQETVATDIRLADHLKRLSGTWNRPATLFIDGYFEHLRQVIAAHRTAI
                     VEHLAPVAGLFAPEDVLYSAPLPLPRALPPLPDGESVMVDMLFWLGGRAEAVLFAPSP
                     LLPAAERRRREGLAAVGIGVTVLTAGELVEPDTFAALLGEQGRAFWQDERLPSAPGGP
                     RLPPF"
     gene            complement(210453..211307)
                     /locus_tag="Snov_0220"
     CDS             complement(210453..211307)
                     /locus_tag="Snov_0220"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: aha:AHA_2938 taurine transporter subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87556.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MMNMAGAQPLARAPTSPTQKAPVPPAPRTLSPRMVDIGVQVAVV
                     AALAGLWEFGARFGALNPFLLPPLSVVLGRIWEDLIAGTVLVDLGLTLYRALAGFAIG
                     AVIGIPLGILMARSALVRWFFDPLVSIGFPMPKIAFLPIFILWFDIYDTSKIIMVAFS
                     CFFPIVAATYAGCSSLDKWPIWSARSFGAKERDLLWEVYLPMAMPQIITGLQVALPVG
                     MITTIVTEMLMGGRGVGGAMIMAGRFADSVGVFAGIVQIIILGFVVVKSLEIVRRRIL
                     VWHPESRR"
     gene            complement(211304..212101)
                     /locus_tag="Snov_0221"
     CDS             complement(211304..212101)
                     /locus_tag="Snov_0221"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: bja:bll6090 ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87557.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MSDILAGRRRPAGLAYAAVDLAVRFSPVLVLAVFWEFLGLSGIV
                     SQQMLPGLMEIFAAFVDMLVNGDLLYNTARSVSRAAAGLGAAVVVGVVVGLMMAQFRA
                     ARLLVNPIVQIFYPMPKSALIPVVMIWLGLGDSSKILLIFLGCLLPVVVGTYNGARGV
                     NPFLLWSASSLGASRLDVLHEVVLPAAMPDILNGCRTALAFSFILMVSSEFVIATDGV
                     GFMISSLGDGGQYPAMFAAIFFVAGIGFAADRIYAMLARHMLRWREA"
     gene            complement(212101..212931)
                     /locus_tag="Snov_0222"
     CDS             complement(212101..212931)
                     /locus_tag="Snov_0222"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: rci:RCIX444 putative ABC-type sulfonate
                     import system, ATPase component;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87558.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSVTTHAAASRQHAHTARGISIRDVSHTYGARTGGMLALDGIDL
                     DIGDGEFHCLLGPSGCGKSTLLYLIGGFIPVQAGTISTSSGTVVAPGPDRSIVFQNFA
                     LFPWKTVKDNVLYGLKKAGVAGAERERRAQRYIDMVHLTGFEDAYPSQLSGGMQQRAA
                     IARTLAVDPGILLMDEPFGALDAQTRRVMQEELRAIWRDSRKTVVFVTHDVQEAVFLA
                     DRISIMSARPGRIQHVINVDLPKDRGEEILENRDFIGLSEHIWRLVREQAVAATRGAH
                     "
     gene            complement(212928..213956)
                     /locus_tag="Snov_0223"
     CDS             complement(212928..213956)
                     /locus_tag="Snov_0223"
                     /inference="protein motif:PFAM:PF09084"
                     /note="PFAM: NMT1/THI5 like domain protein;
                     KEGG: bja:bll6093 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NMT1/THI5 like domain protein"
                     /protein_id="ADH87559.1"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="InterPro:IPR017909"
                     /translation="MATRRGALALAAALAALIAVPGAMPAAHADPVKIRIGWSTMPGH
                     LIPVLYSKPDILKHYGKSYTVEPIRFRGSSPQITAMAAGEIDMAAFGPLVLALAVTNA
                     RLDVKVVADIIQDGVDDYHSETFLVRSDSGISKVTDMKGKRVGTNAIGSASDTAIRAM
                     FRKNGMRDKRDYTMVEVAFPNIPAMLDEHKIDLGTVLQPMSKQLLATGKYKVLFTSED
                     AMGPSQLVFLAANGKFLEANRQAVLDFFEDHVRAVRWFTDPKNRAEAVKIIANFMQQP
                     PETLSHLFTREDYFRDPFMVPNVKSIQESIDIAVDLGLAPAGIKVEPDHVDLSFVKEA
                     QKRIEASQ"
     sig_peptide     complement(213867..213956)
                     /locus_tag="Snov_0223"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 30"
     gene            complement(214224..214982)
                     /locus_tag="Snov_0224"
     CDS             complement(214224..214982)
                     /locus_tag="Snov_0224"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: mrd:Mrad2831_0925 short-chain
                     dehydrogenase/reductase SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87560.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MSTSTQRTMIVTGGSKGIGAAIARAAGGAGFRVAFSYKGDAAGA
                     EQVARDIAAAGGEALTIKADVAREEDVLALFEQVDARFGPPDVLVNNAGGVGPLGRVE
                     AISASALTEVMAVNVVGSFLCCREAVRRMSTRHGGRGGIIVNISSRAAGLGGAGEWVH
                     YAASKGAVDSLTIGLAREVAAEGIRVNAVAPGLIATNLHAVAGAPDRLERLAPSIPMR
                     RPGTAEEVADVVMWLASPASAYVTGAVIPVAGGR"
     gene            complement(215042..215974)
                     /locus_tag="Snov_0225"
     CDS             complement(215042..215974)
                     /locus_tag="Snov_0225"
                     /inference="protein motif:PFAM:PF05853"
                     /note="PFAM: protein of unknown function DUF849;
                     KEGG: mlo:mll1033 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF849"
                     /protein_id="ADH87561.1"
                     /db_xref="InterPro:IPR008567"
                     /translation="MAAARKVIITCACTGAIHTPSMSPHLPITPDEIIADAIGAAEAG
                     AAILHLHARNPENGRPDQTPEAFGRFLPQIRQQTNAAINITTGGSPYMKVEERVLPAA
                     RFKPEVASLNMGSINFGLYHLLDRYKEFKFDWERQHLEATRDLVFRNSFKDIEYILET
                     CYDNGTRFEFECYDIAHLYNLKHFLDRGLVKPPLFVQSVFGILGGIGTHPEDIIHMKR
                     TADRLFGDQYRWSVLGAGASQLRVAAMAASMGANVRVGLEDSLWIGPGELAPSSGAQV
                     RKARQILEGMGLELASPDEAREILQLKGADRVDF"
     gene            complement(216055..217008)
                     /locus_tag="Snov_0226"
     CDS             complement(216055..217008)
                     /locus_tag="Snov_0226"
                     /inference="similar to AA sequence:KEGG:pRL80036"
                     /note="KEGG: rle:pRL80036 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87562.1"
                     /translation="MEINVGLAAIEEASRKLSNWGRWGKDDHSGTLNHVTPEHVVEAA
                     KLIRQGKVFALGIPLDREGPQNGLFGGRFNPIHQMLATGTDAVAGQQDWNKIRYADDT
                     LNLCVQGATHWDALGHIFYDDKAYNGHDPRLINSRGLNVLGIEHSKSKMNGRGVLLDI
                     ARFRGVDWLQDGESISNDELDACAKKQGVEIRKADFVIIRTGQMERCLAEGQWGGYAG
                     GDAPGVKFENCYWCAEKEVAAICSDTWGVEVRPNETTEANQPWHWVVIPAMGLCMGEI
                     FYVKELAEDCARDGVYEFFFCGPPLIITGGTGSPINPQAIK"
     gene            217371..218204
                     /locus_tag="Snov_0227"
     CDS             217371..218204
                     /locus_tag="Snov_0227"
                     /inference="protein motif:PFAM:PF00561"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: jan:Jann_2938 alpha/beta hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold protein"
                     /protein_id="ADH87563.1"
                     /db_xref="InterPro:IPR000073"
                     /translation="MTVTPKLDVTDIVVSRDAELAVRVDGADHLPWIVLSNSLAADLT
                     MWDDQIPFLTRSYRVLRYDTRGHGRSSAPNGPYSFDMLVADFIAVMDRFDVRQADVLG
                     LSMGGMTALGVGLAYPERVNRLICADARADAPPPFVAGWDQRIAAVAAGGMGAVLAGT
                     MERWFTAQTRQERPEIVDRAARMVLDTSPVGYAGCAEALKGLDYLRHLPRLEPETLYI
                     VGAEDGGAPPDAMRAMAAATPGAQFEILPRVAHISNMEDVAGFNARVAEFLDISRQAA
                     E"
     gene            218208..219101
                     /locus_tag="Snov_0228"
     CDS             218208..219101
                     /locus_tag="Snov_0228"
                     /inference="protein motif:PFAM:PF03446"
                     /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
                     KEGG: sme:SM_b20668 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase NAD-binding
                     protein"
                     /protein_id="ADH87564.1"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTSETKRTVGIVGLGIMGSAYARNLLERGYEVVGTDVAEAAMAE
                     LAGQGGRRVGSARAVAEAADIVLLALPSVKALEAVTAEIAGAVRPGAVVCEMGTLPID
                     AKEACRRALEARGAQLLDCPVSGTGAQAAKRDLSIYASGDEAAFRKVEAAFADFARDV
                     RYCGGFGTGMKLKYIANLLVTIHNLSTAEALLLAERAGLDLNLVYDAIRPGAGGSRMF
                     DVRAPMMIEERYEPATMKMDIYIKDLQLIMDFAREMRAPTPLMAASLPFYFAALAQGR
                     GKEDTASLFAVLKGMTGPAED"
     sig_peptide     218208..218276
                     /locus_tag="Snov_0228"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.884) with cleavage site probability 0.884 at
                     residue 23"
     gene            219107..219544
                     /locus_tag="Snov_0229"
     CDS             219107..219544
                     /locus_tag="Snov_0229"
                     /inference="protein motif:PFAM:PF03928"
                     /note="PFAM: protein of unknown function DUF336;
                     KEGG: pnu:Pnuc_0551 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF336"
                     /protein_id="ADH87565.1"
                     /db_xref="InterPro:IPR005624"
                     /translation="MSAVSLDQADIAARVALETARARSAQPLTVVVLDAGGHVVVARR
                     EDGSGIARFEIAFGKAWGALGMGISTRGLAARAAKMGTFFNALAAVTDGRMVPVPGGV
                     LIRDGANRIIGAVGISGDTSDVDEACAVAGVEAAGLVADIEER"
     gene            219546..220268
                     /locus_tag="Snov_0230"
     CDS             219546..220268
                     /locus_tag="Snov_0230"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: ara:Arad_12307 short-chain alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87566.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTRLDGKTAVVTGAGRGIGRATALALAQAGAHVVAVARTQADLD
                     QLAREGEGRIEPLAADVRDEDFLARIEAMGDLDILVNNAGGNRPKMMVDVDDETLDWM
                     IDLNIRSVYRVARAAARAMGEGGVIVNMSSQMGHVGSPRRTVYCMTKHAVEGLTKAMA
                     VELAPRGIRVVSIAPTFVVTPMTQGMFEDAEFKRFVYDMVPMNDLPVPEDIAQSILFL
                     VSPGARFITGDSLRVDGGWTAR"
     gene            221025..221750
                     /locus_tag="Snov_0231"
     CDS             221025..221750
                     /locus_tag="Snov_0231"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: bbt:BBta_3436 putative ABC transporter,
                     ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87567.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSDVSPPPAPVFHARGLSKTYVMGDVEVHALRSVDLDIFEREFV
                     VLLGPSGSGKSTLLNILGGLDAPTSGEANWRDHNLVGADDAELTRYRREHVGFVFQFY
                     NLIPSLTVLENVALVTEIASHPLNARDALALVGLEHRLDHFPSQLSGGEQQRVAVARA
                     IVKSPDVLLCDEPTGALDYETGKVVLAAIVRANQQLGTTTVIITHNAAISGMADRVLR
                     LGGGRIVGEERNPRRLSPDEVHW"
     gene            221747..224110
                     /locus_tag="Snov_0232"
     CDS             221747..224110
                     /locus_tag="Snov_0232"
                     /inference="protein motif:PFAM:PF02687"
                     /note="PFAM: protein of unknown function DUF214;
                     KEGG: bbt:BBta_5376 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF214"
                     /protein_id="ADH87568.1"
                     /db_xref="InterPro:IPR003838"
                     /translation="MSLLDRKLLRDISTMRGQVVTISLVIAAGIAVFVASISTYDSLL
                     SARDRFYLNARFPQVFVTLKRAPLSLLSQINEIAGIVTAEPRIVRELIVDSPASVLPI
                     SARMVSIQNGGDESLVRLHMRRGTAPLPGDAKSVAINEAYADASGIVPGDDIRILLNG
                     RVQTFRISGTALSAEYVYSVKPGLPIPDDRLYATIWVDRSAVEAAFDLKGAFNDLVVF
                     VAPGTDPQAVIAELDRLLEPYGSVGAIERRDQPSNRFLDDELNQQRVMSITIPFIFFG
                     VAAFLLNVVLGRLVAAQREQIAALKALGFSAVPIGMHYIKLVAVIVLIGSLLGIACSV
                     AFGEAMIAAYRGFFRLPVFTFELTPWSLVAGTAVSFAMASLGVLSAVRNVLVLPPAVA
                     MRPVAPLRFRRLRLEGLMTAFGYTPQRMMIVRNLAGRPVRTALTVIGIAFAVPMVVLG
                     LFWRDAIDHMIDVQFNLVERGNVAVTFPHPFDRGIIYDLARQPGVLAAEGQRIVPVRL
                     RASQRSYLTSVIGLPTGSELRRPHDASLRPIDVSAEGITLTRRLAERLDVDLGQVVTI
                     EVMEGRRLRRDLPVGAIVDELIGMASYMQMDAINQLTGEGDVVSAAALFVDPAALSDL
                     LRRFKDLPVIESVAVKSYTLSSFMAKIAGLVFVSAGILTAFGIIIAVGVVYNSARIGL
                     QERAWELASLRVLGFSGAEVSRILFSEFAFEIALGVPLGLLTSRAIISLIAQFHSNES
                     FQIPGVIGPRTYAAAGLVVVLAALASAYVVRRQIDRLDLVAALKTRD"
     gene            224113..225312
                     /locus_tag="Snov_0233"
     CDS             224113..225312
                     /locus_tag="Snov_0233"
                     /inference="protein motif:TFAM:TIGR01730"
                     /note="TIGRFAM: efflux transporter, RND family, MFP
                     subunit;
                     KEGG: bbt:BBta_3438 putative secretion protein HlyD
                     precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux transporter, RND family, MFP subunit"
                     /protein_id="ADH87569.1"
                     /db_xref="InterPro:IPR006143"
                     /translation="MRITVGRGIGLLLLLIAVAGVVWAVLPRPIPVETSKVTKGHFVA
                     TVDDDGNTRIRERYVVAAPLAGRLTRVQLKAGDRASTGDVLASILPSPAPFLDPRSRR
                     ESQERLGAAEAALERAKAMVERARAQAVQAEQELTRTRTLVERGASTMQALERAELAK
                     RVADRDLRAAAFQLHAAEHELDQARALLAQYSDGAKEIPETWSVTAPITGIVLKVNQE
                     SETIVQPGTPLLELGDPRDIEIVVDVLSTDAVEIRPGARVTIEHWGGPNALEGRVRRV
                     EPAAFTKISTLGVEEQRVNVLIDIVSPPDRWSGLGEAYQVDAKIAVFGLEDATIVPAG
                     ALFRRDDTWHVFTVENGRAQLTPVVVLRRSARSAAIGSGLVLGQSVIVYPSDRIEAGV
                     SVKTSSK"
     sig_peptide     224113..224187
                     /locus_tag="Snov_0233"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.973) with cleavage site probability 0.969 at
                     residue 25"
     gene            225515..226117
                     /locus_tag="Snov_0234"
     CDS             225515..226117
                     /locus_tag="Snov_0234"
                     /inference="protein motif:PFAM:PF01381"
                     /note="KEGG: mrd:Mrad2831_5929 XRE family transcriptional
                     regulator;
                     PFAM: helix-turn-helix domain protein; Cupin 2 conserved
                     barrel domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, XRE family"
                     /protein_id="ADH87570.1"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /translation="MQAEPVEIEDSVADQLRILAAELRRHRKDRQLSLEALSLLSGVS
                     RSMISKIERGETVPSTGTLSRLAEALGTTFSQLMAHPVESEIIVIPADRQPILSDTAS
                     GYHRRCISPVLPGRGVDWVINTLPALGTSGEFVAHRRGVEEYIYVLKGRLEARVGARR
                     VTLETGDALYFQAHETHQFTNLEAGECEYFLIINSSGLRG"
     gene            226180..226566
                     /locus_tag="Snov_0235"
     CDS             226180..226566
                     /locus_tag="Snov_0235"
                     /inference="protein motif:TFAM:TIGR00004"
                     /note="KEGG: mrd:Mrad2831_5927 endoribonuclease L-PSP;
                     TIGRFAM: endoribonuclease L-PSP;
                     PFAM: Endoribonuclease L-PSP"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="ADH87571.1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR019897"
                     /translation="MTERRLISTPAAPPAAGPYSQAVTAGNLVFVAGQLPLDLSGAVP
                     EGVEAQTRQSLANVTAVLDAAGASAASVLKTTVFLKNMNDFAAMNAVYAEVFGTSLPA
                     RSTIEVARLPRDVLVEIECIALSGQA"
     sig_peptide     226180..226248
                     /locus_tag="Snov_0235"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.864) with cleavage site probability 0.672 at
                     residue 23"
     gene            226577..227071
                     /locus_tag="Snov_0236"
     CDS             226577..227071
                     /locus_tag="Snov_0236"
                     /inference="similar to AA sequence:KEGG:mma_0888"
                     /note="KEGG: mms:mma_0888 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87572.1"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR011037"
                     /translation="MTDWKGGVLLHIHIAPAASYEMEELAEANLVAGRGIEGDRYFLG
                     TGTYSPKPDIREVTLIEIEALEALAKNDPPLQQSPITLDPADHRRNLTTRGVPLNHLV
                     GKRFRVGETVLRGGRLNFPCKYLEELLGMPVFLPLYNRSGLNCSIETGGIIRPGDPIE
                     PLDD"
     gene            227078..228031
                     /locus_tag="Snov_0237"
     CDS             227078..228031
                     /locus_tag="Snov_0237"
                     /inference="protein motif:PFAM:PF00111"
                     /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
                     protein; oxidoreductase FAD/NAD(P)-binding domain protein;
                     KEGG: mrd:Mrad2831_5925 ferredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="ADH87573.1"
                     /db_xref="InterPro:IPR000951"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /translation="MTARMIMKLDVAERVDDATDVILVSLRHPRRPALPAWKAGAHID
                     VHLPDGRIRQYSLCGDPADRTRYRIAVKREMAGRGGSAWIHETLAVGDAVHCSAPRNN
                     FALAPQAGRHLFIAGGIGVTPLAALAYEALQRGDAFELHLRARSRRHAPLLAELERAF
                     AGHLHLHLDDEAPASLDDILAWFGVTADAHLYFCGPAGLNAAIAAAAERQSWAAERCH
                     TEVFQPTLDENFKPEPFDITIASTGQTLRVPADRSALDILRANGFVMPSSCELGVCGA
                     CICGYRDGTVIHRDSVLSLADRQDKLTPCVSRARVGVTLEL"
     gene            228082..229425
                     /locus_tag="Snov_0238"
     CDS             228082..229425
                     /locus_tag="Snov_0238"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: mrd:Mrad2831_5928 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="ADH87574.1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR017871"
                     /translation="MEDLTVSLSTMDAGADVPAVPTGSLSPGERRKVVWSSVIGTTVE
                     WYDFLIYGTAAALVFNKLFFPSFDPVVGTIAAFGSYAVGFLARPLGGAVFGHFGDKLG
                     RKAMLSLTIIIMGAGTFLIGCLPSYDQIGIWAPILLVALRLVQGLGIGGEWGGAVLMV
                     VESVPDNRRGFFGSIVQLGYPLGVLASIGVFAMATKLPEAEFLSWGWRIPFLASALLV
                     VVGLFIRLRLHETPAFQRVKKQNTVSKLPLVEILTRHPRTFLTAVGLKVSEIAYVSVV
                     TVFSISYVTVQLGLPRSVILNGLLIAAFIELFTIPLFGWMADRFGRRVMFVFACLFSI
                     VFAFPLFWLFDTADPTVIAITVAIALSLGQGVMFAIGAAWMSELFDARLRYSGASLGF
                     QVGAALSGGFTPIIAAALLAWSGATWPISIYLVILALITLWATFCAPETAGKKID"
     gene            229523..229819
                     /locus_tag="Snov_0239"
                     /product="hypothetical protein"
                     /pseudo
     gene            complement(229982..230058)
                     /locus_tag="Snov_R0003"
                     /note="tRNA-Arg4"
     tRNA            complement(229982..230058)
                     /locus_tag="Snov_R0003"
                     /product="tRNA-Arg"
     gene            230297..231139
                     /locus_tag="Snov_0240"
     CDS             230297..231139
                     /locus_tag="Snov_0240"
                     /inference="protein motif:PFAM:PF00899"
                     /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
                     MoeZ/MoeB domain protein;
                     KEGG: xau:Xaut_4128 UBA/ThiF-type NAD/FAD binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UBA/THIF-type NAD/FAD binding protein"
                     /protein_id="ADH87575.1"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTTTDAPAPARASVFSADEVERYARHLVLAEIGGPGQQKLKKAS
                     MLVVGAGGLGAPALLYLAAAGVGRLVVIDDDIVSLSNLQRQVIHTTERIGQPKTESAG
                     ALVAALNPHVVFEGVDARITADNAMELVSSVDVVIDGSDNFSTRYLVSDACALAGRPL
                     VTAALGRFDATVTTLRPHEKNADGTPNPTYRCLFPEPPPAGTVPTCAEAGILGALAGV
                     AGSLVALEAVRAVVGFGEGLVGRLLMIDTMSMRFETLSYGWDPDNPLTGESPTITDLS
                     AHRR"
     gene            complement(231200..232201)
                     /locus_tag="Snov_0241"
     CDS             complement(231200..232201)
                     /locus_tag="Snov_0241"
                     /EC_number="1.1.1.26"
                     /inference="protein motif:PRIAM:1.1.1.26"
                     /note="KEGG: xau:Xaut_4126 glyoxylate reductase;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
                     catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxylate reductase"
                     /protein_id="ADH87576.1"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /translation="MARKKPLVVVTRRLPDKIETRMRELFDARLNVDDVPMSQEQLAE
                     AMATADVLVPAICDRIDAKVIEAAGPNLKLIANFGNGVDHIDVAAANARGITVTNTPG
                     VLTEDTADMTMALILAVPRRLTEGAALITSDDGTWPGWSPMWMLGHRIWGKRLGIIGM
                     GRIGQAVARRAKAFGLQIHYHNRRPLPAHIEEDLEATYWDSLDQMLARMDILSVNCPH
                     TPATFHLLSARRLKLIRPDAYIVNTARGEVIDEHALIRMIENGEIAGAGLDVFEREPA
                     VSPKLLKLARAGKVVLLPHMGSATVEARVDTGEKVIVNIKAFMDGHRPPDRVLPAML"
     gene            232410..233045
                     /locus_tag="Snov_0242"
     CDS             232410..233045
                     /locus_tag="Snov_0242"
                     /inference="protein motif:PFAM:PF06347"
                     /note="PFAM: protein of unknown function DUF1058;
                     KEGG: azc:AZC_0237 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1058"
                     /protein_id="ADH87577.1"
                     /db_xref="InterPro:IPR010466"
                     /translation="MDGLRGRAKLRNWAFGLAAGLLVAGLAAGTLGHAQEEPASGESP
                     GASSGASSGDSSGEAPGAANGPTGRASGLPVPRFVSLKADKVNVRSGPTRDHAVAWVF
                     TRAGLPVEITAEFETWRRIRDSDGAEGWVYHSMLSGRRTALVSPWKAGEPTPLYADPD
                     KSSAVKAKLEPGVLGKVEHCDGKWCRFFENGFDGFVAQERLWGVYPGEKIE"
     sig_peptide     232410..232514
                     /locus_tag="Snov_0242"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.971 at
                     residue 35"
     gene            complement(233052..233462)
                     /locus_tag="Snov_0243"
     CDS             complement(233052..233462)
                     /locus_tag="Snov_0243"
                     /inference="protein motif:PFAM:PF01361"
                     /note="PFAM: 4-oxalocrotonate tautomerase;
                     KEGG: bja:bll5259 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="ADH87578.1"
                     /db_xref="InterPro:IPR004370"
                     /translation="MPMIQIKFSSPSPTPRMEAALAGRAAQLAEEWLGKDPAVTAVLV
                     ERADPSCWFCGGRSLAEARLAAFWLDIRVTEGTNTKDEKAAFVAACFEAFAALLGPLH
                     AESYVHVVEARGDAYGYGGVTQERRYIAARPAAA"
     gene            233557..234402
                     /locus_tag="Snov_0244"
     CDS             233557..234402
                     /locus_tag="Snov_0244"
                     /inference="protein motif:PFAM:PF00126"
                     /note="PFAM: regulatory protein LysR; LysR
                     substrate-binding;
                     KEGG: bja:blr5260 transcriptional regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87579.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /translation="MTDRPLDLELVRAFVHVAELSSFTRAAEALGSTQAGVSLRLRKL
                     EDRLGRTLLERTPRLVRLTPDGAQFLERARRLLAADRDARLWGAPSVQRLRLGISDHT
                     TGDTLPGLLSRLAAVSPEVVFDIRMGFSRVLLDAFDAGELDAIVVRREGDRRAGEMVR
                     QDRYGWFAAGEARRGSAPLPLALLAAPCGVRAAATGALDAAGIAWREAFTGGSVSSVA
                     AAVAAGLAVAPMAAHLAPAGSVDVGPALGLPALPSAKVMLIARAADAPTRAALCELAA
                     FLRAG"
     gene            complement(234513..235037)
                     /locus_tag="Snov_0245"
     CDS             complement(234513..235037)
                     /locus_tag="Snov_0245"
                     /inference="protein motif:PFAM:PF01475"
                     /note="PFAM: ferric-uptake regulator;
                     KEGG: xau:Xaut_3845 ferric uptake regulator family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator, Fur family"
                     /protein_id="ADH87580.1"
                     /db_xref="InterPro:IPR002481"
                     /translation="MNEGFRPHNVAISRVVVEEEPVLPVARLRDSSAARTGCPFHDVR
                     HMLRDVGLRPTRQRLALGWLLFAKGDRHVSAEILHEEAIKARFPVSLATVYNTLHQFT
                     EVGLLRELAVDGSKTYFDTNPSDHHHFFLEGENNLVDIPSAAVEVERIPEPPEGFEVA
                     RIDVVVRLRPKRRS"
     gene            235481..235990
                     /locus_tag="Snov_0246"
     CDS             235481..235990
                     /locus_tag="Snov_0246"
                     /EC_number="4.2.1.59"
                     /inference="protein motif:TFAM:TIGR01749"
                     /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
                     dehydratase FabA;
                     KEGG: azc:AZC_4642 3-hydroxydecanoyl-(acyl carrier
                     protein) dehydratase;
                     PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
                     FabA/FabZ"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-hydroxyacyl-(acyl-carrier-protein)
                     dehydratase FabA"
                     /protein_id="ADH87581.1"
                     /db_xref="InterPro:IPR010083"
                     /db_xref="InterPro:IPR013114"
                     /translation="MVERQTSFNYEELLACGRGELFGPGNAQLPAPPMLMFDRITEIS
                     DDGGPNGKGHVRAELDVKPDLWFFACHFLGDPVMPGCLGLDAMWQLVGFHLGWLGAPG
                     RGRALGAGEIKFSGQVLPTVRKVVYGIDFKRVMRSKLVLGIADGWLEADGEVIYRASD
                     LKVGLFQTA"
     gene            236052..237272
                     /locus_tag="Snov_0247"
     CDS             236052..237272
                     /locus_tag="Snov_0247"
                     /inference="protein motif:PFAM:PF00109"
                     /note="PFAM: Beta-ketoacyl synthase;
                     KEGG: azc:AZC_4643 3-oxoacyl-(acyl-carrier-protein)
                     synthase I"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-ketoacyl synthase"
                     /protein_id="ADH87582.1"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR018201"
                     /translation="MRRVVVTGMGIVSSIGNSTQEVLASLREGKSGIVRADSYAELGF
                     RSQVHGAPQLDASAIVDRRAMRFHGGGTAWNHVAMDQAIRDAGLEENEISNERTGIVM
                     GSGGTSTRTIVEAADITRKNNSPKRVGPFAVPKAMGSTASATLSTWFKIKGINHSISA
                     ACATTNICIGSAAEQIQWGKQDIVFAGGCEDLDWTLSCLFDAMGAMSSDYNDTPAVAS
                     RPYDKNRDGFVISGGAGVLVLEELEHAKARGARIYAEIIGYGSTSDGADMVAPSGEGA
                     ARAMQLAMKGVKGGIDYINPHATSTPIGDLKEIEAIRAVFGAHAPPISATKSLTGHSQ
                     GATGVHEAIYSILMMQNGFIAASAHIDELDPAFADMPIVRERVDNARLERVLSNGFGF
                     GGANAVLVFQHPDA"
     gene            237304..238155
                     /locus_tag="Snov_0248"
     CDS             237304..238155
                     /locus_tag="Snov_0248"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: xau:Xaut_0052 enoyl-(acyl carrier protein)
                     reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87583.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MGLMQGNLMNGKRGLIMGVANDHSIAWGIAKTLAAQGAELAFTY
                     QGEALGRRVRPLAESLGSDTLISCDVEDLDSVDAVFAALKEKWGSIDFLVHAIGFSDK
                     NELKGRYADTTRANFTRTMVISCFSFTELAKRAAAIMPNGGSVITLTYGGSTRVMPNY
                     NVMGVAKAALEASVRYLAADYGPQGIRVNAISAGPIRTLAGAGIADARLMFNYQKRNA
                     PLRRTVTIDEVGGSALYLLSDLSSGVTGEVHFVDSGYNIISMPHPDALKTIEDAEERA
                     AGEVAAE"
     gene            complement(238185..239666)
                     /locus_tag="Snov_0249"
     CDS             complement(238185..239666)
                     /locus_tag="Snov_0249"
                     /inference="protein motif:PFAM:PF01979"
                     /note="PFAM: amidohydrolase;
                     KEGG: rhi:NGR_c28580 putative amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="ADH87584.1"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR017909"
                     /translation="MFSRSPPTPASFTCIDATAAPLDHAGCLCHRPEIGALSRRLGAG
                     LSRRGFVAGMAASLAAASLGVPGPARAQAGPNRVLFTNVRLFDGTSGTLREGVSLLVE
                     DKIVKAIASGTPAAPEGAQVIDGGGRVLMPGLIDMHWHAMFAALPIHVIATADIGYIF
                     LAAAAEAERTLMRGFTTIRDLGGPSFALKQAIDEGLIAGPRIYPCGAMITATGGHADL
                     RPTSELPRAAGTPGATEQSGANAIADGEAEVLLRVREQLLQGASQIKMVGGGGVSSPR
                     SPLDASTFTESEMRAAVQAAGDWNTYVASHAYAPQTIRRSLDAGVTCIEHGHLMDEEI
                     AAQMAEKGIWLSTQPFLSAEDATPLTGPSRERMLQVFAATRTVYPLAKKHGIKTAFGS
                     DLLFSAVLARRQGTMLTHLAEWYSAAEALTMATATNAELLTLSGPRNPYPGTLGVLRE
                     GAFADMILVDGNPLEDLSLMADPEAKFLVIMKDGRIHKDTLGR"
     gene            complement(240511..241359)
                     /locus_tag="Snov_0250"
     CDS             complement(240511..241359)
                     /locus_tag="Snov_0250"
                     /EC_number="4.2.1.51"
                     /inference="protein motif:PRIAM:4.2.1.51"
                     /note="KEGG: azc:AZC_0138 prephenate dehydratase;
                     PFAM: prephenate dehydratase; amino acid-binding ACT
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Prephenate dehydratase"
                     /protein_id="ADH87585.1"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR018528"
                     /translation="MTTRRIVFQGEPGANSHIACREVYPDHEAVPCPTFEDAFAALQN
                     GEADLGMIPIENSVAGRVADIHHLMPTSGLTIVGEFFLPLSHQLMAVKGATLATVKTV
                     ESHVMALGQCRNIIRKLGLKPIVDADTAGAARLVAEAGDPTRAAVASRLAAEIYGLDI
                     IAENIEDEAHNTTRFVILAKEGEWAPANNGPTVTTFVFRVRNVPAALYKALGGFATNG
                     VNMTKLESYQLDGEFFATQFYADVDGHPDDRALKLALEELSFFSKEVRILGVYPAHPY
                     RIALRA"
     gene            complement(241370..242125)
                     /locus_tag="Snov_0251"
     CDS             complement(241370..242125)
                     /locus_tag="Snov_0251"
                     /EC_number="2.7.7.38"
                     /inference="protein motif:TFAM:TIGR00466"
                     /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
                     cytidylyltransferase;
                     KEGG: azc:AZC_0137 3-deoxy-D-manno-octulosonate
                     cytidylyltransferase;
                     PFAM: acylneuraminate cytidylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonate
                     cytidylyltransferase"
                     /protein_id="ADH87586.1"
                     /db_xref="InterPro:IPR003329"
                     /db_xref="InterPro:IPR004528"
                     /translation="MSSQDTLILIPARMASTRLPGKPLADLGGRPMIVEVARRSAAAN
                     IGRVVVATDDEGVRKAVENAGFAVVMTRADHTTGSDRIFEALGHVDPERRVSRIVNVQ
                     GDLPTIDPALIRSAVDLLDDPAVDIGTLAAQITVEAERTNPNVVKAVGSPLSPSRLRA
                     LYFTRATAPYGEGPLFHHIGLYAYRRAALERFVALPPSPLESREKLEQLRALEAGMRI
                     DVAIVDTVPLGVDTPEDLERARELLAREAKTAK"
     gene            242343..242984
                     /locus_tag="Snov_0252"
     CDS             242343..242984
                     /locus_tag="Snov_0252"
                     /inference="protein motif:PFAM:PF00034"
                     /note="PFAM: cytochrome c class I;
                     KEGG: azc:AZC_0136 cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="ADH87587.1"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /translation="MDGFELNKIAGAVLGVLTFTVGLNVFSDILFTTHAPEKPGFEIA
                     VQEASSGSAQAAAPADVPIAQLLATASVEKGAAQAKKCAACHNFQEGAGAKVGPDLYA
                     VVGRAVASAPGFAYSAAMKAHGGEWTFEQLNNFIKNPKADIPGTAMGFAGIAKESERA
                     DLLVYLNTLSHNPLPLPKPEEAAPAAAPAAAPAGEKPAEPAPAAPAPAAPAHP"
     gene            243159..245066
                     /locus_tag="Snov_0253"
     CDS             243159..245066
                     /locus_tag="Snov_0253"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: azc:AZC_0135 ABC transporter substrate binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 5"
                     /protein_id="ADH87588.1"
                     /db_xref="InterPro:IPR000914"
                     /translation="MPSLLRRLDLASRGLPALSAALLAFGLLAGPVAAQEGAAPGAAQ
                     GAAGEWRHGLSLLGTPKYPADFKHFDYVNPDAPKAGLLRLSVDGTFDSLNDIIPRGTP
                     ASGLQLIYDTLMSPAYDEVATEYGLLAESVRYPADFSTVTYRLRPEAKWHDGQPVTAE
                     DVVWSFEQLTKNNPRQAYYYSHVKKAEVTGEREVTFTFDQAGNRELPQIVGQIRVMPK
                     HWWTGKDASGKQRDISQGTLEVPLGSGPYKVKQVVPGRSISFERVPDYWGAGLPVNIG
                     TNNFAEQRYEYFRDNVVELEAFKGDQYDFRVETSAKDWATAYDFPAVKQGKVILEEFP
                     DRASGSMQAFIPNLRRTKFQDQRVRRALNYALDFDGMNRTLFFGQYKRTSSYFQNTEL
                     ASSGLPTGLELEILNSVKDKVPPSVFTTPYANPPDGGEDVRRANLREAAKLLREAGYQ
                     VKGGKLVDPQGQPFTIEILLASPAFERVALFYKPTLERLGITVNIRQVDVSQYINRIR
                     ARDFDMIVTGWGQSLSPGNEQRDFWGSAAADREGSSNYAGIKDSGIDALIERVIYAKD
                     RAELVAATHALDRVLLAHDYVVPTWNYPNTRTARWNRFGRPDKLPEYSFGFPDIWWWD
                     AQKAAQTGGTQ"
     sig_peptide     243159..243263
                     /locus_tag="Snov_0253"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.995) with cleavage site probability 0.988 at
                     residue 35"
     gene            245227..247116
                     /locus_tag="Snov_0254"
     CDS             245227..247116
                     /locus_tag="Snov_0254"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: azc:AZC_0134 putative ABC transporter solute-binding
                     protein precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 5"
                     /protein_id="ADH87589.1"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017909"
                     /translation="MQGGVSRRALLTLTTAAGAALAFPRGAFAQEAAPPPAAGANGER
                     HGLSAFGDLKYPADFKHFAYVDPNAVKGGTFSQVGPTAAFNQSFQTFNSLNGYILKGD
                     GAQGIALIFDPLMVRALDEPDAIYGLVAKSVTVSPDGTVYRFRLRPEARFHDGSKLTA
                     HDVAFSLNILKEKGHPIIGQSLRDMEAAEADGDEFAVVRFKPERARDVPLLAASLPIF
                     SRAYYGKKPFDESTLEPPLGSGPYKVGRFEPGRFIEYERVADYWGSGLPVNVGTANFD
                     VQRYEYFRDREVGFEAFKARAYLFRQEFTARTWATGYNFPALKDGRVKQEILPDHTPS
                     GAQGWFLNLRRPQFSDPRVREALSYAFDFEWTNKNLMFDAYKRTTSFFENSDLKAEGP
                     AGPDELALIAALGDRITPEEVAVLKAPPWLPPVSDGSGQDRALLRKGAQLLREAGWVI
                     KDGRLTNAEGKTFTIEFLDDENGLERHTSPFIKNLKLLGIEANFRLVDPPQYQRRLND
                     FDFDTTVRRYSMSTVPGDSLRNYFGSRAAKIPGSNNLSGISDPLVDLLIEKVIAAATR
                     DELRTACRVLDRRLRAGRYWVPQWYSAEFRIAYWDEFAWPSVPRPDYDRAIPTIWSAR
                     GRSAG"
     sig_peptide     245227..245316
                     /locus_tag="Snov_0254"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.993 at
                     residue 30"
     gene            247380..248486
                     /locus_tag="Snov_0255"
     CDS             247380..248486
                     /locus_tag="Snov_0255"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: azc:AZC_0133 peptide ABC transporter permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87590.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MLAYIVRRLALMVPTVIGIMLISFAVVQFAPGGPVEKVIAELTG
                     QGASATSRITGGGGDFGGMQQNAPAGDPVSSKYRGAQGLDPAFIKQLEKQFGFDKPAY
                     ERFGKMLWDYARFDFGRSYFRDISVIDLIAEKMPVSISLGLWMTLITYAISIPLGIAK
                     AVRDGSRFDVWTSAVIIVGYAIPSFLFAILLIILFAGGSFFSWFPLRGLTSDNWDQLS
                     LGAKILDYFWHLALPITSMVLGAFATMALLTKNSFLDEIRKQYVITARMKGLSERAVL
                     YRHVFRNAMLIIIAGFPGAFVAAFFSGSLLIETIFSLDGLGLLGFESVLNRDYPVVFA
                     NLYIFSLVGLLINLLSDLTYTWVDPRIDFETRDV"
     gene            248488..249666
                     /locus_tag="Snov_0256"
     CDS             248488..249666
                     /locus_tag="Snov_0256"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: xau:Xaut_2635 binding-protein-dependent transport
                     systems inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87591.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MDAANTTLPSTAPTGASATPAETPRRSRLSPLNQRRLANFRRNR
                     RGWWSFWIFSVLFVLSLGAEFIANDKPFLVEYDNAYYFPGLVAYPETTFGGDFETEAD
                     YRDPYLQKLISEKGGWMVWPPIRYSYSTHNLDLPTPAPSPPTWMLTEAQCAPVVEKLG
                     RTGGCDALEWNWLGTDDQGRDVLARLIYGFRLSVLFGLILTIISSIIGVAAGAVQGYF
                     GGWTDLIFQRFIEIWTSIPALYLLLIISSILAPGFWVLLGILLLFSWVSLVGLVRAEF
                     LRARNFEYVQAARALGVSNLTIMWRHMLPNAMVATLTMLPFIVSSSVMTLTALDFLGF
                     GLPPGSPSLGELLAQGKSNVQAPWLGLTGFFTVAIMLSLLIFIGEAVRDAFDPRKTFQ
                     "
     gene            249701..249961
                     /locus_tag="Snov_0257"
     CDS             249701..249961
                     /locus_tag="Snov_0257"
                     /inference="similar to AA sequence:KEGG:RPE_3763"
                     /note="KEGG: rpe:RPE_3763 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87592.1"
                     /translation="MNKIVREHYPVDRLPEDLREGIEGPYVSVTVVTEEAPAGVDERI
                     EAILRNPKPMTIEEARARVGERGTTTEEAVARIRALRDEWDE"
     gene            249965..250401
                     /locus_tag="Snov_0258"
                     /product="hypothetical protein"
                     /pseudo
     gene            250398..252029
                     /locus_tag="Snov_0259"
     CDS             250398..252029
                     /locus_tag="Snov_0259"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: bra:BRADO1006 oligopeptide ABC transporter
                     ATP-binding protein;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87593.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /translation="MTSTSPLLSVQDLSVAFAQGARTTLAVDHVSFDLKRGETVALVG
                     ESGSGKSVTALSILKLLQYPAASHPSGKVLFKGADLLAMSEREIRGVRGNDITMVFQE
                     PMTSLNPLHTVEQQIAEILFLHRGMRGAGARARVIELLTEVGIPEPETRLGSYPHQLS
                     GGQRQRVMIAMALANEPQLLIADEPTTALDVTVQAQILKLLKDLQRRLGMAMLFITHD
                     LGIVRKIADHVCVMNKGRIVEAGPVADIFAKPQHPYTRALIAAQPRGNPEPPHPEAPV
                     VLEAKDLKVWFPIKAGLMRKTVGHIKAVDGISVEIRRGETLGVVGESGSGKTTLGLAL
                     LRLISSDGPIVFMGESIDTLGFKQMRSHRHAMQVVFQDPFGSLSPRMSIADIVGEGLR
                     VHQPKLSAEEREQRVIDALKDVGLEPESRHRYPHEFSGGQRQRVAIARAIVLEPSFVV
                     LDEPTSALDMIVQAQIVDLLRDLQHKRGLTYLFISHDLRVVAALASRVMVMKGGVVVE
                     EGPAADLFAHPKTDYTRALFAAAFNIETAGTAADA"
     gene            252039..252686
                     /locus_tag="Snov_0260"
     CDS             252039..252686
                     /locus_tag="Snov_0260"
                     /inference="protein motif:PFAM:PF00293"
                     /note="PFAM: NUDIX hydrolase;
                     KEGG: xau:Xaut_2637 NUDIX hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="ADH87594.1"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR004385"
                     /db_xref="InterPro:IPR015797"
                     /translation="MTDRAGIGELADRSIDVALTEPVSVGSGFRAYHRVIATLDGAGG
                     APLRQQRDILRVGPVVAVLAYDPVAACFVMIRQFRLGAQLATGVGELVEIAAGLIDPG
                     EKPEDAARRECREEIGVEPRALLPATQFLPTPGVTDEFATLYIGLVDSREVPAEAGEP
                     GETEHTRPFLVPVDEAMASLHAPFPGAFANGFVMLALQWFALNRGRVDAFAWPNG"
     gene            complement(252881..253747)
                     /locus_tag="Snov_0261"
     CDS             complement(252881..253747)
                     /locus_tag="Snov_0261"
                     /inference="protein motif:PFAM:PF00877"
                     /note="PFAM: NLP/P60 protein;
                     KEGG: xau:Xaut_0280 NLP/P60 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NLP/P60 protein"
                     /protein_id="ADH87595.1"
                     /db_xref="InterPro:IPR000064"
                     /translation="MNAHSPAALDPRLTPARPDLAAAHLKDVVAAPRYVEGTAQIVVR
                     ASAPMRKEPDPSAPLVTEALFGESVTVYEMTIEGWAWGQIDADGYVGWLPAEALAAPG
                     APATHRVRALRTPLFPGPSIKLPPMELLSFGSRLTITGTRERFAVTETGGFVFADHLT
                     PLDSYEDDFVAVAARFLGAAYLWGGRSSLGLDCSGLVQVALNACGIPSPRDTDMQEAA
                     LGNPVAFSGDLAELRRGDLVYWPGHVGIVEDADTLLHATAYFMSVVREPLKDALARIE
                     ALGTPVRSVKRL"
     gene            complement(253753..254103)
                     /locus_tag="Snov_0262"
     CDS             complement(253753..254103)
                     /locus_tag="Snov_0262"
                     /inference="protein motif:PFAM:PF01047"
                     /note="KEGG: oan:Oant_0731 MarR family transcriptional
                     regulator;
                     PFAM: regulatory protein MarR;
                     SMART: regulatory protein MarR"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="ADH87596.1"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /translation="MAVELRPSQALRLLHELSLAQVRDDAPDLSPRQLAILLGVYLEA
                     PPHTVRGLAARLGVTKPVITRALDTMGELGLVSRRRDDADRRNVIIQRTVEGALYVER
                     LGDLVVTVARSLPR"
     gene            complement(254373..255749)
                     /locus_tag="Snov_0263"
     CDS             complement(254373..255749)
                     /locus_tag="Snov_0263"
                     /EC_number="3.4.11.1"
                     /inference="protein motif:PRIAM:3.4.11.1"
                     /note="KEGG: azc:AZC_0280 leucine aminopeptidase;
                     PFAM: peptidase M17 leucyl aminopeptidase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Leucyl aminopeptidase"
                     /protein_id="ADH87597.1"
                     /db_xref="InterPro:IPR000819"
                     /translation="MGAQLIRAEEASQPRPIWCVTPQNWREVAGGLPVPALSFAEATG
                     FKAEAGALLILPAADGSIAGAIFGCEEVPRDPLAFGKLATALPAGDYRIAHAPADPRL
                     AALGFLLGGYRFTRYGKRNGADVRLVVPEGVDAAYVLRTAEAVALTRDLVNTPANDLG
                     PAEIEAAVRALASRFGAEVRVTTGEDLLAENFPLIHAVGRASPRAPRLIDMSWGDPNA
                     RKVTLVGKGVAFDTGGLDIKPSSGMLLMKKDMGGAANAIGLAQMIMGRGLNVRLRLII
                     PAVENAIDGSAFRPGDIFPSRKGLTVEIGNTDAEGRLILADALSLADEEAPELLIDFA
                     TLTGAARVALGPQLPPAYTDDEALAADLARFGAAEADPSWRLPLWQPYASMLDSKIAD
                     LNNAPGGGFAGSITAALFLQRFVERAGAWLHLDIFAWNPSPRPGRPEGGEAQTIRALD
                     ALIAERFG"
     gene            complement(255884..256474)
                     /locus_tag="Snov_0264"
     CDS             complement(255884..256474)
                     /locus_tag="Snov_0264"
                     /inference="protein motif:PFAM:PF00300"
                     /note="PFAM: Phosphoglycerate mutase;
                     KEGG: xau:Xaut_4141 phosphoglycerate mutase"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoglycerate mutase"
                     /protein_id="ADH87598.1"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /translation="MIKRRIFLVRHGETDWNLAGRLQGYHDIPLNDLGREQAAETARV
                     VERLSGGTVGLDYVASPLSRASQTMAILRAELGLPPDGFRRDPRLREIGFGRWEGATW
                     PELRRRDPVNLAARDADPWNFVPPGGESYADLSARVLAAIGELTHDAVVVTHGGVVRA
                     ILHALTGMPAAQAVELPVRQGAVYLIEDGAFELAVA"
     gene            complement(256471..257088)
                     /locus_tag="Snov_0265"
     CDS             complement(256471..257088)
                     /locus_tag="Snov_0265"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: azc:AZC_1753 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87599.1"
                     /translation="MSKARLPQLFRTLLPIALVAAGLAAAAPASAQNGPIIVGPPPGS
                     GLGGSGLPYIPPPGSQDRGVPPDFQTYPLLNRIFGTGGAIFPGYVSPSGGRNDADRLA
                     YLTGGGQGRMIFAAGTADQLCQMGQAPRIRVVTAPATVKIKFDIGSFTATGTDAGSKR
                     CVGGQAGGARVFASGSAPLGSTVTLRVSYPLNGPSYTHVVALPAK"
     sig_peptide     complement(256993..257088)
                     /locus_tag="Snov_0265"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.988 at
                     residue 32"
     gene            complement(257118..257933)
                     /locus_tag="Snov_0266"
     CDS             complement(257118..257933)
                     /locus_tag="Snov_0266"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: azc:AZC_1754 enoyl-acyl carrier protein reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87600.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MASGGLMSGKRGLVMGVANNRSIAWGIAKAAHAQGAKLAFTYQG
                     EPLKKRVEPLAAELDATLVGHCDVTDPATIDAVFAETERQLGGLDFLVHAIAFSDKNE
                     LDGRYVDTTAENFSKTMLISCYSFTAVAQRAEKLMTDGGSMLTLTYYGAEKWMPHYNV
                     MGVAKAALEASVRYLAADLGPKNIRVNAISAGPIKTLAASGIGDFRYILKWNELNAPL
                     RRTVTIDEVGDTGMYLLSDLGRAVTGEIHHVDAGYHIVGMKNPEAPDLTLERD"
     gene            complement(258057..259028)
                     /locus_tag="Snov_0267"
     CDS             complement(258057..259028)
                     /locus_tag="Snov_0267"
                     /inference="protein motif:PFAM:PF01556"
                     /note="KEGG: azc:AZC_1199 heat shock protein;
                     PFAM: chaperone DnaJ domain protein; heat shock protein
                     DnaJ domain protein;
                     SMART: heat shock protein DnaJ domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone DnaJ domain protein"
                     /protein_id="ADH87601.1"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR003095"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /translation="MRDPYDILGVARNADQNEIKRAFRKHAKKLHPDANKDDPKAQER
                     FAELNSAHEILSDPEKRGQYDRGEIDAEGKPRGFEGFPGGGAGGFNRGGFQRGPHGET
                     IFESFSFGPEGARRSGHGPHDAGGFDDVIADILGGLGGRGRGRARAGGQQEMPRGGDV
                     DISVPVPLERVVEGGPVKVHLPNGRTVEVKIPPKVTEGHRMRLKGQGEPSPFGGAPGD
                     AYVVVAYAPHRHFKVEGADLRTDVSLPLADAVLGGKLRVPTLSGEVELSVPAWTQSGR
                     TFRLRGKGLPKGDDAAGDLFATVRITLPETPDAELEELMRRRRDGAA"
     gene            complement(259125..259628)
                     /locus_tag="Snov_0268"
     CDS             complement(259125..259628)
                     /locus_tag="Snov_0268"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: azc:AZC_1198 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87602.1"
                     /translation="MDTFHRRRATAAQVASRGGSSYKRDTSFRTAALWTTLVGALAMA
                     GCSSAPPLDMQATGSISPRRAAAYQREPVPQGVAPDDWAAARLALAEALREDSKAPSV
                     PWENYASATRGTVTPLASSASGRGACRDFLMSFVRAAGEEWLQGEACRNERGWWKVDE
                     ARLLARG"
     gene            259664..260290
                     /locus_tag="Snov_0269"
     CDS             259664..260290
                     /locus_tag="Snov_0269"
                     /EC_number="1.4.3.5"
                     /inference="protein motif:TFAM:TIGR00558"
                     /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase;
                     KEGG: azc:AZC_1197 pyridoxamine 5'-phosphate oxidase;
                     PFAM: pyridoxamine 5'-phosphate oxidase-related
                     FMN-binding; Pyridoxine 5'-phosphate oxidase,
                     dimerisation-like"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="ADH87603.1"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR009002"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /translation="MEASEELISGDFTAATEPFRLFEEWFAEAKEKEPRDPNAMALAT
                     VDADGLPDVRMVLLNQRDERGFVFFTNTGSAKGCELAAVPKAAVVFHWKSMNRQIRVR
                     GPVEVVSDEEADAYFLTRPRLSQIGAWASVQSRPLEGRFALEAAVAKYTAQYALGSVP
                     RPPHWTGFRIRPVQIEFWHDRPFRLHDRIVFRRDSAEATVWNKTRLYP"
     gene            260340..261089
                     /locus_tag="Snov_0270"
     CDS             260340..261089
                     /locus_tag="Snov_0270"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: mno:Mnod_1067 short-chain dehydrogenase/reductase
                     SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87604.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTKGTNQPRRTMLLTGASRGIGHATVKRFSAAGWRVITCSRHAF
                     PENCPWEMGPEDHIQVDLSDPADTLRAVDEIKSRLPDGELHALVNNAGISPKGPGGSR
                     LGTLNTPEEDWRRVFQVNFFAPILLARGLLEELKRTHGAVVNVTSIAGSRVHPFAGAA
                     YATSKAALAGLTREMAADFGPLGVRVNAIAPGEIDTSILSPGTEKIVEQIPMQRLGTP
                     DEVAKIIYVLCTDTSSYLNGAEIHINGGQHV"
     gene            complement(261299..262276)
                     /locus_tag="Snov_0271"
     CDS             complement(261299..262276)
                     /locus_tag="Snov_0271"
                     /inference="protein motif:PFAM:PF01544"
                     /note="PFAM: Mg2 transporter protein CorA family protein;
                     KEGG: oca:OCAR_6914 Mg2+ transporter protein, CorA family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Mg2 transporter protein CorA family protein"
                     /protein_id="ADH87605.1"
                     /db_xref="InterPro:IPR002523"
                     /translation="MITAHCVRGGTLVSVHLGAGEALPPDAVWIDLNQPADGEDRLVE
                     AAIGISVPTRAEMLEIEPSSRLRVENGARYMTGSIVCNSDSDRPTLAQVSFILAKGKL
                     TTVRYDEPKPFRLVLAKLDRDCPQTMKGDRLLLELLDTIVDRAADIIETLSEDIDGLS
                     RRIFERESSSNGGSQRFRVILKLLGRRADLASKVRESLVSMGRLVTFLSTEGEAERFD
                     KEQRTWLKSMQRDTASLNDHVSYLGNKIIFLLDATLGMVSIEQNNIIKIFAVLSVVLM
                     PPTLIASIYGMNFQHMPELGERFGYPVALIAMLAAAVVPYWFFKWKKWL"
     gene            complement(262468..262692)
                     /locus_tag="Snov_0272"
     CDS             complement(262468..262692)
                     /locus_tag="Snov_0272"
                     /inference="similar to AA sequence:KEGG:SRU_0693"
                     /note="KEGG: sru:SRU_0693 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87606.1"
                     /translation="MSSEDQPAPEAQPSQRWEASQQNAHWREIGLPALAAAAPYNAAK
                     QTVSDAPGTGAARTDEAKIVTIRDVEYFAA"
     gene            262985..263587
                     /locus_tag="Snov_0273"
     CDS             262985..263587
                     /locus_tag="Snov_0273"
                     /inference="protein motif:PFAM:PF03734"
                     /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
                     KEGG: azc:AZC_1194 ErfK/YbiS/YcfS/YnhG precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /protein_id="ADH87607.1"
                     /db_xref="InterPro:IPR005490"
                     /translation="MILRGAGVVLLAVLLGACSNAQRQPAPTASLTPRDKQLLANAPY
                     QKVLPPDMYQRAIVDYSGREKPGTIVVDTDKKWLYFVQDGGKAIRYGVTVGEEGLAFK
                     GNAKVGRKTEWPTWTPTPEIKQRIAGVPDFVGPGPHNPMGARALYLFQGNKDTLFRIH
                     GTNQPEYIGQAISSGCIRMLNEDVIDLYTRVPQGTNVVVL"
     sig_peptide     262985..263050
                     /locus_tag="Snov_0273"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.982) with cleavage site probability 0.967 at
                     residue 22"
     gene            complement(263787..265169)
                     /locus_tag="Snov_0274"
     CDS             complement(263787..265169)
                     /locus_tag="Snov_0274"
                     /inference="protein motif:PFAM:PF00202"
                     /note="PFAM: aminotransferase class-III;
                     KEGG: mno:Mnod_5513 aminotransferase class-III"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class-III"
                     /protein_id="ADH87608.1"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /translation="MLTNLQARDVETLVHPYTNLVAVRETGPLILERGKGVWVHDVDG
                     KPYLEGMAGLWCTALGYGNEELVEAAATQMRKLPFTHIFGGKSHDPAIELAEKLKEMA
                     PVPISKVFFTCSGSEANDTQMKLVWYMNNALGRPKKKKIISRMRAYHGVTIAAASLTG
                     LAGNHNDFDLPIAGVRHTTCPHYYRLAEAGESEEDFATRLAADLEALIIAEGPETVAA
                     FIAEPVLGAGGVIVPPKTYYPKIQAVLEKYDVFFIADEVITGFGRLGTAFGCEAMEMK
                     PHSISVAKALSSAYQPIGGVMIPEDMYQAMLEESRKLGSFGHGYTYSAHPVAAAVAVK
                     TLEIYERESIFERVRAKIPHFGARRAALEDHPLVGEARGAGLVAGIELVADKKSKHQF
                     DPKLGVAAKCVAFAQEEGLIVRNVFGDAVTICPPLVISPAEIDELFDRLTRALDKTLD
                     WAVRENLLAA"
     gene            complement(265258..266610)
                     /locus_tag="Snov_0275"
     CDS             complement(265258..266610)
                     /locus_tag="Snov_0275"
                     /inference="protein motif:PFAM:PF06904"
                     /note="PFAM: Extensin family protein;
                     KEGG: xau:Xaut_2474 extensin family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Extensin family protein"
                     /protein_id="ADH87609.1"
                     /db_xref="InterPro:IPR009683"
                     /translation="MDFRSLPFIRLPFPRRVAPILAVGLLLAGASPLAADDLTRSIDR
                     AGNAINRQLGDFFGVTPERPAKRRPATKSTATAKPVDGKVPLPPSRPGEADQQAALTS
                     QPEEASAPKPEAKPAVAEPDMPKPDIKAASDPGEAKPDTPTPSGERAATSDPGEAKPD
                     TPAPSGEREVVVPPPAAPEPPAAASAPLPPPAPERLAALPPPAAGPTAEPAETARAAP
                     VPTICPELSNEDIGVFTPTEVKTTEPACTLDRGVVLSAVRMKDGRLVQLQPAAELRCE
                     MAASVARWLREKVEPAVATLGSPLDKVLVAGSLQCRSRNHVAGAKISEHGRGNALDTH
                     GYELKDGRRFVIGPPSMGSGEHAMPVDFQEKLKASACADFTTILGPGSDGYHEQHLHV
                     DRAERRSGAVLCQWATARVEAVPPKPPVKPAEAKAGEPAASDAPPEEGATPDSAGKSQ
                     "
     sig_peptide     complement(266503..266610)
                     /locus_tag="Snov_0275"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.936 at
                     residue 36"
     gene            266670..267395
                     /locus_tag="Snov_0276"
     CDS             266670..267395
                     /locus_tag="Snov_0276"
                     /inference="protein motif:PFAM:PF00702"
                     /note="PFAM: Haloacid dehalogenase domain protein
                     hydrolase;
                     KEGG: xau:Xaut_2473 hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Haloacid dehalogenase domain protein hydrolase"
                     /protein_id="ADH87610.1"
                     /db_xref="InterPro:IPR005834"
                     /translation="MNAPRAILFDKDGTLVDFDRTWGPAAGAVMRRLAGADEAALTQL
                     YAASHFLPAEDRFLQSSPLIAGSSRQYGPLWAQILDVPATMDFFGEIDRLFREEGGRY
                     LTPIGSPAQTLGRLHALGLPLGIATNDAEPNARLQATQLGLDGLLSAVYGYDSGYGSK
                     PAPGMVEAFSRLTGLAPADIALVGDTRHDLHTARNAGAIAVLVRCGPGPVDDFAHEAD
                     LVVDTVEDLADMILRAAPAEAAR"
     gene            267392..268177
                     /locus_tag="Snov_0277"
     CDS             267392..268177
                     /locus_tag="Snov_0277"
                     /inference="protein motif:PFAM:PF07386"
                     /note="PFAM: protein of unknown function DUF1499;
                     KEGG: azc:AZC_1485 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1499"
                     /protein_id="ADH87611.1"
                     /db_xref="InterPro:IPR010865"
                     /translation="MIRRRLYIEERMSRLAVWSLRTAIFAFPVTLIGAALYATETLDF
                     RSAAYTVLAGVGVAVLALLLAFAGFVVIWNEGLKGLGRVIGAAALALLLITPTATLAA
                     LAVGLKTLPDVTSDTEDPPEFVTLGTVRSRASTGLAYPGGKLADDQLDIYPGIKPITF
                     DAPPDEIFRVLMNMVTRHKWLVVDSVPPRGERDGRIEAVARSLPFGLRDDMVIRVRRT
                     PTGSIVDMRSVARSGNRDFGSNARRIDQLFDELADQQGRPRRQ"
     gene            complement(268180..269091)
                     /locus_tag="Snov_0278"
     CDS             complement(268180..269091)
                     /locus_tag="Snov_0278"
                     /inference="similar to AA sequence:KEGG:AZC_1482"
                     /note="KEGG: azc:AZC_1482 metallo-beta-lactamase
                     superfamily protein"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase superfamily protein"
                     /protein_id="ADH87612.1"
                     /translation="MAEDIPFERRFDAVPGVADEVAPGVRRVLAPNPGPFTFTGTCSY
                     IVGRGEVAIIDPGPDDASHVSALLAAIHGEKVTHIFLTHTHRDHSGALDALKEATGAP
                     AYAEGPHRPARELHAGETNVLDAAGDRSFLPDVALADGARVEGAGWTIDALATPGHAA
                     NHMAYVLEGAGLIFVGDHVMGWSTTIVAPPDGSMSDYMDSLRRLGERPEQLYLPGHGG
                     AIPQGPAFVERYLRHRQAREAAIVRALERGPLAIPEIVRAIYIGLDPRLAGAAGLSTL
                     AHLEDLVGRGEALTEGPAALEGVFRLP"
     gene            269211..269843
                     /locus_tag="Snov_0279"
     CDS             269211..269843
                     /locus_tag="Snov_0279"
                     /EC_number="4.2.1.1"
                     /inference="protein motif:PRIAM:4.2.1.1"
                     /note="KEGG: xau:Xaut_4148 carbonate dehydratase;
                     PFAM: carbonic anhydrase"
                     /codon_start=1
                     /transl_table=11
                     /product="Carbonate dehydratase"
                     /protein_id="ADH87613.1"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /translation="MDKLLDGYRRFRATSWPERKALFERLAARGQKPQTLVIACSDSR
                     VDPTMIFDAGPGELFVVRNVANLVPPYTAPDAHAEPEQDHHGTSAAIEFAVKVLEVQE
                     IMVLGHALCGGAGALIDGAPAQAQDFLPDWIRIARPARDIALNLSSDPAEQRTILEHQ
                     CVKLSLRNLATFPWIKERVEDGRLALHGAYFAVATGVLERLRADGTFGPV"
     gene            270050..270595
                     /locus_tag="Snov_0280"
     CDS             270050..270595
                     /locus_tag="Snov_0280"
                     /inference="protein motif:PFAM:PF05974"
                     /note="PFAM: protein of unknown function DUF892;
                     KEGG: gdj:Gdia_1370 protein of unknown function DUF892"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF892"
                     /protein_id="ADH87614.1"
                     /db_xref="InterPro:IPR010287"
                     /translation="MGLFSKDIKSLDDLLRQSLGELLYTERRIAKALPGLAAKVSDPL
                     LRRELERARMASEDHLARIEEVFLRHDAAPRSIECPAIDGIFISAEELNEEIDDFYVL
                     DTAIAAAMQAVATYSAARYMTAAAWLRQLGQPECARLLHANLVARQRAADALCALAEQ
                     RLNARARGRSDDRPSGVALAG"
     gene            complement(270592..271512)
                     /locus_tag="Snov_0281"
     CDS             complement(270592..271512)
                     /locus_tag="Snov_0281"
                     /inference="similar to AA sequence:KEGG:RC1_2166"
                     /note="KEGG: rce:RC1_2166 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87615.1"
                     /translation="MAVRVSTLLPATAFLPLPVPLAVSGQPRRVGVEVEFTRLSERRA
                     AERIAREMGGTLREEDPHAFHIIGSRLGDLCVELDMRHAHPHRDGHPMPRLRPHAGLI
                     GAALRPFVPRELVTGPILPGDLGEMDDLVRALREEGAGGDGATVLGSLGLHFNIVPAS
                     LEPSALLAMLRAFLLSEPRLRAQGLTGLSRLHAPPPYPQDYVDKVLGPGYRPDLEALC
                     DDYVGANPTRSRALDLLPLFLELFPERVAPRISGKVKPRAALHYRLPVARVGRPGWSL
                     AEDWNRWVEVERLAADPSRLAAAVARHRPV"
     gene            complement(271654..271730)
                     /locus_tag="Snov_R0004"
                     /note="tRNA-Pro3"
     tRNA            complement(271654..271730)
                     /locus_tag="Snov_R0004"
                     /product="tRNA-Pro"
     gene            271936..272010
                     /locus_tag="Snov_R0005"
                     /note="tRNA-Gln1"
     tRNA            271936..272010
                     /locus_tag="Snov_R0005"
                     /product="tRNA-Gln"
     gene            272061..272798
                     /locus_tag="Snov_0282"
     CDS             272061..272798
                     /locus_tag="Snov_0282"
                     /inference="protein motif:PFAM:PF01177"
                     /note="PFAM: Asp/Glu/hydantoin racemase;
                     KEGG: bja:blr5577 hydantoin racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="ADH87616.1"
                     /db_xref="InterPro:IPR015942"
                     /translation="MRIHLVNPNTTRSMTETIAAAARVVAAPGTQIMAATSAMGPASI
                     EGHYDDALALPGLLAAIAEAEAAGVDAHIIACFDDTGLEAARTLARAPVVGIGEAGFH
                     MASLLAHRFAVVTTLSRSIPVIEGNLLRYGLDRRCAAVRASEVAVLELEDPASGARAR
                     ISEEIGRALREDRAEAIVLGCAGMADLARALGEEHGVPVIDGVASAVALAEGLVRAGL
                     TTSKTGAYAPPRPKPYAGRLADFAPKG"
     gene            complement(272805..273305)
                     /locus_tag="Snov_0283"
     CDS             complement(272805..273305)
                     /locus_tag="Snov_0283"
                     /inference="protein motif:PFAM:PF01047"
                     /note="KEGG: azc:AZC_2790 transcriptional regulator;
                     PFAM: regulatory protein MarR;
                     SMART: regulatory protein MarR"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="ADH87617.1"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /translation="MVAMTDVRESDGLMSAGGPDDPADAKALAIETYRLDQQVGFLMR
                     VANQRHTALFAARMIENLTPPQFATLAKLREVGPCSQNRLGRLVYLDAATIKGVVDRL
                     RARGFVLTADDPLDRRRRAVGLSERGRAVADEAILVAREITEATLEPLDEAERAEALR
                     LLRKLG"
     gene            complement(273367..274101)
                     /locus_tag="Snov_0284"
     CDS             complement(273367..274101)
                     /locus_tag="Snov_0284"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: bbr:BB1775 putative ATP-binding component of
                     ABC transporter;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87618.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MNPPADTPMLEVDGLEAWYGEAKILFGLSLTVAPGEAVALVGRN
                     GAGKSTTMKAVMGLVRRRARRLALHGQDIAALPTYAIARLGIGYVPEDRRIFTDLTVT
                     ENLDLGRRAVRPGGGSLMGPDWPREALFELFPNLAALRDRLGGQMSGGEQQMLAVARA
                     LVGRPALLLLDEPSEGIAPIIVEQMINALGALKASGLSLLISEQNTALCSAVCNRAYV
                     IEQGELRWQGAMSDLDSAVEPMRIFG"
     gene            complement(274098..274871)
                     /locus_tag="Snov_0285"
     CDS             complement(274098..274871)
                     /locus_tag="Snov_0285"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: bpy:Bphyt_4328 ABC transporter related;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87619.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MTQNPAGTVLEVRELTKHYGGVRAVDGVSFSIAPGELLALIGPN
                     GAGKSTCFNIVNGQLKPDSGTVRILGRDVTGVPSRRIAHLGVGRTFQVAAVFGSMTAL
                     ENVQAALIAARGSVFGFWRPATTIARDEAMALLEQTGMAGEAERPAAALAYGDVKRLE
                     LAMALAGDPRLLLMDEPTAGMAAAKRGEMIALVQKLTRSRGLAVLFTEHSMDVVFGHA
                     DRVIVLARGRLIADGTVDEVRADPRVREVYLGGTAEAAR"
     gene            complement(274868..276766)
                     /locus_tag="Snov_0286"
     CDS             complement(274868..276766)
                     /locus_tag="Snov_0286"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: bbr:BB1773 putative permease component of
                     branched-chain amino acid transport system"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ADH87620.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MSLDALLFQAVNGLASASGLFLVAAGLSIIFGVTRIVNMAHGSF
                     YMLGLYLAVTLAPKLGTWIGGPLGFWAGILAAALVVAALGALIEMTLLRRLYGAPELY
                     QLLATFALLLVINDAALFLWGPEDILGPRAPGLSGSVMLLGRRLPQYDIFLALIGPAV
                     LIGLHLLLARTRFGRLIRAATQDREMVAALGINEALLFTAVFALGAGIAGLGGALQMA
                     REPASLTLDLSVLGDAFVVVVVGGMGSIRGAYLAAVLVAEAKALCTALGVVDIFGFTF
                     NMSRLTLVAEFLVMALVLIVRPHGLFGRPQPPAARGGPAEPPLRPFSAPARVFALAAI
                     ALFAAMPLIGTLVSYAPVLALDMLVAALFAASLHFIMGPGGMASFGHAAYFGLGAYGT
                     AYAVTALDLPTPLAFATGIGVAAFGAVLFGWFCVRLEGVYFAMLTLAFAQIVWSVAFQ
                     WEEVTGGSNGLFDVWPEWPFDSRTGLYLAAFVVTLAGLMLLRRLVFAPFGMALRAARD
                     SRLRAEASGIPVARVRWLAFALAGAVCGAAGGLFAFAKGSISPEAISVGRSIDGLVMV
                     LIGGVQSLVGPVVGAGAFTLLQDSVMRETDYWRALLGVLILAIVLLFPFGIAGGLSRG
                     LRRPGGAR"
     gene            complement(276797..278026)
                     /locus_tag="Snov_0287"
     CDS             complement(276797..278026)
                     /locus_tag="Snov_0287"
                     /inference="protein motif:PFAM:PF01094"
                     /note="PFAM: Extracellular ligand-binding receptor;
                     KEGG: dia:Dtpsy_0172 extracellular ligand-binding
                     receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular ligand-binding receptor"
                     /protein_id="ADH87621.1"
                     /db_xref="InterPro:IPR001828"
                     /translation="MRYSSCLRAALTGAAMSVAALALPAFTLPAFAAEPIRIGELNSY
                     KAQPAFLDPYRKGMQLAVKEINDAGGVNGRPLELISRDDGGNPGDAIRVAEDLVTREK
                     VDLLAGTFLSHIGLAVSGFAGKRKVFFLAAEPLTDKLTWTDGNRYTFRLRPSTYMQVA
                     MLLPAAKAAQRKRWAIVYPNYEYGQSAAATFKKLLKDAQPDVEFVEEQATPLGKIDAG
                     PVAQAIADAKPDAVFNVLFGPDLAKFVREANTRGALEGTHVVSLLSGEPEYLDPLKDE
                     TPVGWVVTGYPWYAITTPEHMAFLSAYQKAYGDYPRLGSVVGYTTIKSIAAGLNKAGS
                     TDSEKLVDAFRGLQVTGPFGPFSYRASDHQATMGAYVGILALKDGQGIMVQPSYVDGA
                     SVLPSDAEVKALRPATD"
     sig_peptide     complement(277928..278026)
                     /locus_tag="Snov_0287"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 33"
     gene            complement(278129..279025)
                     /locus_tag="Snov_0288"
     CDS             complement(278129..279025)
                     /locus_tag="Snov_0288"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: met:M446_1767 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF6 transmembrane"
                     /protein_id="ADH87622.1"
                     /db_xref="InterPro:IPR000620"
                     /translation="MPRFNTGPALAAVTGIGLLSVMDGMIKYVATEHGIGQIGVMRYA
                     FGALAAYLVFRAARTPWPDAATVRPHAWRSVVVAATALLFFYSLAVLPLAVALALSFT
                     SPIFIALFAAAILGERPGRPILIALVLGFAGVLVVLWSELTHTGGEEANALGLAAAIG
                     AAITYALSMVVLKSRAARDPLPTIVLLQNSFAGLLLAPLGIWQWTAPAGGEILVFVGI
                     GVLGTAGHLCMAWAYGRADASRLGVFEYTAFVWALAIGLLAFGEVPAVSTLLGATLIV
                     GGALVASGRTKAPPEPEIEIGP"
     gene            complement(279030..279563)
                     /locus_tag="Snov_0289"
     CDS             complement(279030..279563)
                     /locus_tag="Snov_0289"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: cyb:CYB_1709 acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="ADH87623.1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /translation="MTDFLIRPADDADGDAIAVLIAAAFAEYEGCVFDRAAEFPELDA
                     IASHFAARGGTIWVAEADGEVIGSFALAPTRDADAPAGGMEIFKVYVARTARRRGVAR
                     ALFERALTQAQAAGAPEIRLWTDTRFTDAHRFYERCGFHRHGEARECHDLSATWEYSY
                     RLSLNPAAPSRLARIES"
     gene            279769..280245
                     /locus_tag="Snov_0290"
     CDS             279769..280245
                     /locus_tag="Snov_0290"
                     /inference="similar to AA sequence:KEGG:Xaut_1164"
                     /note="KEGG: xau:Xaut_1164 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87624.1"
                     /translation="MNLFHRVLRLALAGMFAAALAACATQAPQPAAPAMPQYTSPITA
                     QQLVGKWGLAAYHRPEDAARTEAQARQGCRQPYVINAGPGGGFMMYLADDSSPSEMVS
                     KQVGTGPIFIGLPTEPAGAKSDREVVRFDGQILVLKWLDPEVAGRYGTMVYVRCPA"
     sig_peptide     279769..279843
                     /locus_tag="Snov_0290"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.786 at
                     residue 25"
     gene            280676..281674
                     /locus_tag="Snov_0291"
     CDS             280676..281674
                     /locus_tag="Snov_0291"
                     /inference="protein motif:PFAM:PF03734"
                     /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
                     KEGG: rpb:RPB_1841 ErfK/YbiS/YcfS/YnhG"
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /protein_id="ADH87625.1"
                     /db_xref="InterPro:IPR005490"
                     /translation="MRGDSGLLSARQRAAVQAAAVAVALTALAAAGPAQAQSGVYGYQ
                     SSYQLYSRSAASNPSAWRPGNAPVYPSGSVYQPPRPSADVGAARGVYGYAPPARRTTT
                     APASSYAASANPSGYDADVELPPAPVQAAAPTTRQTKAASRSTRGTATRTAAVPASYT
                     VEDDIYDDPDTPLPLYRPSTGAKGVDRKFDRHVVRYSSSDPAGTIIVDTGARYLYLIQ
                     GDGTAVRYGIGVGKEGFQWAGSERISRKAEWPEWRPPSEMLDRRPDLPRVMPGGEDNP
                     LGARALYLGKSLYRIHGSNEPETIGQAVSSGCIRMRNEDVIDLYGRVQVGTLVRVI"
     sig_peptide     280676..280786
                     /locus_tag="Snov_0291"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.998) with cleavage site probability 0.980 at
                     residue 37"
     gene            282044..282832
                     /locus_tag="Snov_0292"
     CDS             282044..282832
                     /locus_tag="Snov_0292"
                     /inference="protein motif:TFAM:TIGR01934"
                     /note="KEGG: azc:AZC_3919 ubiquinone/menaquinone
                     biosynthesis methyltransferase;
                     TIGRFAM: ubiquinone/menaquinone biosynthesis
                     methyltransferase;
                     PFAM: UbiE/COQ5 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="ADH87626.1"
                     /db_xref="InterPro:IPR004033"
                     /translation="MAADTRTDGTTSEAADTHFGFRTVPLGEKQRMVDEVFHSVARRY
                     DLMNDLMSLGLHRAWKDLLVSRLRPPKTDRSFRLLDVAGGTGDVSFRTVEAGGAGTSA
                     TVADINGGMLGVGRERAASLGLSDRVEFVEANAEELPFADKSFDATTIAFGIRNVPRM
                     DKALAEMRRVLKPGGRCFVLEFSRVDVPGLDAIYDAYSFKLIPPMGKLVTGDAESYQY
                     LVESIRKFPSPEAFAEMMRAAGFSRVDVTPLTGGIVCLHSGVRI"
     gene            282837..284405
                     /locus_tag="Snov_0293"
     CDS             282837..284405
                     /locus_tag="Snov_0293"
                     /inference="protein motif:TFAM:TIGR01982"
                     /note="KEGG: xau:Xaut_2017 2-polyprenylphenol
                     6-hydroxylase;
                     TIGRFAM: 2-polyprenylphenol 6-hydroxylase;
                     PFAM: ABC-1 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="2-polyprenylphenol 6-hydroxylase"
                     /protein_id="ADH87627.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR010232"
                     /db_xref="InterPro:IPR011009"
                     /translation="MATPLGDYLRLARAGFVLAREGVASRIDPAMRPPGSEPLFAIAK
                     LIERRGPASSAARLGAALSRLGPSYVKLGQFLATRPDVVGAQMARDLELLQDRMPAFP
                     QEVAEATIERNFDRPASVVYSRLSPALAAASIAQVHQGEVTEADGTVQRVAVKVLRPD
                     VQRRFRIDLSSFYRAARLGEQASPEGRRLRLVAVVDTLARSVSMEMDLRLEAAALSEL
                     AQNTGEDEDFRVPAVDWDRTGREVLTTEWIDGIKLNDLDALRAAGHDLPKLGRVVMQS
                     FLRHALRDGFFHADMHPGNLFVDAQGRLVAVDFGIMGRLGHKERRFLAEILFGFITRN
                     WLRTAQVHFEAGYVPPHHSVEDFAQAIRAIGEPIYSRRADQISMAKLLTLLFEVTALF
                     DMKTRPELLLLQKTMVVVEGVARTLDPQLDMWKTAEPVVRAWIERNLGPVGRIEEVAG
                     GFSAIGRSLQNLPDLVAQGQRIANQLDAATRDGLVLSPETMEAIGRAEGRGNRWGTVA
                     LWVIAALLAGHLLF"
     gene            284700..284828
                     /locus_tag="Snov_0294"
     CDS             284700..284828
                     /locus_tag="Snov_0294"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87628.1"
                     /translation="MTLLQWYILVGVPFILLAGAFAADRLSAYDSRHADRHTGPAE"
     sig_peptide     284700..284768
                     /locus_tag="Snov_0294"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.978) with cleavage site probability 0.975 at
                     residue 23"
     gene            284841..284960
                     /locus_tag="Snov_0295"
     CDS             284841..284960
                     /locus_tag="Snov_0295"
                     /inference="similar to AA sequence:KEGG:Lxx08160"
                     /note="KEGG: lxx:Lxx08160 transmembrane efflux pump"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane efflux pump"
                     /protein_id="ADH87629.1"
                     /translation="MTTANFLLLLIMPVGALVVGGIVYLVASRDHHPHAGPAE"
     sig_peptide     284841..284924
                     /locus_tag="Snov_0295"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.802) with cleavage site probability 0.210 at
                     residue 28"
     gene            285080..286309
                     /locus_tag="Snov_0296"
     CDS             285080..286309
                     /locus_tag="Snov_0296"
                     /EC_number="6.3.2.5"
                     /inference="protein motif:TFAM:TIGR00521"
                     /note="TIGRFAM: phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate/cysteine ligase;
                     KEGG: azc:AZC_3913 DNA/pantothenate metabolism
                     flavoprotein;
                     PFAM: flavoprotein; DNA/pantothenate metabolism
                     flavoprotein domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate/cysteine ligase"
                     /protein_id="ADH87630.1"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR005252"
                     /db_xref="InterPro:IPR007085"
                     /translation="MLATKRILLIIGGGIAAYKSLDLIRRLKERGASVRVIMTAAAQH
                     FVTPLAAGALSHERVFTELFDREAEHDIGHIRLSREADLIIVAPATADLMAKMAHGLA
                     DDLASAVLLASDKPVLVAPAMNPLMWSHAATRRNAAQLAADGVAFIGPNAGAMAERGE
                     DGPGRMAEPMEIVEAAERLLAASGPLKGRHVLVTSGPTHEPIDPVRYIANRSSGKQGH
                     AIAAAAARAGAQVTLVSGPVNLPDPAGVDVRHVESARDMLAAVEAALPADAAIFAAAV
                     ADWRAASEAGEKLKKDGNAIPPLMLTENPDILATVAHLSNRRPRLVVGFAAETQNVVA
                     YAQAKRARKGCDWIVANDVSQHSGIAGGVMGGDSNAVHLITAEGVEHWPEASKAAVAE
                     KLIARVAASLGPLGAAE"
     gene            286306..286791
                     /locus_tag="Snov_0297"
     CDS             286306..286791
                     /locus_tag="Snov_0297"
                     /inference="protein motif:TFAM:TIGR00576"
                     /note="KEGG: azc:AZC_0707 deoxyuridine 5'-triphosphate
                     nucleotidohydrolase;
                     TIGRFAM: deoxyuridine 5'-triphosphate nucleotidohydrolase
                     Dut;
                     PFAM: deoxyUTP pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
                     Dut"
                     /protein_id="ADH87631.1"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /translation="MSFEASLDVAVLVLPHGEGLPLPEYATAGSAGLDLLAALPGDEP
                     LTLAPLARAAVPTGLSIALPEGYEAQVRPRSGLALKQGLTVLNAPGTIDSDYRGEVKV
                     LLVNLSDQPVVLERGQRIAQMVVAPVTRIKLVETGDLNETTRGSGGFGSTGLDGRHIS
                     R"
     gene            286801..287244
                     /locus_tag="Snov_0298"
     CDS             286801..287244
                     /locus_tag="Snov_0298"
                     /inference="protein motif:TFAM:TIGR00738"
                     /note="KEGG: xau:Xaut_0076 BadM/Rrf2 family
                     transcriptional regulator;
                     TIGRFAM: transcriptional regulator, Rrf2 family;
                     PFAM: protein of unknown function UPF0074"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, BadM/Rrf2 family"
                     /protein_id="ADH87632.1"
                     /db_xref="InterPro:IPR000944"
                     /translation="MPRLSDKSLLAIAAVVDVALHARGMPVAAKALAARHDLPPRHLE
                     PVLQALVHAGVLKGVRGPRGGYELARERRRITVAEVVRVVEAESEEALDGFPPLVRDI
                     VQPAVAEAERAFEAALDGVTVEDLCRSAAQNTLRKGLPEGIDFTI"
     gene            287364..288341
                     /locus_tag="Snov_0299"
     CDS             287364..288341
                     /locus_tag="Snov_0299"
                     /inference="protein motif:TFAM:TIGR01139"
                     /note="KEGG: azc:AZC_0709 cysteine synthase K/M;
                     TIGRFAM: cysteine synthase A; cysteine synthase;
                     PFAM: Pyridoxal-5'-phosphate-dependent protein beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="ADH87633.1"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005856"
                     /db_xref="InterPro:IPR005859"
                     /translation="MAETALKTPAAQVGRGRIYNSITETIGDTPLVQLNRLPAQRDVK
                     ARILVKLEFFNPIGSVKDRIGVSMIQSLEEAGLIKQGTVLVEPTSGNTGIALAFVAAA
                     HGYRLILVMPESMSVERRKMLALLGAELVLTPAAQGMRGAVARAEELVKELPDAIIPQ
                     QFRNPANPAIHRRTTAEEIWNDTHGEVDIVVSGVGTGGTITGIGQVLKPRKPSLRMVA
                     VEPEDSPVLSGGQPGPHKIQGIGAGFVPEVLDRSVIDEVVTVGNQTAFETARAVARLE
                     GIPVGISSGAAIAAALEVGVRPENEGKTIVVIIPSFAERYLSTPLFEGL"
     gene            288476..290995
                     /locus_tag="Snov_0300"
     CDS             288476..290995
                     /locus_tag="Snov_0300"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: met:M446_0500 multi-sensor signal
                     transduction histidine kinase;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="ADH87634.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR018228"
                     /translation="MAHPAGMGGERNQGGRVPQVRPGRRLLRPLFTGLAFAAPIAPAS
                     AAPASDVFAVLAVQDPSVLIGLALVVGLIVFATTTAIVHLRYRRQSLRREMAAFGEIS
                     RLEAQIDEARALLMAEPQIVVVWRDPAADPEIIGNTPAFTGVAAPARILAFGSWLTPA
                     SAREIEAAVDRLRGRGTPLAATLATQDGRFVEADGRPVGAAVVLRLRDITGVRLDQAQ
                     LEAAYRALDAESSALRTLLDALPAPAWVDGEDGRLRWSNAAYAHAVEARDASDAASRG
                     LMLLDQQSRTQAEKAHAASLPFKARLPVVVAGTRRVLDVLEVPAGGGAAGIALDATEA
                     EVVRAELAQVVGAHRRTLDQLATAVAIFGADQRLVFHNAAYARLFDLDAAFLDDRPTD
                     GAVLDRLRAARRLPEQADFRLWREELHAAYRAIEPREHWWHLPGGRTLRVVTAPNPEG
                     GITYLFDEVTERLALESRFNSLTRIQSETLDALAEAVAVFGSDGRLGLVNSAFRRLWQ
                     LDAAMLDAHPHIDAVAAACRPLTADAAVWARLTATVTGIEARMPTEFRMERNDRTILD
                     GSTQPLPDGATLVTLRDVTDSVNVERALVERNDALVAADHLKSTFVSHVSYELRSPLT
                     TIIGFAQLLDDTGIGPLNVKQRAYVNHITESSAALLAIINDILDLATIDAGSMALELT
                     EVDVRAAMDAAAEGVRDRLAEGGIRLSIELQNAAGSFRADAKRVRQILYNLLSNAVGF
                     APEGSTVTLSAERREDGVIFRVRDMGPGVPPEIGARAFDRFESHTAGSRHRGVGLGLS
                     IVRSLVALHGGTVSLAPAQGGGTLVTCIFPLEAGASRDAAE"
     gene            291017..292846
                     /locus_tag="Snov_0301"
     CDS             291017..292846
                     /locus_tag="Snov_0301"
                     /inference="protein motif:PFAM:PF02367"
                     /note="PFAM: protein of unknown function UPF0079;
                     aminoglycoside phosphotransferase;
                     KEGG: xau:Xaut_3297 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0079"
                     /protein_id="ADH87635.1"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR003442"
                     /db_xref="InterPro:IPR011009"
                     /translation="MIDGRTTGAVPTMPVAHWDVVLPDEVATGRLAMDLAAMLRPGDL
                     VALDGDLGAGKTTLARALIRELAGDPELEVPSPTFTLMQTYDLPRHRVVHADLYRLSD
                     ASELDELGWQEQTDGAVTLVEWPERAEGAVLKTDRLEVHISMPQDRPETARRVRLLGY
                     GRLAGALYRMRAIRSLIDSTGFGPARRRHLQGDASTRSYERLVGAKRNAILMNAPRRP
                     DGPPVRAGRSYSAVAHLAEDVKPFVAMARGLRARGFSAPAIYGGDLDAGLLVIEDLGE
                     EGVLAGTPPAPVPERYEASVDVLAALHALDLPATLAVASGIDHQIPPYDLEALTIEAE
                     LLLDWYLPHCGVALPADARQSFRQLWAAALAPSLAQKPVWTLRDFHSPNLMWLPQREG
                     IAKVGLLDFQDAVMGPPAYDVVSLAQDARVDVPEALELHLLGRYVKARREADADFDMR
                     GFAASYAVMGAQRATKILGIFARLNHRDRKPGYLRHMPRIWNYLQRCLAFTDLEALAG
                     WYKDHVPPPRLHGRPEGAVGMPAPAPVPAAPLAPPRPAEAAPKAPPAAPPAEAPPPTE
                     AAAVTETPSAPATVAEAPAAETPPDAVPSEAASTQTPNDPATT"
     gene            292843..293562
                     /locus_tag="Snov_0302"
     CDS             292843..293562
                     /locus_tag="Snov_0302"
                     /inference="protein motif:PFAM:PF00483"
                     /note="PFAM: Nucleotidyl transferase;
                     KEGG: xau:Xaut_3298 nucleotidyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleotidyl transferase"
                     /protein_id="ADH87636.1"
                     /db_xref="InterPro:IPR005835"
                     /translation="MTAIKTAMVLAAGLGQRMRPLTDHMPKPMVAVNGRPLIDHVLDR
                     LAEAGVEKAVVNLHWHADVLERHLLGRTRPRIVLSDERGALLETGGGIRKALPELGPD
                     PFFVINADTIWIEGIRPNLAALAEGFDPEAMDIALLVAPIATSIGYDGHGDFLMDGEG
                     RLTPRPERILAPFVYAGAAVVAPRIFAGTPQGPFSLSRLFRQAAEAGRLHGERMEGVW
                     MHVGTPEAVALAEEAIERSKD"
     gene            293599..296640
                     /locus_tag="Snov_0303"
     CDS             293599..296640
                     /locus_tag="Snov_0303"
                     /inference="protein motif:TFAM:TIGR02786"
                     /note="TIGRFAM: double-strand break repair protein AddB;
                     KEGG: azc:AZC_0713 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="double-strand break repair protein AddB"
                     /protein_id="ADH87637.1"
                     /db_xref="InterPro:IPR014153"
                     /translation="MSRPDPNLLTIPASAPFLAVLADALLDGRLVEGFAPRHDPFALA
                     SATVFLPTRRAGRLLAEALRARMESGVTLLPRIVPLGDVDEDSLAFAESFTDPPRAVP
                     GMTRRLALASLVRRWRRLLAGDDGRVAVAAGPGAEFALADALAHLIDEMAAQQVPWEK
                     LDTLVPGQHDLYWDMALDFLKIAREFWPALLDELGAVDASVRRDRLIAAEAERLRAAP
                     AGPVIAAGSTGSMPATARLLAAVAHLTDGCVVLPGLDTDLDARSWDHLTDDEAPAPSH
                     PQYGLALLLKAHMRVGRDAVRSLAPPAPHGRERLLSEALRPVASTEAWASLAERLGAA
                     EIDAALAEVSVIEADDAREEALAIAVALREALEEPGRSAALVTPDRDLARRVAAELLR
                     FEVAIDDSAGEPLSESAPGRFARLVADACDAELAPVPLSALLRHPLARFGLERGALDQ
                     AADALELMVLRGPRPEAGADGLVRAVAGFSPGLHHSSDPRAAIDTDRQALAAGLAERI
                     ARAFGPLLALGAGEHPFATLLEAHRAAVAAAWSAEDGGAAEDAIALAELSKTFEAMAE
                     GASEAPVMRLADYAAALPLLLADRPVRPPLLPGARLRILGPLEARLVSVDRMVLAGLV
                     EGTWPSAVRTDPWLSRPMRAALGLEAPERRIGLSAHDFAQGCGAPELILSHPRKLGGA
                     PTVPSRFLQRLEAVSGEARWKMAKLRGDRFRRLAALIEEAPAASRIARPEPAPPVELR
                     PKRLSVTEIETWLRDPYTIYARHVLRLRPLDMLDEAPGAAERGSAIHDALGAFAQAFP
                     EALPAEPEAGLLAFGREAFRELEAFPAEYALWWARFERLVPRYIGWERARRADTRRVF
                     AELGGRMALAGGRFALTGRADRIEQLREGGLAIIDFKTGAVPTAKQTAAHYSPQLPLE
                     AAMAAAGGFRDLPAEGAAALTYVRLGTSELKEVGAVDRDETAFGLAASTLERLEQLIA
                     TFEDPSRGYASLARPMFRGRFGDYDHLARVKEWSTGGEGEE"
     gene            296637..300071
                     /locus_tag="Snov_0304"
     CDS             296637..300071
                     /locus_tag="Snov_0304"
                     /inference="protein motif:TFAM:TIGR02784"
                     /note="KEGG: azc:AZC_0714 putative exonuclease V;
                     TIGRFAM: double-strand break repair helicase AddA;
                     PFAM: UvrD/REP helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="double-strand break repair helicase AddA"
                     /protein_id="ADH87638.1"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR014151"
                     /translation="MSELTDLAPGPLRAATALQTTASDPLLSAWVSANAGSGKTHVLA
                     RRVIRLLMRGVPPGRILCLTYTKAAAANMANRVLDELRRWATLDDETLDKEIVRTDGG
                     RPDALRRAHARRLFAQALETPGGLKIQTIHAFCGALLHAFPFEAGVPAGFGELEEAAR
                     LELLARVRADVVLEAAGRPESALGQALGLIVGTTSDDGIDEIIGAMVADPAALEASDD
                     DLAAAVGLDRPIASRDIEHRIIAEALIARGAWLGLGQALIEEGGNCARRGRSLLEAAA
                     APDEGTADTYARVFLKEDGEPYGDSQFGAAPIRAKYPLLLAERDRLAPLAQLLSAARA
                     LERSRGVLILGREAARRYERAKAARGVLDFSDLVDAARRLLASGASAWVHYKLDQGID
                     HVLLDEAQDTSPEQWEVIRPLVAEFFAGEGARAEARYGAASLPRTLFVVGDEKQSIFS
                     FQGADPRRFDTVRRELMRLTGGVGFEHIELRHSFRSAPGILAAVDTVFHAETAYQGLS
                     ALAEPPVHEAIHAALPSLVELWEPEAPSEKVDIDAWQRPLDAPAADDPKGRLARKIAG
                     HIAARIREGFPVTGRHGTRPARPGDFLILVRRRDSLFEAIIRELKEARVAVAGADRLT
                     VAQHIAVMDLMALGDALLARDDELALACALKSPLFGLDDSDLMKLAPERAGLLEDALF
                     ARAGENPHWRAAAERLRRLRPEARRLRPFDFYARVLGRERGRAAMIARLGPEAADALD
                     EMLALARSYENVEAPSLAGFLAFLRRGGAEAKRDMEAGRDEVRVMTVHGAKGLEAPYV
                     ILADTTSGPMTRRAAGLLRVELPDGRRAALHAPSKKGDTPAMARARAQGDAAQQDEYR
                     RLLYVALTRAESALVLAGADGGRKRPADCWYDLVRGALEPEAVEQPAAGFAGTVRRWR
                     SAVHEEIIAAPAVAAIAAAPDEAERALARALSRPIEEPAARAALRPSASSLLSAAPEG
                     PEALALHRGELLHRLMAALASLPPEERAAPGRRLLAAAGDFEEAAREELLTEALGVLA
                     VPGLADLFGPGSLAEVPLVGELEDGTPVSGRIDRLAVLGDRILIADFKTDRRVPREAS
                     SLPPAHVRQVALYARLLRRLYPGRPIEARLVYTAGPLAHALGADVLERIVESVTSQ"
     gene            300154..300474
                     /locus_tag="Snov_0305"
     CDS             300154..300474
                     /locus_tag="Snov_0305"
                     /inference="protein motif:TFAM:TIGR01068"
                     /note="KEGG: xau:Xaut_3301 thioredoxin;
                     TIGRFAM: thioredoxin;
                     PFAM: Thioredoxin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="ADH87639.1"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017936"
                     /db_xref="InterPro:IPR017937"
                     /translation="MGVEKVSDQSFESDVIKSDGPVLVDFWAEWCGPCRMVAPVLDEV
                     AGELGDKLKIVKLNVDENPATASKYGIMSIPTLLLFKDGQLASRQVGAAPKAKMLQWI
                     NSAI"
     gene            300627..301133
                     /locus_tag="Snov_0306"
     CDS             300627..301133
                     /locus_tag="Snov_0306"
                     /inference="protein motif:PFAM:PF09351"
                     /note="PFAM: Domain of unknown function DUF1993;
                     KEGG: vap:Vapar_2424 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Domain of unknown function DUF1993"
                     /protein_id="ADH87640.1"
                     /db_xref="InterPro:IPR018531"
                     /translation="MPLSIYDASIPVFERALRNLDAILTKAEEHAAANGIDLSELAAA
                     RLAPDMFPLTGQIQSASDSAKFAAARLTGTTGPSFADTETTFEELHARIAKTLDYLAS
                     VDRAGFEGAETREIVQKSRRGERHFVGQAYLLTFALPNFFFHVTTAYDILRHKGVPVG
                     KSDYLGAF"
     gene            301435..303363
                     /locus_tag="Snov_0307"
     CDS             301435..303363
                     /locus_tag="Snov_0307"
                     /EC_number="1.1.99.3"
                     /inference="protein motif:PRIAM:1.1.99.3"
                     /note="KEGG: azc:AZC_0150 hypothetical protein;
                     PFAM: cytochrome c class I"
                     /codon_start=1
                     /transl_table=11
                     /product="Gluconate 2-dehydrogenase (acceptor)"
                     /protein_id="ADH87641.1"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR008168"
                     /db_xref="InterPro:IPR009056"
                     /translation="MSGARKRGIVFGLAAAFWGLGLAPAPAQTPAAPDDSALVARGEY
                     LARAADCMPCHTGDKAKPFAGGLGLNTPFGTLYSVNITSDVATGIGSWSFDDFRRALH
                     DGIRKDGAYLYPAMPFDAYTGITEDDLKALWAYVRRIPAVNAPNPENGLSFPFNIRLG
                     MLAWRELFFQPAFFKPTPGKSDEWNRGAYLVEALGHCSDCHSPRNIMGAIKGKEAFTG
                     AEVDGFYAPDIASGALGKTWRKDMLIQFLKTGSAPQKTVVFGPMAEVVHDSLSHLTDA
                     DLAAMATYLLESPPPLDAPAPQKASPLPADVYARASKLFIDNCAVCHQQQGTGLLGAI
                     PSLAGNPAVTAAEPYNVIAATLHGLPSDGHYGTMPSFAGRLSDQQIADVVNYVRTAWG
                     NQGTPNATPRMVAAWRETVKVPDYGTQAASAFDCAQVGGAPGAPGPDPKAVAALTAAI
                     AGGNREVSSLVESYEAAAPNASPAQVVDALMAAYCPVVAAGAGEDYQKYARLKGFTLQ
                     AAADVSFRGTPDSLPDVPVVTAVVAGKSLVARQPESLAGPLACPAAGKIPADLVTAAA
                     GLIGKPQLPVPGGAGGGYARELVTKNPKARPADIANALILSYCGLVAADKGIEPATQH
                     AYVEDFGQQVIQTLQVQP"
     gene            303590..304453
                     /locus_tag="Snov_0308"
     CDS             303590..304453
                     /locus_tag="Snov_0308"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: oan:Oant_2567 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF6 transmembrane"
                     /protein_id="ADH87642.1"
                     /db_xref="InterPro:IPR000620"
                     /translation="MSLRSLGSMLLLAVMWGLSIPVTKMGLETLPPLTLTALRFAVAV
                     PLLFALLAGRWRLPWRAVPKVAALGFLAIGIGQVTQTLGVVGTSASVGTVITATIPLF
                     IVVIAALRLRQPVTLLQTAGLIAAFAGIALVAFGDRDPAALAQTTASGAILMLLSAAA
                     IAFYYVWSVEVADAYGTVTVVAWSTLCGFISLAPWAAWEASNTPFVIGVTAIGAAIYL
                     GVVVTVAGLFLWLNMLRTVPARVAASVQFLQPVVGVMASAALFGDHLGLAFFVGVALV
                     LTGLATTLANR"
     gene            complement(304606..304690)
                     /locus_tag="Snov_R0006"
                     /note="tRNA-Leu5"
     tRNA            complement(304606..304690)
                     /locus_tag="Snov_R0006"
                     /product="tRNA-Leu"
     gene            304913..305935
                     /locus_tag="Snov_0309"
     CDS             304913..305935
                     /locus_tag="Snov_0309"
                     /inference="protein motif:PFAM:PF01370"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     KEGG: azc:AZC_1016 NAD dependent epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="ADH87643.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /translation="MVDVAAELPLESEAELEARAAPMERLVTIYGGSGFIGRHVVRAL
                     AKRGWRVRVAVRRPDLAGHLQPLGAVGQINPVQANLRYPASVLRAAEGAEVVINLVGV
                     LHESGRQSFEAVHAFGAKQVALAAREVGARLIHGSAIGANAESTAFYGKSKAAGEAAA
                     FEAVPEAVIMRPSIVFGPEDDFFNRFASMSRLSPVLPLIGGGETRFQPVFVGDVAEAY
                     ARAVDNLARPGTVYELGGPEILSFKQLMELMLAEIDRKRLLVPVPSAVAAFKARFLEL
                     LPNPLLTRDQVRMLGYDNVVSEAAKAEGRTLEGLGIKPTALGAILPSYLWRYRKAGQF
                     TRPEAA"
     gene            complement(306099..306905)
                     /locus_tag="Snov_0310"
     CDS             complement(306099..306905)
                     /locus_tag="Snov_0310"
                     /EC_number="3.6.1.27"
                     /inference="protein motif:TFAM:TIGR00753"
                     /note="TIGRFAM: undecaprenol kinase;
                     KEGG: xau:Xaut_1807 putative undecaprenol kinase;
                     PFAM: Bacitracin resistance protein BacA"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenol kinase"
                     /protein_id="ADH87644.1"
                     /db_xref="InterPro:IPR003824"
                     /translation="MSFGTLLEAFLLGLLEGFTEFLPVSSTGHILLAGHFLGFESQGK
                     VFEVVIQLGAILAIVVAYFQRFLHVLVTLPTSERSRNFVIGILIAFLPAAVIGAFAHG
                     FIKNVLFETPALICIMLILGGGVLLWVDTLKLRPIHDDAMAFPKALALKIGFIQCLAM
                     IPGVSRSGSTIVGGLLLGASKPAAAEFSFFLALPTMAGAFAYDLYKNRDALNADDATL
                     IAVGFVAAFIAALAVVRGLIAFVSRHGYTPFGWWRIAVGGVGLVALALVG"
     gene            307140..308102
                     /locus_tag="Snov_0311"
     CDS             307140..308102
                     /locus_tag="Snov_0311"
                     /inference="protein motif:PFAM:PF08239"
                     /note="PFAM: SH3 type 3 domain protein;
                     KEGG: bxe:Bxe_A1493 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SH3 type 3 domain protein"
                     /protein_id="ADH87645.1"
                     /db_xref="InterPro:IPR013247"
                     /translation="MRILVAGAMLLMALGGSAFAQGRGFVTTDVNLRAGPSVEYPVVL
                     VLAEGSPLDIFGCLEDYSWCDVAVDDYRGWVAAQYVESVYQGRRVEFYDYAPVIGVPI
                     IGFTFGDYWGRYYQGRPWYSTYDRWGPPRRPPVWGPPGWAPPPKPGWGKPGWGGPGWG
                     GPPPPKPGWGGKPPNGGWNGNPPHGGWNGNPPHGGWGGKPGNNPGWNGNPGWNGNPGW
                     NGGKPPQGGKPPQGGKPPQQGGPPPQGKPPQWQRPPQQGQKPPQSPPQQQWLQRPPQG
                     PVPYDTSRWRNNQSAPPSQQPQRPGYGGRPNCVPNTPGCPAPQR"
     sig_peptide     307140..307202
                     /locus_tag="Snov_0311"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.984 at
                     residue 21"
     gene            308305..308505
                     /locus_tag="Snov_0312"
     CDS             308305..308505
                     /locus_tag="Snov_0312"
                     /inference="protein motif:TFAM:TIGR00001"
                     /note="KEGG: mno:Mnod_5554 ribosomal protein L35;
                     TIGRFAM: ribosomal protein L35;
                     PFAM: ribosomal protein L35"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L35"
                     /protein_id="ADH87646.1"
                     /db_xref="InterPro:IPR001706"
                     /db_xref="InterPro:IPR018265"
                     /translation="MPKMKTKSGAKKRFKLSGTGKVVMAQAGKRHGMIKRTNKQIRDQ
                     RGTTVMSERDAFNVRKFYLPNG"
     gene            308537..308905
                     /locus_tag="Snov_0313"
     CDS             308537..308905
                     /locus_tag="Snov_0313"
                     /inference="protein motif:TFAM:TIGR01032"
                     /note="KEGG: mes:Meso_0674 50S ribosomal protein L20;
                     TIGRFAM: ribosomal protein L20;
                     PFAM: ribosomal protein L20"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L20"
                     /protein_id="ADH87647.1"
                     /db_xref="InterPro:IPR005813"
                     /translation="MARVKRGVTSHAKHKKVLKAAKGYFGRRKNTIRVAKQAVEKAQQ
                     YAYRDRKVKKRNFRALWIQRINAATRELGFTYGRFIDGLGKAGIEVDRKVLSDIAIHE
                     PAAFAALVEQAKAALEKQAA"
     gene            309159..310262
                     /locus_tag="Snov_0314"
     CDS             309159..310262
                     /locus_tag="Snov_0314"
                     /EC_number="6.1.1.20"
                     /inference="protein motif:TFAM:TIGR00468"
                     /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
                     subunit;
                     KEGG: azc:AZC_4449 phenylalanyl-tRNA synthetase alpha
                     subunit;
                     PFAM: phenylalanyl-tRNA synthetase class IIc; aminoacyl
                     tRNA synthetase class II domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase, alpha subunit"
                     /protein_id="ADH87648.1"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004188"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /translation="MSVAAALPDLDALERELSSAITAAADEAGLEAVRVSALGKKGSV
                     SELLKSLGGMSPEERKTAGPAINGLRDRLNEALGARRTELKAAALTKRLETERVDVTL
                     PVRETPAELGRVHPISQVIDELTAIFADMGFSVAEGPDIEDDFHNFTALNFPEGHPAR
                     EMHDTFYLPTKEDGSRLVLRTHTSPVQVRTMLSKKPPIRVICPGRTYRSDSDQTHTPM
                     FHQVEGLVIDKGSNLGHLKWILEEFCKAFFEVDNVKMRFRPSFFPFTEPSMEVDIQCD
                     RSRPGEIRFGEGSDWLEILGCGMVHPNVLKNCGLDPDEYQGFAWGMGIDRIAMLKYGM
                     PDLRAFFEADVRWLSHYGFRPLDFPTLAGGLSN"
     gene            310282..312687
                     /locus_tag="Snov_0315"
     CDS             310282..312687
                     /locus_tag="Snov_0315"
                     /EC_number="6.1.1.20"
                     /inference="protein motif:TFAM:TIGR00472"
                     /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta
                     subunit;
                     KEGG: azc:AZC_4450 phenylalanyl-tRNA synthetase beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase, beta subunit"
                     /protein_id="ADH87649.1"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR004532"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016027"
                     /db_xref="InterPro:IPR020825"
                     /translation="MKFTLSWLREHLSGDYSLDDVTGTLNRIGFEVEGVEDKAAKLKG
                     FSIAYVVSAVQHPNADKLRVCMVDTGQGEPVQVVCGAPNARTGMKSVFSPPGTYIPGK
                     DITLGIGTIRGVESRGMLCSAAELELSEDHDGIIDLPADAPVGATYVDWAGLGDPVVE
                     IAVTPNRADGLGIHGIARDLAAAGVGTLIEKPIEAVKGAYPCPVSVIIAEGAPCPAFA
                     LRLVRGVKNGPSPDWLQAKLRAIGLRPINTLVDITNFLTFDQNRPLHVFDAAKVHGNL
                     VVRRAKEGESLPALDGKTYALDESMCVIADDRAVESLAGVMGGEESGCDETTVDVLVE
                     SALWEPINIAQTGRKLGLNSDARFRFERGIDPAFTLPGLEMATKLILDLCGGEASEVV
                     LAGAIPDTTRVIEFPLSLTEKLTGLVASDSEQVETLGKLGFKVEGTSGTARVTPPSWR
                     GDIEGKADLVEEVVRIAGLDRVPSIPFPRDETARKPVLTTLQLRTRKAKRALAARGLV
                     EAVTWSFVAKEQAELFGGGAPELALANPIASDLSDMRPSLLPGLIGSAQANADRGHGD
                     SALFEVGQVFKGDRPQDQFIAATGIRRATARPMGAGRHWSAKAGAVDAFDAKADALAV
                     LAAAGAPVANLQISTDAPAWFHPGRSGTFRLGPNVIGHFGELHPSVLEALDADGPLVG
                     FEVLIDRIPEPKAKATRVKPLLELAAFQPVERDFAFVVPRSVAAGDMVKAAAGVDRKL
                     ITAVNVFDLYEGAGIDEDKKSVALSVTLQPREKTLTDAEIEAVAGKIVAEVAKKTGAM
                     LRG"
     gene            complement(312819..314171)
                     /locus_tag="Snov_0316"
     CDS             complement(312819..314171)
                     /locus_tag="Snov_0316"
                     /inference="protein motif:PFAM:PF01593"
                     /note="PFAM: amine oxidase;
                     KEGG: azc:AZC_4451 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="ADH87650.1"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR017909"
                     /translation="MNRSPSRPGALSRRRFLAATSAALLPMPALAQAQYAGDVDVAIV
                     GGGAAGIAAARKIAEAGRNYVLLEAGSALGGRARTVSAFGQDIDLGASGFARTDSTLA
                     AAAQAMGSEITPLPSGRRLFLDGREAHESAYDAFSVALGKARRDMLAVADTNKDPAAA
                     TVIGPVDGWAATSAQLIGPLSAGRALASLSTLDLVQREAPPDDATSVKGIGALIETLG
                     SRLNVQTGAAVSVITNAGRFHTLTLRGQRAPIRARAIIVAVPAPVIAAGALRFNPVLP
                     PRLAAAFRGVPAGFLEQVVFRLPRNPLGLQPNETVLARAGTAPPALLRGRINGGDVHV
                     LTFGDAQAREIAEKGEAAALNLVRTYLATAFELDADAVSEVVCSRWGADPLFRGALVA
                     ASPGQGAQRRLFADTVQNRIFLAGDYVPTRGWGTLAAAWSSGEAAAARALRLVGDGPA
                     "
     sig_peptide     complement(314076..314171)
                     /locus_tag="Snov_0316"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.948 at
                     residue 32"
     gene            complement(314243..314851)
                     /locus_tag="Snov_0317"
     CDS             complement(314243..314851)
                     /locus_tag="Snov_0317"
                     /inference="protein motif:PFAM:PF01810"
                     /note="PFAM: Lysine exporter protein (LYSE/YGGA);
                     KEGG: rec:RHECIAT_CH0002605 probable amino acid efflux
                     protein, LysE family"
                     /codon_start=1
                     /transl_table=11
                     /product="Lysine exporter protein (LYSE/YGGA)"
                     /protein_id="ADH87651.1"
                     /db_xref="InterPro:IPR001123"
                     /translation="MPLSAYIAGLASGLSLIVAIGAQNAFVLQRGLRGEHVFAVCLAC
                     ALSDAVLIAAGVAGLQQMLAMAPWLDAALRYAGAAFLVWYGARSLRSALRSQEALVVG
                     AGGAAALGPTLAATLALTWLNPHVYLDTMVLLGTLSTRHPGAEAFFAFGAITGSFAFF
                     FGLGYGAAWLRPLFARPSSWRVLEGVIAAVMWSIALGLLMDR"
     sig_peptide     complement(314774..314851)
                     /locus_tag="Snov_0317"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.823) with cleavage site probability 0.595 at
                     residue 26"
     gene            314941..315837
                     /locus_tag="Snov_0318"
     CDS             314941..315837
                     /locus_tag="Snov_0318"
                     /inference="protein motif:TFAM:TIGR03298"
                     /note="KEGG: rhi:NGR_b00130 transcriptional regulator,
                     LysR family;
                     TIGRFAM: transcriptional regulator, ArgP family;
                     PFAM: regulatory protein LysR; LysR substrate-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87652.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017685"
                     /translation="MLDYSALRAVAAVVQAGSFEKAARTLNVTPSAVSQRVKQLEERL
                     GTVLIARGTPCTATEIGAKLCRHMEHVGMLEGELLAGLPALADASPRQRVTVHIAVNA
                     DSLGTWFVEAIAAFARRSDYLVGLVVDDQDHTAEWLKAGRVVAAVTSLEKPIQGCRRL
                     SLGALRYHATASPDYRARHFPDGVTPAAIANAPALTFDQKDQLQSRWIRQALGADIAH
                     PTHWLPSPQSFIEATLAGMGWGMNPFRSVRDHLAAGRLVELIPDTPVDTPLFWQVNRL
                     VAERLADLTREVTAVARRELAG"
     gene            316018..316680
                     /locus_tag="Snov_0319"
     CDS             316018..316680
                     /locus_tag="Snov_0319"
                     /inference="protein motif:PFAM:PF04401"
                     /note="PFAM: protein of unknown function DUF540;
                     KEGG: xau:Xaut_1152 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF540"
                     /protein_id="ADH87653.1"
                     /db_xref="InterPro:IPR007496"
                     /translation="MLRDAFAAFAETFSPDYRRVLLRSVGFAVGLLVALGIGAHYALT
                     YFVALDLRWAEITLDIVAAFGIFIAAIFLVPPVTSLIAGLFLDDVAAQVERGFPGEPE
                     GQPLPIGRSLFLTVKFFGVMLAVNLVALLLLLVPGVNLVVFYVANGYLLGREYFQLAA
                     MRYRDEDEVALLRRHHAGAIFLAGLIIAAVVSVPILNLVTPVFATIFMVRLHKRLSRR
                     EY"
     gene            complement(316677..317528)
                     /locus_tag="Snov_0320"
     CDS             complement(316677..317528)
                     /locus_tag="Snov_0320"
                     /EC_number="4.2.99.18"
                     /inference="protein motif:TFAM:TIGR01083"
                     /note="SMART: HhH-GPD family protein;
                     TIGRFAM: endonuclease III;
                     KEGG: azc:AZC_3684 endonuclease III/Nth precursor;
                     PFAM: HhH-GPD family protein; iron-sulfur cluster loop"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="ADH87654.1"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR005759"
                     /db_xref="InterPro:IPR011257"
                     /translation="MADGDRDSGSGPARERAGTRKPAAKPASGKAAAKKIASKAKAVL
                     EEQAATRPGRRRAVANAAAAAIGGAFKPWTKKEVETAFSRFEEANPHPEGELNYHDPF
                     TLLVAVVLSAQATDAGVNKATKTLFEEAPTPARMVALGEEGVARHIRTLGLYRGKAKN
                     VVELSRLLIAEHDGKVPPDRAALEALPGVGRKTANVVLNIAFHMPTIAVDTHLFRVAN
                     RTGLAPGKTPLEVELGLERVIPDRFKLHAHHWLILHGRYICKALKPECPRCLIADLCR
                     WPEKTPA"
     gene            317551..318081
                     /locus_tag="Snov_0321"
     CDS             317551..318081
                     /locus_tag="Snov_0321"
                     /inference="protein motif:PFAM:PF10003"
                     /note="PFAM: Protein of unknown function DUF2244,
                     transmembrane;
                     KEGG: azc:AZC_3683 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF2244,
                     transmembrane"
                     /protein_id="ADH87655.1"
                     /db_xref="InterPro:IPR016990"
                     /db_xref="InterPro:IPR019253"
                     /translation="MNAASTNQALGPTIDDEPTLFAARYQPYRSLGQHGFLVVMIIVA
                     GISFVCGTAFLLMGAWPVFGMFGLDALAIYWAFRLNFRQARACEEIVVTPSLIRLRHV
                     AADGTVYEEELNPLWTRLHRELHEDYGLQRLTLEMRGRPYVIGGFLHTAQREELAEQL
                     SRALAEARRGVVRSTF"
     gene            318210..319088
                     /locus_tag="Snov_0322"
     CDS             318210..319088
                     /locus_tag="Snov_0322"
                     /inference="protein motif:TFAM:TIGR00589"
                     /note="TIGRFAM: methylated-DNA/protein-cysteine
                     methyltransferase;
                     PFAM: Methylated-DNA-[protein]-cysteine
                     S-methyltransferase DNA binding; helix-turn-helix- domain
                     containing protein AraC type;
                     KEGG: xau:Xaut_2813 methylated-DNA--protein-cysteine
                     methyltransferase;
                     SMART: Helix-turn-helix, AraC domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="ADH87656.1"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="InterPro:IPR018060"
                     /translation="MLAPNLDAAHPLEIAAHDYEIVRRAVEYVNLRFRDQPEVEEIAR
                     AAGVNPRALTDLFRRWCGLTPKDFLQAVTIDAARRVLTESDNVLDAAYELGLSGPGRL
                     HDLFIVHESMSPGEWKTGGAGLVVRYGFHASQFGMALAMVTPRGLCGLAFADEGEEDK
                     ALADMRRRWPNALYIEDPIATAPYAARIFDSQKWSLDDPLRIVFIGTDFEVRVWETLM
                     RIPLGKATTYSNIASCVERPSAARAVGAAIGKNPMSFVVPCHRVLGKNGDLTGYHWGL
                     TRKRAILGWEAGQLCK"
     gene            complement(319110..319550)
                     /locus_tag="Snov_0323"
     CDS             complement(319110..319550)
                     /locus_tag="Snov_0323"
                     /inference="protein motif:PFAM:PF05232"
                     /note="PFAM: transmembrane pair domain protein;
                     KEGG: mrd:Mrad2831_5841 transmembrane pair
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane pair domain protein"
                     /protein_id="ADH87657.1"
                     /db_xref="InterPro:IPR007896"
                     /translation="MRTPADRIRHVVIFEIIALSIITPLGAWVFGLPMTEMGVVGAGA
                     ALIAASWNYLFNLGFDHALARLRGSVRKTLGLRVVHALLFEAGLLAVLVPFIAWYLRI
                     GLVEAFLMDVALAGFFLIYAFLFNWAYDVIFPVRETRRRPVPAE"
     gene            complement(319669..320292)
                     /locus_tag="Snov_0324"
     CDS             complement(319669..320292)
                     /locus_tag="Snov_0324"
                     /inference="protein motif:TFAM:TIGR01258"
                     /note="KEGG: bbt:BBta_0198 phosphoglyceromutase;
                     TIGRFAM: phosphoglycerate mutase 1 family;
                     PFAM: Phosphoglycerate mutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase 1 family"
                     /protein_id="ADH87658.1"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /translation="MSERLLVLVRHGQSEWNLKNLFTGWRDPDLTELGVEEAKTAGKR
                     LKADGYTFDIAFTSKLSRAQKTLDLALAELGQTGLPTIENLALNERDYGELSGLNKDD
                     ARVKWGEEQVHIWRRSYDVPPPGGESLKDTIARTLPYYVTEILPKVLQGNRTLVVAHG
                     NSLRALIMVLEKHTPESIMKRELLTGVPVIYRLKPDSTIESVVDLAG"
     gene            complement(320311..321126)
                     /locus_tag="Snov_0325"
     CDS             complement(320311..321126)
                     /locus_tag="Snov_0325"
                     /EC_number="1.17.1.8"
                     /inference="protein motif:TFAM:TIGR00036"
                     /note="TIGRFAM: dihydrodipicolinate reductase;
                     KEGG: mpo:Mpop_2435 dihydrodipicolinate reductase;
                     PFAM: dihydrodipicolinate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate reductase"
                     /protein_id="ADH87659.1"
                     /db_xref="InterPro:IPR000846"
                     /db_xref="InterPro:IPR011770"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTQMRLVVVGASGRMGRVLIRAVDEAPDLLLVGAIDQPGSEFIG
                     RDAGELAGLPPLGVKISDDALTHFAAADGVIDFTVPQATVGYAALAAQARIVHVIGTT
                     GFSPEDEEKIAAASRHAAIVKSGNMSLGVNLLAALVRRVARTLDEGFDIEVLEMHHNR
                     KIDAPSGTALLLGQAAAQGRGVTLEENGVFTRHGHTGARKAGDIGFATLRGGSVVGEH
                     NVIFAGQAERIELAHKAEDRGIFARGALAAARWARGRKPGLYSMADVLGLADF"
     gene            321471..323231
                     /locus_tag="Snov_0326"
     CDS             321471..323231
                     /locus_tag="Snov_0326"
                     /inference="protein motif:TFAM:TIGR00118"
                     /note="KEGG: azc:AZC_2376 acetolactate synthase large
                     subunit;
                     TIGRFAM: acetolactate synthase, large subunit,
                     biosynthetic type;
                     PFAM: thiamine pyrophosphate protein TPP binding domain
                     protein; thiamine pyrophosphate protein central region;
                     thiamine pyrophosphate protein domain protein TPP-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, large subunit,
                     biosynthetic type"
                     /protein_id="ADH87660.1"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /translation="MMREMTGAEMVMQALIDQGVEHMFGYPGGAVLPIYDAMFHQNQV
                     RHVLVRHEQGAVHMAEGYARSSGKVGVVLVTSGPGATNAVTGLTDALLDSIPLVCITG
                     QVPTHLIGTDAFQECDTVGITRPCTKHNYLVRDVNDLARIMHEAFYVAQNGRPGPVVV
                     DIPKDVQFAKGMYVGPENIQHKTYQPRLKGDPEKIKAAVELLAKAKRPVLYTGGGVIN
                     SGPEASRLLREFARLSGYPVTSTLMGLGAFPASDKQWLGMLGMHGTYEANMSMHDCDV
                     MLCIGARFDDRITGRVDAFSPNSKKIHIDIDPSSINKNVKVDLPIIGDVRHVLEDILT
                     VWRGMKVEPDRQAIASWWGQIDRWRARKSLAFQPGDRIIKPQQAVKALYDAVKDKDVY
                     ITTEVGQHQMWAAQHFHFEEPNRWMTSGGLGTMGYGLPAAIGVQVAHPNSLVIDIAGE
                     ASIQMCLQELSTALQFNLPVKIFVLNNEYMGMVRQWQDLLHGGRYSHSYSESLPDFVK
                     LAEAYGAVGLRCSNPADLDGTIQEMINVDRPVLFDCLVDKMENCLPMIPSGKPHNEMI
                     LPDHPEALDEAISEEGKMLV"
     gene            323392..323907
                     /locus_tag="Snov_0327"
     CDS             323392..323907
                     /locus_tag="Snov_0327"
                     /inference="protein motif:TFAM:TIGR00119"
                     /note="KEGG: xau:Xaut_1489 acetolactate synthase, small
                     subunit;
                     TIGRFAM: acetolactate synthase, small subunit;
                     PFAM: Acetolactate synthase, small subunit-like; amino
                     acid-binding ACT domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, small subunit"
                     /protein_id="ADH87661.1"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004789"
                     /db_xref="InterPro:IPR019455"
                     /translation="MPPVQEPAERHTLSMLVDNEPGVLARIVGLFSGRGYNIDSLTVS
                     EVSHASHLSRITVVTTGAPPIIEQIKSQLDRLVPVHKVVDLTVVGKAVERELALIKVR
                     GKGEIRQEALLIAESFRARTVDTTLESFVFEITGKPEKIDQFVSLLEPLGLVEVSRTG
                     VAAIGRGPDGM"
     gene            complement(323940..324485)
                     /locus_tag="Snov_0328"
     CDS             complement(323940..324485)
                     /locus_tag="Snov_0328"
                     /inference="protein motif:PFAM:PF06041"
                     /note="PFAM: protein of unknown function DUF924;
                     KEGG: vap:Vapar_2217 protein of unknown function DUF924"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF924"
                     /protein_id="ADH87662.1"
                     /db_xref="InterPro:IPR010323"
                     /translation="MSLPTAAEIIAFWREAGPDKWFEKDDAFDAAIRARFLAAHEAAA
                     AGELDGWAQTAEGSYALLLLLDQFPRNLFRNSPRAFATDEKARAVADHAVAQGFDMEF
                     DTLERRFIYMPFMHSEALADQERCIALCEASGDEEGTMYAVIHRDIIRDFGRFPHRNP
                     VLGRDTSEEEHAFLKAGGFAG"
     gene            324638..325300
                     /locus_tag="Snov_0329"
     CDS             324638..325300
                     /locus_tag="Snov_0329"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: mch:Mchl_0328 transcriptional regulator, TetR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="ADH87663.1"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /translation="MTTPPDPAGETFTERQQAVLDTVLALMVEQGGDVTMTAVARRAS
                     CSKESLYKWFGDRDGLLTATVRWQASKVRAGNYDRTRLDILALRDSLIRFAANWLGVI
                     SSPTSVALNRFAISQAGTRGSNLGAIMLANGRFAIGERLKPLLDAGREAGLLDFDDTE
                     TAFRTFIGLVGRDVQIRVLLGDRLSLSPSEIERDAARATDQFLTLCGTEKTGPGRNQT
                     NA"
     gene            325315..326334
                     /locus_tag="Snov_0330"
     CDS             325315..326334
                     /locus_tag="Snov_0330"
                     /EC_number="1.1.1.86"
                     /inference="protein motif:TFAM:TIGR00465"
                     /note="TIGRFAM: ketol-acid reductoisomerase;
                     KEGG: mlo:mll1405 ketol-acid reductoisomerase;
                     PFAM: Acetohydroxy acid isomeroreductase catalytic domain
                     protein; acetohydroxy acid isomeroreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="ADH87664.1"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013023"
                     /db_xref="InterPro:IPR013116"
                     /db_xref="InterPro:IPR016040"
                     /translation="MRVYYDRDADLNLVKGKKVAIIGYGSQGRAHALNLKDSGVKDIA
                     IGLKPGSATAKKVEADGLKVMSVAEAAKWADLMMMATPDELQADIYKNEIAPNIRDGA
                     AIAFAHGLNVHFGLIEPKSTVDVLMIAPKGPGHTVRGEYEKGGGVPCLVAVHQDASGN
                     ALDLGLSYASGVGGGRSGIIETTFKEECETDLFGEQVVLCGGLVELIRAGFETLVEAG
                     YAPEMAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEWGEYVSGPRIITAETKAEMK
                     RVLTDIQTGKFTSEWMQEYRAGAARFKGIRRINDAHQIEEVGEKLRGMMPWIGKNKLV
                     DKTKN"
     gene            complement(326703..327227)
                     /locus_tag="Snov_0331"
     CDS             complement(326703..327227)
                     /locus_tag="Snov_0331"
                     /inference="protein motif:PFAM:PF09335"
                     /note="PFAM: SNARE associated Golgi protein;
                     KEGG: azc:AZC_2367 uncharacterized membrane-associated
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SNARE associated Golgi protein-like protein"
                     /protein_id="ADH87665.1"
                     /db_xref="InterPro:IPR015414"
                     /translation="MIELESYAREMLAFVEAHAHWAPYIAFALAFGESIAVLSLFFPA
                     TFVLIGLGPIIEAGGAPFAPVWAAAVAGASLGDALSYWIGRHFKDSARHIWPLRNYPE
                     MLARGERFFRSYGSWSVFIGRFFGPLRAVVPLVAGMFGMPHLIFQMANVTSAMVWAFL
                     LLAPGAAAVKLLGW"
     gene            complement(327235..328518)
                     /locus_tag="Snov_0332"
     CDS             complement(327235..328518)
                     /locus_tag="Snov_0332"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: xau:Xaut_1940 FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="ADH87666.1"
                     /db_xref="InterPro:IPR006076"
                     /translation="MAFDTDHPASWYAATAHHLSPFPPLAGTVRTDVCVIGGGYTGLS
                     AALHLAEAGLSVALLEASRLGSGASGRNGGQIHSGQRRDQDWLEAHVGLDDAKALWRL
                     AEDAKALLHRLIARHMIDCDVKPGLIVADHKPSYVAHSHAYARKLNEVYGYPHAAPLT
                     REELRELVGSDAYYGGMIDRGGGHLHPLNLALGLAKAAHTAGARLFEQSRALRINEAG
                     DKVKVSTPRGVVEADWVLECGDGLQDGLDKRVDTHVMPIANYIAATEPLGERGREIIS
                     NGAAVADSRFVVNYYRLSGDGRLLFGGGESYTRRLRPNPGEFVRPYMLKVFPQLADVR
                     IDYGWGGLLGITMTRMPFVRRLSPRVLTAAGYSGQGVMLAPYFGKILAEAVKGQLGRF
                     DLLAGLPVPPFPGGPLMRWPLLVAGMSYYALRDRL"
     gene            complement(328543..330378)
                     /locus_tag="Snov_0333"
     CDS             complement(328543..330378)
                     /locus_tag="Snov_0333"
                     /inference="protein motif:TFAM:TIGR00585"
                     /note="KEGG: azc:AZC_2393 DNA mismatch repair protein;
                     TIGRFAM: DNA mismatch repair protein MutL;
                     PFAM: MutL dimerisation; DNA mismatch repair protein
                     domain protein; ATP-binding region ATPase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="ADH87667.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014763"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /translation="MPLRLLPSTLVDRIAAGEVVERPAAALKEIVENALDAGATRIEV
                     VIDGGGRRLMRVTDDGCGMSADELALAVERHATSKLDTEDLLSIATLGFRGEALPSIG
                     AVARLSITSRPRGSDTAHEIRVEGGAKSAVKPAALGFGTRVEVRDLFFATPARLKFLK
                     SERAETAAAVDAVKRLALARPDVGFILVTDDRPPVTWPARSADAAGRRARIADVLGHE
                     VGANALDIDGLREGARLSGLAGLPTYAKANSLSQYLFVNGRPVRDKVLIGAIRAAYAD
                     LLPSDRHPVTALFLDLDPHEVDVNVHPAKTEVRFRDAGNVRALIVRTLTDALALGVPR
                     TASTAAEKLAQFARPEFRQGAGNPPRPGNYDWTRSWAAPDVAPREASPAGFREEAAGF
                     DFGLGLALAPSADARANAAPPAPDLMERPLGAARAQLHETYIIAQTKDGVVVIDQHAA
                     HERIVYEKLKAAMERDGLARQMLLVPLVVELDPSDAARLAERAAALEKLGLVLEPFGP
                     GAVLVREVPSLLGDADVCALVTELAEHAAEWDDALPLERRLLHIAATMACHGSVRAGR
                     RLRVEEMNALLREMEETPNAAQCNHGRPTFVTLALADIERLFARR"
     gene            complement(330466..331283)
                     /locus_tag="Snov_0334"
                     /product="hypothetical protein"
                     /pseudo
     gene            complement(331283..332194)
                     /locus_tag="Snov_0335"
     CDS             complement(331283..332194)
                     /locus_tag="Snov_0335"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: azc:AZC_3518 spermidine/putrescine ABC transporter
                     permease component I protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ADH87668.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MAVKSSGRWLVLSVPYLWLLALFLVPFLIVFKISLSTDAIAQPP
                     YEPIFDLSAGWDAFKEAFAQLSFENYSYVLSWDNEFIEAYGSSLWIAGVSTFLLLLVG
                     YPIAYGMARAPKSIRPTLLMLVILPFWTSFLIRVYAWIGILSPEGLLNQLLMALGIIS
                     PDAPLQILATNTAVYIGIVYSYLPFMILPLYSALEKMDDTLLEAAADLGCPPFAAFWK
                     ITWPLSLPGVFAGCLLCFIPAVGEFVIPDLLGGSDTLMIGKVLWTEFSVNRSWTVSSA
                     VAVLLLMVLVIPIVFYQNLQAREVEGR"
     gene            complement(332205..333380)
                     /locus_tag="Snov_0336"
     CDS             complement(332205..333380)
                     /locus_tag="Snov_0336"
                     /inference="protein motif:TFAM:TIGR01187"
                     /note="TIGRFAM: spermidine/putrescine ABC transporter
                     ATPase subunit;
                     PFAM: ABC transporter related; Transport-associated OB
                     domain protein;
                     KEGG: xau:Xaut_2941 spermidine/putrescine ABC transporter
                     ATPase subunit;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter ATPase
                     subunit"
                     /protein_id="ADH87669.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005893"
                     /db_xref="InterPro:IPR008995"
                     /db_xref="InterPro:IPR013611"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSNGVAEKTQKTIGGIRRKFAPWNDPQAVPLIRYQNVTKRFGEF
                     TAVDNLSLDIYEREFFALLGPSGCGKTTLMRMLAGFEDPTEGKITLAGQNLVGTPPYK
                     RQTNMMFQSYALFPHMSVWDNIAFGLRQDRMEKGAVAARVEEMLKLVKLEKFAKRKPH
                     QLSGGQRQRVALARSLAKRPKVLLLDEPLGALDKKLREETQFELMDIQMELGMTFLIV
                     THDQEEAMTVADRIAVMNHGKLVQVDQPAVIYEQPNSRYVADFVGDVNILDAKVEALA
                     PGAVTLRSEAAPDMPIRVAQECAAKVGDSVAVALRPEKLRVELDPPADPSVNTLTGTI
                     WDIGYLGDLSIYHVELPNGMRVKAAKPNLTRMVERPITWEDKVYVSFTPDAGVVLTN"
     gene            333574..334974
                     /locus_tag="Snov_0337"
     CDS             333574..334974
                     /locus_tag="Snov_0337"
                     /EC_number="6.3.1.11"
                     /inference="protein motif:PRIAM:6.3.1.11"
                     /note="KEGG: azc:AZC_4442 glutamine synthetase family
                     protein;
                     PFAM: glutamine synthetase catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamate--putrescine ligase"
                     /protein_id="ADH87670.1"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /translation="MAKKKRPDKDVVEAPRGVTSLAEAKAWMAARGITEIECAVPDLA
                     GVGRGKIMPVSKFLSGPTMNLPLSVFFQTISGDYPPYDGLVDSVVVDSDLVMEPDFST
                     LAVVPWAQDPTAQIIHDAYHRDGRPVDLAPRQVLKNVVELYSHKGWKAVVAPEIEFYL
                     VEPNTDADYPLKPPIGRSGRPEIGRQSYSIQAVNEFDALFEDMYDYSEAQGLEIDTLI
                     HEDGAAQMEINLLHGDPVVLADQVFLFKRTIREAALAHKIYATFMAKPIADEPGSAMH
                     IHQSIVDAETGKNIFSDKDGDPTPEFFSFIAGQQRYMPAVMSIMAPYVNSYRRLTRDS
                     MAPINVQWGYDNRTAGLRVPPSSPAARRVENRVPSSDANPYLVIAASLACGYLGLVEG
                     LRPTDPLEADAKFLDFELPRGLLEAVAALQYSEEIAGVLGPSFVKTYTAVKQQEFDTF
                     MRVISPWEREYLLLNV"
     gene            complement(335352..336314)
                     /locus_tag="Snov_0338"
     CDS             complement(335352..336314)
                     /locus_tag="Snov_0338"
                     /inference="protein motif:PFAM:PF00296"
                     /note="PFAM: Luciferase-like, subgroup;
                     KEGG: bja:blr5498 putative oxidoreductase protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Luciferase-like, subgroup"
                     /protein_id="ADH87671.1"
                     /db_xref="InterPro:IPR011251"
                     /db_xref="InterPro:IPR016048"
                     /translation="MAKSGEQPSPHSAPLPAACWSPSPRVAFNSSRRWAAIAARTKRI
                     RLGSAVTVLSSDDPIRVFQRFATVDAISNGRAEVILGRGSFTESFPLFGFDLKDYEAL
                     FSEKLDLFAALLKDNGTADGVTWNGNLRPPLEKQHVYPLVESGTLKTWIGVGGSPESV
                     VRAARYGLPLMLAIIGGDPARFAPYVDLYHRAVDQLGGVAHPIGVHSPGYVAETDEQA
                     REEFFADYKRMRDRIGAERGWPPMGRDEFEREVTRGSLYLGSPETVARKIAKTATTLG
                     IGRFDMKYSAGPLAHEKSMKCIELYGRQVIPRVRELLAQEKVEA"
     gene            336519..337403
                     /locus_tag="Snov_0339"
     CDS             336519..337403
                     /locus_tag="Snov_0339"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: xau:Xaut_4653 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87672.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /translation="MTVLLDIDQLRTFIAIAETGSFTKAADVVHKTQSAVSMQMKRLE
                     ERVGKAIFARDGRASRLTDEGDRLLDYARRIVKLNMEAVASLASAELSGRVRLGVPDD
                     YADRYLPEIMARFSNTHPNVELTVVCDPSTDLIDRIDTGDLDLAIVTDCEMINRETEI
                     IRREQLLWVGSNRHPVHLEDPVPLALGRQTCNWRQEAISMLQAVGRPFRILYTSSNST
                     AVSAAVLSGLAISVLPESGLRPGMRVLGPSDGFPALAPCRIGLLRNRHEASPLADALA
                     NHIVQGLDNISEAAIAAE"
     gene            337734..338156
                     /locus_tag="Snov_0340"
     CDS             337734..338156
                     /locus_tag="Snov_0340"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: nwi:Nwi_1654 glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="ADH87673.1"
                     /db_xref="InterPro:IPR004360"
                     /translation="MSAPVPGDLVPFLRYADPHAAIAWLKKALGFSPILVVDDGHGGV
                     AHAELALGTSALMIGGVKDDVLRMRTPAEAGGVTQGIYVVVPDADALWTCTMEAGAEV
                     VMAIYDTPYGSREFTVRDPEGHLWSVGTYRAGSYKSDS"
     gene            complement(338309..339679)
                     /locus_tag="Snov_0341"
     CDS             complement(338309..339679)
                     /locus_tag="Snov_0341"
                     /EC_number="6.3.2.2"
                     /inference="protein motif:TFAM:TIGR01436"
                     /note="TIGRFAM: glutamate/cysteine ligase;
                     KEGG: azc:AZC_2967 glutamate-cysteine ligase;
                     PFAM: glutamate--cysteine ligase GCS2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/cysteine ligase"
                     /protein_id="ADH87674.1"
                     /db_xref="InterPro:IPR006336"
                     /db_xref="InterPro:IPR011556"
                     /translation="MARDQIDTQPIESRDDLVAWLEAGCKAPMKFRIGTEHEKFPFTL
                     NGHEPVPYEGPNGIRALLEGMQALNCWEPIMEGSTIIGLADNVGGGAISLEPGGQFEL
                     SGAPLITIHETCAEVNSHLTQVREVATPLGFGFLGLGMSPKWTLAQTPVMPKGRYKIM
                     TAYMPKVGTHGLDMMYRTCTVQVNLDFSSEADMVQKLRVGLALQPVATALFANSPFTE
                     GKPNGFLSFRSEIWRDTDNNRSGMLPFAFEKGMGFERYVDYALDVPMYFIKRGDHYID
                     VAGSSFRDLLAGKHPAVPGETATVSDWANHLSTIFPEVRLKRYLEMRGADGGPWANLC
                     ALPALWTGLLYDQASLDAAWELAKGWSADERQKLRDDVPRLGFKAEIAGRSMHELARE
                     VVAISRAGLARRDKRDSQGRDETRFLQPLEESLVSGLTPAEVLLKRYETEWNRSVEPI
                     FDDCAY"
     gene            complement(339818..340495)
                     /locus_tag="Snov_0342"
     CDS             complement(339818..340495)
                     /locus_tag="Snov_0342"
                     /inference="protein motif:PFAM:PF03734"
                     /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
                     KEGG: mdi:METDI0732 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /protein_id="ADH87675.1"
                     /db_xref="InterPro:IPR005490"
                     /translation="MPIHRRSLLLGAPFLLAGCTTARRQEPTPVARSLAYAPSYETMY
                     AALDGEPYPVPAVDLSQIDPRFLRREVAYATREEPGTIVVDVEARYAYLVMENGRALR
                     YGVGVGKEEGFNFRGAATIARKAEWPRWTPTPDMIRREPERYAKYAGGLPGGPGNPLG
                     PRALYLYRDGRDTLYRLHGTIEPWTIGTMVSSGCIRLLNQDIIDLYRRVPAGSRAVVL
                     SSAGTAA"
     sig_peptide     complement(340427..340495)
                     /locus_tag="Snov_0342"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.813) with cleavage site probability 0.463 at
                     residue 23"
     gene            340607..341521
                     /locus_tag="Snov_0343"
     CDS             340607..341521
                     /locus_tag="Snov_0343"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: bid:Bind_0309 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ADH87676.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /translation="MDLAAALRAFVRTVERGSVTAAARDLAVTQPAVTKHLRNLERHV
                     GARLLERSARLVRPTPQGAALYETSRSALASIDSALEGVRRDMGAIEGTLRIHAPACL
                     GARRLHGIVMEFQAAHPGVNVDLILENRSVDLVYENLDLAVKYGRPEGQDLVIRRLGL
                     VRRVLVAAPSFLARCGPVDTLERLSEVDIVTTPAVVSPRDMLMLQRAGTPLGESIEVP
                     VRPVLRTNAAEVIEQTLLGGHAAGPVQVLFAARDLAAGRLVRLLPEYEVRPSEAFLAY
                     PSVRFMRPVVRAFTDFAVPALRATEGIT"
     gene            complement(341556..342680)
                     /locus_tag="Snov_0344"
     CDS             complement(341556..342680)
                     /locus_tag="Snov_0344"
                     /inference="protein motif:PFAM:PF04107"
                     /note="PFAM: glutamate--cysteine ligase GCS2;
                     KEGG: azc:AZC_2303 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase GCS2"
                     /protein_id="ADH87677.1"
                     /db_xref="InterPro:IPR006336"
                     /db_xref="InterPro:IPR011793"
                     /translation="MTTEEYRIGIEEEYFIVDGETKSALRRMPAPFMDQARGALGEAV
                     SGEMLQSQIEMMTRPHVSAADARRQLHGLRRSLGEVAAEFDLAFLAAGTHPTASWQTG
                     KRTPTQRYDGLMHDLQMVGERNMLCGMHVHVELPDADQRVDVMRRILPYLPIFVALST
                     SSPFWESKRTGLMGYRLAAYDELPRTGLPELFESAKDYQDYVDALVAARAIRDSSYVW
                     WTIRPSQKHPTLELRAPDSCTRVEDSVAIAALYRALVRHLVRDPKLNAGIDAVDRAIA
                     VENKWRAQRYGIHGSFVDRRTREAVPVTQAVETLIDQLREDARALGGLDELEHLRTIL
                     GGGTSADIQIAVYQEAAHRTGNRNEALNAVKTWLAHASAQ"
     gene            complement(343013..343795)
                     /locus_tag="Snov_0345"
     CDS             complement(343013..343795)
                     /locus_tag="Snov_0345"
                     /inference="protein motif:PFAM:PF04452"
                     /note="PFAM: protein of unknown function DUF558;
                     KEGG: xau:Xaut_4104 16S ribosomal RNA methyltransferase
                     RsmE"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF558"
                     /protein_id="ADH87678.1"
                     /db_xref="InterPro:IPR006700"
                     /db_xref="InterPro:IPR015947"
                     /translation="MARHQEDSSDQPYDFRAQRLYVDDDLGEGTLVRLDRDRAHYVAD
                     VIRLEVGGALHLFNGRDGEWRAVREPAGRREAVLRCEARLRRQAEPADLDYVFAPLKH
                     ARLDYMVQKAVEMGAGRLVPVMTRRTQASRVNTERMRANVIEAAEQCGILSLPAVLEP
                     SALARWLADLAPERRLVFCDEAAPEADPLAELREAVAGPLAVLIGPEGGFDEEERRLL
                     KARPGTIVLSLGPRILRADTAAVAALAMVEAARQTAANFSAR"
     gene            343910..344623
                     /locus_tag="Snov_0346"
     CDS             343910..344623
                     /locus_tag="Snov_0346"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: azc:AZC_2377 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87679.1"
                     /translation="MRGSILQARQMRFTARACVPALGGAFVAVMLGAFPAHAQWIGAP
                     GGDGSSSGSSGAVTITAPSPGPAAGAGGGFAPGMGAPQQAAPQGMSQGAAQANPNMSE
                     CQGQVMKLRGDLEARGGALEKAAKAKRPPTELCPLFRNFTSAQQSFYSYLSTNKTKCG
                     VPDEVIAQLKKNVNSVNATRNKVCEVAKLQESGGGAGPSGPPPQGQISAGLGLPSGLP
                     SVGAPKGGMFDTLGGDALR"
     sig_peptide     343910..344026
                     /locus_tag="Snov_0346"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 39"
     gene            344630..345580
                     /locus_tag="Snov_0347"
     CDS             344630..345580
                     /locus_tag="Snov_0347"
                     /inference="protein motif:TFAM:TIGR01474"
                     /note="KEGG: nha:Nham_3184 4-hydroxybenzoate
                     polyprenyltransferase;
                     TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
                     PFAM: UbiA prenyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate polyprenyl transferase"
                     /protein_id="ADH87680.1"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /translation="MTAPSTPAGPAPADSAVSWVDRAPAALRPFLRLARIDRPIGSWL
                     LLIPCWWSVALALGMQARAGEADYSRALILGVLFAVGAVAMRGAGCTWNDILDRDIDV
                     RVERTRARPLPAGQVTLLGAFAFLALQALVGLVVLICLPPFAIVTALASLGLVAIYPL
                     MKRVIWVPQAVLGLTFSWGALMGFAALLEELPAAAFLLYAGSVLWVIGYDTIYAHQDR
                     EDDALVGVKSSARLFGRATKPWLVGFYAAAAALIGVALVTAGAGPYAWGGLGIFVVQL
                     GTQVRRLDIDDRALCLKLFKSNRDAGLILLAGFLLDALVG"
     gene            345640..346272
                     /locus_tag="Snov_0348"
     CDS             345640..346272
                     /locus_tag="Snov_0348"
                     /inference="protein motif:PFAM:PF01612"
                     /note="KEGG: azc:AZC_3929 3'-5' exonuclease;
                     PFAM: 3'-5' exonuclease;
                     SMART: 3'-5' exonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="ADH87681.1"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /translation="MSIRLHRGDLVDLSRYTPENAPFVAIDTETLGLNPHRDRLCVVQ
                     LSPGDGTADVVQIPAGAGPGSAPNLEALLTDPRITKLFHFARFDVAVLGKTFGLTVAP
                     VWCTKIASRLTRTYTDRHGLKELVRELIGVDLSKQQQSSDWAAEELSEAQLQYAASDV
                     LYLHALREKLASMLARDGRTELAQSCFEFLPTRAKLDLAGWPDEDIFAHS"
     gene            346411..347388
                     /locus_tag="Snov_0349"
     CDS             346411..347388
                     /locus_tag="Snov_0349"
                     /inference="similar to AA sequence:KEGG:Xaut_0067"
                     /note="KEGG: xau:Xaut_0067 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87682.1"
                     /translation="MNKHVEPPVRLGASAAEPAARRAPASARVETDRSKTVARFKAAA
                     RHSRRVRFFRWALPVGVTTALGLTLAVNYLDPFSIAVDLPFELGRISLSGSKVKMEFP
                     KLHGFTSDNRGYSVTAEAAYQDLTKPDAIDLETIAAKLELADHGWVNLVAATGHYDTK
                     TEKLMLDGGIRFDTSSGYGGHLQNASVDIKGGKLVSKKPVEFTYLDGKLTADSIEVTQ
                     KDSRALLVGNVQLDFKMPPADGAKPSDGARPSNTANASGAANASATSTAAATPPASRT
                     AAAAQPTDIFHGAPSPVPVVVNGATPANVPLPPRRPPQLRGATTVGATP"
     gene            347437..348123
                     /locus_tag="Snov_0350"
     CDS             347437..348123
                     /locus_tag="Snov_0350"
                     /inference="protein motif:PFAM:PF03968"
                     /note="PFAM: OstA family protein;
                     KEGG: xau:Xaut_0066 OstA family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="OstA family protein"
                     /protein_id="ADH87683.1"
                     /db_xref="InterPro:IPR005653"
                     /translation="MITLLRFAGAAGLALLVTGAACLGPLARPALAQARNVPNALQGF
                     AANRDEPIRINANSLEVRDQQKQAVFTGNVVVIQGDTTLRCKELVVYYDGKESGGKAG
                     APASSEALASGSPINSSAIRRLEINGSVVVTTKEQTATGDYGTFETASNTITLNGSPV
                     VLTSGPNVIRGKKLTVDLASGMSRFDGGRIESLIVPNSMKDGALPGGPGAKPGAGAKP
                     AAKPGAKPTQ"
     sig_peptide     347437..347535
                     /locus_tag="Snov_0350"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.968 at
                     residue 33"
     gene            348288..349271
                     /locus_tag="Snov_0351"
     CDS             348288..349271
                     /locus_tag="Snov_0351"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: azc:AZC_3926 putative ABC transporter
                     ATP-binding protein in NtrA/RpoN 5'region;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87684.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MGFFSAIVGRGKSAPRGGRDNGTARGFGSGGRTGRTEARRDPDF
                     TSNLAPEITPGLEADMEALFAAAPVKASPKSFATPLRPEPVDDRGVLRATGLAKSYGG
                     RKVVRDASINVRRGEAVGLLGPNGAGKTTIFYMITGLVKADAGRIELDGHDVTHLPMY
                     RRARLGVGYLPQEASIFRGLSVENNIRAVLEVVEPSRKERERQLDALLEEFRVTHVRK
                     SPSIALSGGERRRVEIARALASRPTFMLLDEPFAGIDPIAVGDIQTLVRHLTQRGIGV
                     LITDHNVRETLGLIDRAYIIHSGAVLMEGSPDEIVASEEVRRLYLGEEFRL"
     gene            349344..350942
                     /locus_tag="Snov_0352"
     CDS             349344..350942
                     /locus_tag="Snov_0352"
                     /inference="protein motif:TFAM:TIGR02395"
                     /note="KEGG: rpa:RPA0050 RNA polymerase factor sigma-54;
                     TIGRFAM: RNA polymerase sigma-54 factor, RpoN;
                     PFAM: sigma-54 DNA-binding domain protein; sigma-54 factor
                     core-binding region; sigma-54 factor"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, sigma 54 subunit, RpoN"
                     /protein_id="ADH87685.1"
                     /db_xref="InterPro:IPR000394"
                     /db_xref="InterPro:IPR007046"
                     /db_xref="InterPro:IPR007634"
                     /translation="MSLSPRLEFRQTQSLVMTPQLMQAIKLLQLSNLDLVAYVEAELE
                     RNPLLERQVEPEGERPAEMEGEGGDQLERVSDADLDPRASHASEAADGERDERVSDWL
                     EERLETSRSAIEDRLDTTLENVYPDDAVREPTGLAPGGEAPAYSEWAGVGTGGRDDDG
                     YNLEAFVSAETTLADHLEGQLALAVSNPVERLIGQNLIDLIDEAGYLSADLAGVAERL
                     GAPLAQVEKVLAVVQGFDPPGIGARSLSECLAIQLKERNRYDPCMAALLSHLELLARR
                     EFTTLKRVCGVDDEDLAEMVGEIRRLNPKPGLAFGSGVIQPIVPDVFVRGGPDNWLVE
                     LNADTLPRVLVNQAYYSRVQKTTRNDREKAFLSDCMQTATWLTRSLDQRARTILKVAT
                     EIVRQQDAFLTLGVQHLRPLNLRMVADAIGMHESTVSRVTSNKYMATPRGIFEMKYFF
                     SSSISASDGGEAHSAESVRFRIKQMIDAESPDDVLSDDTLVQRLREAGIDIARRTVAK
                     YREAMRIPSSVQRRREKQAALSAG"
     gene            351116..351709
                     /locus_tag="Snov_0353"
     CDS             351116..351709
                     /locus_tag="Snov_0353"
                     /inference="protein motif:TFAM:TIGR00741"
                     /note="KEGG: xau:Xaut_2035 sigma 54 modulation
                     protein/ribosomal protein S30EA;
                     TIGRFAM: ribosomal subunit interface protein;
                     PFAM: sigma 54 modulation protein/ribosomal protein S30EA"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal subunit interface protein"
                     /protein_id="ADH87686.1"
                     /db_xref="InterPro:IPR003489"
                     /translation="MPLRVSGKNIDVGEALRQRVADRVAGAMGKYFDGGWSGHVTVAR
                     EGSGYRSDCALHLDSGTILQAHADAQDPYSSADAAVERIETRLRRYKSRIKRRAANGE
                     GEGLAETVPLTVFSTPDHEDAELLEGWNPTVVCEATANLPRLSVSDAVLELDFTGAAV
                     LVFRHAGHGRINVVYRRGDGHVGWVDPPVSAVTEEVH"
     gene            351816..352280
                     /locus_tag="Snov_0354"
     CDS             351816..352280
                     /locus_tag="Snov_0354"
                     /inference="protein motif:TFAM:TIGR01419"
                     /note="KEGG: azc:AZC_0344 PTS IIA-like nitrogen-regulatory
                     protein;
                     TIGRFAM: PTS IIA-like nitrogen-regulatory protein PtsN;
                     PTS system, fructose subfamily, IIA subunit;
                     PFAM: phosphoenolpyruvate-dependent sugar
                     phosphotransferase system EIIA 2"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PTS IIA-like nitrogen-regulatory
                     protein PtsN"
                     /protein_id="ADH87687.1"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR004715"
                     /db_xref="InterPro:IPR006320"
                     /db_xref="InterPro:IPR016152"
                     /translation="MALNDILALSAIFPSLRVGSKKQALQELSAHAAQILKRDEREIF
                     ETLNQRERLGSTGVGSGIAIPHGKLAKMDKLFGMFARLEKPIDFEALDGEPVDLIFLL
                     LAPEAAGADHLKALARVARLLRDPEVAKKLRNSRDAAAIFTILTGTPATDAA"
     gene            352397..352720
                     /locus_tag="Snov_0355"
     CDS             352397..352720
                     /locus_tag="Snov_0355"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mno:Mnod_7736 transcriptional regulator, XRE
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ADH87688.1"
                     /translation="MPATPVPANLALAPEQCRAARAMLDWSVEELAARAHVTVDWLAA
                     FEQGREPGDGFDHEAERLRRVLEEAGIELLDAGEASSGGGPGLRIKQKAGYIPAERLS
                     SANDV"
     gene            complement(352952..354025)
                     /locus_tag="Snov_0356"
     CDS             complement(352952..354025)
                     /locus_tag="Snov_0356"
                     /inference="protein motif:PFAM:PF00107"
                     /note="PFAM: Alcohol dehydrogenase zinc-binding domain
                     protein; Alcohol dehydrogenase GroES domain protein;
                     KEGG: nha:Nham_2536 zinc-binding alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Alcohol dehydrogenase zinc-binding domain
                     protein"
                     /protein_id="ADH87689.1"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /translation="MPKMKAAIFVEPGRIVLDEKPIPDVGPLDALIRITTTTICGTDV
                     HILKGEYPVAKGLTIGHEPVGVIEKLGSQVTGYTEGQRVIAGAITPSGHSYACLCGCG
                     SQDGAGTKHGFKAMGGWKFGNTIDGTQAEYVLVRDAIANLAPVPDALTDEEVLMCPDI
                     MSTGFSGAESGEVKIGDHVAVFALGPIGLCAVAGAKLKGATRIIGVDTVPERLAIAKQ
                     LGCSDVVDFKQGDVYEQIMALTDGRGVDVAIEALGTQNTFETALRVLRPGGTLSSLGV
                     YSSDLKIPLGAFSAGLGDNKIVTTLCPGGKERMRRLIDVIASGRVDLKPLVTHRYKLD
                     DIEAAYDLFSHQRDGVLKVAITP"
     gene            complement(354117..354818)
                     /locus_tag="Snov_0357"
     CDS             complement(354117..354818)
                     /locus_tag="Snov_0357"
                     /inference="protein motif:TFAM:TIGR03598"
                     /note="KEGG: xau:Xaut_0361 ribosome biogenesis GTP-binding
                     protein YsxC;
                     TIGRFAM: ribosome biogenesis GTP-binding protein YsxC;
                     PFAM: GTP-binding protein HSR1-related"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTP-binding protein YsxC"
                     /protein_id="ADH87690.1"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR019987"
                     /translation="MDTTAQDDDKPEAGGAAAAFSPEEIEAGRRLFAGEWNFLSAAPT
                     IPTMPPMRGIEIALAGRSNVGKSSLVNALTGRKALARTSVTPGRTQELIFFGLGPELT
                     LVDMPGYGFAKAPKDKVDAWTATIHAYLRGRANLARVFVLIDSRHGLKPIDTEVLDGL
                     DKAAVSYAIVLTKADQLKKGELAQRVEATQAALLRRPAAFPIVFPTSSREGWGIPELR
                     AAVVRLMAERGIAAG"
     gene            complement(354823..356652)
                     /locus_tag="Snov_0358"
     CDS             complement(354823..356652)
                     /locus_tag="Snov_0358"
                     /inference="protein motif:TFAM:TIGR03593"
                     /note="KEGG: xau:Xaut_1921 putative inner membrane protein
                     translocase component YidC;
                     TIGRFAM: membrane protein insertase, YidC/Oxa1 family
                     domain containing; membrane protein insertase, YidC/Oxa1
                     family;
                     PFAM: 60 kDa inner membrane insertion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertase, YidC/Oxa1 family
                     domain containing protein"
                     /protein_id="ADH87691.1"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="InterPro:IPR013308"
                     /db_xref="InterPro:IPR019998"
                     /db_xref="InterPro:IPR020001"
                     /translation="MTTENRNMIIAIVLSMAVLIAWQYFSGIPQMEQQRQQHAAQQQA
                     AQQQAAQPSGEAGTAAPAPGTSAPAPAGTAPKALTRAEALARSPRAVIDTPRVIGSVA
                     LKGGRIDDLSLKDYRETVDPNSPIIVLLSPSGGPNPFYAEFGWVPGAGASVQVPNAET
                     LWTAPEGAKLTHEAPLVLSWDNGAGLIFRRTLSIDANYMFHVVDEVENTTAAPVALHP
                     YGLVSRHGTPHVLGYYILHEGLIGVTSEAGLHEIKYKDIAERKTETFPSVGGWLGITD
                     KYWAATVIPGIQEKVQARFSAAQAGNDFSYQTDFLGDAVSVAPGAKASTEGRLFAGAK
                     EVRVVDGYQSTYNIDRFDLLIDWGWFYFITKPLFLVIDWIYKGVGNFGVAILIVTVML
                     KIVFFPLANKSYASMAKMKAVQPEITALRERYGDDRVKLQQEMMEIYKKEKINPVAGC
                     LPIVIQIPVFFALYKVLFVTIEMRHAPFFGWIKDLSAPDPTTIFNLFGLIPWDPGQVP
                     VIGHFLLLGVWPIIMGITMWAQMKLNPAPPDPTQKAIFDWMPLIFTFMLGSFASGLVI
                     YWAWNNTLSVIQQSIIMRRNGVKIELWDNVKELFGRKKKPKAG"
     gene            complement(356649..357050)
                     /locus_tag="Snov_0359"
     CDS             complement(356649..357050)
                     /locus_tag="Snov_0359"
                     /inference="protein motif:TFAM:TIGR00188"
                     /note="KEGG: azc:AZC_4054 ribonuclease P protein
                     component;
                     TIGRFAM: ribonuclease P protein component;
                     PFAM: ribonuclease P protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="ADH87692.1"
                     /db_xref="InterPro:IPR000100"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /translation="MHRIVKRKDFLAAASGLRANSGPLLLQGRDRADDTAPRIGLTVT
                     KKHGNAVERNRIRRRLRAAVRDALPRAGKDGFDYVIVARRAALGTPFADLVKDIERGI
                     ARLHSGRRPPKPAPRDSAAQLPARADGDTLP"
     gene            complement(357116..357250)
                     /locus_tag="Snov_0360"
     CDS             complement(357116..357250)
                     /locus_tag="Snov_0360"
                     /inference="protein motif:TFAM:TIGR01030"
                     /note="KEGG: azc:AZC_4055 50S ribosomal protein L34;
                     TIGRFAM: ribosomal protein L34;
                     PFAM: ribosomal protein L34"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L34"
                     /protein_id="ADH87693.1"
                     /db_xref="InterPro:IPR000271"
                     /translation="MKRTYQPSKLVRARRHGFRARMATRNGRKIINARRAHGRKRLSA
                     "
     gene            357701..359269
                     /locus_tag="Snov_0361"
     CDS             357701..359269
                     /locus_tag="Snov_0361"
                     /inference="protein motif:PFAM:PF02518"
                     /note="KEGG: azc:AZC_4070 periplasmic sensor signal
                     transduction histidine kinase;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase HAMP region domain protein; histidine kinase A
                     domain protein;
                     SMART: ATP-binding region ATPase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="ADH87694.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /translation="MKKRSGAGSQAIALPAAAAGFGELRLHAGTPQVTAETAAATSPK
                     PPRHLGLSGKLLAFTLAFVLLAEVLILVPAVAAFRLNWLSDRLAGARTAALVLDAAPD
                     GMISPQLTQELLRSVGAITVALKRDDTRRLLASTDMPPEVDHHADVRDVGPWQAVSEA
                     FDTLLARDGRVIRAVGTPPRGDGFVEIVIDETPLRKAMLRFTGNLLLVSLVIAALTGA
                     LVYLGLAWMFVRPMRRLTQRMVAFRADPSHPVPEVETDGRMDEIGQAERELTAMQQQI
                     AETLQQKSHLAALGLAVSKINHDLRNLLASVQLISDRLADIRDPAVQRFAPKLEVALD
                     RAIAYCEHTLAYGKAQEPAPERRMVPLAPLVAEVRDTLGLGPDEAQGIGFVESVDREL
                     EVDADPDQLFRVLLNLCRNAVEALSARSPNEPSRDQIRITGRREGAIVIIEVADTGPG
                     VPERARAHLFEAFQGSARRGGTGLGLAIAAELMHAHGGDIQLVPGTIGATFQLRVPDR
                     PVDLEAHRALRQHG"
     sig_peptide     357701..357757
                     /locus_tag="Snov_0361"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.612) with cleavage site probability 0.561 at
                     residue 19"
     gene            359247..360533
                     /locus_tag="Snov_0362"
     CDS             359247..360533
                     /locus_tag="Snov_0362"
                     /inference="similar to AA sequence:KEGG:AZC_0891"
                     /note="KEGG: azc:AZC_0891 glycosyl hydrolase family 2
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 2 protein"
                     /protein_id="ADH87695.1"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /translation="MPCASMAERKGEGRGRGRWFWAGLILLATIHAAVAADVTVSGRQ
                     ILNDGKRFDVRGATGDGPLPMLATLGATTVRTYGEDPGPILDAAEKAGLKVIVGLWVG
                     QPRQGADYGDRAFVERQLAELQAMVEKYRNHPALLMWGIGNEVEVELADDSPAWPAIE
                     QVAAMVRRVDPAHPTMGVLAETGSDKVKKLIAQAPSIQVLGLNSYGDALYSAASRARA
                     QGWEGPIVVTELGALGQWQAAQAPWGAPFEPSSTQKAIQLRRYLKALEGEEVGTIAFL
                     WGSKQEVTPTWHSLLLPDGVWLEASEAMAEAWGGQAPAENHAPRIGYLRVADDPSAPF
                     AVWPAGDEGSFTLDAVDPDGDMLEARWSVMAESAARSVGGDPEAAPHAFPEAVRQSGP
                     TGARISGLPAGRYRVFVEVHDGRGAAATANMPFEVR"
     gene            360781..360857
                     /locus_tag="Snov_R0007"
                     /note="tRNA-Arg1"
     tRNA            360781..360857
                     /locus_tag="Snov_R0007"
                     /product="tRNA-Arg"
     gene            complement(361273..362031)
                     /locus_tag="Snov_0363"
     CDS             complement(361273..362031)
                     /locus_tag="Snov_0363"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: bpy:Bphyt_6213 short-chain dehydrogenase/reductase
                     SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87696.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTENRELAGHTALVTGAARNVGRAIAVALARAGARVVVHARSSV
                     DAANETVAQCQQAFGGADGAFAHFADLTDPEAVRIMFAEVEARFGGLDLLVHNAAERA
                     DGPFDEISFAEWRRIVGSILDSAFLCDQAALPLLRRSAAASIIHIGGVAAHVGVRHRA
                     HVSAAKAGIVGLTRALAAEFASEQITVNCISPAQMETERKGHMPEHFRQRPVPLGRPG
                     QPAELASLVCFLAGPSGRFITGQTIHLNGGWYMG"
     gene            complement(362078..362908)
                     /locus_tag="Snov_0364"
     CDS             complement(362078..362908)
                     /locus_tag="Snov_0364"
                     /inference="protein motif:PFAM:PF01575"
                     /note="PFAM: MaoC domain protein dehydratase;
                     KEGG: bxe:Bxe_B2585 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC domain protein dehydratase"
                     /protein_id="ADH87697.1"
                     /db_xref="InterPro:IPR002539"
                     /translation="MTGLDAWIGRMETSAARLDGWPLAGLRAALDQNEAVQAGTALPP
                     TGQWLYFQPLAPQSRLGADGHPERGGFLPPIELPRRMWAASDMTYHRPICVGDEVEKR
                     SRIANVSSKSGRTGTLAFVTVEHSYLRSGMLMLSETQTLVYRDAPSPGEPPSPPQPAP
                     DGALWSQEVTPDSRLLFRYSAVTFNAHRIHYDEPYARQVEGYPGLVVHGQLTATLLIE
                     AFRKERPKFAVGGFSFRAMRPVFAGTTIHLEGAGDGDGYRLWARDQDGAVIVEAKVRP
                     "
     gene            363006..363227
                     /locus_tag="Snov_0365"
     CDS             363006..363227
                     /locus_tag="Snov_0365"
                     /inference="protein motif:PFAM:PF00364"
                     /note="PFAM: biotin/lipoyl attachment domain-containing
                     protein;
                     KEGG: pla:Plav_2982 biotin/lipoyl attachment
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin/lipoyl attachment domain-containing
                     protein"
                     /protein_id="ADH87698.1"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR011053"
                     /translation="MAKVDIKTEITGNVWKIEKAVGEQVGEEDVILILESMKMEIPVS
                     APEDGVIIEILVAEGDTVTEGTVVARIEA"
     gene            363231..364592
                     /locus_tag="Snov_0366"
     CDS             363231..364592
                     /locus_tag="Snov_0366"
                     /EC_number="6.4.1.4"
                     /inference="protein motif:PRIAM:6.4.1.4"
                     /note="KEGG: sil:SPO2540 carbamoyl-phosphate synthase,
                     putative;
                     PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
                     Carbamoyl-phosphate synthetase large chain domain protein;
                     biotin carboxylase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Methylcrotonoyl-CoA carboxylase"
                     /protein_id="ADH87699.1"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR013817"
                     /db_xref="InterPro:IPR016185"
                     /translation="MKKILVANRGEIACRVFRSSRALGLSNVAVYSDADAESAHVEAA
                     DQSVGVGPAPARESYLRVEKVLDAARETGADAIHPGYGFLSENAEFAQSVIDAGLIWI
                     GPSPETIRQMGDKQRARQIAEAAGVPVVPGSIRFEPGMLEGLEPAAEAVGYPLLVKAA
                     GGGGGIGMRRVDGPDKLTDIVVATQSMAQKSFGNGAVFLERFVPKARHVEIQVFGFGD
                     GRAIHLFERDCSLQRRFQKVIEEARAPGLPPHVTDAMAAAAVRLCEATRYSGAGTVEF
                     IVDAGTFEFFFLEMNTRIQVEHPVTEMITGRDLVAMQIELARGSLAFIPQAEIKTHGH
                     AIECRLYAEDPNKMFMPAPGPLATFRPPTGMAHLRIDSGYREGDVVTPFYDPMVAKVV
                     AWGEDREEARRRAVEALRAFSIDGIRSNRHFLLACLGDENFVSGDVHTGFIDAHRMRL
                     LAA"
     gene            364628..365500
                     /locus_tag="Snov_0367"
     CDS             364628..365500
                     /locus_tag="Snov_0367"
                     /inference="protein motif:PFAM:PF01978"
                     /note="PFAM: transcriptional regulator TrmB;
                     KEGG: bbr:BB3556 putative transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TrmB"
                     /protein_id="ADH87700.1"
                     /db_xref="InterPro:IPR002831"
                     /translation="MAGKLAIAANESDDLLADLKRLGFTEYEAKIYIQLLRMPPSTAY
                     EISKGANVPRPNTYHALEALAQRGAVLPVSENPVRYVAAPPNDFLAALSNQTRALCAD
                     LSERLSSIAPSSKGEYVWMLRGEGNVHSKIDTLIEESDTSIWIKASDTVLRRHKEALR
                     KAAARGIEIFIVLFGPDAEEFRFGPTCRVYIHEGNGVRMGTTDNLFTVSIDHIETLTA
                     TVEGEVVAAYTRNGPIVNLAESLVRHDYYMAEIFARLGPQIDEAFGPYLRDLRLACFS
                     PEQAASFKKRTGLS"
     gene            complement(365558..367753)
                     /locus_tag="Snov_0368"
     CDS             complement(365558..367753)
                     /locus_tag="Snov_0368"
                     /inference="protein motif:PFAM:PF02629"
                     /note="PFAM: CoA-binding domain protein;
                     KEGG: bbr:BB1576 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-binding domain protein"
                     /protein_id="ADH87701.1"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /translation="MTVQDTHTLRAARGEALIAEARANGRGSLDEAAGKALLADFGVR
                     VPRSRFAADVVQAAEIAGELDGPFVVKVVSPDILHKSDAGGVALRLADADAVRAAVEA
                     MAAKPLIAAAKVDGWLVEEMMPSGREIVIGGYRDPQFGPMIMVGLGGIFVEVLRDISF
                     RICPIEAKDAEEMLAELKGHALLDGARGEAGIDKAALIDIMLRIGGAGGLLMRHQADI
                     AELDLNPVIASQNGAVAVDARVILTPQAEADIAFEAPDASPLDAFRPLFEPRTVAVLG
                     ASTKDVAIANTFIRRMKAFGYEGSIYPIHPAAEEIEGLKAYPSLADTPEPVDYAYIAV
                     GAERIPGILAAAGGRCRIAQVISSGFGELEDGKALQDALVEGGRTGGARILGPNCLGT
                     YSPRGGLTFPAEAPKEVGTIGVISQSGGLTTDIIKRGEWRGLRFSGAVTIGNSADVEP
                     HELLAYYLADPQTRAIGIYMEDVKHGRAFYEQLKKASKPVVILKGGRSALGRLAAASH
                     TGALAGDEKAWEALQKQTPAVLVATVDEFIDLLLALQHFDLHPDHPTRTVTLFGNGGG
                     SSVLGTDAFAGAGLEVAPYGEEARRLLEAMKLPPGTSVANPIDTPVRTLQEKDGFVAG
                     EILDIVYGHAHPDAVLMHLNLSAFVGRGSVDPIDNLFTVVGQTKEKWPGGPHFALALR
                     TDGSAALDDRRRHYREKARAIGVPVFDEIAPAAKALAGIGHLERRLNGR"
     gene            complement(367764..369299)
                     /locus_tag="Snov_0369"
     CDS             complement(367764..369299)
                     /locus_tag="Snov_0369"
                     /inference="protein motif:PFAM:PF01039"
                     /note="PFAM: carboxyl transferase;
                     KEGG: bbr:BB2690 putative carboxyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyl transferase"
                     /protein_id="ADH87702.1"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /translation="MPHDVMLEKLDERRTQARRMGGLDKLAKRAERGQLNAKERLDAL
                     VDPGSFFEVGLLGASGVFDADVEATPRDGKITGFGRIEARDVGVVVNDFTTKGASTSA
                     TNSKKMGYIRRTCTERGMPFLHIGESTGARLPDAMGSKGMGALLGNDTTQFKRMRDTP
                     WVAAALDTSFGSSAWLCCCADFAVMKKGSIMSVSSPRLVSMAIGEKVDLEELGGWRLH
                     AEQTGLIDYFVDTDAEAMAVIRQFLSYMPSHNGELAPNAPVTEGSGEDQDRILAVLPE
                     KRTQVYNMKKIIEVIFDRDSFFEVKARFGKSAVVGLARLNGQAVGVVANNPQVGGGAL
                     SAEACRKIIDLTVLCDSFNLPIVRLVDTPGFVVGTEAERRGAPGHIMNFMNATCLTTV
                     PSVTVLCRKAYGRAYVAMGGGAHNDAMIAWPTAEVSFMDPVFATSIVHNLTAGQEGFE
                     DALAHIQKDLEIWDMARIFSAQDVVKPQETRAWVIRMLDIQRRRRSGGLGQHLMRTWP
                     TSY"
     gene            complement(369355..370431)
                     /locus_tag="Snov_0370"
     CDS             complement(369355..370431)
                     /locus_tag="Snov_0370"
                     /inference="protein motif:PFAM:PF01188"
                     /note="PFAM: Mandelate racemase/muconate lactonizing
                     protein;
                     KEGG: oca:OCAR_6795 O-succinylbenzoate-CoA synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Mandelate racemase/muconate lactonizing protein"
                     /protein_id="ADH87703.1"
                     /db_xref="InterPro:IPR013342"
                     /translation="MSRLRRIRLSRLRLPLIRPYRLSYRTFDEFEPYLVEVEDSDGCT
                     GFADAHISPGSSSETREGGWAFCLAKMDAIIGKAPADAKEIVLADFAKSKVAATALTA
                     AIEVLEGSELLDVTDTRSQPLLTPINALEPEAIAAEVEKWIGEGFRTFKVKVGKDVDA
                     DLARVAAIQQVVSGRATLRLDANRAFSREQGIAFASRLDPAGIELFEQPCDSDDWEAN
                     AAVAAASTVPLMLDEPICTLGDIERAAKIERVGFCKLKLKRFGSLQRLADGLNAVRAH
                     GMSPVLGDGLGSEVQGWLEACVARDTVDNAGEFNGFLKPKTGLFENPLPFESGEVRMP
                     AGYRPQLDRAAVERATIATHDVAA"
     gene            370858..371829
                     /locus_tag="Snov_0371"
     CDS             370858..371829
                     /locus_tag="Snov_0371"
                     /inference="protein motif:PFAM:PF03401"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: reh:H16_B2308 extra-cytoplasmic solute receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87704.1"
                     /db_xref="InterPro:IPR005064"
                     /translation="MLKFLLRTAALAAAIAMMPAGARADFPDKPIRYLLHVSPGGATD
                     VMARKLAIAMEKILGVPLVVENKPGGRGATQLAELAAAKPDGYTIGAVTSTHIGAFNQ
                     TLKQYKVDSFDWIARLVNEPYLIVVNKDSKITSMKDLVEAANAKPGSVVMAGFVRGSG
                     GHFAWEIMAKSADLDSKKVRWVPFDSVGDAVTAALGNHAEVAIAYVDLVKTHVQAGNL
                     RVVAVMSDKRVPQFPDVPTLKEQGYAADTSWQQMRGIIGPKGIPEPIKAKLADAVKQA
                     LETPELKAYMEESALVPAFQGPADFTATAQRENAATKEWMATLGLTR"
     sig_peptide     370858..370932
                     /locus_tag="Snov_0371"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.964 at
                     residue 25"
     gene            371906..372409
                     /locus_tag="Snov_0372"
     CDS             371906..372409
                     /locus_tag="Snov_0372"
                     /inference="similar to AA sequence:KEGG:Xaut_1331"
                     /note="KEGG: xau:Xaut_1331 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ADH87705.1"
                     /translation="MATQHDEPTVDVSAEPKDLSFRLELGDALAGAALLAFAVTFWVL
                     GADIDDGGGYGVGAATFPRGIALLLGIGALVLLANGLVHLFGPPSGHLVTIGRPLHVI
                     AGMGLMLAFAPAMRHLGYYPTMGVFLAALLWVADCRRPLHILAYVAGFLLFSKVVFEM
                     VLSIPLP"
     gene            372418..373944
                     /locus_tag="Snov_0373"
     CDS             372418..373944
                     /locus_tag="Snov_0373"
                     /inference="protein motif:PFAM:PF01970"
                     /note="PFAM: protein of unknown function DUF112
                     transmembrane;
                     KEGG: amt:Amet_1107 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF112
                     transmembrane"
                     /protein_id="ADH87706.1"
                     /db_xref="InterPro:IPR002823"
                     /translation="MIDGFLAGLSAFSSWQVMAGLLGGVVIGYVVGALPGLSAGVGMA
                     LLIPFTFGLDPVVSVVMLVSLYMASEYSGAIPAILMNTPGEPSSAITALDGYPMRERG
                     EAGEALTLSILGSAVGSIISTLLLIFTVMWMTKIALAFGPTEYFALAVLGLSLISTLA
                     GHSILRGFIALLFGLLLTTVGADPVDGVMRYVFTDNLLGGFPFIAALIGLFALSEVLR
                     MLESPGDRVTPLKELPGLTAQFGLLKPHAGNLVRSTFIGYILGVIPGAGATIASITAY
                     SVQKRLSKSPETFGKGNPEGVVAAETANNACMPGALAPMLALGIPGKASTAVLVGALA
                     IQGVRPGPLIFTQHPEIPYSIYIALLVGMPFMVLLGLFGSRLWVRLTTIPASVVTGIV
                     AATCLLGTYSESNDIFAIGVAVGFGIVGYLLSKVDIEPAPIVLALVLGYMMESNFRRS
                     LVMSGDDMGVFLREPISAVCLVLAAIIFVAPLLQNLLAWRRRRGELDIRPGADTEVSR
                     "
     gene            373941..374834
                     /locus_tag="Snov_0374"
     CDS             373941..374834
                     /locus_tag="Snov_0374"
                     /EC_number="4.1.3.6"
                     /inference="protein motif:PRIAM:4.1.3.6"
                     /note="KEGG: bja:bll0499 citrate lyase beta subunit;
                     PFAM: HpcH/HpaI aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Citrate (pro-3S)-lyase"
                     /protein_id="ADH87707.1"
                     /db_xref="InterPro:IPR005000"
                     /db_xref="InterPro:IPR011206"
                     /db_xref="InterPro:IPR015813"
                     /translation="MNGERPLRSVLYVPGIRERALEKIRELDVDALIIDLEDSIAPEM
                     KPQARENACRAVSAGGYGFRQVAIRVNSRGTRWFEDDLAAVAAAGPDIVVLSKVEAPD
                     DIGEAHRLLRSAGAAPGLQLWAMIETPLGLLDLSEIVREGRKQPDNRLAGLVLGTNDI
                     AKDTGVLAGDDRAAMVPWLLNAVLVARAHGLSVFDGVYNAFTDMDGFVRECAQGRQLG
                     FDGKTLIHPSQIALANRLFAPADEDVAEALTIVEAFALPENADKGVITLGGKMVERLH
                     AMSAKRLIAIDAAIKARGSFA"
     gene            375025..375957
                     /locus_tag="Snov_0375"
     CDS             375025..375957
                     /locus_tag="Snov_0375"
                     /inference="protein motif:PFAM:PF00497"
                     /note="KEGG: bja:blr4463 ABC transporter substrate-binding
                     protein;
                     PFAM: extracellular solute-binding protein family 3;
                     SMART: extracellular solute-binding protein family 3"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 3"
                     /protein_id="ADH87708.1"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR018313"
                     /translation="MALDLDTHSRAKGGPMGARLRSALLGVLGLALATGGLATALPQQ
                     AEASMPAACAALQAKYPSLKGKTLINAINPHTPGYETIDPADPTKYIGFDIDLGEAIG
                     ECLGFKLTYKPVTFAALLTTLQAEQADIVISDIYATKERAKAADFITYLKVFDGVLVA
                     KGNPKGIDGINLSLCGAVAAENTGYVEVPLIQALEAECKKAGKPAPEILLFDNNANCI
                     QAILAGRADTYINDVNTVDGAVKAYPDKLAKATAVTLPYSVGIAVPRNKVEFRDAVMA
                     ALTEIQKSGLQAELMKKWNLPAEQLESPKLVLAD"
     gene            376040..377665
                     /locus_tag="Snov_0376"
     CDS             376040..377665
                     /locus_tag="Snov_0376"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: ABC transporter related; binding-protein-dependent
                     transport systems inner membrane component;
                     KEGG: bbt:BBta_6505 ABC transporter permease/ATP-binding
                     protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="ADH87709.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="InterPro:IPR017871"
                     /translation="MDLFLHYLSMPYLIDGVGYTLLITVLGLLGGLLMGVVLAAMQLS
                     RFRALAIIARGYSIIFRGTPLILQMVFCYNALPLIGIKLTAISAAGLALALNEAPFIA
                     EILRSNVIGVDRGQVSAGQALGMTPAAIMRRVIAPQAIRSMVPALGNEAVSALKNSSL
                     ASVVAVQELTLRSTQLASATFDFFSIFFASGLMYLILTGAIAVIQIVVEMLLDLDRPP
                     PKEQLRRFLRAMLPGRAEPVPADAAGAVPPDVAKEILEEIAVDPLPPASPKAALARPD
                     REARARRLAGNNVAVEVKGLRKRYGDQTVLDGIDLTVRAGEVVALLGPSGSGKSTLLR
                     CINRLEGWEDGTIRVGGRFLGSDEAGRPLSPRTTAQMRASVGVGMVFQQFNLFGHLTA
                     EENIAGPLRWVQGLSRLDARRRAQELLERVGLAHRADALPRHLSGGQQQRVAIARAVA
                     PGPSVLLLDEPTSALDPELVGEVLEVIRRLAVEDGLAMIISTHQLHFAGDVADRIVFL
                     AGGSIVEEGPAQQVLREPRHPLTARFLSTMAAD"
     gene            377733..378971
                     /locus_tag="Snov_0377"
     CDS             377733..378971
                     /locus_tag="Snov_0377"
                     /inference="protein motif:PFAM:PF03069"
                     /note="PFAM: Acetamidase/Formamidase;
                     KEGG: bra:BRADO1537 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetamidase/Formamidase"
                     /protein_id="ADH87710.1"
                     /db_xref="InterPro:IPR004304"
                     /translation="MTKHHLPATPDTVHWGYFSRTLDPVLTLKSGERAVIETITHHAN
                     DDYERMIAGDRAAEEIFLWTKEAKTLRRRGAGATEGPFTYGSGEGLGVHLLTGPIAVE
                     GAEPGDVIEVRIIDAWPRPSANPAYQGRFFGSNPSANWGFQYKDLIEEPKPREVVTIY
                     ELDMGEAAVKALYSYRWTPQTDPDGIVHPTIDYPGVRVDHGTIVKKEGILPGIKVPAR
                     LHFGTMGLAPAEADFVSTIPPNYTGGNMDDWRIAKGARMYYPVAVPGGLFSCGDAHAS
                     QGDSELSGTAIEISLTGEFEFILHKKEQLDGTLLEGLNHPLLENDELWSVYGFSVANY
                     LTELGPDHQTEILKRGSLDNAMRDAFRKLRRFLMTTQKLSEDEAISLMSVAADFAVTQ
                     VVDANWGLTGSIRKSIFAGR"
     gene            379072..381408
                     /locus_tag="Snov_0378"
     CDS             379072..381408
                     /locus_tag="Snov_0378"
                     /inference="protein motif:PFAM:PF03069"
                     /note="KEGG: bja:blr4466 transcriptional regulatory
                     protein;
                     PFAM: Acetamidase/Formamidase; helix-turn-helix- domain
                     containing protein AraC type;
                     SMART: Helix-turn-helix, AraC domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family with
                     acetamidase/formamidase activity"
                     /protein_id="ADH87711.1"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR004304"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR020449"
                     /translation="MNAEPFTSEAYAEGARERAWQEVLGGFGLHSLGGRQGTPAHASA
                     LSRLSSLGVRLGTLAADAQTLRPLSGRGGLPLLLLPVETTMVLTIAGDSQIVPAGHVV
                     LGPRGADWQVQFQRGVRALALSVPAEAFRGRKVAPLAACPPRVFAPDGLADVLARTVQ
                     SGSGALDRLSDAEWEAVAQSAAELLLALSAELATTRADPSSSRAALLQRIYAAIERNI
                     GSEDVSIAEIARGEGISERYLQKLFEGTGESFSHYVRERRLQRAWHDLANPGEATVPI
                     SEVAYRYGFADSAHFSRLFRERFGLPPRELRRREAGRHGQDALPSGQRGWPQEALVQL
                     RARQTEAEPDARRGVVLGSDPPADAPESPAHHYLPVNAHHVHWGFFSRSLKPLLEIDS
                     GDIVTVETLTQHASDAPELMIEGDPGAESVFHWTRAAKAVDRRGAGPLDASVFGRGAG
                     EGFGVHICTGPIAIRGAQPGDVLEVEILDIEPRPSRHPDHAGRVFGSSVAAWWGFHYS
                     EFLSEPHPRETVTIYEILADADEPHAKAVHAYRWEPQTDPSGVRHLLYDYPGVPVRPG
                     TVTPKKGVLEGVRIPLRPHFGVIAVAPRETGLVDSVPPAYFGGNLDNWRLGKGATIYL
                     PVSVPGALLSVGDPHAAQGDGELSGTAIECSMTGTFRVILHRKADTAGTLLADLTYPL
                     IETTDDWVLTGFSHPNYLAEFGADGQSEVYAKSSLDLAMRDAFRKVRRFLMTTKGLSE
                     DEAIALMSAAVDFGITQVVDGNWGVHAILSKRLFPDRG"
     gene            complement(381413..382240)
                     /locus_tag="Snov_0379"
     CDS             complement(381413..382240)
                     /locus_tag="Snov_0379"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: rle:RL1231 short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87712.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MSGKTFFITGANSGFGFAIAAAALREGHQVIGTVRSEETRAALA
                     ERLPAVRPVLCDVTEFDRIDDVVRQAEDDHGPVDVLINNAGYGHEGVLEESPLEEMRR
                     QFDVNVFGAVAVAKAFLPRFRERRRGFIVNVTSMGGMITMPGIAYYCGSKFALQGISE
                     VMRAEMAPFGVHVTALCPGSFRTDWAGRSMVRTERSIPDYDALFDPIRQARQARSGKQ
                     LGDPEKLAAAVLRLVESDTPPPQLLLGSDALGLVSDRIERLRQEIEAWKPVTISTDG"
     gene            382337..383251
                     /locus_tag="Snov_0380"
     CDS             382337..383251
                     /locus_tag="Snov_0380"
                     /inference="protein motif:PFAM:PF06719"
                     /note="KEGG: bid:Bind_1549 AraC family transcriptional
                     regulator;
                     PFAM: AraC-type transcriptional regulator domain protein;
                     helix-turn-helix- domain containing protein AraC type;
                     SMART: Helix-turn-helix, AraC domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="ADH87713.1"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR009594"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /translation="MKAVEERSARRELVELAERLAPRHGYNPTGLDNVRLLRTEAVLH
                     DIPVLYRPGAVFVLQGRKQGLLEDEVYLYDEEHYLAVSVPVSFRMQSIASAERPLLAV
                     YVEFDMRLAAEIASEVGVRRAEPAAGKMRGLASSRMEPAIEDVVLRLLRALRDPVELA
                     VLGAAISRELHYRVLVGPQGGAMIAALQQRGTSGRIVQSLARLRETYDSALSVAALAG
                     EAGMSVPSYHVHFKALTGSTPMQYVKAMRLHEARLMIARQDRTIAEVAACVGYASPAQ
                     FSRDFKRHFRRTASEEARWVRQHLGELA"
     gene            complement(383279..384586)
                     /locus_tag="Snov_0381"
     CDS             complement(383279..384586)
                     /locus_tag="Snov_0381"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: bpy:Bphyt_6342 FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="ADH87714.1"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR018184"
                     /translation="MSAADIFAEGFKAQPYWWDAAEPETDLDPLPARADAVVIGSGYA
                     GLNAATELARAGLDVVVIDGERIGEGGSTRSGGMVSSGQKLVVGGAIKGIDPELFNRM
                     IGDSISSFDYLQNLIQGEGLDADLKITGRFFGAHAPSLLQPTWHNGRILAEKTGVTVH
                     LYDRANQRHAIGSDYYHGGIVVDEYGGLHPGKYHQALRQRARASGAKLRSHAKAGPVQ
                     DADGGLKRVPTTRGDILARHVVSATNGYTRKDGHPDLARRVVPVKSYQIATEPLPADL
                     IETLIPRARMISDTRRDVIYSRPSPDGTRILFGSRPGFFEREDRDAAPAIYERMTEIW
                     PELKAYRISHAWSGFVAMTVDKVAHMGRRDNSDFAVGCNGNGVALMSYLGYQTAQKIL
                     GRQNRTTAFDREQFTAVPLYSGNPWFVPIVAAWYRLQDWYERR"
     gene            complement(384673..385419)
                     /locus_tag="Snov_0382"
     CDS             complement(384673..385419)
                     /locus_tag="Snov_0382"
                     /inference="protein motif:PFAM:PF00005"
                     /note="KEGG: bxe:Bxe_A2431 polar amino acid ABC
                     transporter ATPase;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ADH87715.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MNRADTLIELDGVTKSFGSFQVLKGISLSVKDGEAVCIIGPSGS
                     GKSTILRCINGLIPIDGGSIRVGQHEVHKLKTEKEMRPLRHQVSMVFQQYNLFPHRTV
                     LQNIMMAPVQVLGHDAREVEARAHRLLAKVRLSNKADAYPGQLSGGQQQRVAIARALA
                     MEPQVILFDEVTAALDPETVKEVLTAIRELVDDRLTCILVTHEMKFAREVADRVCFTD
                     HGRIVESGPPAQIFDAPQDARTREFLGQVL"
     gene            complement(385416..386228)
                     /locus_tag="Snov_0383"
     CDS             complement(385416..386228)
                     /locus_tag="Snov_0383"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="KEGG: bxe:Bxe_A2432 polar amino acid ABC
                     transporter inner membrane protein;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="ADH87716.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /translation="MQWPLTYHEKKRAVQLAIVLALVAWLAADALTGGAANWQRVWLR
                     LPLLLTGSGSGWPLTGGFVLNIFLGLCSMVLAAVMGTLLAFGMMARNRAIRLPCFFIM
                     NFLRNSPWLVLLFAMLYIIPFNVRLFGFSIAVPAFVKAVIGLALPTGANFAEIIRGAV
                     QSIHSGQWEAARAFGYMPMAIYWRIILPQALRRMIPGWMNLYALLMIATSLATVTGIQ
                     DVITTLNTLLSMENERVIVYFYIATLFLFFAYCYPIALLARRMEQSVKGDAL"
     gene            complement(386230..386946)
                     /locus_tag="Snov_0384"
     CDS             complement(386230..386946)
                     /locus_tag="Snov_0384"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="KEGG: bxe:Bxe_A2433 polar amino acid ABC
                     transporter inner membrane protein;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="ADH87717.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /translation="MFGLDYSWLSDPVYQDWLLRGTLTTIGLALASSAIAILIGAFGA
                     LALSLRIAWLDALIELFVELFRNTPPLLQMLFFYFTLSTIGLRVTDPATGLSVPLLSA
                     FDCALVSLSLFGGALCIEAFRSGLESLPHSVTEAARSLGYSRWARFRRIEMPIASRIC
                     LPALTNILTNLFKTTSQASVITVPELMYYAGQIYNDTFRTAEVMLLVLLIYVSLVSLL
                     SWGMSRIEQALAFPGYGKGH"
     gene            complement(386972..387796)
                     /locus_tag="Snov_0385"
     CDS             complement(386972..387796)
                     /locus_tag="Snov_0385"
                     /inference="protein motif:PFAM:PF00497"
                     /note="KEGG: bxe:Bxe_A2434 polar amino acid ABC
                     transporter periplasmic ligand-binding protein;
                     PFAM: extracellular solute-binding protein family 3;
                     SMART: extracellular solute-binding protein family 3"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 3"
                     /protein_id="ADH87718.1"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR018313"
                     /translation="MRTSILTIAASLAMTLGIGAASADTLADVKAKGTLTIGVKNDYP
                     PYGFLNDKGEIVGFEVDLGKYIAKELLGPEGKFELVPVVAANRIEFLNSGRIDIILAT
                     LGVTEERGKVIDFSEYYVSAPGPSVIAPKAATFSKWEELKGLTLCGIQGSYYNKHLSG
                     DLGIQLTAFKTQPEAYRALKDNRCVGFVFDDMTLRQKTEEADWAGYKIAVDPYEYIPQ
                     AAGIRKNDVAFRDAVNKAITKAEAEGKLIEWETTYGMPPAKYIAERAKAAAAKLKP"
     sig_peptide     complement(387725..387796)
                     /locus_tag="Snov_0385"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.992 at
                     residue 24"
     gene            387996..388760
                     /locus_tag="Snov_0386"
     CDS             387996..388760
                     /locus_tag="Snov_0386"
                     /inference="protein motif:PFAM:PF09339"
                     /note="KEGG: mlo:mll9009 transcription regulator;
                     PFAM: regulatory protein IclR; Transcriptional regulator
                     IclR;
                     SMART: regulatory protein IclR"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, IclR family"
                     /protein_id="ADH87719.1"
                     /db_xref="InterPro:IPR005471"
                     /db_xref="InterPro:IPR014757"
                     /translation="MAAPTASGSQLLDRAALLLDLIADGTSEGATLKELVERSGLNTA
                     TCHRILNTLVGHRLLARDDKRKRYRLGAKMFIYGARAARGPGLISRCEMSLSRLRKKT
                     GETTHLMARHNHDSLCLDRRDGECVVQTLTGSIGGSVPLGAGPGSIAMLAFLDREEQE
                     FILRANEPRFAAFRDLAADKVWRLIEETRARGHAVDIGELIPGIAGVAMPILDETGVP
                     VASLGFTFLCAKIVPGLVENYAALLRAEIDLIERRS"
     gene            complement(388768..389469)
                     /locus_tag="Snov_0387"
     CDS             complement(388768..389469)
                     /locus_tag="Snov_0387"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: ara:Arad_9641 short-chain dehydrogenase protein"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ADH87720.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTARTVLISGGGRGIGAATGRVMMQAGWNVSLGMRSPALPDWAE
                     EGPGQVQACAYEATDPAAAERWVAEARARFGGIDAVVANAGIMIRKDVIAAEDEELAR
                     LMEVHVAAPRRLAKAAWNDLAASGRGRVIIVSSLSGKRVKSAISSLYSVSKFAATGLA
                     HALRHTGFELGIRATAVCPGFVATDMGLPLTTRTAEELTDPADIGRAIRFLIELPNTS
                     SVAEFAVNWTLEESF"
     gene            complement(389480..390802)
                     /locus_tag="Snov_0388"
     CDS             complement(389480..390802)
                     /locus_tag="Snov_0388"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: ara:Arad_9647 oxidoreductase protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="ADH87721.1"
                     /db_xref="InterPro:IPR006076"
                     /translation="MSKFSPFATTLWYATAAPAPQTTRLEGRVSADVCVVGAGFTGLT
                     TALELARQGVKVVLLEAEEAGFGGSGRNAGHCTPTFSYYSLPSLRKILGEPWAERLIH