LOCUS       BX640511                 588 bp    DNA     linear   BCT 26-FEB-2004
DEFINITION  Magnetospirillum gryphiswaldense - MM22.
ACCESSION   BX640511
VERSION     BX640511.1
KEYWORDS    magnetosome membrane protein.
SOURCE      Magnetospirillum gryphiswaldense
  ORGANISM  Magnetospirillum gryphiswaldense
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Rhodospirillaceae; Magnetospirillum.
REFERENCE   1  (bases 1 to 588)
  AUTHORS   Gruenberg K., Mueller E.C., Otto A., Reszka R., Linder D., Kube M.,
            Reinhardt R., Schueler D.
  TITLE     Biochemical and proteomic analysis of the magnetosome membrane in
            Magnetospirillum gryphiswaldense
  JOURNAL   Appl. Environ. Microbiol. 70(2), 1040-1050(2004).
   PUBMED   14766587
REFERENCE   2  (bases 1 to 588)
  AUTHORS   Kube M., Sontag M., Reinhardt R.
  JOURNAL   Submitted (14-AUG-2003) to the INSDC. Max Planck Institute for
            Molecular Genetics, proScience Ihnestrasse 73, D-14195 Berlin,
            Germany.
COMMENT     This project was carried out by
            *Max Planck Institute for Marine Microbiology, Bremen, Germany;
            *Max Planck Institute for Molecular Genetics, Berlin, Germany;
            -------------- Genome Center
                 Center: Max Planck Institute for Molecular Genetics
                 Center code: MPIMG
            -------------- Summary Statistics
                 Sequencing vector: pUC19; 100% of reads
                 Chemistry: Dye-terminator Big Dye; 100% of reads
                 Assembly program: Phrap; version 0.990329
            --------------
            This sequence was finished as follows unless otherwise noted:
            all regions were double stranded, sequenced with an alternate
            chemistry, or covered by high quality data (i.e., phred quality
            >= 30); an attempt was made to resolve all sequencing problems,
            such as compressions and repeats; allregions were covered by at
            least one plasmid Sequence.
            --------------
FEATURES             Location/Qualifiers
     source          1..588
                     /organism="Magnetospirillum gryphiswaldense"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:55518"
     CDS             1..588
                     /transl_table=11
                     /locus_tag="MM22"
                     /note="magnetosome membrane protein"
                     /db_xref="GOA:V6F2Z8"
                     /db_xref="InterPro:IPR021147"
                     /db_xref="UniProtKB/Swiss-Prot:V6F2Z8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAE45335.1"
                     /translation="MAAQTAASETPAAAAAPADSPTAVAPTPDSVGRDLVAENMIKDY
                     VLAAVAASIVPVPLFDIAAVVAIELRMIQKLSELYGKPFSESLGRSVIASLAGGVVGY
                     GAGMAVAVSLTKLIPGVGWMLGMVSLPVIAGATTYAIGRVFVKHYENGGDIFNLSADA
                     MRAYYKQQFEKGKALAAKVKARKEAAAVDDVAAAH"
BASE COUNT           97 a          204 c          190 g           97 t
ORIGIN      
        1 atggccgcgc agaccgctgc ttccgaaact cccgccgccg ccgccgctcc ggcggacagc
       61 ccgaccgccg tcgctccgac cccggattcc gtcggtcgcg atctggtggc ggaaaacatg
      121 atcaaggatt atgtcctggc cgccgtggcc gccagcatcg tgccggtgcc cctgttcgac
      181 atcgccgccg tggtggccat cgaactgcgc atgatccaga agctgtcgga actgtacggc
      241 aagccgttct cggaaagcct gggccgcagc gtcatcgcct ctctggccgg cggcgtcgtc
      301 ggctatggcg ccggcatggc cgtggcggtc agcctgacca agctgatccc cggcgtcggc
      361 tggatgctgg gcatggtgtc gctgccggtg atcgccggcg ccaccaccta tgccatcggg
      421 cgcgtcttcg tgaagcatta cgaaaatggc ggcgacatct tcaatctcag cgccgatgcc
      481 atgcgcgctt actacaagca gcaattcgag aagggcaagg ccctggccgc caaggtcaag
      541 gcgcgcaagg aagccgccgc cgtcgacgac gtggctgccg cgcactga
//