LOCUS BX640511 588 bp DNA linear BCT 26-FEB-2004 DEFINITION Magnetospirillum gryphiswaldense - MM22. ACCESSION BX640511 VERSION BX640511.1 KEYWORDS magnetosome membrane protein. SOURCE Magnetospirillum gryphiswaldense ORGANISM Magnetospirillum gryphiswaldense Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Rhodospirillaceae; Magnetospirillum. REFERENCE 1 (bases 1 to 588) AUTHORS Gruenberg K., Mueller E.C., Otto A., Reszka R., Linder D., Kube M., Reinhardt R., Schueler D. TITLE Biochemical and proteomic analysis of the magnetosome membrane in Magnetospirillum gryphiswaldense JOURNAL Appl. Environ. Microbiol. 70(2), 1040-1050(2004). PUBMED 14766587 REFERENCE 2 (bases 1 to 588) AUTHORS Kube M., Sontag M., Reinhardt R. JOURNAL Submitted (14-AUG-2003) to the INSDC. Max Planck Institute for Molecular Genetics, proScience Ihnestrasse 73, D-14195 Berlin, Germany. COMMENT This project was carried out by *Max Planck Institute for Marine Microbiology, Bremen, Germany; *Max Planck Institute for Molecular Genetics, Berlin, Germany; -------------- Genome Center Center: Max Planck Institute for Molecular Genetics Center code: MPIMG -------------- Summary Statistics Sequencing vector: pUC19; 100% of reads Chemistry: Dye-terminator Big Dye; 100% of reads Assembly program: Phrap; version 0.990329 -------------- This sequence was finished as follows unless otherwise noted: all regions were double stranded, sequenced with an alternate chemistry, or covered by high quality data (i.e., phred quality >= 30); an attempt was made to resolve all sequencing problems, such as compressions and repeats; allregions were covered by at least one plasmid Sequence. -------------- FEATURES Location/Qualifiers source 1..588 /organism="Magnetospirillum gryphiswaldense" /mol_type="genomic DNA" /db_xref="taxon:55518" CDS 1..588 /transl_table=11 /locus_tag="MM22" /note="magnetosome membrane protein" /db_xref="GOA:V6F2Z8" /db_xref="InterPro:IPR021147" /db_xref="UniProtKB/Swiss-Prot:V6F2Z8" /experiment="experimental evidence, no additional details recorded" /protein_id="CAE45335.1" /translation="MAAQTAASETPAAAAAPADSPTAVAPTPDSVGRDLVAENMIKDY VLAAVAASIVPVPLFDIAAVVAIELRMIQKLSELYGKPFSESLGRSVIASLAGGVVGY GAGMAVAVSLTKLIPGVGWMLGMVSLPVIAGATTYAIGRVFVKHYENGGDIFNLSADA MRAYYKQQFEKGKALAAKVKARKEAAAVDDVAAAH" BASE COUNT 97 a 204 c 190 g 97 t ORIGIN 1 atggccgcgc agaccgctgc ttccgaaact cccgccgccg ccgccgctcc ggcggacagc 61 ccgaccgccg tcgctccgac cccggattcc gtcggtcgcg atctggtggc ggaaaacatg 121 atcaaggatt atgtcctggc cgccgtggcc gccagcatcg tgccggtgcc cctgttcgac 181 atcgccgccg tggtggccat cgaactgcgc atgatccaga agctgtcgga actgtacggc 241 aagccgttct cggaaagcct gggccgcagc gtcatcgcct ctctggccgg cggcgtcgtc 301 ggctatggcg ccggcatggc cgtggcggtc agcctgacca agctgatccc cggcgtcggc 361 tggatgctgg gcatggtgtc gctgccggtg atcgccggcg ccaccaccta tgccatcggg 421 cgcgtcttcg tgaagcatta cgaaaatggc ggcgacatct tcaatctcag cgccgatgcc 481 atgcgcgctt actacaagca gcaattcgag aagggcaagg ccctggccgc caaggtcaag 541 gcgcgcaagg aagccgccgc cgtcgacgac gtggctgccg cgcactga //