LOCUS       BT066221                 820 bp    mRNA    linear   PLN 15-JUN-2012
DEFINITION  Zea mays full-length cDNA clone ZM_BFc0105A23 mRNA, complete cds.
ACCESSION   BT066221
VERSION     BT066221.2
KEYWORDS    FLI_CDNA.
SOURCE      Zea mays
  ORGANISM  Zea mays
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae;
            Zea.
REFERENCE   1  (bases 1 to 820)
  AUTHORS   Soderlund,C., Descour,A., Kudrna,D., Bomhoff,M., Boyd,L.,
            Currie,J., Angelova,A., Collura,K., Wissotski,M., Ashley,E.,
            Morrow,D., Fernandes,J., Walbot,V. and Yu,Y.
  TITLE     Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs
  JOURNAL   PLoS Genet. 5 (11), E1000740 (2009)
   PUBMED   19936069
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 820)
  AUTHORS   Yu,Y., Currie,J., Lomeli,R., Angelova,A., Collura,K., Wissotski,M.,
            Campos,D., Kudrna,D., Golser,W., Ashely,E., Haller,K., Descour,A.,
            Fernandes,J., Soderlund,C. and Walbot,V.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2009) Plant Sciences, Arizona Genomics Institute,
            1657 E. Helen Street, Thomas Keating Building, Tucson, AZ 85721,
            USA
REFERENCE   3  (bases 1 to 820)
  AUTHORS   Yu,Y., Currie,J., Lomeli,R., Angelova,A., Collura,K., Wissotski,M.,
            Campos,D., Kudrna,D., Golser,W., Ashely,E., Descour,A.,
            Fernandes,J., Soderlund,C. and Walbot,V.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2012) Plant Sciences, Arizona Genomics Institute,
            1657 E. Helen Street, Thomas Keating Building, Tucson, AZ 85721,
            USA
  REMARK    Sequence reverse complemented by GenBank staff
COMMENT     On Jun 15, 2012 this sequence version replaced BT066221.1.
FEATURES             Location/Qualifiers
     source          1..820
                     /organism="Zea mays"
                     /mol_type="mRNA"
                     /strain="B73"
                     /db_xref="taxon:4577"
                     /clone="ZM_BFc0105A23"
     CDS             367..774
                     /codon_start=1
                     /product="unknown"
                     /protein_id="ACN32097.1"
                     /translation="MYSLVAVDVGGDVVGQREAAVAGQLLRRGEHSVDLNVGRLEAPA
                     RGLPVGPGVRRRVQGPHAVAALVVALAGFGCLALQEGQARRQVVEHVGARDVGHRGLD
                     CQHRHQEDDCNARASSLHGCAFLFQRDGWPGPG"
BASE COUNT          187 a          216 c          241 g          176 t
ORIGIN      
        1 gacaagcatg ataagttgac attataaatg gtatagttgc aaacacgagc acttgcgaga
       61 ttagacacgg atataagaag ccaacgacgg catcacacga ttacaggcga acacaccaat
      121 cagcacaaac atcaccaaat cctttattct agtcactcag tgcagatgca gcctactgct
      181 agcagggcac tgaacatcac catcccgtcg tatggattct ggtaagggaa cagtatccct
      241 tcattcgatc ctgccgacac aaacagggca aataatgtta gttttgtctg taataattgc
      301 ttgggtttca ctgccacaaa cgcctgaaac taaagggaga gatcacggtc aagtttgcag
      361 ctgtgtatgt actcacttgt cgcagtcgat gtcgggggtg atgttgtagg acagcgagag
      421 gccgcagtcg ccgggcagct cctgcgccgc ggagagcaca gcgtggacct gaacgtaggc
      481 cgccttgagg caccggcacg tggcctgcct gtcgggcctg gtgtccgccg ccgcgtacag
      541 ggtcctcacg ccgtcgcagc actggttgtt gctctcgctg ggtttggctg ccttgccctg
      601 caggaagggc aggcacggcg acaggtcgtt gagcacgtcg gagcacgaga tgtcggccac
      661 cgcggactgg actgccagca tcgccaccag gaggacgact gcaatgcccg agctagtagt
      721 cttcatggct gcgcttttct ctttcagcga gatggctggc cggggcccgg gtgatagcag
      781 tgggaggagc tagctagctg gtcctgcttg ttgattagtg
//