LOCUS       BA000030             9025608 bp    DNA     linear   BCT 07-OCT-2016
DEFINITION  Streptomyces avermitilis MA-4680 = NBRC 14893 DNA, complete genome.
ACCESSION   BA000030 AP005021-AP005050
VERSION     BA000030.4
DBLINK      BioProject:PRJNA189
            BioSample:SAMD00061088
KEYWORDS    .
SOURCE      Streptomyces avermitilis MA-4680 = NBRC 14893
  ORGANISM  Streptomyces avermitilis MA-4680 = NBRC 14893
            Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
            Streptomyces.
REFERENCE   1  (bases 1 to 9025608)
  AUTHORS   Omura,S., Ikeda,H., Ishikawa,J., Hanamoto,A., Takahashi,C.,
            Shinose,M., Takahashi,Y., Horikawa,H., Nakazawa,H., Osonoe,T.,
            Kushida,N., Shiba,T., Sakaki,Y. and Hattori,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:S Omura
            Kitasato University, Kitasato Institute for Life Sciences; 1-15-1
            Kitasato, Sagamihara, Kanagawa 228-8555, Japan
            URL    :http://avermitilis.ls.kitasato-u.ac.jp/
REFERENCE   2
  AUTHORS   Ikeda,H., Ishikawa,J., Hanamoto,A., Shinose,M., Kikuchi,H.,
            Shiba,T., Sakaki,Y., Hattori,M. and Omura,S.
  TITLE     Complete Genome Sequence and Comparative Analysis of the
            Industrial Microorganism Streptomyces avermitilis
  JOURNAL   Nat. Biotechnol. 21, 526-531 (2003)
REFERENCE   3
  AUTHORS   Omura,S., Ikeda,H., Ishikawa,J., Hanamoto,A., Takahashi,C.,
            Shinose,M., Takahashi,Y., Horikawa,H., Nakazawa,H., Osonoe,T.,
            Kikuchi,H., Shiba,T., Sakaki,Y. and Hattori,M.
  TITLE     Genome sequence of an industrial microorganism Streptomyces
            avermitilis: Deducing the ability of producing secondary
            metabolites
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98, 12215-12220 (2001)
REFERENCE   4
  AUTHORS   Ikeda,H., Shin-ya,K. and Omura,S.
  TITLE     Genome mining of the Streptomyces avermitilis genome and
            development of genome-minimized hosts for heterologous expression
            of biosynthetic gene clusters
  JOURNAL   J. Ind. Microbiol. Biotechnol. 41, 233-250 (2014)
COMMENT     This work was done in collaboration with Haruo Ikeda(*1),
            Jun Ishikawa(*2), Akiharu Hanamoto(*3), Chigusa Takahashi(*3),
            Mayumi Shinose(*3), Hiroshi Horikawa(*4), Hidekazu Nakazawa(*4),
            Tomomi Osonoe(*4), Norihiro Kushida(*4), Hisashi Kikuchi(*4),
            Tadayoshi Shiba(*5), Yoshiyuki Sakaki(*6,*7), Masahira
            Hattori(*1,*7)
            and Satoshi Omura(*1,*3).
            Final finishing process and all annotation were done by H. Ikeda
            and J. Ishikawa.
            *1 Kitasato Institute for Life Sciences, Kitasato University
            *2 National Institute of Infectious Diseases
            *3 The Kitasato Institute
            *4 National Institute of Technology and Evaluation
            *5 School of Science, Kitasato University
            *6 Institute of Medical Science, University of Tokyo
            *7 RIKEN, Genomic Sciences Center
            All the annotated genes identified are available from following
            urls.
            http://avermitilis.ls.kitasato-u.ac.jp
FEATURES             Location/Qualifiers
     source          1..9025608
                     /db_xref="taxon:227882"
                     /mol_type="genomic DNA"
                     /note="This strain is also named as strain: ATCC 31267,
                     NCIMB 12804 or NRRL 8165."
                     /organism="Streptomyces avermitilis MA-4680 = NBRC 14893"
                     /strain="MA-4680"
     repeat_region   1..231
                     /note="left terminal inverted repeat"
                     /note="long_terminal_repeat"
     repeat_region   1..49
                     /note="perfect repeat"
     CDS             complement(1380..1811)
                     /codon_start=1
                     /locus_tag="SAVERM_1"
                     /old_locus_tag="SAV_1"
                     /product="hypothetical protein"
                     /protein_id="BAC67710.1"
                     /transl_table=11
                     /translation="MTAEWYVLVEEDTRETKRADGVELRLHRWKLAATQHIAGDQEQA
                     AAAAEDAALNYMPGVLARHARPGDEPARHAFLTQDGAWLVLLRQRHRECHIRVTTARL
                     MHTQEEKEAPPKSFKEKLRSALDGPQPPEPAGRPWKPGSET"
     CDS             2466..2699
                     /codon_start=1
                     /locus_tag="SAVERM_2"
                     /old_locus_tag="SAV_2"
                     /product="putative secreted protein"
                     /protein_id="BAC67711.1"
                     /transl_table=11
                     /translation="MPPQGARGTIVSATGSGKTSMAAASTLNCFPEGRILVTVPTLDL
                     LAQTAQAWRAVGHHSPMIAVCSLENDPVLNERT"
     CDS             2765..3310
                     /codon_start=1
                     /locus_tag="SAVERM_3"
                     /old_locus_tag="SAV_3"
                     /product="putative endonuclease VII"
                     /protein_id="BAC67712.1"
                     /transl_table=11
                     /translation="MDWNFPDDDIFFCGGCGDDDTPDPRVPRQDKALCVRCDRVERQV
                     RRYRITVPRRNAIMRFQRDVCALCQEGPPTDHCPDAVSFWHIDHDHRCCPPGGSCGRC
                     VRGLLCLPCNATRLPAYERLPNVLRDSPRFNTYLNSPPARHPEARPTARDHAGPRDAS
                     SYLIDAFFTAADHPEGNALSS"
     CDS             complement(3433..3939)
                     /codon_start=1
                     /locus_tag="SAVERM_4"
                     /old_locus_tag="SAV_4"
                     /product="hypothetical protein"
                     /protein_id="BAC67713.1"
                     /transl_table=11
                     /translation="MALTPGGTRVTQWQDRQAIGDMHERRVAAALRARGWTVQPCGQG
                     TYPPAVREALRRTRSALRHFPDLIAARGADLITIDAKDRMPSTDTDRYAVSADTVTAG
                     LFFTAAHAPTPLYYVFGDLKVLTPAEVVHYTAHALRHRSGAFHLVRTEQAHCFDDVFG
                     SAGAAAAA"
     CDS             3994..4932
                     /codon_start=1
                     /locus_tag="SAVERM_5"
                     /old_locus_tag="SAV_5"
                     /product="hypothetical protein"
                     /protein_id="BAC67714.1"
                     /transl_table=11
                     /translation="MMLLMAAYVDPRFRPTLWPGTPVPTPELMPLRGARADGEWIVWT
                     PQVRSRSHTVPVPEDFYLREFMEVDPEDLDAVAALMGAYGHLGGSINTGSWDVDVYER
                     LKELTEREHPRAPFALHGELATLFMREAQAAITTWLALRREGGLDALIEPEVSEEELA
                     QWQASNADLEEAWPRDLDHLRELSLEIRISNLVSELNAALKPFSIGIGGLGDRYPTIL
                     AVAFLQLYNHLAEDATIRECANETCRRHFVRQRGRAAYGQNRTSGIKYCTRECARAQA
                     QREHRRRRKQQTTTLQQPPAPGPQSHDTSEPTAEGR"
     CDS             4936..7563
                     /codon_start=1
                     /gene="ttrA1"
                     /locus_tag="SAVERM_6"
                     /old_locus_tag="SAV_6"
                     /product="putative helicase"
                     /protein_id="BAC67715.1"
                     /transl_table=11
                     /translation="MISLREHQVEANARIRAWAGFPTRSPVPAQGLRGTVVSATGSGK
                     TITAAWAARECFRGGRILVMVPTLDLLVQTAQAWRRVGHNGPMVAACSLEKDEVLEQL
                     GVRTTTNPIQLALWAGHGPVVVFATYASLVDREDPEDVTGRAKVRGPLEAALAGGQRL
                     YGQTMDGFDLAVVDEAHSTTGDLGRPWAAIHDNSRIPADFRLYLTATPRILASPRPQK
                     GADGRELEIATMASDPDGPYGEWLFELGLSEAVERGILAGFEIDVLEIRDPSPALGES
                     EEAQRGRRLALLQTALLEHAAARNLRTVMTFHQRVEEAAAFAQTMPQTAARLYEAEVS
                     AEALVDAGALPESSIGAEFYELEAGRHVPPDRVWAAWLCGDHLVAERREVLRQFADGL
                     DAGNKRVHRAFLASVRVLGEGVDIVGERGVEAICFADTRGSQVEIVQNIGRALRPNPD
                     GTNKTARIIVPVFLQPGENPTDMVASASFAPLVTVLQGLRSHSERLVEQLASRALTSG
                     QRHVHVKRDEDGRIIGTTTEGEGGQHESEGAVESALLHFSTPRDATTIAAFLRTRVYR
                     PESLVWLEGYQALLRWRKKNHITGLYAVPYDTETEAGVTKAFPLGRWVHQQRRTYRAG
                     ELDPHRTTLLDEAGMVWEPGDEAWENKLAALRSFHRAHGHLAPRRDAVWGDADSELVP
                     VGEHMANLRRKDGLGKNPQRAATRATQLAAIDPDWNCPWPLDWQRHYRVLADLATDEP
                     HSRLPDIQPGVQFEGDDLGKWLQRQRRSWAELSEEQQQRLTALGVTPAEPPTPTPSAK
                     GGGKAAAFQRGLAALAQWIQREGAHKVVPRGHVEAVVIDGQEHQHKLGVWISNTKTRR
                     DKLTHDQRTALAALGVEWA"
     CDS             7554..9626
                     /codon_start=1
                     /locus_tag="SAVERM_7"
                     /old_locus_tag="SAV_7"
                     /product="putative IS4 family transposase"
                     /protein_id="BAC67716.1"
                     /transl_table=11
                     /translation="MGLAAGSASAVGVLLSDHPSEAGACCRQVCFQGAHASRWLSSVA
                     CWRLSSSRWLFRVSSSTRSVRCPVSRASSCCPSWRFREHRRTPPDAAVAPWAAQQPPY
                     LAPHQFSLLPLPELLRWEVLYGLQQVDPWLRIFEPAQVRRMVRDLAETGTLIDGIRDQ
                     QMCPRSTVAVLRMLGRVRTAVRAGHAEYTGTAPAQDDVLDLRALGQRSRTPAGIRQPK
                     TVDLRTIRQPWLRGLLRTWTVQQRPGADEFARTLRGVELASRALAQRPGTDDPAGLRY
                     DDVTAVVDAIRTALKRDGEPAGWNYRMSIASHFFALIDYGHRSGAADDLSAAFVRDPA
                     LHRIPEQEANEDEIGKAIPEPVIRQLDAHLHLLGLGRARGQRTLAPDDLQLMYRTLYI
                     LLRDTGQRPLEVLSLPRDCLETRNDQISLIWNNHKARRHRRRLPITTSTAQAIRTWQE
                     RREQLQASLPPTGADYLFPALTHLATRPYLHTSYLGETLRDWVDSIPHLHGEGTDTQG
                     NPLPFDRSLIYAYAFRHSYAQRHADAGTPLDVLRELMDHKSVSTTQRYYTVSLKRKRD
                     AVTKLAAHVVDHHGHPSPSSETAYELRSVAVPYGGCTEPSNVKAAGSSCPIRFQCAGC
                     GFYRPDPSYLPAIEQHINELRADRETAQAMDAAEFVITAFTAQITAYEQVTDRMQRRL
                     AALPVAER"
     CDS             complement(9886..10635)
                     /codon_start=1
                     /locus_tag="SAVERM_8"
                     /old_locus_tag="SAV_8"
                     /product="hypothetical protein"
                     /protein_id="BAC67717.1"
                     /transl_table=11
                     /translation="MSSISSALSRLPAPRAENAGDLDGGGWAAWLRGHLDPAWRTSEW
                     RQDCWLFTGSVHEPRSSVALCRTEACDTVVSPANIFCPFCKEEQKRSPLPDAEFARAF
                     VPVRNRVAFGGVPEPCSFTKDGQRCVRPRHCKELCATHYTQWKTHSTRKTAGRWEDTA
                     VPYADTPACPAPACPLPGLYGRGLCRHHAQRWMAFLIRSLSSLRVRISCLASSSSVRS
                     VAVVLRVRAGEGVVGCWRCCAASMCSRMPSA"
     CDS             complement(10632..10805)
                     /codon_start=1
                     /locus_tag="SAVERM_9"
                     /old_locus_tag="SAV_9"
                     /product="hypothetical protein"
                     /protein_id="BAC67718.1"
                     /transl_table=11
                     /translation="MLRHSAATRWLRDGVDRDVVQRLLGHASPLSMERYRHVNDAEAR
                     AAVERVGSLKERR"
     CDS             complement(11101..13497)
                     /codon_start=1
                     /locus_tag="SAVERM_10"
                     /old_locus_tag="SAV_10"
                     /product="hypothetical protein"
                     /protein_id="BAC67719.1"
                     /transl_table=11
                     /translation="MLRSLNCWPSRATDPSRVAELVRPYAGTTPQWGQRLLRLIEWAL
                     TPGLIDLAVDLIESGHADEARGPIAVNSDFWSLLYGLAETAPAPAARLVGAYLWRHLA
                     RARADDSGDPFESGHLSTHSQFADTVLSRIAEAEPEAYVSQVLPFVIDVATAGSTGGT
                     DAYAPSGRWAHRLVGGHGVDAALLTALDTALRSLAANSPAAAADALQQLTPSPVQELR
                     FLACRVYAVMNQADEAIAWLLNDERNLRLGWLSSARWASRELIEATTPHCSDETLERL
                     TAMLLDYYPAWEHRRQKGQHSAWGWSQYELLSAICPSRRSDAGCRRLAEWERKFPGQV
                     PSPPTPIQTGFVGSPISDHAARHMTNEQWHRALNMYAKPQAERFWPPQGGVHELAQTL
                     GSRAEQEPERFTDFAFTLGPDAPATYLCAIVGAVTPHLDADRWEQLALHTHQILGPAA
                     APTICRALQSAPQNFTAASLPALDSYTTDPHPEQDIRDADAEGTRTDLLTAGMNATRG
                     QAALTVAALLFHGSEHLHALTPLVTRLANDSVLAVRVCAAQAVLALMKHDPQIALDTT
                     EQLLNHQDANAYNASTTQRLLINILVREPSRFAAHLARALQGPGDTAELAGQSWAVAT
                     IQGCLTPDLPNSTDELNALARRGAASVFADNIDHYPHLVPLFNDDDADVRKNASQGMR
                     QVFDLFPAQADELVRAFLDGKAFPDHLEHLAFALYDHAGPLPTVAIDACERIVQHAGR
                     ELGDLRTHRAADGHHLVSAVLRLYRQSRQAERIRCLDVIDRLSQAGAYGLTAALENER
                     "
     CDS             complement(13376..15523)
                     /codon_start=1
                     /locus_tag="SAVERM_11"
                     /old_locus_tag="SAV_11"
                     /product="hypothetical protein"
                     /protein_id="BAC67720.1"
                     /transl_table=11
                     /translation="MGLAGGAADKAGNRYEDWWTALRVAELLRGRATGIRLEPPGPAG
                     AGIEFELEADDGTWCEQVKDVPSKGPWTLSAAGKILEAVTGHLAGGKKVRLVLSTGAP
                     ELHDLSKRARGADTLAEFEGMITKAQIPQFVQVLENWSDNGMPVDREVGWRYLQAVHV
                     EHIPPEALRRLVVSEYELLFVGDPEVIVRQLSGYLDEHLHQRLTGSQIRSHLLTVPGV
                     RPRLLAGDTGTLTALAGTVERFVRRVRRDKPAFGMAARPHVEQLYERLVAEDGPQMVV
                     CEGSAGLGKSAVVTDVLVRLTEQGWPAAAVRMDGADASVQTAKDLGVRMTLPDSPAVL
                     LAGVADEAPALLVIDQLDAVSTYNGRMSDAYEAVEDVLAQLVVAPNVKVLLVARTIDI
                     DNDRRLSDLVADRVRTVRFPLSVLDVEQVRAVLSASGTDPDGLGPVTLELLRTPLHLS
                     VFSRLSSSARAASYRTLQELYARYTDERREEIERQVAALDWRGITGTLCASMSERETL
                     QAPMALLDGFARQHIKVLESHGVLVRDGEQIGFFHETYFDFLFARSFISAGEDIHEFL
                     ANSGQYLFRRAQTRQILEHLAGTDPERFRATVGRLLGSDRIRPHLHDVIIAVLGQFDA
                     ALPDWKAVEPVAWGQTPVAGKVRGLLALPQWFDAADHDQRWERWLGTPRTADAAFPEL
                     LAVARHRPEPCCGAGTTVCGHHATVGTAASAAD"
     CDS             complement(15815..17701)
                     /codon_start=1
                     /locus_tag="SAVERM_12"
                     /old_locus_tag="SAV_12"
                     /product="hypothetical protein"
                     /protein_id="BAC67721.1"
                     /transl_table=11
                     /translation="MPSATPSTPSSTPPAWPHCAHDATPEDPVGCRGLRVGSHTACLA
                     HLDDTDRAAYLTVLSPGADIDHRGTPFTPNLLNQLLAALRDPTTGKPRTGEARFDGAT
                     FSGEARFNGATFSREVRFDGATFSRKAQFRETTFTQDARFDGAAFSGETEFENATFSH
                     GARFGKTTFSCRTSFDVATFSDQASFAGATFSGEARFIGARFSRTWFSEATFSAGARF
                     VDAKFSEDARFDGTTFSRDTSFQGATFSGDARFHGARFEMSSFLGPLVCSKQVVMDGA
                     VFGQPVTVEIAAHQVSCVRTRWASTATLRLRYAELDLRDAVFEYPVTVAARPNALRSR
                     VSVSLSEAELSGREPGVRLMSVDGVDAAHLALQDIDLSACRFAGVVHLDQLKVDGWCT
                     FAGVPAGWGRPFSWPSSQRNTLVEEHHWRVRTARRPGRAVARGWTSPQDAPVLKPAMV
                     AALYRQLRKSLEDGKNEPDAADFYYGESEMRRHDVTRPWGERALLTAYWALSGYGLRA
                     IRTLAWLVAAMAATIAVMVLWGLPADDPKPTTTGRQVAVGQEVLLTTDVPAPVNPSGP
                     LTERVTTERLEKGLRVVINSVIFRSSGQDLTATGTYTEMTSRLAEPVLLGLAVLAVRS
                     RVKR"
     CDS             17828..18922
                     /codon_start=1
                     /locus_tag="SAVERM_13"
                     /old_locus_tag="SAV_13"
                     /product="hypothetical protein"
                     /protein_id="BAC67722.1"
                     /transl_table=11
                     /translation="MRSDNNKRAYRTARPEIKGLRAHDEEAIELLAIPQEPQKDVAQP
                     SQHIGPPPEEGEDESRLLLRFAAPRDPVMVADWVSFNVIDTEKQDWARGWAALKKFTE
                     REQHARVPYGYKEGAYPLGQWVAEQRRAYGAGQMTGQRARRLEQLGMVWSPADERFQE
                     NLEAARAYLEEHWTLCAPRSATMLDRPVGQWLSNLRRPGALEGHPEWKTALEAVDEDW
                     NPSWPAEWQRHYAALRDLVADEEGQADVLPGFTVHGMDIGKWLARQRKPEVWQALTDG
                     QRERLEQLGIVPLALEPEEPAKPSATPVGAFERGVAALAQYKAREGSVTVPRAHVERL
                     EDGTEVRLGVFLTLELVPLPAPVGPPAPCT"
     CDS             19446..20279
                     /codon_start=1
                     /locus_tag="SAVERM_14"
                     /old_locus_tag="SAV_14"
                     /product="putative membrane protein"
                     /protein_id="BAC67723.1"
                     /transl_table=11
                     /translation="MTSQNTTAAPCAPNFLPIRKVQSRTNHVPYLRGNHAGPSPVTHA
                     QTQQKPVGSTMSQQQYPQPQQPGRNGLATTALVLGIIAVVVSFIPVLNVVVWPLAILG
                     IVFGAIGLSKAGKVRKGKGAGITGLVTSAVAIIMFFAMNALFFSAVDKASEELDKSYD
                     STTVGDGKSKTGGAKESKVMKDFKVTKCDVVTGDFGIKEMAIHVDYANNGDRRYSYFV
                     EGEVLADGKKVDDFMSTAENLAPGQKFTDKNAGALVNADEIKDAKKLECKTINASRTD
                     F"
     CDS             21562..22080
                     /codon_start=1
                     /locus_tag="SAVERM_15"
                     /old_locus_tag="SAV_15"
                     /product="hypothetical protein"
                     /protein_id="BAC67724.1"
                     /transl_table=11
                     /translation="MLPADPLLGTDQQEVVARLWKRQQTETGWAYLVGLPSYRDREDG
                     DVEAAAYRVWVRAPDHVRPVDGVDYDQVVTEKLERSPQSAVREVLGERRPSGWVLAKL
                     RDGRGPARSVLHAPDCEEAPAGAPLLDMDRALDSAEHPGTRLCTLCGAAQELTPLLRG
                     FDHITDSAPDDS"
     CDS             22243..22770
                     /codon_start=1
                     /locus_tag="SAVERM_16"
                     /old_locus_tag="SAV_16"
                     /product="hypothetical protein"
                     /protein_id="BAC67725.1"
                     /transl_table=11
                     /translation="MSEARPRPYGGGDLHGCGGAREARAREVARDAAGEDARVGAGDF
                     AARQTGARFEQQYLCLAASYDFPQDLTDAQDELRQVRADLQTVYRRVPWSAEPLDAWE
                     THENAWRPSSRPASPGWGPQDAAEIARLRAREVELATANVTHAYWSEFAPAHVLAARN
                     ALKRHQEQQMADASS"
     CDS             23457..23621
                     /codon_start=1
                     /locus_tag="SAVERM_17"
                     /old_locus_tag="SAV_17"
                     /product="putative secreted protein"
                     /protein_id="BAC67726.1"
                     /transl_table=11
                     /translation="MNSAPRTRCPQALRDRRAAVLFVAFFAVVFLADCCFAVFFFGSS
                     WTPASTPREA"
     repeat_region   23618..23621
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  23622..25034
                     /mobile_element_type="insertion sequence:ISSav9"
                     /rpt_family="IS5 family (IS1648 group)"
     repeat_region   23622..23639
                     /note="18 nt imperfect inverted repeat (16/18 nt)"
                     /rpt_type=inverted
     CDS             23675..24559
                     /codon_start=1
                     /locus_tag="SAVERM_18"
                     /old_locus_tag="SAV_18"
                     /product="putative IS5 family IS1648-like transposase"
                     /protein_id="BAC67727.1"
                     /transl_table=11
                     /translation="MGRGDLSDEEWARLEPHLPANRGRGGRWKCHRRVINGILFRQRT
                     GLPWRDLPPCFGSWKTVHDRHRRWSADGTWERILRAVQADADAEGRIDWSMVSVNSTT
                     CRAHQHAAGASTRAPKIPGRRRSPARHRPDEALGRSRGGLTSKIHLAGEGGRRPLGFL
                     ITPGQWGDAPQMIPVLEEIRVPRQAGGRPRTRPDHVGGDKAYSSRRNRRHLRRRQIKH
                     TIPEPRDQRANRRRRGSGGGRPTGFDKAIYRRRNEVERTINRLKNFRAIATRFDKRAY
                     VFHGTVTVAAIRLWLRPE"
     CDS             complement(24570..24983)
                     /codon_start=1
                     /locus_tag="SAVERM_19"
                     /old_locus_tag="SAV_19"
                     /product="hypothetical protein"
                     /protein_id="BAC67728.1"
                     /transl_table=11
                     /translation="MNEGGRMSRDTAVAEVGMRGITFPAWHGEHYVTLAEVLVRLGSF
                     GLDLTWRIEFDEIVDPRCVEMERRSADAGMDTLTLLSLTTPFLQLIDAEARGFAGDEL
                     VLVLTEFDSSSWDVRAVDKRVLSELRQHYPGAEDL"
     repeat_region   25017..25034
                     /note="18 nt imperfect inverted repeat (16/18 nt)"
                     /rpt_type=inverted
     repeat_region   25035..25038
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(25166..25690)
                     /codon_start=1
                     /locus_tag="SAVERM_20"
                     /old_locus_tag="SAV_20"
                     /product="hypothetical protein"
                     /protein_id="BAC67729.1"
                     /transl_table=11
                     /translation="MNEIMLSLAGAELPSVLPDDVPAAYRAIAEEGWTVDGNGAYLLS
                     ALQAGYHGSTAGEFEDIVHFEATVNGRGMMDYDLPASGPERQNRLLRRSIAYACLALQ
                     AAPAESEHPLLGYVSLSEGGLSDDTLTANVTFCTRRSGIPPYVSDIQDYSEESLLELS
                     RDDAVNALKGADGR"
     CDS             complement(25699..29451)
                     /codon_start=1
                     /gene="rhsA"
                     /locus_tag="SAVERM_21"
                     /old_locus_tag="SAV_21"
                     /product="putative Rhs protein"
                     /protein_id="BAC67730.1"
                     /transl_table=11
                     /translation="MTLSGLVSTAAHPERVVQAAVDGFKKDPSEFVGRLIPELIGTKG
                     AGLARGGMRLALKEGMEGVAEQGLRKTARNAVEDAAEDASRQRGAKICEKDPVDVATG
                     RMVLPQIDVSLPGQLPLVVKRQFESSYRLGGWFGPTWSSTLDQRLEVDTAGVVLVGED
                     GLVLAYPHPAPGVPTLPSHGPRWSLDRTDGGYTLTDQKSGHIRHFVDRSDTLAVLEQL
                     DDRNGNWITFEYDADGAPRYLTHSGGYRLRISTEAGRVTALHLASAAVDGGDQDLIRY
                     GYTDGHLTEVVNSSGRPLQYVCDELGRITSWTDTNDSHFSYAYDDEDRCTHQSGAAGH
                     LRSTFAYGAVDPGTGAHTTTVTDSYGQTTHYLINRRCQVIAETDALGAVTRYQRDRYN
                     RLLSQTDPLGHTTSFRYDDAGNLVAATRPDGREARAEYNALGLPVKLVNPDGTITRQT
                     FDERGNLTSVTDPSGQTTRFGYDEGGRLTSMTDPLGHTTGIVCDRAGLPLTVTDPLGA
                     VTRYERDAFGRTTAITDPTGATTRLEWTVEGHLSRRTAPDGTSESWTYDGEGNCTSHT
                     DPVGGVSLFEYTHFDLPTARTGPDGVRYEFEHDTELRLSQVTNPHGLTWNYAYDAAGR
                     LVAETDFDNRTLTYEYDFAGRLASRTNALGQMIAFERNELGQIVRKDAAGQATTYAYD
                     FTDQLAQATGPDGTALTILRDRHGRMISEAVNGRALTYDYDELGRRTRRTTPSSATTI
                     WSYDVAGRRTSMTGSGRSIDFVYDEAGRELGRRFGHITLEHSFDALGRLTSQSVLGPA
                     GRRTQHRQYTYRADGHLIGIEDQLSGKRRFDLDLAGRVTAVHAVNWTETYAYDAVGNQ
                     TSASWPAGHPGQEAIGNRTYTGTSLTRAGQVRYEHDGLGRIILRQKTRLSRKPDTWRY
                     TWDAEDRLTSVTTPDGTRWRYTYDPLGRRTAKLRLAEDGETLVERVDFTWDGTVLCEQ
                     TTTSPDLPHQVTLTWDHQGLRPVTQTERIVAADAPQQEIDSRFFAIVTDLVGTPSELL
                     DERGEIVWRTRATLWGSTTWAKNSTAYTPLRFPGQYYDPETGLHYNYFRHYDPETARY
                     VTPDPLGLGPAPNPAAYVPNPHMWADPLGLKCEPPEGYTSQPAFKNDPYHPDAVERGI
                     NEMRELYGIKERPPSGMIGANGTQVTSKTMWNHGPYRIDVENPNPGQRAGQLHFQDQS
                     NPTAKYQYNFDEGKFDGLPRSVEREVGKIPGFEAGIRKGLRVLGED"
     CDS             complement(29508..30080)
                     /codon_start=1
                     /locus_tag="SAVERM_22"
                     /old_locus_tag="SAV_22"
                     /product="hypothetical protein"
                     /protein_id="BAC67731.1"
                     /transl_table=11
                     /translation="MSSGLRKVDSSGWQGEGGEAFREKFGVHPTKWAQAAEACNTAAG
                     ALELYADTLKWAQGQAKEAVELYKKGVKASQDAVDAYNKKVDAYNAKIKANEDPGPKP
                     EPFHDPGKADIKAAAQKLAEARKQRNTAASEAQGKIKAALAHAPAEPPPLDRIGNDLK
                     DGFQAANTELTHVVGGALKGTAGLVTSPPA"
     CDS             complement(30107..30394)
                     /codon_start=1
                     /locus_tag="SAVERM_23"
                     /old_locus_tag="SAV_23"
                     /product="hypothetical protein"
                     /protein_id="BAC67732.1"
                     /transl_table=11
                     /translation="MGLGDVTNSLLGGAENLYDAGKKKLGEGVDWATDKVGEGLDKVG
                     AHDWADSVEDWGDEIASDLGPPRVSSSSARPRSPTNSSTAIRTRSARVPST"
     CDS             complement(30394..31323)
                     /codon_start=1
                     /locus_tag="SAVERM_24"
                     /old_locus_tag="SAV_24"
                     /product="hypothetical protein"
                     /protein_id="BAC67733.1"
                     /transl_table=11
                     /translation="MASVSSWPSRTSRRWPVTRWHAVRRRVSGRTRRSSARDCWMWRC
                     PRQGCPGGWRWTARTAKRAWSSRRCAASCRTRQHSTSTPTGTRGRGMSGDGKDLKTEG
                     LALIAKGLTEALGELKELGMVGEAGAGRGFGDIALSGLELGHEGLTGEFTSFCERWEW
                     GVRSLINEGNGFALKTGLSAGTYYETDKYIEGTFKVVTNAAIGNPYASEENVEKMGWG
                     DIATSGVYGGNVDYSKESFDQAMANSGQAWKDAGRDVMTSHTIGPVPGVNPEELHGAF
                     GVSDDEYNQYLDDTFGPSPEARAKAAEQQGGEG"
     CDS             complement(32197..32559)
                     /codon_start=1
                     /locus_tag="SAVERM_25"
                     /old_locus_tag="SAV_25"
                     /product="hypothetical protein"
                     /protein_id="BAC67734.1"
                     /transl_table=11
                     /translation="MREFPLDKHERTEADDRLDQILATTHAELVDAIATQQDHARTMT
                     LIPGSGTAEEPTKTIDRALWSYKEIAAYINVRPDKVRWYRKHGLLPAPDHVEGGKPYW
                     YSDTVRAWMASRPSRREP"
     CDS             complement(32552..33124)
                     /codon_start=1
                     /gene="sig1"
                     /locus_tag="SAVERM_26"
                     /old_locus_tag="SAV_26"
                     /product="putative RNA polymerase ECF-subfamily sigma
                     factor"
                     /protein_id="BAC67735.1"
                     /transl_table=11
                     /translation="MMSETPAQAGRREPLPETRPVPSTELVRRDDFSVFYRTEKKRLI
                     AFLIYAGARVWEADDLAHEVLSQLLPDRWKTLEYPRAYMRKSAIRAYLRQNERTREIP
                     TDELPDLPGGIDPVTCVELSEQTNAIIDAIQQLPPTQRTVMAFVMSDSDTAEIAEALN
                     MAPGAVNTNICRARARLKTTLGLMKGDNNA"
     CDS             complement(33121..33411)
                     /codon_start=1
                     /locus_tag="SAVERM_27"
                     /old_locus_tag="SAV_27"
                     /product="hypothetical protein"
                     /protein_id="BAC67736.1"
                     /transl_table=11
                     /translation="MMRGSGCAAETEMGGTMDPVTFTAGCGVATSAVRLGYVWLSAWS
                     HRRRVELEIHRAELERATLMETISSLPPGSEVTEVLRDGRRVTIKLPPSKAA"
     CDS             34056..35792
                     /codon_start=1
                     /locus_tag="SAVERM_28"
                     /old_locus_tag="SAV_28"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAC67737.1"
                     /transl_table=11
                     /translation="MAEQRRAYGAGQMSGLRARRLEKLGMVWSVADERFQENLEAAKA
                     YYEDHWTLCAPRSATALDRPVGQWLSNLRRAGALDGHPEWKAALEAVDPYWNPDWPVD
                     WQRHYAALRELVRDEGQADVLPGVTVHGMGVGRFVAKNRQHAVWQGLMDGQRELLEAI
                     GIEKGNLTALPELAREYAEDNTGARIVIVDRTGRLLTDSAGTTATGTTLAGEPDIAAA
                     LRNQTTVATRTGTDGGDVLAATMPGSSGTTIRGGLRVTYPMTMVTDREHRIWAALALA
                     GACVLAAVALVAFTLARWITRPLRTLERATTQLAAGRLDNPPDAGSGPPELRRLAAAF
                     THTATRLQHLLQAQHSFASEASHQLKTPLTSLRLRLENFEPYLDPRAHPSLEETIAEV
                     ERLSRMVHGLLALARLENTATTPEPVDADAVLAERAAMWEPLAAEQYVTITVFGPAVG
                     RVWAIPGALEQIIDNLVANALRVSPPGTSITLARAPGADLHVIDQGPGMSEADRERAF
                     DRFWRASDSHHDGTGLGLPIVRHLVHASGGEITLHAATGGGLDARVRLRPASRERRFQ
                     ATAITGAAGRGR"
     CDS             37315..37656
                     /codon_start=1
                     /locus_tag="SAVERM_29"
                     /old_locus_tag="SAV_29"
                     /product="putative PadR-like family transcriptional
                     regulator"
                     /protein_id="BAC67738.1"
                     /transl_table=11
                     /translation="MTRRNPPLTEPQYFILAALMDGPLHGYGIIKAAEQATDGRLRIA
                     VGTLYGALERMERAGLVAAGHEEIVDGRARRYYRLTEDGTEALGREALRMQQAAAVVI
                     GRARDAGAAPA"
     CDS             37653..38609
                     /codon_start=1
                     /locus_tag="SAVERM_30"
                     /old_locus_tag="SAV_30"
                     /product="hypothetical protein"
                     /protein_id="BAC67739.1"
                     /transl_table=11
                     /translation="MNRLLLAAYPKSYRSRQGKELLACLAEAYPGRSWPPPREVAALV
                     RAGVQARARATVDDTTRPWWLDGIHLAALALAALALVPYLQDVWHWALHIDPGQHAIA
                     FHFSGWYPWAGGPTRIRLLPYGLLPLGGLIALLRGRAWIALPAAASMIWAGATTHGRT
                     LFGDEGKAGLSYYGLGAPITARDLALSGTLCAACAVLALCRPSRLRRRSYRWLAPVVL
                     AMFVAGGLHIISVSPTFQRGLFVLEVAALLGAWVATAATGDHRWLIPVAAVAIVRTQA
                     IVAQPDAFMQSFPDLVVLLLLIAPLPALAITAQRRQGQALPE"
     CDS             38623..39624
                     /codon_start=1
                     /locus_tag="SAVERM_31"
                     /old_locus_tag="SAV_31"
                     /product="putative prepilin peptidase-like protein"
                     /protein_id="BAC67740.1"
                     /transl_table=11
                     /translation="MGRPSPAAHVVPQDVRDLTPLNGRNRAMTQHDPPTLPAHRPRAS
                     RQAPEAPDAPSLSRTTRPWMPALLYTLGFLTVYLLAICTPWGQRAENALFGLGKQGGE
                     EAWFYPLSGAAYGSTPLPPLELSAKPTLMVGLAVIVVLTLVRRCWWPGCAALGVVILT
                     TGGKEVLKSTLPRPDLVGAPENLLDQGFPSGHTAIPAALTLAAVLVVSPRIRPYVATA
                     GVLWLACIAAYSATNGGHRPSEVLGATLLACACYGLATWLLPPSAAPGATRSPRALPV
                     ITLTLALAVALVSGARNDTLTRSLVSAATGFICAALVWYAAVGRPAHTARRTRPALG"
     CDS             41010..41612
                     /codon_start=1
                     /locus_tag="SAVERM_32"
                     /old_locus_tag="SAV_32"
                     /product="hypothetical protein"
                     /protein_id="BAC67741.1"
                     /transl_table=11
                     /translation="MLRGRRPRPARRSISRSGIAPARWYISRSAARSSAAFSTSRKGA
                     LMAELVRQQHLDADVGYHGFGFQESDDGDILAPFPDDFADEVFLNAFPGRLDIYSAGH
                     THTASVTVAVWDGPPAAHDRVQWDEQAEADYDSASGEVAVWSMSLGRADEVITLADSG
                     GLWRVRVSCTGRAVAARLSEEEGTGHGVEKYLVQFWPRTA"
     CDS             complement(41665..41967)
                     /codon_start=1
                     /locus_tag="SAVERM_33"
                     /old_locus_tag="SAV_33"
                     /product="hypothetical protein"
                     /protein_id="BAC67742.1"
                     /transl_table=11
                     /translation="MTKERNEPSANPLRVGLKAALGGLRTVLPSGSQCDEYPFATTYE
                     GAAEYDYDPDARKFNFSVRPIAKADNGAGGSLLLSFYAKNRLIDGLEDGFGVKIVS"
     CDS             42010..44046
                     /codon_start=1
                     /locus_tag="SAVERM_34"
                     /old_locus_tag="SAV_34"
                     /product="putative secreted protein"
                     /protein_id="BAC67743.1"
                     /transl_table=11
                     /translation="MGFVHLFPQRGRRLISLTARTTGRRRLALGTILAIVIGSGATGT
                     AYSADGSDNPPPVHGPGARAAAAAEPDTPNGPEVGPPFTKTNNVWQTDTTTPTLRNTV
                     TAPSGHKTTATFEVHTTDSSGKPTATVVKLTDENQWGVLVSGEVTAGKPASVTVPAGK
                     LKNGVTYAVRSSGYDATSNVYESDWSPYSTFKINVPPAEKPYVTFPAPQATSGIDSLA
                     QTPIEFTRTDPGPVTGLRGDDNGRKCSAPDAEGRKVCIEISRDAPTPEDAAVAKGAMR
                     QALRGADLVSWCAAKPDGKDYMNRGEACLKKVGYATLIFVDADDLPRFGTATFALSQQ
                     IKLYNKKSDTGTDRAEFDQQLTVVPTQIDDATEGVHLTWQPGDNCKDCTSSQVQWSSN
                     DGLNTTPHWAVGEVGAQYAMTAKRQTIWNGTGKEQFDLGWSLLGSVDAGNAHAQTSLG
                     TSGDVRVRELAPRCDDIAGGNIKTGCVFPYFKPTWTVDTNLYPAAGAYYWLLQEKLPS
                     HPGSRKWDSLVTYLGPGNNADPDGGDWTNDDSRGIVCPTGTSGFKPNPATPDGSCDEY
                     APASTYQSGGMPKGPNQVASGKECAQLYTKPMTGGTWGLLAENRDGYTGPKWNEKCGR
                     ASVPTDQNTGAFRDLGIKFVPQMRLLDKDGFFISDPGFEHCKNADTVCAWKKVG"
     CDS             complement(44107..44958)
                     /codon_start=1
                     /locus_tag="SAVERM_35"
                     /old_locus_tag="SAV_35"
                     /product="putative secreted protein"
                     /protein_id="BAC67744.1"
                     /transl_table=11
                     /translation="MSGFVRTGACACSPSPSASPTCSTTSSSGRHAPMSPPPFCAGGE
                     VREVAGARHETRRVAGMTDDQQQEQAVAGAWARIEEWLERHAPRSYRMLPPPAPEADI
                     REVEQELDLTVPPGLKAFYRLRNGTGHPGDFGWTPEPDTGLPLQGQETAWLLPRKHGI
                     PPVQHLPYWDEGPHTIGRPDDPMVRYLAFAATDRSGLYGLFTDCTPGTGYGRIGTFEE
                     AGIPKLGVWSSFADYLIEVADALYENRGVEYADGHQDTKVPGLVDQALVWDGPAHPRD
                     PEWTRFA"
     CDS             complement(45160..45432)
                     /codon_start=1
                     /locus_tag="SAVERM_36"
                     /old_locus_tag="SAV_36"
                     /product="putative secreted protein"
                     /protein_id="BAC67745.1"
                     /transl_table=11
                     /translation="MNKTIAWLLTCAGAGVILWLLTSAPDISSAYPRSECHSVLGNDS
                     SPAHGSMEDGVEATCATYQSRRLGWAVLVSVPTVVLASAGMRSRSA"
     CDS             complement(45819..47141)
                     /codon_start=1
                     /locus_tag="SAVERM_37"
                     /old_locus_tag="SAV_37"
                     /product="hypothetical protein"
                     /protein_id="BAC67746.1"
                     /transl_table=11
                     /translation="MCRGPLGSYESLTRPSFAFIVISPSATLLTHAPGSQEPHVSRHN
                     RRRSTLHKRATVFGGGTVAVAAVVATVNIASADQVSPTPRTASKADHAVFVQGNELAG
                     NTIHVFRRGDDGKLTAAGKYATGGKGGDQVDAPTDSLASQGSLVYDRRSGRLLALNAG
                     SGTLTSYAVHGQKLTDRQTVPTGGDFPVGIAVSGDLAYVMNAGGAGSVQGFRITTMGL
                     KPLSGSLRTLGLKNEKVPLFSSSPGQAAFTPDGRNLVVTTKSANTVEVFPIGRDGRPA
                     HKPVVNKSAGMVPFAIAFDKTGRMLVAEAAESTVSTYKVRRNGELQVLQKPLPNGQDT
                     LCWLERAGDFFYGGNTGNSTVSGYRMDARGRLALTNEAGIAAAPSAKSQGVIDIAVAA
                     DKFVYVQNATSGTVDGFRVGRTGALTKVTTVTDLPAFAESGMEGIAAV"
     CDS             complement(47239..48180)
                     /codon_start=1
                     /locus_tag="SAVERM_38"
                     /old_locus_tag="SAV_38"
                     /product="putative hydrolase"
                     /protein_id="BAC67747.1"
                     /transl_table=11
                     /translation="MTDAAPNRSPEQNNVPGLPLRNLAGFTHRWVDAEGIRLHAVEGG
                     RSSGPTVVLLAGFPQTWWAWHKAMPRLAERFHVIAVDLPGQGHSDRPQGGYDTHTAAS
                     RVQAALTALNVPKYWLVAHDIGACVAFSLALRYPDRLHGVALLDAGIPGITLPDAIPT
                     DPERAWKTWHLAFHLVPELPETLITGRERDYVGWFLRVKTLSPNTFDSADIDHYAAAI
                     AAGGGLRASLAYFRDAAESARKNQDTLARRGHLTIPVLGISSSHGSIPDMAAAISPWA
                     ENVTGVVIPQAGHFIPDEQPDATVDALTAFIDHTRAG"
     CDS             49166..49456
                     /codon_start=1
                     /locus_tag="SAVERM_39"
                     /old_locus_tag="SAV_39"
                     /product="putative terminal protein Tpg homolog"
                     /protein_id="BAC67748.1"
                     /transl_table=11
                     /translation="MPGPKRKASASTSERASGSRLWRGSSDDPRVRWATQSLPGEAAR
                     ELFAVRDVGAGEQQLVILARALGHAYFRDGGRRGHRLHIAFTDIEFAGFSTG"
     CDS             complement(49694..50434)
                     /codon_start=1
                     /locus_tag="SAVERM_40"
                     /old_locus_tag="SAV_40"
                     /product="hypothetical protein"
                     /protein_id="BAC67749.1"
                     /transl_table=11
                     /translation="MYPNARGAAFGTPRRPPPHDGPGAKTPGPLLSDPAAGPSCPRLG
                     GGRGGHKCAFGTRAGTGQEQPHTDQKRKTHMNRKSSAHRRPGRRAAVAAGLVLAVGLG
                     VSTQVSAQAAVHAPAKASTAQSVSGTPGQAVTRVADFYGAYIDAKGDYTDPDATLATA
                     LRNHYLTPDFAKRLAAWEKTNAADGVLRAQNIPAQWTATDNGTVGNGHEVIVTLTFGS
                     GETTQKTKLFVLVERYNHIVDIDTTSTR"
     CDS             complement(50521..50901)
                     /codon_start=1
                     /locus_tag="SAVERM_41"
                     /old_locus_tag="SAV_41"
                     /product="putative secreted protein"
                     /protein_id="BAC67750.1"
                     /transl_table=11
                     /translation="MMKSVIRKAAGLAGASVAVAAMSVTGASAAQAESPTHGCPYPYV
                     CFYVDEDAYNAGTPITKYRDVTSSYQTVRSRPHYHVVNTRNDDVAYLRLQDGNSICLV
                     PNSETVFANAYSVTGIKISSSSTC"
     CDS             51232..52623
                     /codon_start=1
                     /locus_tag="SAVERM_42"
                     /old_locus_tag="SAV_42"
                     /product="hypothetical protein"
                     /protein_id="BAC67751.1"
                     /transl_table=11
                     /translation="MPGIRDRGRDDGGTVSMRDDVEEFAALLRQLKDRTDRSYGSLAR
                     RLNMNTSTLHRYCAGEAVPQDFAPVERLAAFCEATPKERLELHRLWLLAVEARQRVRT
                     AGPAEAAVSAEAAVPAPDTDGALAEDGEPAEESCSAEQPGDGPGPDEPAPSPAPRPWF
                     RRRRVLASTSVTCALLAALGTTSALSDDRSSEADGSRSAGPRAAAPGASHRSAKPSAG
                     GSPSPSRSFAAPGPRQKAPAPSGTGSGPTPAAKPATGLPLAWSADSLVWDKGCDHDYV
                     IDKPPAQVPPPPVQQDAGAWAATQGAVHGRHTMVQISVQGQSSTAVVLKALHVRIVSR
                     GNPAAGSAYAMGQGCGGDLTPRRFTVNLDAGRPIARPKDGADIGHTIPAVQFPYRVSA
                     EDPEVLLVDATTQAYNARWYLELDWSSQGRTGTIRIDDHGRPFHTTSIKGMPRYWYGT
                     NNAGGRAWVPYDS"
     CDS             53113..53505
                     /codon_start=1
                     /locus_tag="SAVERM_43"
                     /old_locus_tag="SAV_43"
                     /product="putative IS5 family IS4811-like transposase"
                     /protein_id="BAC67752.1"
                     /transl_table=11
                     /translation="MPRVGVSASDSGRISLAGVVCRRAGQRSRLPVPAWLAGRGGQPE
                     GYCHLQMIDAVRYLVDNGIEWPAMPADFPARDRVCAVFRRRRDHQLIAGFHDRLRGRV
                     RESEAGTRNRRPRSWTRRSSPSVPSPQC"
     CDS             54215..55330
                     /codon_start=1
                     /locus_tag="SAVERM_44"
                     /old_locus_tag="SAV_44"
                     /product="putative unsaturated glucuronyl hydrolase"
                     /protein_id="BAC67753.1"
                     /transl_table=11
                     /translation="MRTLRAAADYAVEKIRAVAPGVSAFPVGTKFEKWVYSQNGDWVG
                     GFWPGTLWMAWLYSKDEQLRTLALESARKLAPRQHDTSTHDLGFLFSPSWVTAWRLTG
                     DDVWRTGAVQAADSLIQRYNPRGRFLRAWGALNDPNNAGRVIIDTMMNLDLLAFASRQ
                     TGDAKYLDIAVEHAKTAQRVFPRPDGSTPHVFDFDPATGAPVGPGTVQGYSPTSCWAR
                     GQAWGVYGFTTIYRRSGERPFLATACKLADYAIGALGADYVPVWDYRAPQQPNDIKDA
                     SAGAIMACGLLDLSAATGRQQYRTVALRLLSALSQTCLTDKSARAQAVVARCTRNRPA
                     EDGIEISLPYADYYLLEGILRVLQPQDVDRAIDLSAP"
     mobile_element  55644..56560
                     /mobile_element_type="insertion sequence:ISSav10"
                     /rpt_family="IS5 family (ISJp4 group)"
     repeat_region   55644..55657
                     /note="14 nt imperfect inverted repeat (12/14 nt)"
                     /rpt_type=inverted
     CDS             complement(55687..56061)
                     /codon_start=1
                     /locus_tag="SAVERM_45"
                     /old_locus_tag="SAV_45"
                     /product="putative IS5 family ISJp4-like transposase"
                     /protein_id="BAC67754.1"
                     /transl_table=11
                     /translation="MSLTGGNRNDVTQLLPLLDKIPAIAGRVGRPRRRPDALLADRGY
                     DHDKYRRLLRARGIRPVIAKRGEPHGTGLGIFRYVVERTIAWLHGFRRLRIRWERRAD
                     IHEAFLGLAVCLITHRHVQRLC"
     CDS             complement(56052..56441)
                     /codon_start=1
                     /locus_tag="SAVERM_46"
                     /old_locus_tag="SAV_46"
                     /product="putative IS5 family IS1421-like transposase"
                     /protein_id="BAC67755.1"
                     /transl_table=11
                     /translation="MLPKPAPKLVEGRPRVPDRQALCGILFVLHTGIQWEYLPQELGF
                     GSGMTCWRRLAAWNEAGVWNRLHVLLLEKLRSKDKLDWSRAVIDSSHVRAARRGPKAD
                     PARSTAHVRAASTTSSPTARASRSRCR"
     repeat_region   56547..56560
                     /note="14 nt imperfect inverted repeat (12/14 nt)"
                     /rpt_type=inverted
     repeat_region   56608..56609
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  56610..57918
                     /mobile_element_type="insertion sequence:ISSav11"
     repeat_region   56610..56624
                     /note="17 nt imperfect inverted repeat (16/17 nt)"
                     /rpt_type=inverted
     CDS             56620..57810
                     /codon_start=1
                     /locus_tag="SAVERM_47"
                     /old_locus_tag="SAV_47"
                     /product="putative IS605 family IS1136A-like transposase"
                     /protein_id="BAC67756.1"
                     /transl_table=11
                     /translation="MATRVKRAFKYRFCPTDAQAAELSRTFGCVRKVYNLALAARTEA
                     WARQERVTYNQTSAMLTVWKKTEELAFLSEVSSVPLQQALRHLQGAFANFFAKRAKYP
                     RFKSKRKSRASAEYTSSAFTFRGGRLKLAKMAGPLDIVWSRPLPEGSVPTTVTVSRDA
                     AGRWFVSMLCDDPTVKPLAATDAAVGIDVGLDHLLTLSTGEKIANPRHERRDRARLAR
                     AQRTCARKEKGSANREKARRKSARIHARITDRRRDGLHKLTTRLVRENQTLVIEDLTV
                     RNMVKNHRLARAISDAAWSEFRSMLEYKAQWYGRDVVVVDRFFPSSKLCSHCGTLQGK
                     MPLHVRTWTCDCQTVHDRDVNAAKNLLAAGLAVTVCGAGVRPQRRTPGGQSATKQKTP
                     RREP"
     repeat_region   57904..57918
                     /note="17 nt imperfect inverted repeat (16/17 nt)"
                     /rpt_type=inverted
     repeat_region   57919..57920
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(58168..58824)
                     /codon_start=1
                     /locus_tag="SAVERM_48"
                     /old_locus_tag="SAV_48"
                     /product="hypothetical protein"
                     /protein_id="BAC67757.1"
                     /transl_table=11
                     /translation="MPSNNSSLRPMALRPDEFYAHARTAADGERRLPLARMTGWDISP
                     FEADGLRVAPLRPPVLPEPARHGEDPLDCNACRSRDEGIWLDDRWRLTRITGVGVPLV
                     LMLHPRDHFDLADLPDELAAELGVLTTHIARHVQALPHISRAHVYRIGDGGAHLHIWF
                     FARPEGQAQLYGSWMVIWDDLLPEYPADAAEADAAIVADALVASYGGRRPAVSELPHA
                     "
     CDS             58919..59212
                     /codon_start=1
                     /locus_tag="SAVERM_49"
                     /old_locus_tag="SAV_49"
                     /product="hypothetical protein"
                     /protein_id="BAC67758.1"
                     /transl_table=11
                     /translation="MEWWWRRTGCWRSTTPGRRIPFTSWWFPRDHAPSLIDFGAGGEE
                     LLAEVIRVVRTVAAQVEQQHGACSVMTNLGLYRESKHQHWHVVHRGEPRTEVP"
     CDS             complement(59260..61488)
                     /codon_start=1
                     /locus_tag="SAVERM_50"
                     /old_locus_tag="SAV_50"
                     /product="hypothetical protein"
                     /protein_id="BAC67759.1"
                     /transl_table=11
                     /translation="MPAMGPEADSGSTTARARPRPAPALRRTATKLRHGTGASACAGR
                     RAVRVTAASVAAFYTGLYGLHEPVTATYALFAAVAMAGLSRIPGTGRQRAAVVIRVLP
                     AGWILVTAGTLLAVHTWAAVAGMLVIGFLLAFAAAAGPRLAGAAPGLQLLYILPCFPP
                     YAPQTLGERLGGATLGILLLVLAESLLLPDPPTTSYRTRSANAAITAARCASELTHPP
                     WTLSDETRSAARSAGEALRPFHVPESQRPAGPGPRERALAHTGMAARVLLARLQEVPR
                     PGRGGPHPHTLALLLEVASSARRTAAALRTGRPAGPGRLPDALAAYRRLRTVPADSAT
                     PETTSTVMHRQAMLMEAAYAAVTLATAADLALGRRPGPTETQDGSFWYAGHSTIRLWA
                     HRLVGHLSPRSVYFQNAVRISLALAAARTVAGVDSLPHGFWAMLAALTLIRTTAAQTG
                     AIVRQALIGTLLGALAAAALLVFVKGNNTAYAVALPVIMLATFWIGPTRGVGWAQGMF
                     TLVVSTVFAQLAPATWHLAEFRFLDVLTGSVIGLVIGLLAWPRGAQEELRRDIAALLG
                     AIASTVTSTTSFLTQGHAQAQRGRPSLQHALTLAESSFAQYQSEPRRAGTPVADWQAT
                     LMAGHHALRGSRRLLEPGDPAASRWPAPAYRAELARDGAELAGQYELVATLLAGTRPP
                     PAPSGRPGPRRAEDTRPHAAPPPPVYYDAEAWLQGLTLDLDRITEATAEAVAGLPPKD
                     KD"
     CDS             complement(62242..62751)
                     /codon_start=1
                     /locus_tag="SAVERM_51"
                     /old_locus_tag="SAV_51"
                     /product="putative acetyltransferase"
                     /protein_id="BAC67760.1"
                     /transl_table=11
                     /translation="MRTASPGDLDSITDLHTLARTAYYQAGGVPDVELASPGGHSSRR
                     ESWRRAVHSSDRTVMCADREGELVGILSMGPPHEADIDAATARQLYQIHVRPGIWGQG
                     TGSALHAEFVRVLRDASLVTGVLEAWERNSRAQAFYARHGWKPDGHHRPGPGNGNYVR
                     MRLSLDPAV"
     CDS             complement(62965..63342)
                     /codon_start=1
                     /locus_tag="SAVERM_52"
                     /old_locus_tag="SAV_52"
                     /product="hypothetical protein"
                     /protein_id="BAC67761.1"
                     /transl_table=11
                     /translation="MHPIGGAGNAGVNDCPLYSVPVRIHSVTDSDARPEKTGEVVNKI
                     KKAAAVAVMVGGMALGGGAAHAAGGHGLDDPADIIIGNLQAVNCDQDFAGGAAFAPVQ
                     GISTEGNTQNIGSFCTVVGPVYD"
     CDS             63529..64401
                     /codon_start=1
                     /locus_tag="SAVERM_53"
                     /old_locus_tag="SAV_53"
                     /product="putative transcriptional regulatory protein"
                     /protein_id="BAC67762.1"
                     /transl_table=11
                     /translation="MPANINPTVRRRRLGAELRRLRKASDLTSAQVAERLLVSQPKIS
                     LLENGHRAISPRDVRDLCELYGVTDRQVIDSLMRMARESGQQGWWNTYGNIPNSVYIG
                     LETDASSIHTYEPMVIPDLLQTPAYAHAVIETTVPPIPAQQADARLKVRLRRQHRIYD
                     PARPLRLWVVLDEPALHRVVGRPDIMREQLEHLNALSAEPHITVQVLPYTAGAHPGRQ
                     GQFSVLRFADSPEAGMVYLERFTSDLYLKKPSEVQQYSMMYDHLQARALSPEGTRDFV
                     TDVTKSHIDVASRP"
     CDS             complement(64481..64588)
                     /codon_start=1
                     /locus_tag="SAVERM_54"
                     /old_locus_tag="SAV_54"
                     /product="hypothetical protein"
                     /protein_id="BAC67763.1"
                     /transl_table=11
                     /translation="MWPGARGIGRGAGRTGRGIAPLLPQGERRFSVTGP"
     CDS             complement(64632..65045)
                     /codon_start=1
                     /locus_tag="SAVERM_55"
                     /old_locus_tag="SAV_55"
                     /product="hypothetical protein"
                     /protein_id="BAC67764.1"
                     /transl_table=11
                     /translation="MTLTATVTCSADPSRVLLGLTFFDGGDILGEVSVDSSGHAQYTT
                     TFATTGTHTITAAYNGNANCFASNSMTTVQVSAAPVPPTPPGHGLCRDDCCGLINIHL
                     GGIKTSVGVDRVRSSLARWLTPRLPYPARLQGLTR"
     CDS             complement(65216..65398)
                     /codon_start=1
                     /locus_tag="SAVERM_56"
                     /old_locus_tag="SAV_56"
                     /product="hypothetical protein"
                     /protein_id="BAC67765.1"
                     /transl_table=11
                     /translation="MPRCTREPSPVTVQDSANNASRPRCARWPKWVDWAGASLGRESP
                     RRSVRLPDRLRRTFVL"
     CDS             complement(65536..66591)
                     /codon_start=1
                     /locus_tag="SAVERM_57"
                     /old_locus_tag="SAV_57"
                     /product="putative secreted protein"
                     /protein_id="BAC67766.1"
                     /transl_table=11
                     /translation="MKDSPPAAGAVRPAAVVAAVPVLTSVVPSTGPAAGNNNVTLNGS
                     GFSGVTAVLFGTKPALGYTVDSTTKITAVAPSGTGTVAVTVKTPGGTSNSVAYTYAAQ
                     PSLTSVSPSQGPSSGGTTVILTGTGLSAATAVTFGSTPAAGYTVNSATQITAVAPAGT
                     GAVPITVTTPGGTTGPVYFFYVNAPTVTSVSPGQGPASGGTTVILTGADLSAATAVTF
                     GSTPATGYTVNSPSQITAVAPAGTGSVAVTVTGPGGVSNSVIYTYVASPVLSSLVPVL
                     GPTGAGAGVTLTGSGLTTTTAVRFGAVSAAFTVLSDTTVAAYAPAGVPGPVLVNVTTA
                     GGTSNSLTYTRVAPPVI"
     CDS             complement(66803..67546)
                     /codon_start=1
                     /locus_tag="SAVERM_58"
                     /old_locus_tag="SAV_58"
                     /product="hypothetical protein"
                     /protein_id="BAC67767.1"
                     /transl_table=11
                     /translation="MPISPNQGSSGGGTLVTITGTNLTGTSAVRFGTRSATNVTNVSP
                     TTVTAVSPSGSGSVGVTVTTPGGTSNPIPFYYVGAPFKQTLSPTSGSTAGGTTVTITG
                     TGFSSATSVAFGANTVAPTVVSDSQLTAVAPAGAAGSVGVSVTTAGGTNNGLSYTYVA
                     VPTVTSVVPDEGPVSGGTSVTVTGTGLTSTSQVTFDGNPAPFTVISDTALSAVTPPGA
                     AGLVDVVVTNDAGSATATDAFTYLAGPGI"
     CDS             69136..69402
                     /codon_start=1
                     /locus_tag="SAVERM_59"
                     /old_locus_tag="SAV_59"
                     /product="putative secreted protein"
                     /protein_id="BAC67768.1"
                     /transl_table=11
                     /translation="MREENGEVMNKVKKVAAVAVMVGGMALGGGVAHASDGPDVVIPN
                     LQVVDCQQEFEGGAAFLPIQGAAAVGDNSQNIGNFCTVVGPVED"
     CDS             complement(70102..70617)
                     /codon_start=1
                     /locus_tag="SAVERM_60"
                     /old_locus_tag="SAV_60"
                     /product="hypothetical protein"
                     /protein_id="BAC67769.1"
                     /transl_table=11
                     /translation="MGSTDDARLQAVLSALWSAANVQGCFGQSDREPEEQDAVPCTVA
                     SLAEFGHLYGRVRLPTGQLVVCGCVAVRGGDESSDWLDLYVPVGALDHAGVAYWDGRP
                     FFRSAATDDWLAAVGAEAFRSASFSLGVIGFEASGCTSASTMAGRLPEERDIGYLLPR
                     GEVLHYGAANT"
     CDS             complement(70718..71920)
                     /codon_start=1
                     /locus_tag="SAVERM_61"
                     /old_locus_tag="SAV_61"
                     /product="putative IS605 family IS1136A0-like transposase"
                     /protein_id="BAC67770.1"
                     /transl_table=11
                     /translation="MGVTPGQVKRAFKYRFCPTDAQAAELSRTFGCVRKVYNLALAAR
                     TEAWARQERVSYSQTSAMLTAWKKTEELAFLSEVSSVPLQQTLRHLQSAFIHFFAKRA
                     KYPRFKSRKKSRRSAEYTASAFCYRDGKLTLAKMSGPLDIVWSRPLPEAAMPSTVTVS
                     QDSAGRWFVSLLCEDPSVRPLPATDTAVGIDVGLDHLLTLSTGEKITNPRHELRDRAR
                     LARAQRSLARKARGDGANRRKARIKVARIHARITDRRRDGLHKLTTRLVRDNQTLVIE
                     DLSVRNMVKNRKLARAISDAAWSEFRSMLEYKAQWYGRGVIAVDRWFPSSKLCSHCGT
                     LQDTMPLNVRRWTCGCGTTHDRDVNAAKNLLAAGLAVTVCGAGVRPQRRTPGGQSATK
                     QKPSQREP"
     CDS             72189..72680
                     /codon_start=1
                     /locus_tag="SAVERM_62"
                     /old_locus_tag="SAV_62"
                     /product="putative transmembrane transport protein"
                     /protein_id="BAC67771.1"
                     /transl_table=11
                     /translation="MGKLTVRALRAVLVVVLTGTLFVQAGMVWALVSGSDPEDGSLPL
                     TPLRVITILGMVSVQVALVCVWRLVAMVRRGTVFSHAAFRYVDGVIGAIVAAALVWFA
                     VTVINAPGQRDDPGVTVIMGGIGLAILGVALIVLVLRMLLAQAVARDVQAAHMQAELD
                     EVI"
     CDS             72680..72901
                     /codon_start=1
                     /locus_tag="SAVERM_63"
                     /old_locus_tag="SAV_63"
                     /product="putative transcriptional regulatory protein"
                     /protein_id="BAC67772.1"
                     /transl_table=11
                     /translation="MPIAVDIDVMLARRKMSVGELADRVGITPANLAVLKNGRAKAVR
                     FATLAALCEVLKCQPGDLLRWEAEDAAGG"
     CDS             73063..73698
                     /codon_start=1
                     /locus_tag="SAVERM_64"
                     /old_locus_tag="SAV_64"
                     /product="hypothetical protein"
                     /protein_id="BAC67773.1"
                     /transl_table=11
                     /translation="MSACAVWPQATQWNFSCAGRFPLAVCPHSGHSREVLRGLTAITS
                     RPALSALACRIVRNTPQPASLTDLLSPALAAAPLGRKAPARPGSDYGAGALLMVRILR
                     SSCAMKSALRTQYDAPVISHRAGSPGQLLVIACTVVALVTAPLSWYAAHTVRPDCVVA
                     ISKVTDGNGHHLPDVNGRVWSDNELADRAYQQAVDSGRCDPPHARWRQWLD"
     CDS             74098..74520
                     /codon_start=1
                     /locus_tag="SAVERM_65"
                     /old_locus_tag="SAV_65"
                     /product="hypothetical protein"
                     /protein_id="BAC67774.1"
                     /transl_table=11
                     /translation="MTDDAYLFLLDDPAVPLGVPPSVAGELSCMDTPAVRAWLDAQGV
                     TTTSPALRILPPEQTAAIPEQAERLPVPLSEAELSRLRHHNAPEAVARLEEELLAYRD
                     CTDGRDTLLRRALAAGIPLARIVELTGEEPAAVAASSG"
     CDS             complement(74429..74899)
                     /codon_start=1
                     /locus_tag="SAVERM_66"
                     /old_locus_tag="SAV_66"
                     /product="putative IS605 family IS1136A0-like transposase"
                     /protein_id="BAC67775.1"
                     /transl_table=11
                     /translation="MVPTEVRPLPKTSRVLGVDWGVKETATTTSNAHDLPHAQHGRKA
                     QAGLTRYDRMRARRRPKKGQAASKGYREAKKWRAKTYAKIARQRQDTGRKWAKKVVTD
                     HDAIAVEDFRPKCGACQCWRPRTVFTRRRRPRPPVPHPSVPRCAPGEFRPQGPA"
     CDS             75600..76676
                     /codon_start=1
                     /locus_tag="SAVERM_67"
                     /old_locus_tag="SAV_67"
                     /product="putative regulatory protein"
                     /protein_id="BAC67776.1"
                     /transl_table=11
                     /translation="MHDHAGGAEAVPRCVSAGGCQDGWDHRVMTLCSRDVPAAERFSW
                     FCELVARDMAPHDIVTEHVQDFSASATLLSLGEGIGVSSVAFPAMQSIRSRRLIRRSD
                     PELWVLALVVKGAMQREQGRNQVNPRPGDLVLYDSSQPYWASIATDDVAQSIVLHLPR
                     RTVPVPEQALRRMVATALPSRTGIGALLSQLLGGLVEQGPKLEAGQTGRVASAVVDLT
                     TAFLAGLSGADGPQTTAARRVAQLHQIKSFIRSRLGEPGLTPTAVAAAHHISLRALQY
                     LFREDGRTVGAFIREQRLERCRAGLADPRLAGHSVAAIAVRAGFCDAAAFSRAFKARY
                     GMPPGEYRRHCGGPPSQGRAGHTG"
     CDS             77069..78430
                     /codon_start=1
                     /locus_tag="SAVERM_68"
                     /old_locus_tag="SAV_68"
                     /product="hypothetical protein"
                     /protein_id="BAC67777.1"
                     /transl_table=11
                     /translation="MHLASGAPLEPIAGDDTGGTYFLCGATAVLHASSEGDAVLLADS
                     VGEALEILVRLPWWCENISAELDEEDLLAEVRAADHAAREEFAPELDAQRAALISGLG
                     LPDRPLAELLAMSQSAAGRTEPDHVLLNSRELCAYRLEESFRQPLRDVVLGPGREVLE
                     RMRRGGLGAREEAAGDPVLRAGVLRAAQYDRRDGDLPLLRLLLEHESAARTERFEERR
                     LAAVLVALHGREGDVSLLRSATGGQVTDSAEAVEWARAEEAKRYGRDVAAESEFTWIE
                     LARRQGRIERARVALIRMLDDTGPDADRLRELSRALERIGDYAQAARAQFNLLSLQDT
                     AWDRASEAYVLARLERRRGDLVAAGRALERARAAVGAGGTTPGGADCQWHRRGLGRLI
                     TEQHLELTLAAAEAGDAELARATMGHGRLLLDTVGKESAKALSRLSTRAKWAVAGLRP
                     PGA"
     CDS             78733..78972
                     /codon_start=1
                     /locus_tag="SAVERM_69"
                     /old_locus_tag="SAV_69"
                     /product="hypothetical protein"
                     /protein_id="BAC67778.1"
                     /transl_table=11
                     /translation="MATTHADALRSQRGIWIDAGTRDEWFLDLGALAFRDALTEAGVA
                     DDIVHFELFEGGHHAVEYRMPPALAWLAHRIADRP"
     CDS             complement(79005..79262)
                     /codon_start=1
                     /locus_tag="SAVERM_70"
                     /old_locus_tag="SAV_70"
                     /product="hypothetical protein"
                     /protein_id="BAC67779.1"
                     /transl_table=11
                     /translation="MNRSGSRDAFRSPDAQEVPSGGVDIPVRTETWTSSNTRFGAAPG
                     RTGPHRAGLGPGALRKGRHRGGDPSESVLADLAGVCAERRY"
     CDS             79425..79850
                     /codon_start=1
                     /locus_tag="SAVERM_71"
                     /old_locus_tag="SAV_71"
                     /product="putavie cyclase/dehydrase"
                     /protein_id="BAC67780.1"
                     /transl_table=11
                     /translation="MSASLVETVDIEAPVAVTWALWSDVSRWPSFLSHVRLVEPLDER
                     RFAWQLSLPGADKNFVAELTEVIPGDRIAWQTTEGVHHAGVVTFHRLSDTSSRVTLQI
                     EYDPKGFVEHIGALTNLDSTLANYDLGEFQKLAETAAAG"
     CDS             complement(80560..82215)
                     /codon_start=1
                     /locus_tag="SAVERM_72"
                     /old_locus_tag="SAV_72"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAC67781.1"
                     /transl_table=11
                     /translation="MTDVPNGRDPNGRDPNGRRALVPASPPGMLRRLQRARLLPRSVR
                     VLRSLRVLPRSVRARSALAAAFAAAVLFTSGALLMRHQLYDERLRATSSVAQQQVTTL
                     LSATANSSISGPWGAPYEIVAGDGMLLASSPELEPYEKDGHAFLTGPGRGGSLPLYTR
                     RRFTFPAVAEPAARSLSGQTLTTVEGTVPASYLPGETQGRGVAAGARVRVYVLIVPDD
                     AERAVGELDRELVVAVPLATALVAGVAWLATRRALRPVEAIRARTASVTAADPRERVE
                     VPDTADEVAELALTINATLQRLEEAATAQRRFVADAAHELRSPLATLLAGLEVATAYP
                     DRADWPAVVSAAGRQARRLSGLTEELLLLARLDAGAPPAPAERVDVAALAGRLSEEYA
                     ERAGGSPKVDLLVAAPDAATTVFAAPGDLERILRNLLDNALRHAVGRVLLTVARDSAA
                     PGSVLCTVRDDGAGVAEADSERIFERFTRLDESRTRTDGGTGLGLAIARDLAARHGGL
                     LVLAVQPKGSGACFVLRLPAGDPMSIRPRPFKGRGRSARSQRL"
     CDS             complement(82208..82954)
                     /codon_start=1
                     /locus_tag="SAVERM_73"
                     /old_locus_tag="SAV_73"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAC67782.1"
                     /transl_table=11
                     /translation="MRILVVEDERELAQTLRLGLTAEGYRVDVAHDGREGLWKARTGD
                     YAVVVLDLMLPLLNGYRVCAQLRREGITTPVLVLTAKDGDWDQAEALDTGADDYVTKP
                     FTYLVLVARLRALMRRARGAASPLLAVGDLVLDVAARTCLRSGVAVPLTPREFAVAEV
                     LARRPGEAVTKSEILHHAWPDEAEDLNLVEVRVSALRRKIDTAFGRQSLLTVRGVGYR
                     LVDDRGETEEDAVQEPPAGRWDGAGRNSGD"
     CDS             83059..84600
                     /codon_start=1
                     /locus_tag="SAVERM_74"
                     /old_locus_tag="SAV_74"
                     /product="hypothetical protein"
                     /protein_id="BAC67783.1"
                     /transl_table=11
                     /translation="MLGAPAHRAASAAPVIRRTKGPDMPTRLTALLSPSRPSRPSRDD
                     AAGPVAGTARPARGAGWATALSLALVCFVTYAALSVRLHQRMLTTGYDLGIFEQAVRS
                     YAHGHLPVAELKGPGFPLLGDHFSPVLALLAPLYRVWPAPVTLLVAQAALFAVAVIPL
                     ARWAEEVRGRRAALVVGLGYGASWGVAQAVGFDFHEVCFAVPLLALSLTAVGRGRARA
                     AALWALPLLLVKEDLGLTVAVVGLLIARTGERDDRRRGGALVLAGVLGSFLEMLVVIP
                     AFNPGGTFAYSSSVPGAGSATPGAGELLLHYTVGLVTPDTKAQTVLALLSVTGFLAVR
                     SPLLWAALPTLLWRFASDNQAYWGTGYHYSAVLMPVLFAAFVDALTRPGPVRYALAAS
                     AAVTVLLLPQFPLWQLTQPATWHTDSRLASARRLMDRIPDGATVAASNRLVPQLTNRA
                     RVSVFGLGGSRPDAEWIIDDSAQPQGWPIAPDDDRRLLSEVRNNGRYRTVADQDGYVL
                     LQRRP"
     CDS             85042..85431
                     /codon_start=1
                     /locus_tag="SAVERM_75"
                     /old_locus_tag="SAV_75"
                     /product="putative endoribonuclease L-PSP"
                     /protein_id="BAC67784.1"
                     /transl_table=11
                     /translation="MLTHIPPDGVAPGNGYSHVVVGEGRLVVISGQVALDEKGNVVGK
                     GDAAAQARQVFENLRRCLAAGGATFAEIAKFTFYVTDVAILPEVRAVRDAHIDTARPP
                     ASTAVQVAALYRPELMLEVEALAIIPW"
     CDS             86073..87080
                     /codon_start=1
                     /gene="ams"
                     /locus_tag="SAVERM_76"
                     /old_locus_tag="SAV_76"
                     /product="avermitilol synthase (sesquiterpene cyclase)"
                     /protein_id="BAC67785.1"
                     /transl_table=11
                     /translation="MPQDIDFGLPAPAGISPGLEATRRHNLGWVRRLGLVGDGPSLAW
                     YTSWDMPRLAACGFPHARGAALDLCADAMAFFFVFDDQFDGPLGRDPARAARVCRRLT
                     GIVHGAGPGPGADACSAAFADVWARSTDGAHPGWVARTAHEWEYYFAAQAHEAINRLR
                     GTPGDMESYLQVRRGIAGTDLPLSLGERAAGITVPAAAFHSPQLRIMREAAIDVTLMC
                     NDVYSLEKEEARGDMDNLVLVIEHARRCTRDEAVTAARGEVARRVIRFEQLAREVPAL
                     CAQLGLSAVERAHVDTYLGVMEAWMSGYHAWQTQTRRYTGAPHVLPSTGPGYFDEVLP
                     T"
     CDS             complement(87168..87629)
                     /codon_start=1
                     /locus_tag="SAVERM_77"
                     /old_locus_tag="SAV_77"
                     /product="putative rRNA methyltransferase"
                     /protein_id="BAC67786.1"
                     /transl_table=11
                     /translation="MRALRSTARAHERAAAVTWVRPFPLADQLADVVLDVFAPRNPSE
                     FHRVLRPTGRLVVVRPTGRHLAELRGQVPALVTIDPAKEQRLFTALTPFFETSRTEQV
                     EYATFLTRTQALDLVGMTPSARHLNRADLAGNGLLPDQVTVSVLATAYRPR"
     repeat_region   87683..87686
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  87687..89851
                     /mobile_element_type="insertion sequence:ISSav12"
                     /rpt_family="ISL3 family (ISPpu12 group)"
     repeat_region   87687..87703
                     /note="17 nt imperfect inverted repeat (16/17 nt)"
                     /rpt_type=inverted
     CDS             complement(87716..88276)
                     /codon_start=1
                     /locus_tag="SAVERM_78"
                     /old_locus_tag="SAV_78"
                     /product="putative IS982 family ISCef3-like transposase"
                     /protein_id="BAC67787.1"
                     /transl_table=11
                     /translation="MCGWSTPHRSAAVAPVRLAGWAQYGYCASHSRYFWGLRLHLVCT
                     LGGLPVLFALTGADERETLRDMLDTAPDVLAAHPGQTIIGDKNYFGREFERGLAERHL
                     KLLRPARKGEAELTGSHLFKPLRQVIESINQTFKGQLNLERHGGKSPAGVSARVLCRI
                     LALTAAIWHNDQTGQPIKRSLTAYGH"
     CDS             complement(88693..89640)
                     /codon_start=1
                     /locus_tag="SAVERM_79"
                     /old_locus_tag="SAV_79"
                     /product="putative ISL3 family ISPpu12-like transposase"
                     /protein_id="BAC67788.3"
                     /transl_table=11
                     /translation="MGDMDVTTLYSIGELSRRTGLSVRTIRFYSDSGVVAPTTRSPAG
                     YRLYDLDALLRLELLRTLRELGMDLPTIQRVLDRELSVAEVAAAHADAMDVQIRTLQL
                     RRSVLRVVASRGSSPEETKLMHRLTQLSGEERRRLIDDFMDGTFGTVDADPAAVAMVR
                     AATPDLPDDPTGEQVTAWVELAELVGDEDFRARMRRTAVRQAAGRPLDIECDAGEELM
                     EFTRQKVAEAMEAGIDPLNDRGAPVIDDLVHRFAEVLARTPDTEFRDWMAQQFEETHD
                     PRVDRYWQLVWIVNGWHVVPNLIPVYPWLIQALRNSRDA"
     repeat_region   89835..89851
                     /note="17 nt imperfect inverted repeat (16/17 nt)"
                     /rpt_type=inverted
     CDS             complement(89844..90179)
                     /codon_start=1
                     /locus_tag="SAVERM_80"
                     /old_locus_tag="SAV_80"
                     /product="putative rRNA methyltransferase"
                     /protein_id="BAC67789.1"
                     /transl_table=11
                     /translation="MPVSLSPALEPFLDLLRCPTCRTGLHLGHGALRCPAGHTFDIAR
                     HGYVSLLTGTRATSGDDAAMARARDRFLSTGSYGPIRQAVARLAADAMPEQGTVLDVG
                     CGTGYYLDD"
     repeat_region   89852..89855
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(90422..91192)
                     /codon_start=1
                     /locus_tag="SAVERM_81"
                     /old_locus_tag="SAV_81"
                     /product="putative oligosaccharide deacetylase, secreted"
                     /protein_id="BAC67790.1"
                     /transl_table=11
                     /translation="MARHGGRGWYGRVLAAAVGVTALAAATSVWTAQAGPVDGQHSAR
                     PAAPGSGTGRAPVSADIAHASDHGAQGVNITIDDGPDPIWTPQVLQVLRENGVKATFC
                     MVGTQAQAHPDLVKAVVAAGHRLCDHTVSHDTTMDTKSHSYQSRQILDAERMITKASG
                     GVRPLYYRAPGGAFTPYSRHLAASRGMRPLGWNADSKDFERPGADAISATVKNEIPHG
                     PTILFHDAGGDRSQTVAALRELLPWLKQQGYSFGFPVR"
     CDS             complement(91736..92317)
                     /codon_start=1
                     /locus_tag="SAVERM_82"
                     /old_locus_tag="SAV_82"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC67791.1"
                     /transl_table=11
                     /translation="MAGTGRVGLTTERLVRAGAELADEIGFEQATPAELARRFGVKTA
                     SLYSHVKNAHDLKTKIALLALEELADQVSTAVAGRAGKDALTAFANAYRDYALIHPGR
                     FAAAQFRLDPQTAAASAGVRHAQMTRAILRGYHLAEPHQTHAVRLLGSVFSGYVGLES
                     AGGFSHSAPDSKESWTEILNALDALLRSWPTAS"
     CDS             92523..92741
                     /codon_start=1
                     /locus_tag="SAVERM_83"
                     /old_locus_tag="SAV_83"
                     /product="hypothetical protein"
                     /protein_id="BAC67792.1"
                     /transl_table=11
                     /translation="MTEPDGRPAGVRLCSSGGGAGAGQMCRSRCSVCVATGTGGVCLT
                     AAARSGKAGQQGSSAGICMGIDLACLLL"
     CDS             complement(92939..94183)
                     /codon_start=1
                     /locus_tag="SAVERM_84"
                     /old_locus_tag="SAV_84"
                     /product="hypothetical protein"
                     /protein_id="BAC67793.1"
                     /transl_table=11
                     /translation="MATGIKDTAHAVEAAAVMRLLPARPRLLALGEPTHGEDTLLGLR
                     NELFRQLVEQEGYRTIAIESDCLTGLAVDDYVTSGTGTLDEAMEHGFSHGWGTFAANR
                     ELVRWMRAYNVRAANDGRPACERLRFAGFDGPLEITHAASPRQALTALHSYLATRVDT
                     NLLPCTATTLDHLLGTDDRWTHPAAMTDPAQSAGQSAEAGRLRLLADDLVALLDAQTP
                     HLTTATSRDDWDRARLYGRTATGLLRYHYWMADTSPARMTRLVGLRDQMMAHNLLALA
                     ARGPALIHAHNSHLQRAKSTMRMGGIPLEWWSAGALVSARLGEEYAFVATALGTIRHQ
                     KVDTPPPDTVEGLLYALPQDRCVIDAPRLATALGDTRPAPRVSPWFGYAPLDPAHLAD
                     SDGIVFVKDVVQSRPRLFSKTG"
     CDS             94242..95009
                     /codon_start=1
                     /locus_tag="SAVERM_85"
                     /old_locus_tag="SAV_85"
                     /product="putative MerR-family transcriptional regulator"
                     /protein_id="BAC67794.1"
                     /transl_table=11
                     /translation="MGRNLQSGERLRPVDLARGHGLSTQAVRNYEEAGILPAAGRTPH
                     GYRTYTSLHAGALRAFLALVPGHGHRTAASIMRAVNEGAVDEALRLIDESHAQLLDDR
                     RTLQAVESALRDLEPTTGSGPGGGSGPAAGSGSGSGGTFIGPLAHKLGIRPATLRTWE
                     RAGLVRPRRDPLTGYRVYDEADVRDARLAHQLRRGGYLLEQIAPLIARVRAAGGLEPL
                     EAALRDWHGRLSARGRALLAGAAGLEAYLHERRKTRS"
     CDS             complement(95110..96105)
                     /codon_start=1
                     /locus_tag="SAVERM_86"
                     /old_locus_tag="SAV_86"
                     /product="putative erythropoiesis-stimulating protein"
                     /protein_id="BAC67795.1"
                     /transl_table=11
                     /translation="MLTTLGLDTAAETVYRTMLMHPQAGVAELAVHLEVPEGDVRDAL
                     DMLSELALVRMSAEDAGRLRAVSPDIGMEILMARQQAELAAQQQRVEASRAAAAQLIS
                     EYSELRPATRHPEVEQLVGLDQIRDRLTGLTREVSEELLTFAPGGPQTADNMAASRPL
                     NGDLLGRGVRMRTLYLDSVRTDRATVEHARWLTSLGGQVRTVPALPTRLILMDRKTAL
                     ISVSSDDTAAGAVVLTGQGTLTALHALFETTWAGAQPLGDTVPVDRHGLTGQQATVVR
                     LLAEGHTDETIAKRLGVSPRTARRIASELMERLEARSRFEAGVRAVQRGWLPARA"
     CDS             96235..96567
                     /codon_start=1
                     /locus_tag="SAVERM_87"
                     /old_locus_tag="SAV_87"
                     /product="hypothetical protein"
                     /protein_id="BAC67796.1"
                     /transl_table=11
                     /translation="MPVCWDGRGMYLVHIHLEFPPRTQLPFGARDMIRAALTADDLVE
                     HVAVHPRSPSRLTLGFYLLAARLEEAEERAARVSRRLAEDVPVLRGARLRGAGVPLVP
                     LAFERTPG"
     CDS             complement(99274..100050)
                     /codon_start=1
                     /locus_tag="SAVERM_88"
                     /old_locus_tag="SAV_88"
                     /product="hypothetical protein"
                     /protein_id="BAC67797.1"
                     /transl_table=11
                     /translation="MTTQPLRTERSGPQTASLVTDLPFKPQLVKAVFRDVTSLHVSRP
                     AAWAAASVTRTVLTEIIDGARSAAAEEARKRLIPKDLISAIDRNVEVEVGSAWYLHSP
                     TFHGLMGEVRNADGALVSLRERRGARTPSGVAGAHRFEAGVRRLLASRGVRAVPAMVR
                     DLDGIVSVFLTALARDAAKVVREGGVKRFGTVSLVVPGEPAPAPLLKDPLLALSTRRG
                     DGRTVGGDDVLAAVTMQLFGDLRQRAITEAAEMTRNTSAN"
     CDS             complement(100279..100866)
                     /codon_start=1
                     /locus_tag="SAVERM_89"
                     /old_locus_tag="SAV_89"
                     /product="putative secreted protein"
                     /protein_id="BAC67798.1"
                     /transl_table=11
                     /translation="MRLHRVAPGIAAGILAPALLLATPSFAATAAPTAVTVPAVSSSA
                     NEPDADDLRVAIVRILADPDSGQRVTREANALLDANDPEAMRAWLETGYRIAQAEDDR
                     VAITRLLADPDSGRRVIAEVNALLDANDSDAIRAWLETGYRIAQAEDDRVAIARILAD
                     PSISPALRAAANAALDDNTPEALRHFLEVGRYQVA"
     CDS             100955..101362
                     /codon_start=1
                     /locus_tag="SAVERM_90"
                     /old_locus_tag="SAV_90"
                     /product="putative hydrolase"
                     /protein_id="BAC67799.1"
                     /transl_table=11
                     /translation="MAVAPLRSQGTVAADVAGVSWRRAFEKGGLERGSWLSGHDRARR
                     FLGAVVVWSERVVGRDGVRLVCRDRGGPGEPVVLLHGLAGHAGEWEVVASRLIARYRV
                     VAVDQRGHGASERHPYAPTSTSACSNSPAASSA"
     CDS             101447..101893
                     /codon_start=1
                     /locus_tag="SAVERM_91"
                     /old_locus_tag="SAV_91"
                     /product="hypothetical protein"
                     /protein_id="BAC67800.1"
                     /transl_table=11
                     /translation="MLEAAQGAPASSGRRTRRPGLSEEVLRAYAYACAFCGYDGMLGR
                     NPVGLEAAHIRWHSQDGPDTLANALALCALHHILFGLGVLGLSPGLRIQVSPLYVARS
                     HAGHAVGILHRRPLAPPRPGHPSPGPEHIHWHHQQVFKHAPTPVAR"
     CDS             102549..103163
                     /codon_start=1
                     /locus_tag="SAVERM_92"
                     /old_locus_tag="SAV_92"
                     /product="putative lipoprotein"
                     /protein_id="BAC67801.1"
                     /transl_table=11
                     /translation="MTLPSRRAFTAAAMASLLVGCAGPGAGQATTAARPGRTPSSSRA
                     AAKPAHALGRSVPVGLQIPAIGVDTPLLRLGLAADGSVQVPPVTAHDRAGWYRHSPTP
                     GQRGPSVILGHVTVGAYGDGVFRHLARLRRGERIVARLENGTAAVFAVTAVRTVPKAD
                     FPADAVYGDVNRPELRLITCGGPRNGDGYLDNVIVFAALSSASP"
     CDS             103255..103746
                     /codon_start=1
                     /gene="sig2"
                     /locus_tag="SAVERM_93"
                     /old_locus_tag="SAV_93"
                     /product="putative RNA polymerase ECF-subfamily sigma
                     factor"
                     /protein_id="BAC67802.1"
                     /transl_table=11
                     /translation="MKRSRERAASELFAALYPRLAGWCRRLVDDDETAHEIASEAFTR
                     LWARWTSVAEPRGFLYVTAANLVRDHWRKLERERRAVHRVTAEAALRPPSEQADPSVR
                     LLVQSLPERLRVPILLHYYADMPIREVSVLTGRKEGTIKADLHAARELLRAHLRRSLD
                     HTL"
     CDS             103709..104197
                     /codon_start=1
                     /locus_tag="SAVERM_94"
                     /old_locus_tag="SAV_94"
                     /product="hypothetical protein"
                     /protein_id="BAC67803.1"
                     /transl_table=11
                     /translation="MPTSGEALITHSDDGPDFEPDDPLAVILRPPSDYLGPPAGRYEA
                     IRRGAARRRLLRAAAGAGLACAVAALIALPLHLATPGAPPSPTVPLAPPPASSSPTAP
                     APPASPEPVSPSPSAGSRTQSATTTPTRAAVPTRAPSATPASASLAPSAPAATPESST
                     RP"
     CDS             104696..106234
                     /codon_start=1
                     /locus_tag="SAVERM_95"
                     /old_locus_tag="SAV_95"
                     /product="putative secreted protein"
                     /protein_id="BAC67804.1"
                     /transl_table=11
                     /translation="MLRSPDGRVRVALIRTLRPLAVLAATAALFAGITDLPAAADGTA
                     VTKLTLGTDQFKMTDTNYESATNNLYNNVLTNHANLTDVVTTDYTKNSSGATDAWMNL
                     RSMRACAGSETQALPPVNKKVAWCWSSAHADDTTPRWFPQGMSTTGTADGGDGAIQGK
                     HVSAVAWHYKTFKTNSAGDLEANDGCKTNNLLKVSFIDRDTGKYRHVLLAEPTSTSSS
                     ASNFKFVTGHGGGIVWYANYLYVTDTANGIRVFDINKLAKVDTYGSGLNSYGVSGGNS
                     SACGYPYVLPEVHYYKQASTPASCSTNAVDGTPDADALCYSWLSLDKTGAGPFKLVTG
                     EWYGNVAGGRVVRYQLNPTSASAYPGLLNMSGGKTVIQDAYAASGYQGLQGGMTWTDD
                     AGLLNFAFSKGCGTKPAVFSHTWAGDTRAVTSCAAGGNWAVGSPQALSYWPKLDTAQV
                     DELWGLTEGICAGTSLRASYPYEFPAVSESGNACTGYNSSDNLSLRSVFAVGFTDPAV
                     QNLH"
     CDS             106628..107440
                     /codon_start=1
                     /locus_tag="SAVERM_96"
                     /old_locus_tag="SAV_96"
                     /product="hypothetical protein"
                     /protein_id="BAC67805.1"
                     /transl_table=11
                     /translation="MAGQDVRGILPEGLGAAVRDTAEEIAALLRGGADMGRGVPGSQW
                     TVGQAAAHLAQAGELMADIAAGRARSWGDGTPQSLAAANERALAAFGERRAEPLAAMI
                     VAQADACVTALEESAAGAALVSPLGPMGPGVLGSYLLTHMLGHGYDLARALGCAHMID
                     RARVELTLPFLITAMPRVSEPARTAGLSASYAIRLWGGGRFGVRVAGGAVAVGPRPPD
                     RPDCTILIEPVTFLLMALGRRGQWSAIAQGRILAWGRRPWLAPRFPALFTAP"
     CDS             complement(107491..108027)
                     /codon_start=1
                     /locus_tag="SAVERM_97"
                     /old_locus_tag="SAV_97"
                     /product="putative secreted protein"
                     /protein_id="BAC67806.1"
                     /transl_table=11
                     /translation="MLSDLSPVIAASARWLLSAFPPAAGPLNDALAEAQAQHAATIAA
                     ALRYPTALDAELLNLLGPGGSGALDHVTGAAAHPLTDAAPAWRTQVDETVVSWAACLL
                     ADPALAAVAAACLAATHHGANGVGDARRLTIPSPRDHRAAPLLRHPDLLGPIADLHRE
                     SLLGLLHPGPALTSPGHR"
     CDS             complement(108349..110238)
                     /codon_start=1
                     /locus_tag="SAVERM_98"
                     /old_locus_tag="SAV_98"
                     /product="putative glycosyl hydrolase"
                     /protein_id="BAC67807.1"
                     /transl_table=11
                     /translation="MAEARNTTEARARDGARGSPGVPFGAGPLRYLPIAEHGLIGDLR
                     SAALVGTNGTIDWYCCPRFDAPSVFASILDAERGGSFELAADVVARTKQFYFPDTNVL
                     ITRFFADEGVGEIQDFMPVVDDSREADRHRLIRRVVCARGALPFRALIAPRFEFGTAP
                     HTVQVQDGQALFESSSLRLALTSTVPIEVAGQDVWSLFKLHEGESAVFTIDRIGGDVT
                     PRFCAVAEAEREFNATVRYWRHWLSRSRYRGRWREMVHRSALTLKLLTYAPTGAIIAA
                     PTTSLPEQIGGERNWDYRYVWIRDAAFCVYAMLRLGFTDEAEAFMGFLSEYVRIEETQ
                     APHLRGPLQIMYGIDGRRELPERELPHLEGYRGSAPVRVGNAAVGQLQLDIYGALVDS
                     LYLYDKWGKPLSSAHWDSISELVDWVCDHWDQPDEGVWETRGGRKTFLYSRLMCWVAI
                     ERAMRLAQHRGLPADMVRWGCARDDIYRRIMRHGWSAGRHAFTQYEDSDILDASLLMM
                     PLAKFISPTDPKWLATLDALGEDLVSDSLVYRYDPQASPDGLQGEEGTFSICSFWYVE
                     ALTRAGRLDEARLAFEKMLTYANHLGLYAEEIGPTGEQHGNFPQAFTHLALISAAFNL
                     DRVLG"
     CDS             110830..113364
                     /codon_start=1
                     /locus_tag="SAVERM_99"
                     /old_locus_tag="SAV_99"
                     /product="putative integral membrane protein"
                     /protein_id="BAC67808.1"
                     /transl_table=11
                     /translation="MFCWIGEAATRRPRLVLFGAFVFLVLCVALGAGAGGRLKTQGYD
                     DPRSDSSFAARVTAEHLGAAPNLVVVVQVPGGFVDDAAAQRAGEDLTRRLAAQPQVSA
                     VSSYWRGRAAELRSRDGRSAMLLAHVDGTGEELGGRVKRLREALTAAGPYTGGSSAPG
                     PSTAGPSTPGPSAAGPSAAGSSTGGSPAGGSSARAAAKGMPALKVHVGGPALVDAELQ
                     DLSESDLKRAEAVVLPGTLILLVLVFGSVVAALLPLLIGVLSIAGTLLVLSVLGRVTD
                     VSVFALNLTTVLGLGLGIDYGLLIVSRFREEITGGHSARDAALRTVRTEGHTIVFSAA
                     TVCAALATLLVFPPYFLRSFAYAGIAVVAIAAVAALTIMPALLTLLGKRVNAWPVPWR
                     RRVQAGCASRWWEALARRVVRRPVLAAVPVIGLLAVLAAPFAHAGFATPDDRALPAGS
                     FSRQAGDLVRGEFGTRSAGALTVFTTSATPQVALDYAPRLSALPGVAQVVGPFGVYRD
                     GRQVAASGPGQAGPSGTDRAAFHSVVPSADPRSGAAQRLVRAIRAMPTPADTHVHVGG
                     PSAVLVDAKDTVAGRLPLALAVITLTTSVLLFGFTRSVILPLKAIALNALSLAAVMGA
                     MVWVFQTGHLQSLLGFTPGPLSTTMPVLLFCIVFGLSVDYEVFVLARIKEAHDAGQDT
                     AGSIVTGIARTGGIVTTAGALLAFTLLSFGTSQVSLLQFFGIGAGLGVLLDATLVRGV
                     LVPALMRLAGGWNWWAPRGLRRDRPARNGPPVTGDPPARRAPPPPPARHAPPTPPVPP
                     VPQVSQASQASQAPAGAGPAVPPVSSPSRRTPDVSRSSHPTQEGLS"
     CDS             113361..114866
                     /codon_start=1
                     /gene="pks11-1"
                     /locus_tag="SAVERM_100"
                     /old_locus_tag="SAV_100"
                     /product="putative polyketide synthase (type-II KS)"
                     /protein_id="BAC67809.1"
                     /transl_table=11
                     /translation="MTDNATDNATGIAIVGLGCRFPGAGDIQAYWKLLLSGQRQFSAV
                     PANRWNHDTFHEPGRRRGGHAAYTDQVAFLDGVERFAGLHYGLPPARVRAMDPQHRLM
                     LDVTREALDDAGWGRGGFDRENTGVFVGISVSDYKDLMTARIRAVSLADGSIGGATDP
                     RILEAFRERAEELSTIHSFTLPGSLLNMAPATVSRQFGLGGPSFAVDAACSSSLIALE
                     TAVAHLRQGTCRIAVVGGAYLSLTPDGLVGFSQLGALSATGVCRPFDKDADGFVLGEG
                     AGSVVLRPLPDALADGDRVYAVIKGIGSANDGASPEPLAPTPEGQLRAMRRAYADARV
                     TPSSVGFIEAHGTGTRAGDRAEAQALRRLRTEYPDDDPALCYLGSAKALIGHSLSAAG
                     IAGLIKTALVVHHRTIVPQPDTTPHPDLGIEAAGLRFAPAARPWPSSGGPLRAAVSSF
                     GFGGTNVHVVLTPPPAPLGHAAGTAEVRPRATHRSLAPNPAPGTAPNPTSC"
     CDS             114860..118594
                     /codon_start=1
                     /gene="pks11-2"
                     /locus_tag="SAVERM_101"
                     /old_locus_tag="SAV_101"
                     /product="putative polyketide synthase (type-II AT +
                     aminotransferase)"
                     /protein_id="BAC67810.1"
                     /transl_table=11
                     /translation="MLISAGSPRLLDGQIGELLDFLDRSPGTPPAAMAHTLGGREMLT
                     ARLAVVAATPDELAGRLRRARRQLADGVRGDLGDGAFAADAPLPPEQRRIAFVFPGQG
                     SQRPAMMHDLYQRSGLFRAALDTLGAPAREHTGLSPAQVLYGQRASTPPGDAQLRQRP
                     AGTDVCQPLLGSVQIAATRLLAACGVSPDLTLGHSAGEFAAAAAAGALTDEDTVRLLA
                     HRGAALAQAETGARGGMLAVQSDKETCRRLVHGIDDVWFACFNHPRQVVVSGTVQGLA
                     ALRRACAAAKVAAVTLEVSNAFHSPRLASAEAAMRADLARRPVTRPPVAFVSCVSAAL
                     CSDPAELRELWARHACAPVRFEEAVRSAYAHGARVFLQVTGNRSLLASVRRSLAGHGD
                     VRLAGTDGPAPDSGRGFLQALAHLAVLGAPVDPRALIPQQDRRLLDLPVARLDTQSYW
                     IRQPRRPATPVNPVNPVNPVNPVNNEAPTAGVPLRPAPFGPCGAPRTEQPATGRTTAG
                     ETTGEATGETTGQTAGEADGQADGPATWQATGQEVLHEALTLLREQGALLTRLSEALG
                     THHATGPAAQSEALPIASTAPAASAPPAPAASGIPAVPAVRCAPPADDDPAAASADAD
                     RPAARNITDITQIREAAEATKVSEATEATEAGEAAEAAEAAETVFAHVARISAFPISH
                     LHGRQLLTDDLGFDSLMLTDLFASLKRQWPFLTIDEKTYDRPTVEGLITMITDGSADT
                     APLTAPRTRPTGRREAADALAAPQAVTEPNAEPNAGPGAGPGAGPDAGPDGDALPDPP
                     AVGPHAVPPTRTGLHAVPPAHTGLHAVPAARTGPATAGLPEQQTQIECFPEVTAHNER
                     LATYSRLGLPNPYFVVHERGMTDTTVVGGRELLSFSSYNYLGMATHPQVNEAARKAIE
                     RCGTSVSASRLLSGSRPLHLELEAELAATLGCEAAITLVNGHATNVTVIGHLVGEGDL
                     IVHDSLAHDSIIQGCRLSGARRRPFPHNDAAALDALLTQVRHHYRRVLVVAEGVYSMD
                     GDIADLPALIEVKRRHGALLMIDEAHSIGVIGAAGRGIGQYFDVDRQDVELWSGTLSK
                     ALASCGGYVAAGRTVVDYLRYTVPGFVFSAGMTPANTAASLAALRVLRAEPQRVARLK
                     ENSALFARLAHRAGIDTGPSHDTPIIPCIVGDSAKTLQLAEALFEQGISVNPILYPAV
                     PEKAARLRFFITCDHTPDQIHHTVRELAHGLRQADTAPAA"
     CDS             complement(118868..119221)
                     /codon_start=1
                     /locus_tag="SAVERM_102"
                     /old_locus_tag="SAV_102"
                     /product="hypothetical protein"
                     /protein_id="BAC67811.1"
                     /transl_table=11
                     /translation="MTSRHGTTTLWRPTGPKELDLVRELKWRAWPARLLGQPFFYPVL
                     NEDYAVKIARDWNVKHDGAGFVTRFEVESQFLRRYPVRQAGGQTILELWVPAAELDDF
                     NAHMAGEIEVVHEFR"
     repeat_region   119397..119398
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  119399..121219
                     /mobile_element_type="insertion sequence:ISSav13"
                     /rpt_family="IS256 family (IS1245 group)"
     repeat_region   119399..119423
                     /note="25 nt imperfect inverted repeat (22/25 nt)"
                     /rpt_type=inverted
     CDS             119461..120039
                     /codon_start=1
                     /locus_tag="SAVERM_103"
                     /old_locus_tag="SAV_103"
                     /product="putative IS256 family IS1245-like transposase"
                     /protein_id="BAC67812.1"
                     /transl_table=11
                     /translation="MPLPARRAGHRATLRCERPVQRGRCRVALSQRRPGPRDPQAAVR
                     ELLPRELRSGSFFPALLERRRRIDQALYAVIMEAYVRGVSTRSVDDLVKALGVDTGIS
                     RSEVSRICQDLDGELTAFRARPLDHVRFPYIYLDAPYCKARVEHQIVSRAVVIATGIT
                     EDGGREVLGVMVGDSETEVFWTEFCVTCANAV"
     CDS             120102..120611
                     /codon_start=1
                     /locus_tag="SAVERM_104"
                     /old_locus_tag="SAV_104"
                     /product="putative IS256 family IS1245-like transposase"
                     /protein_id="BAC67813.1"
                     /transl_table=11
                     /translation="MLGAAYQRCRVHFLRNVFSLINKEAAEMAAATIRTIFAQPTADA
                     VRTQLDTVAGMLGKQFPKVKAMLLEAKDDLTAFAAFPERHGKKIQSTNPLERINREVK
                     RRTDVVQVFPNDDALLRLVTAVLFELHDEWIAFPRRYLPEGSMSQLYPAELPEQAPAL
                     AHTTSTTAG"
     repeat_region   121195..121219
                     /note="25 nt imperfect inverted repeat (22/25 nt)"
                     /rpt_type=inverted
     repeat_region   121220..121221
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(121935..122162)
                     /codon_start=1
                     /locus_tag="SAVERM_105"
                     /old_locus_tag="SAV_105"
                     /product="hypothetical protein"
                     /protein_id="BAC67814.1"
                     /transl_table=11
                     /translation="MASKPVRASLGEVWLTCQICRGDLFRERGVLLNSTGMEFMKLAW
                     ADENATGLICWRCGYVHLFVNKDIKLYRADK"
     CDS             123637..124200
                     /codon_start=1
                     /locus_tag="SAVERM_106"
                     /old_locus_tag="SAV_106"
                     /product="putative secreted protein"
                     /protein_id="BAC67815.1"
                     /transl_table=11
                     /translation="MFSKRLIAAAATAVVIAGLGACGSETGNGSGSGGADLGSSWSDD
                     AGRSGQDAAPHARPDTDTVRGLRDSVRHLSRKTAKATRPHLVNKCTPATRRAKHTQQR
                     GTGTRKKTRTWYTTEHYQDCKKVRNGTETYTRTVRPQQWCVRLDDVDGDTSQDDRWYQ
                     VTRTTYDEALTMAEHTRIEFTPAGTGC"
     CDS             124557..124883
                     /codon_start=1
                     /locus_tag="SAVERM_107"
                     /old_locus_tag="SAV_107"
                     /product="hypothetical protein"
                     /protein_id="BAC67816.1"
                     /transl_table=11
                     /translation="MQLDVYGYVVETLYLAHQSGVARCGDTAVLHQRLVEHLAERWQM
                     PDEGIWEVRGERRHFVHSKVMAWAVVDRTIRLVEAGALDAGLCALMELREAIRHEVCT
                     RGFEPV"
     CDS             124945..125364
                     /codon_start=1
                     /locus_tag="SAVERM_108"
                     /old_locus_tag="SAV_108"
                     /product="hypothetical protein"
                     /protein_id="BAC67817.1"
                     /transl_table=11
                     /translation="MGFLSPGGPRVLGTVEAVRRQPATLEGFVRRYPTAGDHAGLDGL
                     DGDEGGLPALLVVDGRRARSDRPPGQAHGLFGRFLALRTDLGLLAEEYDHVTGWQLGN
                     FPQAYSHIGVIGSALLLQQLGSGAPAAEAEVLLAADV"
     CDS             125995..127230
                     /codon_start=1
                     /gene="cyp1"
                     /locus_tag="SAVERM_109"
                     /old_locus_tag="SAV_109"
                     /product="cytochrome P450 hydroxylase"
                     /protein_id="BAC67818.1"
                     /transl_table=11
                     /translation="MSEQQIIVLDPTGSDPDAEHQALRERGSAALVDILGVRAWSVSD
                     PALLKQLLTSKDVSKDGRAHWPAFAETVPTWPLALWVAVENMFTAYGDNHSRLRRMVA
                     PALSARRTAALQADIEALVNSMLDGLDAFPAGEVADLRKHLAYPLPIAVIGKLMGVPA
                     DRRTEFRTVVDNVFATHLSAEEQAANTAALYALLDALIEIRRAEPGQDMTSLLIAARD
                     EEDGSAFSDAELRDTLLLMISAGYETTVNVIDQAITTLLTDPCQLAHVREGRCTWQDV
                     VEETLRHQPAVKHLPLRYARIDIPLPDGQTIKTGEAILASYAAANRHPTWHEDADRFD
                     ATRPSKEHLAFGHGVHFCLGAPLARLEVATALRLLFERFPDARLATERTALEALPSLI
                     SNGHTSVPVHLRPTSSASS"
     CDS             127243..128214
                     /codon_start=1
                     /locus_tag="SAVERM_110"
                     /old_locus_tag="SAV_110"
                     /product="putative IS5 family IS1373-like transposase"
                     /protein_id="BAC67819.1"
                     /transl_table=11
                     /translation="MTSAAGASVPRRGPKLELLLLSDDERAESERCTRRATPARALAL
                     RARIVPACAGPDVPPFVAVAPELRVAADTVRKWRRRFLARRPDALAGEPRPGRPPTIS
                     VDQDTQLVVAAGRPLPGNRHGARAYRESGAARAVKNAPLLGDGGYRGTPALIPHWPRK
                     DRPLTPQQQAGNAVHRRARACVEHAFSRRKTYKILRDCRLRGDGVHQAILAVARPHHL
                     ALAGQPHLGQGHSLHFPNTGLRDVIQPEQGRAGPGGGGAGTQVRCRRHPKGHRRDSSR
                     GPQPGPEAGTGRAAGGALGRVSGGEAVPQPCCCLPGRAEVEVLGPGR"
     CDS             complement(128414..128743)
                     /codon_start=1
                     /locus_tag="SAVERM_111"
                     /old_locus_tag="SAV_111"
                     /product="putative LuxR-family transcriptional regulator"
                     /protein_id="BAC67820.1"
                     /transl_table=11
                     /translation="MSSASEGVSSDDRTDLSEEIPMSLTLTAPYAEAPAPAPAPASAP
                     ASAPVLAPRERETLRHIAAGRTYLQTARHMGLSKHTVDAYLRRIRAKLNISSTAELTR
                     LAISLGL"
     CDS             129497..132031
                     /codon_start=1
                     /locus_tag="SAVERM_112"
                     /old_locus_tag="SAV_112"
                     /product="hypothetical protein"
                     /protein_id="BAC67821.1"
                     /transl_table=11
                     /translation="MERLPTPAGQQADIPDASPAPACTATATISEQGIVTGWSEGARE
                     LLGYTPPQIVGHPAARLLADGTGEQARRETAGRERFSGQVALLHRDGHRLLRNLLAHR
                     RTPQGPQPAEWLVVSAVTAASASPRTPDSQALREWVFSQSPCILAVFDTDLRLVTANT
                     GMESALLLPEEQMRGLRLPEITPGPASEEAETKMRRALETGQTQHMQAYLHPTGVSAQ
                     RGWSTTLAPLKDPGGTVRAVCLAAHHRQQEHLARQRMLLLNDAGARIGTTSDIQRTVQ
                     ELADVAVPRLADFAAVDLLDVPRRGGEPARLPATGPITMHRTALHTTPDNHTSHTSHT
                     SHDGDDGDGGDTHPATPPAAGEKILYPAQSPVAQCLAQGHGALYEADDPALTRWAAND
                     PTAAWTRRQGTHSVMVVPLRAHGTTLGVALFARSHRPEPFEADDLWLAEELTAQTAVH
                     LHNAHRHAREHTTTMTLQRSLLPQKLPDQGALDIATRYLPAGSKAGVGGDWFDVIPLS
                     GARVALVVGDVVGHGIRASATMGRVRTAVRTLADVDLPPDELLTYLDDLVIHLAADEG
                     GGAEGTTETAAGIGTTCLYAVYDPTTRHCTIARAGHPPPAVVTPDGNVRFLNVPAGPP
                     LGLGGLPFETLETQLPEAASSPSTPTDSSKPATTTSTKASTKCSTPSPAPPTTSTPSA
                     TESSPPCSPTAPTTTSPSSSPAPAPSTPTKSPPSTSPPTPPSSPKHANTPPPNSPPGT
                     SPTPPSPPNSSSANSSPTPSATATHPSNSASSTTTTPSPPKSPTPATPPPTCAAPAPT
                     TKEDAASSSSANSPNAGAPATPPPAKPSGPNKPSPPTNTEFRFRWV"
     repeat_region   131929..131930
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  131931..133947
                     /mobile_element_type="insertion sequence:ISSav14"
                     /rpt_family="IS701 family (ISSus1 group)"
     repeat_region   131931..131955
                     /note="27 nt imperfect inverted repeat (21/27 nt)"
                     /rpt_type=inverted
     CDS             132082..132333
                     /codon_start=1
                     /locus_tag="SAVERM_113"
                     /old_locus_tag="SAV_113"
                     /product="hypothetical protein"
                     /protein_id="BAC67822.1"
                     /transl_table=11
                     /translation="MLRARPGRDEGEREMVHRLASARKAPKVVVERCRTVELSWGGWL
                     VPQIADELRCGVGQARTTHPNPQTPLHVHRLRTALIGLH"
     CDS             132479..133000
                     /codon_start=1
                     /locus_tag="SAVERM_114"
                     /old_locus_tag="SAV_114"
                     /product="putative IS701 family ISSus1-like transposase"
                     /protein_id="BAC67823.1"
                     /transl_table=11
                     /translation="MRGLMLDGRRKSIQAMAARLPDGNEQNLQQFVNQSTWDPVPVQR
                     RIAERMLPLINPVAWVIDDVSVPKDERMSVAVAPQYCGALGKRANCQVAVTVHAATDT
                     ASCPLQWRLFLPKEWASDTDRRAITRIPPEVAQALSRWLTGWDDLLVDQAGRGRPWGA
                     RRRRTGGTGTRSR"
     CDS             132949..133668
                     /codon_start=1
                     /locus_tag="SAVERM_115"
                     /old_locus_tag="SAV_115"
                     /product="putative IS6 family ISRH1-like transposase"
                     /protein_id="BAC67824.1"
                     /transl_table=11
                     /translation="MGSTSPSYRGHRYPVEVISHCMWLYFRFPLSFREVEELMLQRGV
                     IVSYETVRRWCAKFGQAYANGLRRRRPRPGDKWHLDEVFVRVNGELKYLWRAVDQDGN
                     VLDILVQNRRDKAAARRFFRRLMKETRSVPRVVVTDKLRSYGAAHREVMPSVEHRSHK
                     GLNNRAENSHQPTRQRERAMKGFRSTGGAQRFLSAFSGISPHFRPHRHLMTASDHRAE
                     MTIRFAIWDQITGAASRPTTA"
     CDS             133696..134031
                     /codon_start=1
                     /locus_tag="SAVERM_116"
                     /old_locus_tag="SAV_116"
                     /product="hypothetical protein"
                     /protein_id="BAC67825.1"
                     /transl_table=11
                     /translation="MPRRTIRQSRTQQRDNALPGVPRRWRVRRRSVPVVEPPSEPDTH
                     AILSVFTSHVLDMLPWDSQVTFAGVELACRGQVGWVAHRLACVRRAGGCSSPLAGSSP
                     RTLSSSLAF"
     repeat_region   133923..133947
                     /note="27 nt imperfect inverted repeat (21/27 nt)"
                     /rpt_type=inverted
     repeat_region   133948..133949
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             134166..134822
                     /codon_start=1
                     /locus_tag="SAVERM_117"
                     /old_locus_tag="SAV_117"
                     /product="hypothetical protein"
                     /protein_id="BAC67826.1"
                     /transl_table=11
                     /translation="MPPKSGQDAPNRHRVGGDRQHGEDWLSGGRSPSPDWRKPSPLGL
                     GVAVDAVTNVAAPLLAGFAIATIGVVGADGGHFRWPGPVLLCLTLSALLFVTCVQFGF
                     HARRHLYSFADISAWWSDEEMRDHRDLLREEQNADFQLWNRWRGRAYTAYSGGMVMLW
                     LGVALVLVPPARSTSPDTEFRWAAAAVAVGAAVVEAVWSMYPQVRLWFQRRRVLRGNA
                     "
     mobile_element  136639..137502
                     /mobile_element_type="insertion sequence:ISSav15"
                     /rpt_family="IS5 family (IS1647 group)"
     repeat_region   136639..136662
                     /note="24 nt imperfect inverted repeat (18/24 nt)"
                     /rpt_type=inverted
     CDS             136682..137041
                     /codon_start=1
                     /locus_tag="SAVERM_118"
                     /old_locus_tag="SAV_118"
                     /product="putative IS5 family IS1647-like transposase"
                     /protein_id="BAC67827.1"
                     /transl_table=11
                     /translation="MTDLVERLVPDELWVLFRRVVPPTEVIRPQGGGRRRAGDREALA
                     AIIFVATSGCTWRQLPPVFGPSWQTVYRRFAQWSRARVWARLHRVILDELGARGELDW
                     SRCAIDSVSLRAAKGGH"
     CDS             136846..137490
                     /codon_start=1
                     /locus_tag="SAVERM_119"
                     /old_locus_tag="SAV_119"
                     /product="putative IS5 family IS1647-like transposase"
                     /protein_id="BAC67828.2"
                     /transl_table=11
                     /translation="MAAAAAGVRPELADGLPTLRPMEPGPCLGPAPPRHPRRTRCPRR
                     VGLVTVRDRLGQPAGGKRGPLTGPNPTDRGKLGSKIHLITDRNGLPLSLGISGANMHD
                     SLGLEPLVRGIPPIRSRRGPRRRRPGKLHADKGYDYDHLRRWLRKRGIRHRIARKGIE
                     SSKRLGRHRWVVERTVSWLAGCRRLHRRYERKAEHCLAFADIAAALICHRRLTK"
     repeat_region   137479..137502
                     /note="24 nt imperfect inverted repeat (18/24 nt)"
                     /rpt_type=inverted
     repeat_region   137503..137504
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  137505..138900
                     /mobile_element_type="insertion sequence:ISSav3"
                     /rpt_family="IS701 family (ISRhosp2 group)"
     repeat_region   137505..137519
                     /note="15 nt perfect inverted repeat"
                     /rpt_type=inverted
     CDS             137556..138740
                     /codon_start=1
                     /locus_tag="SAVERM_120"
                     /old_locus_tag="SAV_120"
                     /product="putative IS701 family ISRhosp2-like transposase"
                     /protein_id="BAC67829.1"
                     /transl_table=11
                     /translation="MGGDLAGVRLWAGELEAVHERFVHRFSREEPRQSALAYMRGLVA
                     PLERKNGWTLAEEAGHAGPDRIHRLLNRIEWDADEVLDDVRDYVVENLGDRDAVLIVD
                     DTGFLKKGVRSAGVQRQYSGTAGRTENSQIGVFLAYATGRGRTLIDRRLYLPTSWTDD
                     RERCRRAGIDDSVAFETKVAMAKAMVRRAIADRIPFGWVTADAAYGFSKGWRFELEQA
                     DVFHVMATTRHDTVVTRWSIDHPVHDLFPGLPRQKWKRRSCGEGAHGRRIYDWARVEV
                     RPWHREDRRHWVLARRSVSRPEEISYYIAYCPAGTTLDELIRVAGSRWAVEECFQTAK
                     QECGLDDYQVRRYPGWHRHMTLAMAAHACLTVLRARELDIGKAETDPPSSSTTASPRS
                     DD"
     repeat_region   138886..138900
                     /note="15 nt perfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   138901..138902
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             138932..139393
                     /codon_start=1
                     /locus_tag="SAVERM_121"
                     /old_locus_tag="SAV_121"
                     /product="hypothetical protein"
                     /protein_id="BAC67830.1"
                     /transl_table=11
                     /translation="MFVESGHHWSLRPRAPGFAGERLFQQRVSKSADIRLTAVGDHLT
                     AVRIDGSPGIDWRRHYEALTYTPVPVPPEITKGVRAYLDAFGLVFGAFDFGLGTDGRW
                     HWYECNPNGQWAWFPDNITAPITNALADRLQHPQGTFQSCCQAALVTGGEV"
     repeat_region   139333..139334
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  139335..140688
                     /mobile_element_type="insertion sequence:ISSav16"
                     /rpt_family="IS110 family (IS900 group)"
     repeat_region   139335..139349
                     /note="15 nt imperfect inverted repeat (12/15 nt)"
                     /rpt_type=inverted
     CDS             complement(139360..140565)
                     /codon_start=1
                     /locus_tag="SAVERM_122"
                     /old_locus_tag="SAV_122"
                     /product="putative IS110 family IS900-like transposase"
                     /protein_id="BAC67831.1"
                     /transl_table=11
                     /translation="MEGNVPEIWAGVDIGKTHYHCVVINADGKRLLSRRVANDESELL
                     ALIGDVLEISADALWAVDLNHGGAALLIGLLVSHGQPVAYLTGLAVHRASATYKGGEG
                     KTDAKDAFVIADQARVRRDLGLLRPGDEIAVDLRTLTTRRLDAVFDRTRQINRLRAQL
                     LEIFPALERALELTNRGPVVLLTGYQTPAAIRRAGASRIETWLKNRKVRGAAALAKTT
                     VEAAQAQQTALPGEKLAAAMVVRLAKGVMALDEEIAELDALIEVKFCEHPHAEVIRSL
                     PGMGAKLGAEFLAATGGDMDAFGSPDRLAGFAGLAPRPRDSGRVSGNLRRPRRYHRGL
                     LRTMYLSAMVSLQCCPASKAFYDRKRGEGKGHKQALLALARRRLNVLWAMIRDGECFH
                     TSPPVTRAA"
     repeat_region   140674..140688
                     /note="15 nt imperfect inverted repeat (12/15 nt)"
                     /rpt_type=inverted
     repeat_region   140689..140690
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             140787..141911
                     /codon_start=1
                     /locus_tag="SAVERM_123"
                     /old_locus_tag="SAV_123"
                     /product="putative O-methyltransferase"
                     /protein_id="BAC67832.1"
                     /transl_table=11
                     /translation="MTDPADLRRQLANTIPTDDPAWRHALQSVPREIFLGDALFRLTG
                     PQWEPIHRDQTAPGEWLRLIYQDTTWVTQIDGVNAADACSPTTGRPTSSSTLPSLIVR
                     MLDLAGTRDGDNVLEIGTGTGYSTAILCERLGDEHVFSVEYDPGLAAAAADHIHAAGY
                     HPTLNTGDGLAGHKDGAEYDAIIATCAVRHIPPTWLYQVRAGGTITTTISGWMLASGL
                     IRLTVHDDGTATGRFADDQISYMLARPHERPPRPTYYQHPGHTRPTRVNPALLDDWTG
                     HFLAQLAAPSAELMNTTDGVILVDVATGSQAWTEPAGNSWHVHQHGPLNLWDQVENTL
                     TTWQRAGSPPQSDLGMTVEPDGTQRVWLGAPDGPSWDLPV"
     CDS             complement(141787..142821)
                     /codon_start=1
                     /locus_tag="SAVERM_124"
                     /old_locus_tag="SAV_124"
                     /product="putative membrane protein"
                     /protein_id="BAC67833.1"
                     /transl_table=11
                     /translation="MAALWAAEAALTPGEVQAELASDLARTTVTTILSRLYDKGVVDR
                     RGVAMVTTPCRTPRGSPPGACIPSSTVTLTGRPSWPASSPSSIRTTNSFCASYWRPTR
                     DDRPLLIPLLLPFVMPLLARRALDRLAPATALWALTAAALVLAGACVTALGALVLTGL
                     LKLPAFAALGELAHPLRTPTGYLVLPAAAIATGLLTIGAWTLAHSALRQTRAFRTARA
                     EADRRPTAGDLCVVDSPHPDAYALPGRPHRIVVTTAMLRSLKPDERDALFAHERAHNQ
                     GATTASWSIGSAACRPGRMVSYLGACGARRAGPMRGRRGPRAIPVVCRPVPRSCRGRI
                     VGVSLPSARW"
     CDS             142975..143661
                     /codon_start=1
                     /locus_tag="SAVERM_125"
                     /old_locus_tag="SAV_125"
                     /product="putative membrane protein"
                     /protein_id="BAC67834.1"
                     /transl_table=11
                     /translation="MRGPAFMTAPLFAASQLAVNVLSAQSLLAAFGVLGVGVVMFAET
                     GLLIGFFLPGDSLLFTAGLLCTGSGQHGVKLSLAPLLVAAAVGALAGAQCGYVLGRKA
                     GGALLARSRSVRLREGAQRAEELLERYGHAKAIVLARFVPVVRTVLNPMAGALGVPAR
                     TFTVWQVAGGLVWSLGLTLGGYALGSSIPNVDRYLLPIIAVIVAVSLLPLAAELYRSR
                     RAAKAKEVRG"
     CDS             143658..144263
                     /codon_start=1
                     /locus_tag="SAVERM_126"
                     /old_locus_tag="SAV_126"
                     /product="putative integral membrane protein"
                     /protein_id="BAC67835.1"
                     /transl_table=11
                     /translation="MILAFDGSSIDGTAYTDVVDLAHRSPGWLDDMVAAWSTYGLAVF
                     AALMAVGWWRARRVSPAAAVSALAVPAIVFAAYGVNDVLKLLVREDRPCQSLQVITLE
                     ACPAPGDWSFPSNHTAIAAAAAMALLFVSRRLGAVAAGAACAMAASRVWVGAHYPHDV
                     AAGVVVGALVAALAMVTLRRQPDSLVRWITGTRLRPLVLAS"
     CDS             144260..144988
                     /codon_start=1
                     /locus_tag="SAVERM_127"
                     /old_locus_tag="SAV_127"
                     /product="hypothetical protein"
                     /protein_id="BAC67836.1"
                     /transl_table=11
                     /translation="MKRSDLGELAGSVGLGAWTAFGVLTMIVIGDGQPLYGDEDLLSW
                     SVGHRPDVPVALARALTATGTGAIPYVLAVLAGTIAGRTLRQRAVATALCLTCLGAGQ
                     AARYGVMALVARPRPTRVDWATPASGWAFPSGHTTTAALTAGLLVIAVYTRSPPGRAL
                     LALVFGCWGALVGLTRVYLGVHWFTDVVGGWLFAVGWLGLCLCAAAWWLPEAFITGTT
                     DIDQKPPEDHAPQDPGRRGRSRPA"
     CDS             144942..145604
                     /codon_start=1
                     /locus_tag="SAVERM_128"
                     /old_locus_tag="SAV_128"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAC67837.1"
                     /transl_table=11
                     /translation="MRHKILVVEDDHALRDVLLRGLRDEDFDPVPAPDGASALRLATR
                     DIAASVLDIGLPDADGRDVCQAMRANGFLSPVIFLTAHHRLTDRLSGFSAGGDDYLPK
                     PFHLAELAARLRAAVKRAAPLPAATAGDLVLDPVRHSVSVRGTPVDLTPTEFRLLAAL
                     MAASGGIVRRRELVRAGWPEGAQVSDNTLDQYLTRLRRKLRTAGSDLTVTTARGIGHR
                     LS"
     CDS             145601..146962
                     /codon_start=1
                     /locus_tag="SAVERM_129"
                     /old_locus_tag="SAV_129"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAC67838.1"
                     /transl_table=11
                     /translation="MNSMFSRLVPRTLRGRLSLVALTTATLLMVVLTVAFNTVIRHRL
                     QHQADDELHTRAAAVATTIDTSGPTVRVLETSNDQLLDTNVWIYAGTRLLEQPPSTTA
                     HSTLAHAADSLARQDGTHCLTAEEPDPAQLCSLPVSDGRSTATVVTALDLSPYRSSAA
                     TLLWASLCLDAVMLACTYLLTRLAVGRALRPVATMTDQATQWSIVASEERFGAARRPT
                     ELARLGASLDAILDRIRAVLRHEQQLTGELSHELRTPLSRIIAELDWWQARPRSAAET
                     EATHEVIADAARSMRSICDTLLNDARKGTTTTPGTAEILPALHRLAASLEAPVHVTVD
                     ARSDSVPLEAGVQAALLERIVSPLLVNAVRYATSHVTITASREPGGVRIDVDDDGPGV
                     PESFAAQLFQPGRRADPDDGRGGAGLGLPLARRLARSVGGDVTYDPGHKPGARFTVRL
                     PAG"
     CDS             complement(146943..147743)
                     /codon_start=1
                     /locus_tag="SAVERM_130"
                     /old_locus_tag="SAV_130"
                     /product="putative integral membrane protein"
                     /protein_id="BAC67839.1"
                     /transl_table=11
                     /translation="MKIAATTLGETAGDLFAQTLKLGYFLTTIALFLIFVVTLVVQLR
                     SRRYNPFFYWTVILSTSMAGTTMSDFMNRDASAKFLSGGATSLGWGPQGLGLGYPVGA
                     AILISLLIAVFAVWKLTGMTFVIRDIVTFRGEALFWSAILVSNTLGTSMGDFLSDSSG
                     LGYAGGALLVSGMLAMLLVLMKVPVVPNVLLFWFAFVLTRPLGATAGDFLTKPVAKGG
                     LDLGTAGSSAVLLAILVGLMAYAQVRERRTALSSPESAEQEAVTQRAA"
     CDS             complement(147993..148823)
                     /codon_start=1
                     /locus_tag="SAVERM_131"
                     /old_locus_tag="SAV_131"
                     /product="putative integral membrane protein"
                     /protein_id="BAC67840.1"
                     /transl_table=11
                     /translation="MTSETSETAAVHGSAPNAPGHRLRWNKVPEVTVYFWVIKVLCTT
                     VGETAADLLNEKAGLGLTGVSLLMSVLLAVILVVQFRTTAYRPGAYWTAVALISVVGT
                     LVSDNLTDNMGIPLETTTAVFAVLLAVVFVAWYRSERTLSIHSIDTLRRESFYWLAVL
                     FTFALGTSAGDLVAERMALGYWVSAVLFALAIAAVAVARFALGANAVWSFWIAYVLTR
                     PLGASMGDYLSQPTGDGGLGLGTVVTSVLFLAVILGLVVFLAVTRKDVTEPERLARTA
                     "
     CDS             148993..149274
                     /codon_start=1
                     /locus_tag="SAVERM_132"
                     /old_locus_tag="SAV_132"
                     /product="hypothetical protein"
                     /protein_id="BAC67841.1"
                     /transl_table=11
                     /translation="MTIPHSHGRTCADHATHWLRRRLGRAVALAYLAAVLLPGPGRWL
                     RHTHTLVGTGLPLYTASLLLSLVLFSAGLQVPVRALGQLLRRPRACWQG"
     CDS             149373..150071
                     /codon_start=1
                     /locus_tag="SAVERM_133"
                     /old_locus_tag="SAV_133"
                     /product="putative transporter"
                     /protein_id="BAC67842.1"
                     /transl_table=11
                     /translation="MILIVAMPVAAGATVWTGKGHGDQPTMVGLVLASTLVSPLTIPV
                     TVGALAPLLSGGYPDALGPARDTMNSGFAFAQVVLPCAAGLMCRLVLPARLLDGAGRW
                     VVPVALAGSAVLTYVNASGALGALLAHPRPLLLIAAPVVAAVVCAPSFAVGRLAARVL
                     RLDAPAASSLTLACGMNNSSASAVLITTTLPDKPHLLLPVLAYGLLQKTAANRVVRMT
                     RPHRPPGPPCPASS"
     CDS             complement(150032..151414)
                     /codon_start=1
                     /locus_tag="SAVERM_134"
                     /old_locus_tag="SAV_134"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAC67843.1"
                     /transl_table=11
                     /translation="MRQRVVRVALTAVLVAMVLLAVPLALAIRFSLYADQRDALERAA
                     LAGAVRVSPDYATGDPVELPPPPDGGRLGLYDPQLRLRAGSGPRIGDDTARRALTGTV
                     TRSTGGGELVAAVPVSHDEQVIGVVRVSSAVQDVRDRILVGWALLLGVAVLALTVAVL
                     VARRQARALAAPLEDLSRHCRAVTGGDLTARAAPSAIGEIDQVARTHNEMLHSLAELL
                     LRERNFTANASHQLRTPLTGLQLTLEAGLEHDDTRPVLEEALAATRRLHHTVEEVLRL
                     SGSAGLPQPVAPDRPVTGLLRETEERWHGLFAREGRRLECDTGEVPDDVRVPGGPVAE
                     ILGVLLDNARVHGHGTVRVTVRDLDDALALDIADEGTADGDSARLFERGHTEGGAGTG
                     IGLSLARDLAVSLGGRLSLANRAPTTFTLLLPVRAAGGHGAEDRNESDGRRGDGDPQD
                     EAGQGGPGGR"
     CDS             151606..152274
                     /codon_start=1
                     /locus_tag="SAVERM_135"
                     /old_locus_tag="SAV_135"
                     /product="putative lipoprotein"
                     /protein_id="BAC67844.1"
                     /transl_table=11
                     /translation="MARVHTFGVVGLVLAAAVTAGCSGATSGSGSSSSSSSSSGAATT
                     AASTGGSSSGSGSSPAPTESNPPGDIPDNQAFIAYQPSGGAFTAFTVKVPEGWARTSQ
                     GSTTVFTDKLNRVQISAAATSNAPTVGSVAHQVVPQLRGHVSKFASPKVSTVTRKAGT
                     AVLLTYQGDSANDPVTGKVVRDAFERYAFYRQGHEVDLTLSGPVNADNVDPWRIVSDS
                     FTWK"
     CDS             152278..153018
                     /codon_start=1
                     /locus_tag="SAVERM_136"
                     /old_locus_tag="SAV_136"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAC67845.1"
                     /transl_table=11
                     /translation="MNTMLVPPSDEALTARELYRFFRAGEEETLALRGVSLRVRRGET
                     VAVVGPSGAGKSTLLSCLAGLDEPSGGEVRVDGVRISHRPETERARLRAHHIGVLLQT
                     SNLVAHLSVRDNVRLTHSAVRGRPSASVGDLLAEVGLAGRAHALPRQLSGGELARAGL
                     AVALANSPAVLLADEPTGELDGGTERMILQMLRDRAALGCAVLIVTHSAEAVRIADRV
                     IALDDGRAHETTTSQARTQQQEAHDAAP"
     CDS             153005..153718
                     /codon_start=1
                     /locus_tag="SAVERM_137"
                     /old_locus_tag="SAV_137"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAC67846.1"
                     /transl_table=11
                     /translation="MPPRDHAIPAGKPVTSLDEVLVDCRNAALTFGRGATAVVAVHGA
                     NLWVRSADRLAIVGPSGSGKSSLLHLLAGLEQTTSGTVTWPALDGPGGIGIVFQGDSL
                     IAALDVVENTALPLVLAGVPDGEAHRLAAEALALVDAADLAERLPEEISGGQAQRVAA
                     ARVLAQSPRLILADEPTGRLDHTTGGHVLDALLTAADQTGAALVVTTHDPAIAARLTT
                     RLAMRGGRLLTVDEPQEAS"
     CDS             153715..156363
                     /codon_start=1
                     /locus_tag="SAVERM_138"
                     /old_locus_tag="SAV_138"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAC67847.1"
                     /transl_table=11
                     /translation="MNTAWAGGLARHRAGRLLAALAGIALAVALVAALGSFLTVSKAT
                     MTQRAVRSVAVDWQVEVQPGADPQAMLSLVRKAPGIRTAVPVGFAHSSAFTAQVQGST
                     QTTGPGMVLGLPDGYQKLFPGGIRPLTGGTSGVLLAQQTASNLHVAPGDTVGIRLPGT
                     GVRQVRVAGVVDLPQADSLFQKVGAPTQSQPTAPPDNVVLLPSTTFTSLTAQAPAAGV
                     TTQIHAARDAKLPSEPAAAFNTATRGAHNLEARASGAAIVGNNLGAALDSARQDALYA
                     QILFLFLGVPGALLAAALTAAVAAAGGERRRQEQALLRLRGLRPGRIATLSGIEAGLV
                     GAGGAAAGLGIAALLGRLAFGSASFGTSAGTWILWYALAFVLGAVVAAGAVLVPALRD
                     LRGVTVADTRRAGRRTGSVWWMRYGVDFALLIGSWLIFRASSGNQYALVLAPEGVPSI
                     SVSYWAFLGPALLWIGSALLLWRLTLLALTHGRRVLARLSLPLAKNLAGTTAAVLSRR
                     RRPLARSVVLLALAVSFAISTATFNATYKQQAEVDARLTNGADVTVTEPPEARTPPGA
                     AASLKVSGVRHVEALQHRFAYVGSDLQDLYGVRPDTITSATSLQDAYFSGGTAGTLMR
                     KLAKQPDALLVSAETVTDFQLSPGDTVNLRIQDAHTKALRTVPFHYVGVAKEFPTAPK
                     DSFFVANASYVAQATGSDSVGAFLLDTGGTHQKQIAAHLRRQLGTSATVSDLTQTRGT
                     VGSSLTAVDLAGLTRIELAFAVLLAAGAGGLVLALGLAERRRTFAIATVLGATRRQLR
                     GMVLTEAILLTAGGLAGGALIGWALSEMLVKVLTGVFDPPPADLAVPGAYLALTAFAA
                     TVAVLAAALNGVRRAARPAVEELRDL"
     CDS             156360..157139
                     /codon_start=1
                     /locus_tag="SAVERM_139"
                     /old_locus_tag="SAV_139"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAC67848.1"
                     /transl_table=11
                     /translation="MNAPPGSTLPSMRTPAAPDRSRYRVLVVEDDDTIGRHLETGLRS
                     NGYTPTWSRTGTGALTESAQTQYDVLLLDLGLPDMDGLDIARTLRARLPDLLIIILTA
                     RTDDIDVIAGLDAGADDYLVKPFSLTVLLARLRAHLRRRAIAAPPQQPIRLGDLVLDV
                     TARRCTLHDREVDLRPKEFELLAVLARHAGEAVSREVLMAEVWDENWFGPTKTLDVTM
                     AGLRRRLADAANASPIPAALPRISTLRGHGYRLEPHAVPPV"
     CDS             complement(157954..158928)
                     /codon_start=1
                     /locus_tag="SAVERM_140"
                     /old_locus_tag="SAV_140"
                     /product="putative hydroxylase"
                     /protein_id="BAC67849.1"
                     /transl_table=11
                     /translation="MSERNPILITGAAGEVGGVSRTTVDMLLEQGHPVRAFVRQDDER
                     AHALRQAGAEVFVGDLLTIADVSAALKGVRRIYFSMSLSPYYTDAVSLMAAAARAQGD
                     IEVFVNISEYEQSFMTFEKMTAPEEERRAWLGGLVANWSPQQRAHWVAEQVLDWSGLP
                     TVNIRAAMFVENPLMTWLALEPLANGELRLPFGHHRLAPIAGYDVAELCVKILADPAP
                     HISKSYDLNGPELKDMHGFAEDYAAALGRQVTYVPEDVETWNETYVDTVLGALPHTAE
                     HLKTLTRLMGGGGYRGVTDQLETLLGRPPKTVRWALENHPRIRKLASA"
     CDS             complement(158997..160031)
                     /codon_start=1
                     /gene="ephA1"
                     /locus_tag="SAVERM_141"
                     /old_locus_tag="SAV_141"
                     /product="putative epoxide hydrolase"
                     /protein_id="BAC67850.1"
                     /transl_table=11
                     /translation="MEGSLTHRFVDVNGVRLHIAEQGQGPLVLLLHGWPESWYSWRHQ
                     FGALAAAGYRVVAPDQRGYARSEQPPDVASYTLLHLVGDVIGLIEELGEEQAVVVGHD
                     WGAPVAWTTAMLRPDKVRAVAGLSIPPILPGGMVPPSITRTQYGEGFYQVYFQQPGVA
                     DAEFAKDIPNSFRRFLVGASGDNPLGREPSPLVIPDGLGLLDIMPESPALPAWLTEED
                     IQAYAEDFALHGERAFTGAFNWYRNIERNNELLAPFRGRGIDVPALYVVGDRDMVTSL
                     RGPDGGPSLSEIFRGQGGPGNPLSAVAPQLQGPVVLPGCGHWTQQERPVEVNAALLDF
                     LTRIDGSAPR"
     CDS             complement(160053..160754)
                     /codon_start=1
                     /locus_tag="SAVERM_142"
                     /old_locus_tag="SAV_142"
                     /product="putative dehydrogenase"
                     /protein_id="BAC67851.1"
                     /transl_table=11
                     /translation="MTAIKGASVFVTGGSRGIGKMLVEALYARGAGKVYATARDPRTV
                     THPDAVPLALEATDPASVAAAAEQAQDVTILINNAGASVRASYLDSPMEDVRRDLETN
                     FYGPLLVTRAFVPVIERNGGGHILNAHSALSWLADGTPYGASKAALWSQTNSLRLELQ
                     PRGIAVTGLHMAYVDTEMTSGVDAPKADPRDIAVAALDGIEAGAHEVLADDITRWVKS
                     QLSADLEDMYAQLKH"
     CDS             complement(161392..161961)
                     /codon_start=1
                     /locus_tag="SAVERM_143"
                     /old_locus_tag="SAV_143"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC67852.1"
                     /transl_table=11
                     /translation="MTTEVKQSPRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSM
                     YQLFESKDELLAASLKERSAAFVAKALPPADDGRSPRERILYVFERVESQAGAPDFQG
                     CRYLAVQIELKDQAHPASRVAYQIKADLMAFFRSEAERGGASDPDLLARQLILVFDGA
                     SARAGIGADNLTGLIVPTLTTLLDAADMH"
     CDS             complement(162195..163493)
                     /codon_start=1
                     /locus_tag="SAVERM_144"
                     /old_locus_tag="SAV_144"
                     /product="hypothetical protein"
                     /protein_id="BAC67853.1"
                     /transl_table=11
                     /translation="MSGIHPFRVLRAKPLWIANGVITGVLALLFTVFYVGANIDPVDH
                     MKNLPVGLVNADKGAAVGGEQVNLGARITESIKKSTASGGKIDWKVMDEKEMKEELGK
                     GKLYGALVVPADFTSATTALTGAATTGVPTRPTLTVLTNQSAGSVGSSLARTATTQAA
                     ENASLQVGKELTPQGGTGQAKLPAAARVLLADPAAVAVEDGHPLDSHSGLGLTAFYYA
                     LVLVVVGMLSANVISGQVDHALGYTHNDMGPLRLHRPLIRATRVQTLAISSTLMAGLS
                     LLMGTLVMVGAIGLMGMDAAHLPLLWLFSVCAIAVSGIGALTLLAVFGTPGMLVVTLV
                     FIGMAVPTAGATTPLQALPGFYRFLAEFEPLRQITGGIRSILYYDAQADAGLTRGWVM
                     MAVGLTAAALFGFGMTGWYDRKGLHRIPAETEPAKTAAPA"
     CDS             complement(163767..165950)
                     /codon_start=1
                     /locus_tag="SAVERM_145"
                     /old_locus_tag="SAV_145"
                     /product="putative membrane transport protein"
                     /protein_id="BAC67854.1"
                     /transl_table=11
                     /translation="MFEGFGRLLYRRRKPVLILTLLFAVLSGAYGAGVFGSLTPLGFQ
                     DPGSDSVRAAKIAEKAFPQRTPDAVIVYRDEDRTVDDPSFQQAVVQQLASLPKSEVTG
                     YLDFWTTRMPTQVSHDRHATYVALNLHGSSEKAKEDAYEAVKDKIPAPGLQTLQGGTV
                     PTGHQASEKIEHDLRIAEIISAPVLFLLLLVVFGGLTAAFLPLLVGVLSILGSMAVLR
                     TIANITDVSVFSMSLVTILGLAVAIDYGLLIVSRYREELAAGYTGEAAIGRTLATAGR
                     TVMVSGTTVAAALAGLTLFPSTFLKSMSYGGVAAVLLAVLFSLVALPALLAVMGPKVN
                     AFPLRRKKAGRPTAAGEGAWYRFGHGLMRRRRVVVVGAAGLLLTLALPFSKIEFGSIN
                     AQQLRSSSEGRQVFDAMEHDFDGDAVKSIDSLLVLKSDGTSKDQGAALKAYAERLGAT
                     EGATSARITGVEGTTARVSVTYDGNPISPHARDLVNRLKDVPEPPGARAYFGGESAVY
                     DDTLDALGETLPWMLLYIAVMTYLLLFLAFGSVLLPLKAIAMNMLSLTATFGVLVWIF
                     QDGHLHNLLGFDPTGNIEPNMPIMLFALIFGLSMDYEVFLVSRMREQYDKSGDSTEAV
                     ASGLQSIGRLVVSAALLMCVPLAAIGMSDVLTIKLFGVGMVFAVLVDVLVVRILLGTA
                     VMRLLGRAAWWAPGPLARFYDRFGIKETDMPADDTAGERVPVATG"
     CDS             166102..166851
                     /codon_start=1
                     /locus_tag="SAVERM_146"
                     /old_locus_tag="SAV_146"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC67855.1"
                     /transl_table=11
                     /translation="MQEDLVRKWRVLTWGAADDSKPRRYREAFVTALQYDGAMARLKT
                     HDEALRLRLLHRAAATVFDRGTAALSLRQLAADVKTSTTAVYSLFGNKAGLLRSLYEE
                     AARLFAARLAAIRPTDDPAGDVIRLGLVYREYAIANPHLYAILFSDRSVQCPSESEPE
                     RPREAIETYRPLVDAVRRGQQAGQFGSESDPEVIALSVWGTAHGLVSLVLSGNEPPGL
                     AVADCYERALGVLVAGWRVSEGEVQGFADVP"
     CDS             167014..167367
                     /codon_start=1
                     /locus_tag="SAVERM_147"
                     /old_locus_tag="SAV_147"
                     /product="hypothetical protein"
                     /protein_id="BAC67856.1"
                     /transl_table=11
                     /translation="MTSKVYWTTAPRSMMKKFGQIMRDLGADREEPGPSEAGEGPETG
                     LPDQEITTWVDTTEFGSQKFDALAAHASQGQNIFFLRRSKERFTQLMSVETSVRVLDT
                     TGAPPPENDLFAGLR"
     CDS             complement(167757..168923)
                     /codon_start=1
                     /locus_tag="SAVERM_148"
                     /old_locus_tag="SAV_148"
                     /product="putative gluconolactonase"
                     /protein_id="BAC67857.1"
                     /transl_table=11
                     /translation="MNRRTFLAATTASLAATQLAGPAYAYAYSSSPSGSTAVHYAVVA
                     RFWGAMPTGVTVSRRGRIFVNFPRWGDDVPFTVAELRGGKPVAYPDAEVNRQDASDLA
                     GHFQSVQSVVVDGADRLWILDTGSPGFAGSSYGGPKLVAVDLRTDRIVRKILFPPEVV
                     PANSYLNDVRFDLRRGAEGTAFITDSGGSNGIVVVDLATGRSWRRLTGHPSALPDERF
                     LPVIDGEPFMVRPAGGEPTYYETGSDGIALSADGTRLYYCPLSSRRLHSVSTDALANP
                     DATDAEVAATVEDLGFKPMADGLESDDKGRLYGGDLEHNAIWRRSPNGTYRTLAQGRD
                     LLWVDTLSVASDRHLYAIANQLNRLSPFHEGKDLRRKPYLLVRLPIDAGPVRLV"
     CDS             complement(169217..169735)
                     /codon_start=1
                     /locus_tag="SAVERM_149"
                     /old_locus_tag="SAV_149"
                     /product="hypothetical protein"
                     /protein_id="BAC67858.1"
                     /transl_table=11
                     /translation="MSETLDSAATTIARWRSAEERGDVDAAVACLSPDVVLSSPLTDQ
                     FRFEGSDQLRDFLTSAFAAVKDVHYHTQTGEGDTYALVYRARVGSQSFEEVQMLRLDN
                     QARITEITLFGRPMPALTALMHLMGPALARQQGRRGLATLMSVSTVPIHAMVSSGDRS
                     MVAKTRPAARQP"
     CDS             complement(169801..170613)
                     /codon_start=1
                     /locus_tag="SAVERM_150"
                     /old_locus_tag="SAV_150"
                     /product="putative dehydrogenase"
                     /protein_id="BAC67859.1"
                     /transl_table=11
                     /translation="MTTNRPVALVTGASSGIGKQTALALVAAGFEVAGTGRDTSRVTP
                     LQGVTFFDLDVVSDKLVTAVVQQVIERFGRIDVLVNNAGVGSIGAVEETSLAQAQGVF
                     DINVFGVMRMVKEVLPHMRARGRGRIINLSSVQGFIPAPYMAVYGASKHAIEGYSQSL
                     DHEVRQYGVRSLLVEPAYTNTGFEANSAKPDSPLQTYADQRHVFDRLMTEAIKAGDDP
                     AVVAKAIVTAATDTKPKLRYAAGPMAGRARMLRFVPAWVLDKQIRSMNKLTG"
     CDS             complement(171402..172043)
                     /codon_start=1
                     /locus_tag="SAVERM_151"
                     /old_locus_tag="SAV_151"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC67860.1"
                     /transl_table=11
                     /translation="MTGTQTAGRRYGGRDAAQRQQERRTRLIQAGLDLFGTAGYASAS
                     VKQVCSHAGLTERYFYESFRDREDLLAGVYDELITTIIAETAQAAAAAAPDVDAQLRA
                     GLEVFIRTLAGDARKARLVLIEVVGASPRLEVRRRDVLHEFAAMVAAVVGPLSDPEAS
                     SSRLAMTAMSLVGGVNELLVDWTLGHQKATVEELIDLCHTLYIAAYRAISDQL"
     CDS             172191..173102
                     /codon_start=1
                     /locus_tag="SAVERM_152"
                     /old_locus_tag="SAV_152"
                     /product="putative dehydrogenase"
                     /protein_id="BAC67861.1"
                     /transl_table=11
                     /translation="MAAPPKHPNTSSRRDHDKLARTQPLTGRVIAVTGAGRGIGRAVA
                     ARLAAAGAAVAIGDLDTRLATEAAGALSTRPGGRLLGLPLDVTDTPSFEDFLRTVETR
                     LGPIDVLINNAGIMWVGPFAEEPEEAALRQFDVNVHGVLRGMKLVIPGMRKRGRGHVV
                     NIASAASKVAPAGEATYAATKHALHGYSTAVRAELRGTGVHMSLVMPGVVDTELAVGT
                     ATGPTRRLTTDQVADAVLDVVLRPRFEVFVPRQVAALTRLAALLPGRARDALHHLLVP
                     NQLAALSDRSVRAAYEQRTRTARHPES"
     CDS             173107..174243
                     /codon_start=1
                     /locus_tag="SAVERM_153"
                     /old_locus_tag="SAV_153"
                     /product="hypothetical protein"
                     /protein_id="BAC67862.1"
                     /transl_table=11
                     /translation="MTTTPKPAPSAKKAQDAAAPRPIPEFEGVHDVWPRGDRLSAVRS
                     AAATYRERFVQQGRIHAVRSFDIAAAPYPTRFGFHGAALAVNPFVSIVNRMLVVQFDG
                     FDGEPKTLVWEPTVAAGTAQAPFYAQLKRLAGDFLTEHVFARFYQDPNTVLPSCGLRP
                     EDVDFVSFDHLHVQDVRMIMGSTRTIPGERAPREALFPRARLLVHRRELGTFESTHPM
                     QWAWYVDGGMDGVPPERVTAFDGDVELGVGVSLLWTPGHTDGNHSLVLNTPDGVWVSS
                     ENGISADNWQPELSRIPGVRRHAAFYGHEVVPNANTLEDSLNQYDSMVKEKTLADPSR
                     RDPRWLQILPSSELAPFKRHWPVRPSFLHGGLNYGELTPAGGRR"
     CDS             174240..175163
                     /codon_start=1
                     /locus_tag="SAVERM_154"
                     /old_locus_tag="SAV_154"
                     /product="putative hydrolase"
                     /protein_id="BAC67863.1"
                     /transl_table=11
                     /translation="MTGPAARRIAADGVELAAYQWGTSTAPAVVLVHGYPDTSAVWHP
                     VADRLADHFHVTAFDVRGAGASHRPRGLRAYRMSRMEADLEAVLDAVSPDRPVHLVGH
                     DWGSIHSWESVTGTRLAGRIASFTSISGPCLDHVGHLIRARLRPRHPDLPKVLRQAAR
                     SWYIAYFHLPLLPALTWRALGHRWRAFLTGSQGVPGHTPYPAPTLARDAVSGTALYRA
                     NMLPRLLRPRDRPTTVPVQLIIPTRDFCVTPVLSYGVEHWTGQIQRRPIDAGHWAQLS
                     HPEEVASRIAEFAHRIEDGSRRTPDRTAHPI"
     CDS             175255..176166
                     /codon_start=1
                     /locus_tag="SAVERM_155"
                     /old_locus_tag="SAV_155"
                     /product="hypothetical protein"
                     /protein_id="BAC67864.1"
                     /transl_table=11
                     /translation="MFRAAHAHPERPSEPIDHHDLVLQPRDVTFDWSTTPLHWLPGEP
                     FATHTFDVLHLMLPELERWFVRTFEQALPLITDDRLREDVRGFIGQEAMHAEAHQEVL
                     EHLLAKGLDPAPYTRQSEWIFRRVLGDRPELTPAATHAHLLQRLALIAAFEHFTAYMG
                     HWILSNGHLDRAGADPAMLDLFRWHGAEEVEHRSVAFDLLVHLDPRYRRRVTGMLVTA
                     PVLTRLWIRGVRFLMSADPELDDRVEVRFRDYLAAARKDLLPPPVSFARSVLRYFRPG
                     YHPTQEGSTQQAVAYLATSPAARAAAQ"
     CDS             176190..177290
                     /codon_start=1
                     /locus_tag="SAVERM_156"
                     /old_locus_tag="SAV_156"
                     /product="putative iron-sulfur oxidoreductase"
                     /protein_id="BAC67865.1"
                     /transl_table=11
                     /translation="MDTSTPLTRPPDLYGRPRSDSFMQKLAALSDHAVTRLARRSTPP
                     RHPQAAETPAIRELVVATKHQEAEDVVSLRLAAPDGGILPPWQPGAHIELHLPSGRKR
                     QYSLCGDPADRHRYRIAVRRIANGQGGSAEVHDALSDGMRVAITGPRNAFPFAAEASI
                     LLIAGGIGITPILPMAREAARRGLDWRLVHTGRSRGSMPFAAELAELTAAAPGRVTIR
                     PDDESGAPEAADLLSLSPATGAVYCCGPAPMIDGVRRAFGDSRASALHFERFAPAPIT
                     DGRPFELQLGETGRVLPVPYDRSALDVLHDALPDLPFSCRQGFCGTCRVQVAHGHVDH
                     RDRRLTATERAAGAMLPCVSRAPEGERLVLEL"
     CDS             complement(177538..179952)
                     /codon_start=1
                     /locus_tag="SAVERM_157"
                     /old_locus_tag="SAV_157"
                     /product="hypothetical protein"
                     /protein_id="BAC67866.1"
                     /transl_table=11
                     /translation="MTQPDRILSDPCGTIVDMVARVEPDLTVEQIRDAVKQAAPSRTA
                     RRSLAKTLTADPALLTSRRPEGSRSVERLIHKLLAHGARQVAVPLCAGCGKPEPLPQR
                     RGKLRVCAYCDATARAQQQPCADCGLPRVIRYTGRNGEGLCSSCQPKDNIDWAQRICD
                     HIATVDPTVPAETVRQIITTITRGRPHYVRRLAWDLEDRPGMLTGNAGHGTPKVIALI
                     DALRDAGAQAIVRPPCPHCGRTSVTLRNTLGDVRVCPTCYNTRKAVNCSRCKRRSPVA
                     RRSPDGQSICNHCDRTDPINHEECSGCGRLRPIIRRNSPTGPLCDTCYRPPVAICLLC
                     GHARPCFGVAGGMPRCENCTRLREPCLDCGRTMPVKARTANGPLCETCFKKNPVSFKA
                     CTRCGTVERLRHHGLCHRCACNEELTALLAGPDGAVAAPLMQLHSTLMASNHVRVLDW
                     LQKRNTAVSVLREIATAECSLDHESLDARTDKAVEHLRAILVAAGALPRRDEQLVAAE
                     RWIAAAVAAIADLSDRHTIQAFATWTHLTRLRKYSRRKPITAGQAVSARRSVKAAVGF
                     LAWLRAEGLNLEAVGQRDLDRWLEGGPTTRQYARDLVLWAVRTKRATNISIPARLKNS
                     PTQALDEDERREIAHRLLGDDQLDARDRVAGLLSLLYAQPFSVIIRLTADHVVVREKS
                     VLLRLGKEPLELSPELGNLIQQIAADRRRDGQIGQIDAHWLFPGIRPGQHLSHITLAA
                     RLKRLGIRSLPSRTAAIRDLTAEVPAAVVNRLLGLSTSTATSWAKRTAKTSYAAEIAR
                     RSDSDK"
     CDS             complement(179949..180287)
                     /codon_start=1
                     /locus_tag="SAVERM_158"
                     /old_locus_tag="SAV_158"
                     /product="hypothetical protein"
                     /protein_id="BAC67867.1"
                     /transl_table=11
                     /translation="MTAKLDYRWKLREVMATRGMFSTISLQPLLAERGIDLSSSQVYR
                     LVTERPERLSLKVLMALLDILDCSMDDLIEPVASASSAAKPKRAVGDADTSVGSFRPK
                     RARIVPRSEP"
     CDS             complement(180284..181426)
                     /codon_start=1
                     /gene="int1"
                     /locus_tag="SAVERM_159"
                     /old_locus_tag="SAV_159"
                     /product="putative tyrosine-family recombinase/integrase"
                     /protein_id="BAC67868.1"
                     /transl_table=11
                     /translation="MARDVEAPIGSARLELVEGVRLLHPADAVLEAMLTGWGRQQRGG
                     RHLQEKTVSDRIATIRRFVKFADAFPWTWGAADMDEWTTHLVAEKHLQPSTIRATQGA
                     VRMFCDYLLDPRYDWAVECERRFGTHPIQVCHEWNTLDHLLDYEGDPDRRPMTRGELQ
                     QLFDHIDERVDLAIRRGRKGALTAYRDATLFKVIYGWGLRRTETARLDTFDWYRNPKA
                     KEFGRFGMLEVRYGKSSRGQPPKRRSVCSTMPWAVEAVEDYTTNIRPRFKGHDRSKAL
                     WLSERGTRLSAKEIDERFSVYRKALKLDEDLVPHCLRHSYVTHSIEDGADPVFIQQQV
                     GHEYASTTALYTGVSGDFANTMMRKAIDSALQRDLQDFGPGGRSRR"
     CDS             181802..182389
                     /codon_start=1
                     /locus_tag="SAVERM_160"
                     /old_locus_tag="SAV_160"
                     /product="hypothetical protein"
                     /protein_id="BAC67869.1"
                     /transl_table=11
                     /translation="MLYLATPSGADVRAAMQAGLLACMTTPAQGNVIPPGALYACDNG
                     KFGKGWPGEQAWFAWLTATVNRYSRGRCLWAVAPDVPMDAAATLAESLPWLEPIRALG
                     IPAAFAAQDGSEHGLIPWDSIDVLFLAGSTEWKTSPAAHRLAVEARKRGLAVHMGRVN
                     SRRRLRIAQAFGCTSCDGTYLAFGPDTNLPASWPG"
     CDS             182430..182948
                     /codon_start=1
                     /locus_tag="SAVERM_161"
                     /old_locus_tag="SAV_161"
                     /product="hypothetical protein"
                     /protein_id="BAC67870.1"
                     /transl_table=11
                     /translation="MTTRLRHIGAAIMGILDPIPSTVPSPMREEEGAWVRAHAWTKGL
                     RKIEDAYPCGFHRWCSCERGICPGCASGHHDRCVSAGGPRVDEHADTITDAQGFVVAV
                     IRFRPGQRPCRWICPCPHPTAVEETAETGKPEKPPAAQHAVPAQRPAVAPEGQLPLFA
                     SGPQEHGDGEAP"
     CDS             182945..183952
                     /codon_start=1
                     /locus_tag="SAVERM_162"
                     /old_locus_tag="SAV_162"
                     /product="hypothetical protein"
                     /protein_id="BAC67871.1"
                     /transl_table=11
                     /translation="MRFPVQETLPFEDLPEVPTASPWCQRWREGRHSWAHVRDGGFDA
                     RRYTVDVIPDEEPAKGFVLAHHYSGSYPAVTVQFGLYDVVDGERRLCGVAVFGVPVST
                     AVLTKPLPELRPYTESLVCSRFVLLDECPANSESWFLANCLKRLLARGVHGVVSFADP
                     VPRRTASGLLVMPGHVGTIYAATNAVYASRATARTVSQQRLDELCAEVEQIAELLVAR
                     PEAAGEAIEAFNAMTGHDYVALDFAEYYGSRSLEEFAKEAARPARPVVADINRDELVE
                     IVRRLLTASAESGYYLRLLEANVSHPRVSDLVFHPSDILQDPSAEQIVDEALKYRPIA
                     L"
     CDS             184316..184795
                     /codon_start=1
                     /locus_tag="SAVERM_163"
                     /old_locus_tag="SAV_163"
                     /product="putative secreted protein"
                     /protein_id="BAC67872.1"
                     /transl_table=11
                     /translation="MKIRRILTWLAATAATTALILFGASPASATVYWQTYSTNSNWHC
                     GPTTKTPLSNYVVFQTCIVVTPDKTKGQAVLIVTNSSTKDVILRQGEVHSDELYGVNG
                     YSTCTYDYTLSSGQSRACFGPTVAFSTCGDGYAWGVLHANSFDYAMGTETVRFVTTC"
     CDS             complement(185138..185368)
                     /codon_start=1
                     /locus_tag="SAVERM_164"
                     /old_locus_tag="SAV_164"
                     /product="hypothetical protein"
                     /protein_id="BAC67873.1"
                     /transl_table=11
                     /translation="MSRAKWVRTRCRHGSGSSPSAQRPVRCPVYVAGGCGHVVRAGAA
                     ACGPGRLPSTVRAPSRYRILCPYVRVRPAETP"
     CDS             185890..186507
                     /codon_start=1
                     /locus_tag="SAVERM_165"
                     /old_locus_tag="SAV_165"
                     /product="hypothetical protein"
                     /protein_id="BAC67874.1"
                     /transl_table=11
                     /translation="MYQAFTPQVRALRKETDGPLMFANVLGMRAEESPDRRNREMWRR
                     TTDNSARIVDEWLPAHQVSTEEVWERTISAGLPYHWCYDSYPGAKDRGGSSRCSCSAC
                     TLANHRDLLLTAGRRPRMAELCALVERVRQVPFNPNITMAELIALSRRRDAPDPGVLV
                     EETEDFERMERDVHAALRKPPTWDSKARTGPGEILHSAAGCDGCH"
     CDS             186549..186905
                     /codon_start=1
                     /locus_tag="SAVERM_166"
                     /old_locus_tag="SAV_166"
                     /product="hypothetical protein"
                     /protein_id="BAC67875.1"
                     /transl_table=11
                     /translation="MTMTTTQRILDLAAAAPASHGEDLVLLLAEANELYQQGLQELHR
                     EMASRLGGLATEDLMFAAETAGMPCDASQDRDEVILLLALVEWEMTPAAIAYAEMAED
                     AARRGVCLVPEEGREP"
     CDS             187026..187742
                     /codon_start=1
                     /locus_tag="SAVERM_167"
                     /old_locus_tag="SAV_167"
                     /product="hypothetical protein"
                     /protein_id="BAC67876.1"
                     /transl_table=11
                     /translation="MTSRREPRLADAAEIAAEQGLTPSRISQFYTERAENAAGRTFPD
                     PVDKRGRARLWNHAEVTEWFADRAPSRLAEHAPPSLPPGTLLNAAEASRYLGYKNSSQ
                     VTTFVRDHPGYFPEPDVVEEKGTAANPYRRQLWKVETLQAWMATRPGRGRRAGAKEAP
                     PLPDVPVDGDPEELLGASQAAALLGYKTVGSFSSSLSQGNLPLLKTTDGVAENAGRQN
                     GRRRWTRRRILEQAAQRSKK"
     CDS             188180..189094
                     /codon_start=1
                     /locus_tag="SAVERM_168"
                     /old_locus_tag="SAV_168"
                     /product="hypothetical protein"
                     /protein_id="BAC67877.1"
                     /transl_table=11
                     /translation="MNSAAQSIPATAMAPTPAEPLTHQVLAGLAQHRIATTSQMRRML
                     RPDGTRQLMSRVLNRLRSDGFVDCTVLPDANRTRTNAWYLTQEGARLTRDLPVLRGRP
                     PYPISSMTAASLKTPHTLAVVRAHLAFAADARRLGHEHGPWDWTPEVSHSIGEGERIV
                     ADAVMYYTVVESEHRRKLRAFVEVDRSTMSSERLAVKLIEYARLFQYEAQPVGRRRQA
                     SVGPAWLRWYPVFPRVLFVLTGASRVRLENRMSDLQAMVAQHPLVAGLAREVRLGAAV
                     LEDLEQHGPAQDVWMPLVGGNSRPWTDL"
     CDS             complement(188910..189866)
                     /codon_start=1
                     /locus_tag="SAVERM_169"
                     /old_locus_tag="SAV_169"
                     /product="hypothetical protein"
                     /protein_id="BAC67878.1"
                     /transl_table=11
                     /translation="MNGVRGGQHPSWRSASSQFTPTPGAIHGEAHREEGQQQTSTAVR
                     RPATEGLARPRRHPRAARHSSGRGHRRRAARHGRGPAHPGLRSSIEQGTAGAALLDGL
                     DGTTKTFFEDFARRTIGHPRADSMASVSLTLVAANEQDQPIGALSVTAPGTIIERALE
                     YGYSNVQAVILSVAIGKVHGLAVAEQARGQGLASFLLKRAWQVYDQLGYFLLHGSLET
                     ERDLGAFYKGCVYTVYAPGEGFACSPAGGLPAERPPAVHLTGPSTGANYLRPEASTRL
                     GRDRAAPGLQARRLPAGPPERDPPRVGAEPPSPADRSSDSPA"
     CDS             complement(190026..191453)
                     /codon_start=1
                     /locus_tag="SAVERM_170"
                     /old_locus_tag="SAV_170"
                     /product="hypothetical protein"
                     /protein_id="BAC67879.1"
                     /transl_table=11
                     /translation="MTDTRRRPTPSGFTQHLHPFPADLGRWEAEHARALRTGHVRDHT
                     CTAECEPVLVYERTRWGWLAWTIPGDGSQPELPHQIGVLTPSATPTQRLALRWLTRRP
                     GRRISLAPGTPGSLRVVTVAVALFSLLAGLFAMADGIPADVALPAIVLAPLLAEHLPT
                     TLDARAREHVRSVEGASACCYLQRLAALHTYLVQAAAVSDRYELRRSAQISQHLLWDA
                     ADLLQTQDTRSASCELIARERLMLQLTHQVAQVLRYPSARSAPADADQAREPERPPRP
                     YRQAPQHTPGTSPPKGTPLMPQSNPAARTSDIYLLFAHEPYYPGPGTLEINTTVVAAD
                     TLLHPWILQPDGTRIHDLLTQGRQPREVIPLATLTHELNGGADWPTVGDWERVTADLV
                     QLVQTQRCDALSLGLPAVARALICTGPENQVRAFNAAAGDFTVYGPDDRTKVLTEVGM
                     FLTGVAAEQPFWPGDGLLPPLCQSA"
     CDS             complement(191479..192900)
                     /codon_start=1
                     /locus_tag="SAVERM_171"
                     /old_locus_tag="SAV_171"
                     /product="hypothetical protein"
                     /protein_id="BAC67880.1"
                     /transl_table=11
                     /translation="MTRFGAGIRRGVMAADQFTQIANGLFRDSRLSFKAKGICGYIST
                     HVTGWHVTVADLVRVGPDGRDAVRAGLSELQRHGYLIREQLRHDDGTLGDIVYSITDH
                     PAIADAALAQTAGTAFVSAPQAGAGFGAGVRRGVMAADQFTQIANGLFRDARLSFKAK
                     GVFGYISTHRDGWRMSVTDLARRGRDGEAAVKSGLKELEKHRFLLRERERHPDGTLGA
                     AAYFITDLPSLQNTSSQPLSGFPPVDNPTSVNRPTKNTNRKNTTKQKTNPLRPCDRGD
                     AARTNARTVPSHATTSPKPPTPADEMHAGIRLLLDIGASRPELLLTGPALTDQGRVAT
                     VMLEAGWSAEQLRHVITSRPLPNLVRTSIGAIIAARLRAAQAYPPPATAARPGAAPLD
                     EPFAEATRERSSTAAAARSVTQALTYRALVECAGCGVPATAPGDDLCPTCLGWPLCRT
                     CPGPTRKRAHPDGDGRCTTCASA"
     CDS             193615..194553
                     /codon_start=1
                     /locus_tag="SAVERM_172"
                     /old_locus_tag="SAV_172"
                     /product="hypothetical protein"
                     /protein_id="BAC67881.1"
                     /transl_table=11
                     /translation="MTMSPGKQAAESGAAPAMAAGVELEKMRRRVRVSRLALFTAIAA
                     GPVALGVAVMSGPTTVVAAPLDKPTAVRSAVASDPAGYAQLFVDAWLRSSADDANSAQ
                     ARLAQSLAPDVDLPDPVAGAQPKPAAVTAVRSAQREDGEWAVTVAAQYADGRVRYFVV
                     PVAADASGSSFAVTGAPGVVAGPARAAVSQSLFGVSVPSGGDLASAVGEFFGAYLTGA
                     GEVDRYLAPGVKLSPVSPAPYTAVTVQEVWGAEEAVAAEEVPADGTKVRVRVQVEARD
                     DAGRWPLAYDIDLKSRSGRWEVAALESGTGGGGGAR"
     CDS             194571..194891
                     /codon_start=1
                     /locus_tag="SAVERM_173"
                     /old_locus_tag="SAV_173"
                     /product="hypothetical protein"
                     /protein_id="BAC67882.1"
                     /transl_table=11
                     /translation="MLAGRLDETGDGWINMLESWATKGFKAGLMALVVIGMVQKFSLK
                     AGLGALLLMVIALGLYDSRNDLADMFTDEVKNPSKGAPAVPGIVRGPDPLARVHSDGT
                     GDGL"
     CDS             194888..195463
                     /codon_start=1
                     /locus_tag="SAVERM_174"
                     /old_locus_tag="SAV_174"
                     /product="hypothetical protein"
                     /protein_id="BAC67883.1"
                     /transl_table=11
                     /translation="MSAATMGRVGRFYTSARRHPWVLGKVADWKIPLGPYTPAQIAVA
                     VGGGFLLVKTISWWSWMGPVPIVAWVLTVWAVRRPKIKGRAPLQAALGWVLLAWQPQG
                     GRMGGRAARDRLSRPLFGGFTLEVAAPAVPVMATLRVDQPAADRKARRGPAVRPSARP
                     RSAPQARPVSVGPVSGVQQLLALAEQAGGAR"
     CDS             195460..198141
                     /codon_start=1
                     /locus_tag="SAVERM_175"
                     /old_locus_tag="SAV_175"
                     /product="putative ATP/GTP-binding protein"
                     /protein_id="BAC67884.1"
                     /transl_table=11
                     /translation="MRVPIRHIAGHLVWSTHGSVWALYRLHPGPDERGRREETVQGTY
                     VPAAVRDEQLAKITHLIRSLSGAPRLFGLCAQVDPGEIALRMIEGIEPGETAADGGPH
                     PWVENVEATLDLLGEQEMHRRTLWLAVPLQNEAAGGQMTASLGAMWADVAPMLGMRAA
                     PVARREVSGYREQASRVEAALAGGVAFRPARPAEIVWMIQHTLHRGLEEPLLTEAETS
                     DLYGGQLRAGMLQSPSYADLGQVRLQEGGVDLALDDVEGLSGGDRIGRSGRKAWWRLK
                     TSSPLRRRWLQVESDAGVGYQAQLALAECPPAVSQDAADLFAQLETLDFPVDYTVDLT
                     LVPAEKARDQVRRKKNELVDQADQYDARPTGMPASLTDAARDLGELDARLSRTSVEVE
                     VQSVTVLTVWGPTAAVCDARARALAALLGGADYRAVRPAGLQEALFTLGLPGTARPGV
                     VREFTQHQVSEDWALGGAFTAAEVGDPNGMFLGIDLDCGTTRPVMINVADAPKQDASA
                     SMGIVGDLGAGKSVLEKLISESVWARGGVAICIDRTPVREWATFARTAAAGRCQIIDA
                     AQAEVSIDPLRMFDGPEGRHYALSYLTLQLGIGPMSTNGEVLHHAVERAAAGDAPSMH
                     RVLQVLDEMAGAQAGKRQDAAATLAGLIRVVASNPLAAMVFDPALPPVRLDASGASDM
                     IVITTTGLKLPPKAAFDKPEVLHQQPLEALIGRAVLYLIAAIARQTAFEDPERFTAVV
                     LDELYWLTSSAEGTALVHEILHDGRKHGAGLLAGSHDAEELGPDRGLMAYRALARTAD
                     RERARRGLEFLGLDPHDPELLRLVTTGLSPVGQRGREGEFLIACPRQNTGRIKVVIPR
                     IERISSSITTTPGRRTTAPGSAPLAGAATGDRPKELR"
     CDS             198138..198488
                     /codon_start=1
                     /locus_tag="SAVERM_176"
                     /old_locus_tag="SAV_176"
                     /product="putative secreted protein"
                     /protein_id="BAC67885.1"
                     /transl_table=11
                     /translation="MTSFAPSRSRRLAAAASALTVIAVAVGVLVLALGVSLPEAWWPR
                     TGQAFAADAAKAPADPCDRIAGPAKAYCERGRHATSAQAGGDAAAWKLLSAATAIGAL
                     VIWRRRAHTRQGRA"
     CDS             198490..201222
                     /codon_start=1
                     /locus_tag="SAVERM_177"
                     /old_locus_tag="SAV_177"
                     /product="putative membrane protein"
                     /protein_id="BAC67886.1"
                     /transl_table=11
                     /translation="MFRPDRGTLRSVGFVLLVTGVFVMVNSQVVYAASSNSETGDLLT
                     PLNITSSEGVPINGYELNAEGGSIVAFKTQALAFALSGLFTLIRMLVGLAGWAIEVAF
                     RFPLLKILSRPAQKAADTYDNVVVDTLGLKGLLLAWAFVFAGFMIVRGRVGRGLGEIF
                     LTLLIAAFAASAFVRPDTLLAQDGPLGQSQQVAAEVAQQSVNSYDWGGKLASKGPCEG
                     MAGSAEITCLEREGEGPVSAAEVARPIQDSITNALIVKPYMLLQYGRILDPAKPADRR
                     AYAVHLMWVTGGYKAGAKKDNEDKKDACAKIKGEAKKYCERDTDVVPGNNGSGTLPEL
                     TPGGELLDASHAIVTDEDREFYAFLQDMKKTGDVGKSCAAYAEKPTWWRVGGAALLLI
                     ATLFICGMLLSSAIVLLGTQGICAAAAAAGGVTFIAGMLPGPARQSVWKWLSIWGISA
                     LTVVGVCAFVPFFGIAVDATITNGPDLMVERILLIDVLAIAGTAGHRRLLTGITSFGR
                     RMAMRMRYAKVGGTHMPGDTSELGAALAMNSPAALGGYGGGLRAFTGGGGGRFGLLGT
                     RQRLMGALTSLFDGAGMPVDTGRVLADAGAEAGRGLAPLTAAAAVSGAGARLGAKGTH
                     WLLIGRRPDKEQLAKWRKPTADGDPDAGGPDGGPDGGSGGGGPRRPGGPPDRYRDEDG
                     QVVDRRTGQVLHDQNTDRTLLSTRAHNRLVRLRGYRILNRGGRAAYGTTVGLPANVRR
                     ARSGKSQYLLDARQQVQVWGNTVREDGRAWADTGRHVSRVLREHTDDSGGPGPFVTRR
                     LPARPAPAPRPTGSSSSPARTRQASPRASASASPASVSTRPSAPPTSPPRLGSGAPRA
                     AAGGRPGRTAPPGDGGAEGSASTGNRARMQELMRQAEALREMRARWQVEDGEDG"
     CDS             201219..202370
                     /codon_start=1
                     /locus_tag="SAVERM_178"
                     /old_locus_tag="SAV_178"
                     /product="putative NLP/P60-family secreted protein (PgpA
                     peptidase)"
                     /protein_id="BAC67887.1"
                     /transl_table=11
                     /translation="MRTARRRKTQWGCVVVLLLFAAVCCAAPAGNAISAYVALKTGAS
                     ADGGVAEGGTAADIPPRMLTAYKKAVQQVGKHVPKCQGMRWPILAGIAKVESNHAVGR
                     NIADNGDIRPRIYGVLLNGSGAGGNTTAFPDTDGGKWDGTASGERAVGPFQFLPSTWE
                     GIGEDANGDKTADPHNADDAALGAAAYLCGNGRDLTKRAQLKAAILQYNHSNEYVSNV
                     LGWIDQYTAAAKDPDLKNVTGKVRTVIEAALSQRGVPYSWGGGNASGRSYGICCSPSG
                     KSGASIKGFDCSGLTLYAYAKAGIQLPRTAAAQAGVGQRIPTSLGSDALNAGDLVFYA
                     DAPGHDSTIYHVGIYVGSGQMVNAARPGTVVRLDAVNAMSGYAGGARLL"
     CDS             202367..203014
                     /codon_start=1
                     /locus_tag="SAVERM_179"
                     /old_locus_tag="SAV_179"
                     /product="putative secreted protein"
                     /protein_id="BAC67888.1"
                     /transl_table=11
                     /translation="MTTSPARSPRLLLIATGVLVVAGVILLTVPHTQSAPSASAPPRA
                     AAPTSHPSASASGGRTGQASGLAPAPASTASAQSASASALPPHGEGTAGDAVIHKSLE
                     DAWPADLAADEERKLLAAGRGLLRADATGIGRAKWPAIFGDPDQAVAPAFATARFRIQ
                     AAIARRDGSPNKAVVHLVWAGTDRGGTYTDRRITDRYFTRTSTKGASTWTPQPRT"
     CDS             203056..205614
                     /codon_start=1
                     /locus_tag="SAVERM_180"
                     /old_locus_tag="SAV_180"
                     /product="putative ATP/GTP-binding protein"
                     /protein_id="BAC67889.1"
                     /transl_table=11
                     /translation="MFTGIIHTVGWVIAYWYVPVAAAIVIWAVSETAVRRLARKASAE
                     RMALELVPSRHFDPGLEEIFRRGVQLARASTSMPWWAPRRTKAVQIRLRADGSSPLRY
                     RIEGPAGGERLLSITPFGPGVTVNRARPLVDKPREHVVRAEFILRGKPTAPLREVPLD
                     PDPLQPLIDAVCDLRAELGDLAEIRLDIQRAPKWALRARRVQLMSDARRRERREAQRA
                     ARWVRQDATGIEDSLAWQLQQLVSRKQDGGGRRLVMPPVPRRVDPQDALGKLAGDDHL
                     VRVQLLVMCASNTEGRAEARLAQLQAAFDVFGGGSRWAMRGWRVGPWRFGADRWPSRR
                     GFERRWRLGHCQPPRPNWVRLEELLGLLKPPTVHCRLPLLAADLPTFEFGNPELLLQG
                     IYRSPDGRRRLIASYAKETLFEVGVGKAGGGKTERALAQAIGWAHAGGGLLFVDPHRD
                     SWPRALPFLAHDALMQRIALIDLNAHGTSPHVSCWNPLGMHQGQTAHEVVEATADAFA
                     SALGWDDASAPRALTILTAALAVLVAVNETACQAGRPEDQATVFHLRALLTDPLFRAA
                     ALAGVEGRLEEETRSWWQTVFPTLPADSFAVVLNPIARLAANPVTRAFLGQPAGVYNI
                     RGAMDSKMIVWVCPGGNGPTDRLITALLARDLLRAVRSRRDTPEGQRVPFRPYFDELI
                     TLTGAAPETIASMFEDFRKYKVHVHGMTQLLARLPNPVRLSLVQNASTLASTAGSQSA
                     IAPITAEWGDRPGPDIVAALDRFEHYMSLTVRGARVGPVPITGPHLDEVFADYARPRQ
                     AAALERSARAMAGAAPLDQLTALATNQLNRVGDFLAQHAPTTRPAARLQKKGYQ"
     CDS             205611..206525
                     /codon_start=1
                     /locus_tag="SAVERM_181"
                     /old_locus_tag="SAV_181"
                     /product="hypothetical protein"
                     /protein_id="BAC67890.1"
                     /transl_table=11
                     /translation="MTTAFETLSSGRTPSPVEPLPHQLLAVLGQHRMATTGQLHDLLR
                     PDAARQTVSTPLNKLRRKGLVDYAVLPQSNRSRAWYLTGEGARLVRDFPALRGRPPYP
                     ITSATAASLKTPHTLTVVRTHLAFVTDARRRGDEHGHLDWTPEVSHPLSDGEKIITDA
                     VMHYTLIGDDQRTKLRAFVEVDRTTMSSERLASKLIEYARLWSYEPQPASRSRARQPA
                     VPGAVWLRWYPVFPRVLFALTGASRYVLDNRISDLQAMVAQHPLVGTLARQVPMGAAV
                     LEDLEDKGPTRNVWVPLAGGKPRPWTEL"
     CDS             207837..208697
                     /codon_start=1
                     /locus_tag="SAVERM_182"
                     /old_locus_tag="SAV_182"
                     /product="putative secreted protein"
                     /protein_id="BAC67891.1"
                     /transl_table=11
                     /translation="MDGHGVDRERSSLLTRRLSLLIGALVLAAAGTAHADDDPDVGAG
                     KCQVIKFCVGVGVDDETGGKGTQTGSQGSSGSKTQCKLTKVNPKPPANHPVWNGADPK
                     KSDLYFRACTDGGDGFVVVPQGQPAPQVDPQELAQRAVDSMTLLGPDIASPRGAGKYT
                     VGVPTWMWVNQSATTFGPNTASASAGGITVTATAKVSKIVWQMGDGASVTCNGPGTPY
                     QASEGMAQSPNCGHVYSKSSAGARSGKYPVTATSTWTIDWQGGGAAGQLTEIRQTNVQ
                     VAIGELQVVR"
     CDS             208719..209423
                     /codon_start=1
                     /locus_tag="SAVERM_183"
                     /old_locus_tag="SAV_183"
                     /product="hypothetical protein"
                     /protein_id="BAC67892.1"
                     /transl_table=11
                     /translation="MSKSQERLAASPNGVPQQGRVSGAVAPPRVSARRRRPGVIALSL
                     ALIAAGGAGVAVLLLQVGHRTEVVTVARDVQVGQVLSEEDLGKASIALDPAVKAVRAG
                     DLDSVVGKRAAVELRPGSLLAPSQVTEDSLVKAGEQLVPIGLKSEQVPATALVPGQKV
                     ELVHVPAQGVEDTGKSSGLSPRTIAGRVVKASGAAPGSGVVVVDVATSADDGPIAAAW
                     VSAGTLRLVLAAPDGS"
     CDS             209423..210250
                     /codon_start=1
                     /locus_tag="SAVERM_184"
                     /old_locus_tag="SAV_184"
                     /product="hypothetical protein"
                     /protein_id="BAC67893.1"
                     /transl_table=11
                     /translation="MAVIALAGCSGAPGVTTSALALLLSWPLEQGRKMILAECDPDGG
                     AVLHGLLQGTLGDRYGLRNLSVAARKGESGDAFWRQLIDLSSDDGKQESPRDRLLLPG
                     ITDPAQAASLVSVWKALAVAFRGIDASQGHDILIDLGRTGAFGPSAVLAEQADAVVVV
                     VRNTLRSLQSAQARVAVLEKRVGDVGLIVINEGPYPAGEVQRVLQVPVVATLPYAPKD
                     AQVLSDGADQPRHFTKSALMKASRTCSALLVQRAAARRARLDPRAAFVGGGEVTRAR"
     CDS             210240..211733
                     /codon_start=1
                     /locus_tag="SAVERM_185"
                     /old_locus_tag="SAV_185"
                     /product="putative ATP/GTP-binding protein"
                     /protein_id="BAC67894.1"
                     /transl_table=11
                     /translation="MRGKPLHPDPTVAPPPGRPQPAWPHQANGTAAGAASSTHALGTA
                     TPQVTVDYQVARHIAGQVAKQREELLKAKPDMDRASEQQRCLDWINEAVALWSDSAAM
                     APQEDEALRRAVYDLLFRAGRLQPYLDDERVEDIIIQGPDEVWLDYGDGERRMVGPIA
                     ESEDELLELLRELARSSGHNERTISTANPTLALSLQDGSRLQAITGLGPMTYAVIRRH
                     RVSHAGLDDLVRLGTIDPILRDFLGACVRAEKNIMIAGKQKAGKTTLLRAMLKEFGPE
                     CRFATIQTEDELFAHANGYHRQVVSLVGRESNGEKDVTGRGAGEVTLLDLMHPALRMS
                     LERIVVGEVRGPEVVAMMQALTNGSGGNLCTIHARRPDIIFDRIAELYALAQDNLSEQ
                     LAYRQTANGLDFIVYVDMTDETQIGGRRHRYVSHVLELTGIGENGRPATNTVFSPGAE
                     FGELRAVPRMDPGCVDDLRRVGFDSAQLQQPYGAWQAPLQLKVGVIR"
     CDS             211730..212659
                     /codon_start=1
                     /locus_tag="SAVERM_186"
                     /old_locus_tag="SAV_186"
                     /product="putative integral membrane protein"
                     /protein_id="BAC67895.1"
                     /transl_table=11
                     /translation="MTLLWGLLSGMAVIGGLIGVVAGLVGTTAPRRAPLQQRWQALRA
                     GKDQGEDVRLRRRTLAALAVVVFVAVWLVSGNFVGGALLGVAVVGVPWLISPAQMAQE
                     RIGQLEALSEWTQRLAGLLRLGMGLEQAMITSRQGAPDELAPQIVNLSDRLRLGWRPD
                     GALRAFAEELNDVTADKVVAALILSVNDRGPGLAQALEDLAGTVRDEVAKKRAIEADR
                     AKPRTTVRWMTVITVGVVVAGFFVPSYTKPYSTLLGQLVLAFLTVGFIGVLALMRQLG
                     AFRRIPRFLITDPSSTVRLPLAGDGAGRAGRWP"
     CDS             212678..213562
                     /codon_start=1
                     /locus_tag="SAVERM_187"
                     /old_locus_tag="SAV_187"
                     /product="putative integral membrane protein"
                     /protein_id="BAC67896.1"
                     /transl_table=11
                     /translation="MNLFPVVLTGGAVGAGLALLVRELLRPQAALGPALQRSAPATLT
                     MPEPELDREEVWGRWLLARLERLPGVRIPTINLALLGQGRGQFMLRKTTLAALGLLCP
                     VIATIPWIIAGVSLPFYVPAGVGLLIAGLLFITPDLAVRDQAKRAREEFAHALSAYLD
                     LVALKRAADAGPAEALEKAAEVGLGWPFLFLQGALRRARMEKIPPYQALTELAAEYDL
                     PVLDDVADIMRGSATDGAAVYKALRARTAALNSELLADQAAEANAASEKMTAPGALLA
                     VLVMLLMAFPAVIRMLTV"
     CDS             213608..213823
                     /codon_start=1
                     /locus_tag="SAVERM_188"
                     /old_locus_tag="SAV_188"
                     /product="hypothetical protein"
                     /protein_id="BAC67897.1"
                     /transl_table=11
                     /translation="MKHTAARTYRAVHWATTRLQEGLEEAKRRPDRGDISTTTVIIWV
                     AAVTGAVLIAGTIAVVISKYNGKLTGL"
     CDS             213820..214248
                     /codon_start=1
                     /locus_tag="SAVERM_189"
                     /old_locus_tag="SAV_189"
                     /product="putative membrane protein"
                     /protein_id="BAC67898.1"
                     /transl_table=11
                     /translation="MMSPPARLKDWWQGRRWGDDRGDTSIQMAIIFPFVLIATVAVIQ
                     VSMWYYARQIALTAAREGLTAARAYESGPADGAAQAREVLGRVAGDSLRGYSVSASSN
                     GQRVRVQVSGTAMSMIPGVPGLQVTQSASGPVERWTVPGR"
     CDS             214245..214706
                     /codon_start=1
                     /locus_tag="SAVERM_190"
                     /old_locus_tag="SAV_190"
                     /product="putative membrane protein"
                     /protein_id="BAC67899.1"
                     /transl_table=11
                     /translation="MNYVRYMARWARRLRSDEGSAAIEAAIILPSLIMFLWLAIAGGR
                     LVTSGSKIDAAAEDAAREASIHRTAGAAQSAAHAAAAESLNDQGITCASTSVSVNTGG
                     LSVPVGQVGTVTVTVTCTVDLSDLLLPGVPGARTLTSTATSVVDQYRQRGD"
     CDS             214706..215158
                     /codon_start=1
                     /locus_tag="SAVERM_191"
                     /old_locus_tag="SAV_191"
                     /product="putative membrane protein"
                     /protein_id="BAC67900.1"
                     /transl_table=11
                     /translation="MSFRQTGLSRARWDDRGGVTVFVAVCVLALIGIIGVAVDGGSKM
                     RATERADYIAGEAARAGGQAIDPAEAISGTAIVVDLQDAQAAAQAYLRSAGATGTVSV
                     SGDGKTLNVNVTGSYDTKFLSVVGIGSLSVTGQGKATLLHGVTAPEGN"
     CDS             215158..218625
                     /codon_start=1
                     /locus_tag="SAVERM_192"
                     /old_locus_tag="SAV_192"
                     /product="putative membrane protein"
                     /protein_id="BAC67901.1"
                     /transl_table=11
                     /translation="MRTTHSPATAAGRTLGRVLKAVLSLLVLAAAVAGLPLLLAWVTP
                     AIWASSHDDLTHLLDRQDTGAAFLLLLVAVGWIGWAQFAFCAVRELIAQVGGRSWQAP
                     RRLGASQRAAALLVGSILVLLPTSSALASDAHASPATTEARVPGQAPAPQTAEPDQTL
                     PDSASTPASRTSYTVRATRPAQSLWGIAERELGDGERWREIAALNEGRTMVDGQVFRA
                     HGFLQPGWQLEMPDTAAAAGGIRTQLGRAAPTAEGKNEHVVTVHSGDYLSKIAEEELG
                     DGGEWPRLFKASRGKTQPDGLPAISDPDVIYAGQQVTVPGAQPDPHTPPRDGDNGDEA
                     GSQETTPPATQKPDGKQKPGDDRRDEQAPAPGTTTAPAPESSAPSTPASRPAEQPGQE
                     QGSPSATASATPRPGTSPAPSAAAPSATAEAPGSADSSPATTASETPPPAPAPAPASS
                     PLNLRTVLGAGTLLAAAITGALALRRTLQRRRRTPGEKIAIASETSPAEAKLAAAAEP
                     GGAARLDVALRTLAHQVAHEKAADLPPIRAARIGTRTVEVLPEGLARKPQAPFVAGQA
                     GWWVLPAEAVLLDEETAREVPAPYPGLVTIGSTESGDLLLLNLPQVAALLLDGNPVHI
                     TEVCTSLALELGMSPWASEAEIVTIGFGEDLPQLLPTSRIAHMRHARHALRDLSERLL
                     EAHQMPETSHQPYLLLCASTLDADLAWQFADIIDKAQHVPVTLIAPASAAAASFPDAE
                     ILNASLSKPQQFDYIGSEITVQRLEHAAYLQITTALAISAQPADPAEGPWEEVPHEPD
                     TPQRPRPLDLAKPTQSGDGEKPVPASPFTAGTGDSEIYPALLAASTDPASLKLLPDPK
                     APGKAPAEPGTEPAEMTPDGRAPQKAAEATGRPQETPAAEAVGEDTQAQDLHAPEIRV
                     LGPVEVTGVATTGHGPSQARLAALLYFRPGRSADVLCADMDPVSPWSTATLNARLQGL
                     RRALGNDPAGNAYVPRRRSGDDPYELSEAVRCDWARFTQLAQRALPQGTAGLPDLEKA
                     LGLIRGRPFGTRPLPWAEPYQQEMSTRIIDVAHTVATYRTPTGPHHDLTAARQAIATG
                     LDVDDSAELLYRDWMRIEHAAGNRAGLHTAITRIQDINRKIDCSLENETEQLINDLLG
                     PTGGRARGR"
     CDS             218903..220732
                     /codon_start=1
                     /locus_tag="SAVERM_193"
                     /old_locus_tag="SAV_193"
                     /product="hypothetical protein"
                     /protein_id="BAC67902.1"
                     /transl_table=11
                     /translation="MKSGADSGQQPVKTASQNQLLCLGRAQRLVISAVVLGGLTISGI
                     GFAGSYTAVRALALKKGFGNFSYVFPIGIDAGICVLLAMDLLLTWIRIPFPLLRQTAW
                     LLTAATIAYNGAAAWPDPLGTAMHAVIPILFVVAVEAARHAIGQIADITADKHMEGIR
                     ITRWLLSPLPTFLLWRRMKLWELRSYEQVIKLEQERLVYQARLHTRFGRAWRRKAPVE
                     SLMPLRLARYGVPLTQTAPTGLAAAGIEPVLLPPAPQPQPQAEPADTVGRGTGQVTAA
                     ALGNQPAAATGGEYIQALPTDENTRPATPPKAGDPSYPCDPSHAPRKQYERDRTAQQP
                     AGKPNPTVVPDHDDSSQPEASDTPETPHHEEALDEEESRAREHSRLSPTYGYRLASAH
                     GPLPSQYVLDHHEVTNPEGHPPSLEEPDTSLDSLLPQQPRDSRRDDGRSPEPAATSPV
                     RGTRSEPGRTPRATPSAEHRAHSPEPALEETPDAEAGDSSLPDLTAVDHYYLAWNDFQ
                     QQHGKEPNGTELSAHLAQRGIHDRENHPIKPKTLTRYFLEFRIYDAWATHRARTSRTD
                     SEPVLNDLAYQGITAQYNRPIQTTDLEKRLPGFERRWHALSCH"
     CDS             complement(220848..221402)
                     /codon_start=1
                     /locus_tag="SAVERM_194"
                     /old_locus_tag="SAV_194"
                     /product="putative acetyltransferase"
                     /protein_id="BAC67903.1"
                     /transl_table=11
                     /translation="MTVNVRHYGAADLDEIRETILDLHVEVRHRDFGLTGPFYDRDRF
                     NERLSAYAARPGWSAALGYEDGQPVGFCFGTALAPDTKWWDSMKEPLPAETTHEDGHR
                     TVSLNEIVVRKSWRGRSVAWQLHEAWLHGRTEERVTLLVNPAAGNGAVQARYEAWGYR
                     SIGLQQPFPDSPVFAVMLRPTKLD"
     CDS             complement(221399..222835)
                     /codon_start=1
                     /locus_tag="SAVERM_195"
                     /old_locus_tag="SAV_195"
                     /product="hypothetical protein"
                     /protein_id="BAC67904.1"
                     /transl_table=11
                     /translation="MQRHRALDAQRRCSASLVNGRLRAGQRKKRRGPVGLGPEIFTFG
                     GPESGVEDYRGAVTANVNLAAAMERSGLSQGELASRLNQRIEALTGKLGALSDRHVRH
                     WLAGKTRWPHKRQRIVLEAEFGVSAEELGFIPPPRRTPALSEDDDVRRRAFTTATASL
                     TAAALRPAHLSSGASRVGMVDANRLEENFARLVAADAATGLTVGLETRAVAHAQHALD
                     LMAIGHASERVRRRLYFLAAAFMGTALWAALDRMETARAGRHLDRGLRLARLSGDAGM
                     EMRMWGHAALLHLQQRQFPDALAAAQMGRETQVCRRDPLFRSLAAARLAGVQSGAGER
                     AAAVRTLGQAEVAYERATPEQLRPAYMDFYDRAEFEGLAGLVMMRLGRNEESEAHLHR
                     ALSGLRPDYHRNRVYYTVLLATTQLRQGDADAACATALTKLPDDPDSLSGRTKALFAR
                     FDQDLTTEAAGAHFVTEWADRYSRGGIA"
     CDS             222871..224691
                     /codon_start=1
                     /locus_tag="SAVERM_196"
                     /old_locus_tag="SAV_196"
                     /product="hypothetical protein"
                     /protein_id="BAC67905.1"
                     /transl_table=11
                     /translation="MTSTALDALTSAIPRSVRTGHEVSIERDPASMPGHLTKADSVWP
                     GRLRRIIRAGLKLWNQPALVETAELLTTELVTNAFRHGSGTDIGFRLLISGDHVVIEV
                     RDGSPDRPVLRRASPEDEDGRGLALVSAMADEWGTTSDGTTTWCTLPLRKGSDHPMQR
                     TATPVPSLREYPAIQLPGNPNTVTRARTIARSGLTVLDWQGDVHAATEVVAIRRTPQP
                     ATLLTEEAKGTVMDWRTRAMRLAGEVVRPESRWHEPVATVPRHEFVPRWWQSDGDAWL
                     LRDGPAAPDAWLEAAYTDQTLVTRVDACPADHAAPGAMASGTPTSSSTLPSLVVRMYR
                     HAMIAENSDVLVTTGTGYGTALACARLGHARVTSIDVDADLVKAASDRLVLVAGYRPQ
                     MAVGDITGELPGAYDRIIATVSVRPVPVSWLSALRPGGRLVTTIAGTGLILAADKTNE
                     GGATGRIEWDRAGFMPTRHGADYGPPADDVWQEAAEADGEDVITSRYPLLYPPDAWDV
                     MSMLELQIPGITYRRSMDGGNRTVWLLHPDGSWARATARGFLDSPTVHQGGPRRLWSD
                     LDRIRNRLNREGALPVYGAQVTITPDGTTTLTRGSWSFTL"
     CDS             225238..226227
                     /codon_start=1
                     /locus_tag="SAVERM_197"
                     /old_locus_tag="SAV_197"
                     /product="hypothetical protein"
                     /protein_id="BAC67906.1"
                     /transl_table=11
                     /translation="MTRDDTPLITHLAGRDEELRLALEDLGLDRYLAAKRLLRATGTD
                     WGLRTSRSQVLAVVAANSRAIESWCSEEPEDVDARMMWARVLTQRLLNAHRRGLSGQD
                     LVNGVHTVWAACRAAAERWPEDPVPYVCYLALAQTDIDQRFPHSPVHWATPADAMLPP
                     GPWRLLNWVNQRDPGSREAYHRMLQVFQARARGALDFAQWVASVAPEGSALKVLPLYA
                     YVESYRLLRQRSQSVGVIAYWATEDKAHYARQALYGWFAHADPRSLSLLDLNYLAHGL
                     TATGVGQATAVFEEIGNHVTPAPWIHVTPNPQWWQDDFRSARRRALTATSGRR"
     CDS             226312..227820
                     /codon_start=1
                     /locus_tag="SAVERM_198"
                     /old_locus_tag="SAV_198"
                     /product="putative amino acid/metabolite permease"
                     /protein_id="BAC67907.1"
                     /transl_table=11
                     /translation="MSARRTRVQLDDDAALRAHGYHPELARRMGGFGNFAISFSVICI
                     LAGGMTLFGYGLNTGGPAVMMWGWVGIGFMTLLLGMCLAEVTSAYPTSGGLYYMAHRL
                     GGPRWAWVTGWLNLLGLLGAIAGIDYGCALFIGAFASLQWDLVPTPETTILIFAGILL
                     LHGTLNALGVRLVNVLNSISVWWQISGVLLIGGTLTLAPAEHQSAGFVFGHFHNATGF
                     TSPVYVAALGCLLAAYTFCGYDASSHLSEETSQAQVSAPKGIVRSIGYSWIAGFILLA
                     GMLFAVQDYTGTQGSSTGVPPAQIFIDVLGTGVAKGLLMVVIVAQLFCGNAETAAASR
                     MVFAFSRDGALPFSSTWRRVTHRTRTPIAAVWLSVGVALVLALPSLYSPAAYAAVTAI
                     NVIGITPAYVIPVYLRLRAGDRFQAGPWNLGGWSKPLGWISVTYVAVLTVVFCLPQAS
                     PVTAQSFNYAGLALAVVLLLAWAMWITKGKRHYKIPPLGSAAENTALAGEVM"
     CDS             227817..228737
                     /codon_start=1
                     /gene="glnA5"
                     /locus_tag="SAVERM_199"
                     /old_locus_tag="SAV_199"
                     /product="putative glutamine synthetase"
                     /protein_id="BAC67908.1"
                     /transl_table=11
                     /translation="MMSGQISHHLSPTPAPGLVTLEELGHLVQGREIDTVMVAVPDLR
                     GRLMGKNLDAHHFLTKLPGGPEMCAYILATDVDMNPLDGFELAGWHTGYGDLRVVPDL
                     GTIRRLNYLPGTVLVHGNAVHPDGRPVAVAPREILRSQLRALAVHGLQARVGIESEFV
                     LYKGTEAQLRRSGFRNPTPVSPDNLDYALDRPPALNAFFHDLHNALHEAGAPIEAIKT
                     EGAPGQIEVAWPYGTPPWAHATPTPSTNTPSVTSPHNTASHPRSWPPRRPAPDPASTC
                     TSPCGATTRRPSPCVHARSCPSYSSTPLPG"
     CDS             complement(229825..236937)
                     /codon_start=1
                     /locus_tag="SAVERM_200"
                     /old_locus_tag="SAV_200"
                     /product="putative large secreted protein"
                     /protein_id="BAC67909.1"
                     /transl_table=11
                     /translation="MAARRTRFLSAGVAGAVLAGLLSTMSVVAPQQAFATADDPTPVV
                     PSQSLGSVPAQQAEEVGKALPDPKWPNAAEATVDLSQAAPGDPGTVTPSPTTTGSENS
                     TQVGDVVDVAPAPDPVGATTQLSAQRRADGDVSPSPSASSSTDASTSPSPEASTSSSP
                     QPPDSVTSEPDQDPVSPDQVQVRVLDHQTVEPAGGIGLGLQVNRTDGVNAPGQVQVDV
                     DYSGFQYAYGADFASRLRLVKLPACALQTPEAEGCTDREFVPVDNDTATGTLTATVTA
                     AADTEVSGASTQLMREASASGASVYTLASGSSSDAGDYRASTLSPTGSWEVSTGSGAF
                     TYNVPIQLPKPPMGSAPSLSLSYNSQSVDGRTSASNNQASWAGMGWDLNVGYIERRYR
                     NCSEDGLPTIGDMCWDSPNSAKEPSGAVYVINLNGVTSELIQDNTGSGAYHLKNDPGW
                     RVQRLFDGYGAGRDGEYWVISTQDGQRYYFGWGRSERTGTATASVFTEPVVGNDTGEP
                     CHDQFPEPCTQAWRWSLDRAVDANEVETMYFYDKEYNHYRSVANSDKAREYVSSGYVK
                     EIQYGWSSQIPDGKLPAKVELSHVNRCIERVQENDPLRDEPATCPTFDDKPTSYPDVP
                     VDLMCDGTSADYNCAGKTYYPTFFSTDMLWDVKTYVSDQDGTGWDLVEQYQNKYGMPN
                     PDGTIGKTLWLDYIQRKTYGDGDDIVLPVINFNRTDLDNKVGSAELNFPRIQEIHGDL
                     GATTKVSYGFANACDIDHLPTQASNTQDCYWQKWTPEGETESKTGWFKKFLVTKVEVD
                     PTVTTNQDGAPVMTTSYTYEGGAGWRFTGDPLVKDEDESWSDWRGYQETQVTTGADTG
                     QKTKKYWLYRGLDGDRTSKTDTSATKTVTVNDGDGNNYADHAWLAGHTLSTSLRDDTD
                     ISHERTYHTYWSHNTAQYDGLPDAHFVRESKSTTNTKISGGWREHVVENEYDDSEAAS
                     TTFGLPMRTDDWGQSNVSDNRCTTYGRAYNTDNYDSTGAQRWTVVQDQVKHYSVGCSS
                     IADSNQDGYTSTLYDNATSIDANKPVDGNATEVRTYTKAGRYRSSWTGYDKAGRIVWS
                     EDGKHNRSTITYSPANTWPMNGITSTSPDPDGTATARGPLTFTEWTSRFWATPTTSKD
                     ANGNITKVTLDAAGRPVEVWKPTETGSSPSMKFSYTIPTSTNSAGVPDSADGYPHVAS
                     HTLQSGSTYLVSHAYTDGLGRARETQTPLPSDVDPATKQIVPFRQVAVTRYDSAGQVT
                     GASAVFRNQGTAGSGGPSSPQPSDLPSYSDLVLDWAGRTVSSQIQVKGTPQKAGRVDT
                     SYLGDYTSVTPVDSTATDTYTDVYGQVSKVVEHTASSAYTTAYGYTAKGELAQITDPR
                     GNNTLYTYDWAAQRKTTDDPDAGLSSSEYNENGQVSQTTATTNDVQTVLTYGYDNLSR
                     ATSVRSGADELAAWVWDDPAATGGKGQITSAVSRDASGNTYTTKTGKFDERGRPLNTT
                     VTLPTTVNGLAGDYTTSVTYDAADHITSVSYPAAGKLAAEKVTTTYDDYGQPTRLTSS
                     LGGTAYIDNTTYDAYGRLVERDYGAEFGGNGIQAQRQYGYDDSNGTRWLRSIATTTTI
                     NDLVSEAQKDTYLYDNTGKLTELREQASGQTAQSQCLRYDDQSRLTLAYTHTTAGNCA
                     DTTKTTSDFKGTSPYQTGYTYDRLGNLQSVTDTNSAGAATTRDYLYPGYDDAGTWTTA
                     NADQPHGVRKINKVSAGTTTAAGTYTYYADGAMKQRVEGSTTTDYTWSRLGRLATVKT
                     TKTSGSDLTRYTYDASGNLLVRTTPQETVASIGGTELRTTDGISATATRYYSFGATTV
                     AMRTTDGNNTVNGKITYLMGDTQASTQIAVDAATGTATRRRYTPFGDERSGSLPTGTN
                     HGFLGKTEDTNTGLSLLGARAYDPSLGRFLSPDPLSTPYDPQNLSAYSYSGNDPINYS
                     DPSGLIKLNSDGTQCSDGWQKCGPGTVGGGGDTPTPAPTVQDQLVDLLPREENGWDAD
                     RLAQVWVHYGQTTQGGGYWDAPVGDGDRTGMACFGRTACSEAFRVWKETHDFAKAKRV
                     AATFCVENPKRCGADNGAYDSMKEASEAVPILLAGEMGAAFSKVLKARGCSFKPTTRV
                     LMKDGKTKPLGKIKPGDLVEAADPTSGHHREVREVTAVHLNHDDDLVDLSIRGLDGRI
                     QTLHTTARHRIWDDTAQVWEQAGRLITGHKVNTSGNQHATITSVLAQRGAADMYDLTV
                     EGLHTYYVLAGETPVLVHNGSCWSSTNRKTSVKNAFGHWKKHKSEFPNLNNAKEYVEA
                     GTDFLRSTDPSVLTRTRANGDVIRFNPATDEFGVMDPSGVPRTYFKPDPASHGYPTNL
                     DYFNAQ"
     CDS             237437..237682
                     /codon_start=1
                     /locus_tag="SAVERM_201"
                     /old_locus_tag="SAV_201"
                     /product="hypothetical protein"
                     /protein_id="BAC67910.1"
                     /transl_table=11
                     /translation="MHERVLTDVDPIQETHLSEPGLLVIDVAGMDDETVLAFQNAIAQ
                     TWATSTADRTTQDPGQPGVRLRLYADLRQVLAPTSPP"
     CDS             complement(237840..238601)
                     /codon_start=1
                     /locus_tag="SAVERM_202"
                     /old_locus_tag="SAV_202"
                     /product="hypothetical protein"
                     /protein_id="BAC67911.1"
                     /transl_table=11
                     /translation="MVGGQWRGVVERLAQQLGEAQAAGRRVKEAKATAARQSPSSTGL
                     ERAEYQRRLRAYVQTPEHKAAGHAIRVAVALMKAHDAALLRSAHTLLARRANGKRPPR
                     RLPRPLVLPGGYASQWWISSIDSTYAGIWRAIPSPGPELRLGSTNDPLVQEVAKQARL
                     LQASHVGYRGRDDLYEAFHPDGTREGGEPVAPIRGLSQETSRRANLALGRGNGIRIQP
                     SRMEEAGQMHTDYFAVWDRSRAYAAAVLALLRARA"
     CDS             complement(239037..239462)
                     /codon_start=1
                     /locus_tag="SAVERM_203"
                     /old_locus_tag="SAV_203"
                     /product="putative secreted protein"
                     /protein_id="BAC67912.1"
                     /transl_table=11
                     /translation="MSLKKINTVLAAAFILFILWFGAEFILSPETTAPGFGLPSWPSG
                     DGDGFLIIKGIRDVVLALVLGILLVTGHRRALGWALLVEALAAYGDMTAVLAHHGSVA
                     TALGVHCLTATLMVVNGLLIMRETRKVAAAPATPAPQPA"
     CDS             complement(239788..240234)
                     /codon_start=1
                     /locus_tag="SAVERM_204"
                     /old_locus_tag="SAV_204"
                     /product="putative membrane protein"
                     /protein_id="BAC67913.1"
                     /transl_table=11
                     /translation="MFNALEVVTTVIIGVMVGVEFSVAFVMNPILNALPEDSGQLGHA
                     HGGRMLGAVMPVWYIGSLVLVAVWAIAGWRHHGTGLVVTAGALLMLSVIMSILLLVPI
                     NNRNKTWTPDNRPADWKQQMNRWERFHYVRVAVIIAAFALLVAALT"
     CDS             240325..240903
                     /codon_start=1
                     /locus_tag="SAVERM_205"
                     /old_locus_tag="SAV_205"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC67914.1"
                     /transl_table=11
                     /translation="MSVQERKQRERAERERLIVATARELAEQQGWDAVTTRRLAERIE
                     YSQPVLYSHFRGKREIIGAVALEGAAEMAVAVRAAASSADGPRERVAALARAYLDFAA
                     RNPAVYDALFQLDGGLAYAQEDTPEPLKDAFAALLESLGEVAGNGVHPGLFTETFWAA
                     LHGLATLTRAGRLPPEDTEPRVELLVDRLAML"
     CDS             complement(241742..241966)
                     /codon_start=1
                     /locus_tag="SAVERM_206"
                     /old_locus_tag="SAV_206"
                     /product="putative Tn3 family transposase"
                     /protein_id="BAC67915.1"
                     /transl_table=11
                     /translation="MAVPGTPRDSLHILDALLNLDAGVKPEMAATDNASYSDMVFGLF
                     TMLGFNFSPRFKDLGDQRFLAGGDARCGDR"
     CDS             complement(241989..242195)
                     /codon_start=1
                     /locus_tag="SAVERM_207"
                     /old_locus_tag="SAV_207"
                     /product="putative Tn3 family transposase"
                     /protein_id="BAC67916.1"
                     /transl_table=11
                     /translation="MDTIAAANAKLIEAQAKVPIVKFWGEGLLASVDGLRFVVPKRTI
                     HAGPSPKYYHFTLQARHHLTERSK"
     repeat_region   242243..242244
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  242245..244816
                     /mobile_element_type="insertion sequence:ISSav17"
                     /rpt_family="IS110 family (IS900 group)"
     repeat_region   242245..242261
                     /note="17 nt imperfect inverted repeat (13/17 nt)"
                     /rpt_type=inverted
     CDS             complement(242908..243411)
                     /codon_start=1
                     /locus_tag="SAVERM_208"
                     /old_locus_tag="SAV_208"
                     /product="putative IstB-like ATP-binding protein"
                     /protein_id="BAC67917.1"
                     /transl_table=11
                     /translation="MIHTLAKCEWIKKSLPLCLIGDSGTGKSHLLIALGTEAAMAGYR
                     VKYVLATKLVNELVEAADEKQLTKTIARYGRVDLLCIDELGYMELDRRGAELLFQVLT
                     EREEKNSVAIASNESFSGWTKTFTDPRLCAAIVDRLTFGGNIIETGTDSYRLATTRAR
                     AEQQAVV"
     CDS             complement(243581..244771)
                     /codon_start=1
                     /locus_tag="SAVERM_209"
                     /old_locus_tag="SAV_209"
                     /product="putative IS110 family IS900-like transposase"
                     /protein_id="BAC67918.1"
                     /transl_table=11
                     /translation="MPQIWAGVDIGKEHHHCVVVDERGERLLSRRVFNDEPALLELIA
                     DVLALCEDTLWAVDINHGGAALLISLLLSHDQPMVYITGLAVHQASAAYRGQGKTDEK
                     DAFVIADQARMRQDLGLLRPGDEIAIDLRTLTARRLDLVNDRTRQTNRLRAQLLEFFP
                     ALERALNLSKKGPVMLLTGYQTPTAIRRSGARRIGTWLKNRKVKNAAALAETAVEAAR
                     SQHTALPGETLAAAVVARIAKGVQALDQEIAELDALIEARFNDHRHATVIRSLPGMGT
                     LLGAEFIAATGGDLEAFGTADRLASFAGLSPVPRDSGRVSGNMRRPRRYHRGLLRAFY
                     LSAMASLRTCAASQAYYGRKRNEGKGHKQALLALARRRANVLWAMLRDGECYEVRPTV
                     TAAT"
     repeat_region   244800..244816
                     /note="17 nt imperfect inverted repeat (13/17 nt)"
                     /rpt_type=inverted
     repeat_region   244817..244818
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(245081..246040)
                     /codon_start=1
                     /locus_tag="SAVERM_210"
                     /old_locus_tag="SAV_210"
                     /product="putative regulatory protein"
                     /protein_id="BAC67919.1"
                     /transl_table=11
                     /translation="MARPEKDIPAAAPMEVAELARELRALRRSSGLTYKDLSDKSHYS
                     SAALSTAASGKTVPKWEVVESFVRGCGFTGDLTTWQRLHKNALARAKTEEAAGKVKVR
                     AAEAETGEPDGADERTEVHHPRLLGGLRKPVPAPEAVVPAQPDGLLTLVQQFMDAHMQ
                     LDARLPEDPQRVSSLTVDHVHTALALCTTPQDVLSVMRELVADKGLTIGALERRSRKY
                     YPISGATFAHVLNGDELPTTEWLNIFLRACGVDQERTLIWHYTVTRIKIANLRHRKTP
                     PPLTVTPVEPSISADYMRRLLVLTVGVMSVLGATVTAVIATIR"
     CDS             complement(246027..246653)
                     /codon_start=1
                     /locus_tag="SAVERM_211"
                     /old_locus_tag="SAV_211"
                     /product="hypothetical protein"
                     /protein_id="BAC67920.1"
                     /transl_table=11
                     /translation="MREGCSARGALTHLHLHRDSDEPYEPGVEMSPSSSSRKKRRRLI
                     VSAVTANGAGAVAGVAAQAAISDPFFSALVAAFVAGVVGDLLLQVTRTRNGALGDAAR
                     PGEHGRAGRRELDNGHGGDDRAARHKTGDGNGRASGARPGCTRCTRPSRQDAHPAAPR
                     VSPSEAVMTPRHLYHRHLHRGAKRFTRRVHERNARHGLRQPRGTHGAS"
     CDS             complement(247471..248142)
                     /codon_start=1
                     /locus_tag="SAVERM_212"
                     /old_locus_tag="SAV_212"
                     /product="hypothetical protein"
                     /protein_id="BAC67921.1"
                     /transl_table=11
                     /translation="MTAIDDLLADARIPTTRREGFDVGAALRRLAADAAAAAAKPNPD
                     MVRAAQAGQRLSVVCRWILNKPDAADHVDRLAQEPETPADDGHLDVDGALVFACLLYL
                     TEHRESAQFWWQLAAGAGHRAAAYCLHLHHLALGEVREARHWLHEVTDDVLDSEAPDS
                     AFLATLEAVAMYVRRTGSSLAGAPTGGLEMEVDRLATAKADSCIIVQRPGRRLADLMH
                     DFTRR"
     CDS             complement(248139..248741)
                     /codon_start=1
                     /gene="sig60"
                     /locus_tag="SAVERM_213"
                     /old_locus_tag="SAV_213"
                     /product="putative RNA polymerase ECF-subfamily sigma
                     factor"
                     /protein_id="BAC67922.1"
                     /transl_table=11
                     /translation="MGNGDVSTDVSPQDGGHGQPVQAPPALPLDFEGFYLGHQEFFHD
                     FSEIHLGSRRVAEQVVHQVFLEILGGWDELLQQGDLEQQTLSVLHRCVTRRLEEDGRS
                     PAFLINGPIAKNLEAVRSQLELSNSAGGLYEAILELPTRQFTVIVLRHLLGYPTKRIA
                     RYMGLDSRTVDYHGRKGKERLRIRLGLPTAPGKDKKGAGQ"
     CDS             complement(249173..249661)
                     /codon_start=1
                     /locus_tag="SAVERM_214"
                     /old_locus_tag="SAV_214"
                     /product="hypothetical protein"
                     /protein_id="BAC67923.1"
                     /transl_table=11
                     /translation="MRGRCRWPDRRRHGLHSPGGAPQPSQPRSGGVERPNRSSKKMVP
                     AALPEGPAGGRVVGEGGVHRLTDRVFVVGEQGLPPLFGLGGHPFTDRMQTCCLRGQVC
                     GRILLRALFGGSPFGTGQPPYPLEVEGLGLGERAQGRPNCGASGIKGGVRDGEAPSPA
                     RS"
     CDS             complement(249733..253416)
                     /codon_start=1
                     /locus_tag="SAVERM_215"
                     /old_locus_tag="SAV_215"
                     /product="hypothetical protein"
                     /protein_id="BAC67924.1"
                     /transl_table=11
                     /translation="MEETSGPVAVFCKLLGRLVRECGIQQSDLARAVNRSTAAISMLL
                     NGHRSTLPPWDDVARIVEYCHQRATTTPSAGLASDLAYWRHRHREAETDADHAPPRPR
                     AAKPPALPPAQTIPDVPDDFVSAVGVLIGERTGFDRLAAELLEPLKLHGAVVTDLNAV
                     LEGFADRVGASCGTTRTALLRAADLVTLVTAFCETVAASGIRYTTELGHEQADLTSDV
                     VAELERVTLGSQRVRHPADLRAEIAAAYAYAADTVCDESGVGGQQPDKLAHRAWRRYE
                     ALLAQVTWECPELRLTSETQDPPEALDPSEPVTPDVSSSRGLAGLSRLLETFAQDNGA
                     PTPAHQQQLRAPLAQVEESGPRIPDLEAGYINPAFRVAGRSGDRALARDDWWEVQPLW
                     DDLEDFLAAHLLTEDATRAPLLILGHPGSGKSLLTKLIAARLPAAEFFCQRVELRHLP
                     ADLGVQEQLEEAVLRSTGRRTPWPDVTDPDTGVVRVVLLDGFDELLQAAADHMDPARH
                     FAYLQSVQQFQQREADQARPTIVIVTSRTVVADQALTPHPSTVIRLEPFDADRIRGWL
                     HVWNTTNRRYFSTHALQPLTWDVVGRHEELAGQPLLLLMLALYDASGNALHLLHGEDI
                     QRLGLYERLLTEFVRRQVTKHNALPADTEAARVAHELQRLSVIAIGMFNRHRQGITAT
                     DAENDLAALLDPAPADATPLLFGRFFFIHEAQAIVTGHERRAYEFLHATFGEYLLTRL
                     VTGELRHLLPTTSPDSDHPVDDGRLYALLSHVPLTDRAEVVRNTSEQLTRLTQAQREH
                     LTSLLTSLFNQTPGDTHHRTHVPYRPALTHRTQQDAVYSANLLLLAVLAHPTLRASAL
                     VGSRNTVDCWRRHTLLWRSQFSDGSWDAFTRALAAEPFTDPATGRRDLLVGLSTHQPE
                     QELAWTVNLATRDDTTAQTFQHLDGTAPAGLYRPAAFTYDLGAQHVLHAVAPVLHQMP
                     AALETYHGVDRTRSLSLAHALISLLYRPANDPGPPGTPYAELLLMLRSLSGDGRLLAA
                     DILGRHLLHAAADLPAATVIDILDQLTTIQFTSAGGLSARTWLVLAQCVSDLAGRPDI
                     PHVQLGRITRRFGADAPALDASGDPLTRLLCLFTEAQTSTMWHAADHPPGQAVLTEGI
                     TLLERIPHPRPPQAVVGLLRLARDLGADDWLAQHAEPLLKTLTHDGLHRLRPTDVDWL
                     QPLVHDASLLDELNLVTRRWRQQ"
     CDS             complement(254011..254895)
                     /codon_start=1
                     /locus_tag="SAVERM_216"
                     /old_locus_tag="SAV_216"
                     /product="putative pyrophosphatase"
                     /protein_id="BAC67925.1"
                     /transl_table=11
                     /translation="MRVDFKRYQQAAIKTLQPPAEGTDPVLVPLLGLAGEVGSLTTAY
                     KKFLRDGPAFEQGKHQLREELGDVLWYIAALTHRFGLDLDDVAAANLEKVKDRWRTTP
                     QEEHAPFDAGFPAHEQLPRQTSLTFTPTKTDDGRTVIVLTREDGTPAGDPLTSASHVE
                     DGYRFHDIFHLAHATVLGWSPVTRFLLGRKRKSDPRADEAEDGGRAIAIEEGISALVF
                     SYAARHRYLADIKHIDQELLATIGHMTAHLEVSICRAADWEHAILTGYAAWRQLRDHN
                     GGIVQLDLDQRTLTVTQD"
     CDS             255013..255273
                     /codon_start=1
                     /gene="fabC4"
                     /locus_tag="SAVERM_217"
                     /old_locus_tag="SAV_217"
                     /product="putative acyl carrier protein"
                     /protein_id="BAC67926.1"
                     /transl_table=11
                     /translation="MDDITSVVIDFLAEYEGVSPGELRSELEQDGRELPVDSLLVVEI
                     LTRIEERYHVAIPADREAAQATGSVRAFAAAVLDAIEERQQS"
     CDS             255270..255677
                     /codon_start=1
                     /locus_tag="SAVERM_218"
                     /old_locus_tag="SAV_218"
                     /product="putative transcriptional regulatory protein"
                     /protein_id="BAC67927.1"
                     /transl_table=11
                     /translation="MTPPLSDNRDRDPELVRLGERLKKTRDYLNMSQQFVSDSTGIPR
                     SAISDIERGERRVDSLELKKLARLYRQPVAYFLAEEKDADASEYSLAGLPRALAQLTD
                     GDARTVLEFAEYLTLRRAAEREDQNAEGGSPTA"
     CDS             255674..256570
                     /codon_start=1
                     /locus_tag="SAVERM_219"
                     /old_locus_tag="SAV_219"
                     /product="hypothetical protein"
                     /protein_id="BAC67928.1"
                     /transl_table=11
                     /translation="MNWALAHRIASIAAVQTHRDLGIDRTQYVHVHRALGAADVIGMA
                     QPMPRLFGVYFSPADKGPAVMLNASLNAITQRHTAAHELGHHRLGHRTAADEELDPAL
                     RWGNGSWPEEEKTAEAFAAWFLMPLPAVRAALERICGSRPSHPEHVYRVARELGTSYA
                     GTVRHLVNLRLLDAGRAGQWSKIAPADLRSSLAAGASLPGQAQVHVITAASAGQTVHA
                     DAGDVLVLHLDNALFDVLPKGVEPWTSDGTTPLASAVVTDELPPGEQGLIEVAVPTHG
                     AALRLTVVREAPRAGVDETWPA"
     CDS             256598..257401
                     /codon_start=1
                     /locus_tag="SAVERM_220"
                     /old_locus_tag="SAV_220"
                     /product="hypothetical protein"
                     /protein_id="BAC67929.1"
                     /transl_table=11
                     /translation="MSGGLMHTFTVTERDVTQAWVAACNKLDRKDNPDRTGLHTVVRI
                     ADPTSDDPVFRAELDRLRTARGLWPLETVASTLFPAALAARSADPDDLAERYRRMYPV
                     IKRYPGNHRGTYFGRLVFYPAASKTGIDQLSTVISRLRTQAAGTKIAAAYEIDIAAAT
                     DQEEAGADLLVHTAGKDNSYIGFPCLSHISLQLDRDRRVHAAALYRSHFMFERAYGNY
                     LGLGRLLAYIAQQAELACGTLTVMAGHARLDGPVTQLRPLLTGTSRLAA"
     CDS             complement(257443..258474)
                     /codon_start=1
                     /locus_tag="SAVERM_221"
                     /old_locus_tag="SAV_221"
                     /product="hypothetical protein"
                     /protein_id="BAC67930.1"
                     /transl_table=11
                     /translation="MVTVLQERAEQRVLDCGPARKIRVAGRTLTVTPVFDTYWRFAAA
                     RQKVYEARLAGGAGPFTDDPILQRHRFTNCFRAADRVSQDLIGGVIYRGEQAWEEVFF
                     RTLLFKIFNKTSTWRLLNGALGEVRWNAYDYRTYDRVLSQAFSAGQRLYSAAYIVPPP
                     QLGEERKHQNHLRLLEMMMTADAPQRVLSAPTLEGAYRVLLGFPAIGPFLAYQFVIDL
                     NYAAEMPFSEMDFVVPGPGARDGIRKCFGSAADGIEAEVIRYMADTQDEHFARLGLSF
                     AGLRGRPLQLIDCQNLFCEVDKYARVAHPDIAGISGRSRIKQTYRQQADAMPAWFPPK
                     WQLNGPPGH"
     CDS             258522..258809
                     /codon_start=1
                     /locus_tag="SAVERM_222"
                     /old_locus_tag="SAV_222"
                     /product="hypothetical protein"
                     /protein_id="BAC67931.1"
                     /transl_table=11
                     /translation="MELLWQCPRRKTLVDWPEDVDTRLDVLVRAAAAAGEQTSRSQVL
                     AALVTAAEVRPAVISELLHSYRQMQADALEADNTRADLPSVRSPGRTRGRR"
     CDS             260024..261079
                     /codon_start=1
                     /locus_tag="SAVERM_223"
                     /old_locus_tag="SAV_223"
                     /product="putative DNA-binding protein"
                     /protein_id="BAC67932.1"
                     /transl_table=11
                     /translation="MRCGGCRRPISLRKWGRGCVSWLPPPLAFRLHAGSTGWRAELWL
                     PRRVGQGAGLKAVSEERFQDGLGHARRYVARHGHLAVPHADAPQDGFDLGRWLANLRA
                     ASAGLPPEYVRVLAELDVWWNPPWPISWQRAWHRARAHALAHGPVSGGDNLAGLPRWL
                     ERWLRRQIAEYSQLAAEQQQLLAQLGLTPAEIDRFHAWPARRRSVMHGLEATHDYAAS
                     HGHLAVSQLTSHDGFALGKWLNQVRHRQRTATQPTRLGRQLTALDTWWNPPWPLDWQR
                     YYWATRHHLHGLPEGVVWWPGAPEEAQTQQWLHEQQASWQHLHNEQKALVGRLATDQS
                     TGGSPRSDRPDSSPLSS"
     CDS             261139..262191
                     /codon_start=1
                     /locus_tag="SAVERM_224"
                     /old_locus_tag="SAV_224"
                     /product="hypothetical protein"
                     /protein_id="BAC67933.1"
                     /transl_table=11
                     /translation="MPRGRPQDLAWRQFVRPAAVPEPVVLAAAYAARMTQEWTSAMSF
                     SSFAPPSGGQDEAAPVDPREAVEAVAMRWQAFSSRGAQVGWASQESLRQAGVTGYGPL
                     INRVVEIHGLMGSIGEQLALARAAEQDAQRHQRTAAIHDPRQAAVLEHSRRMAVRALC
                     EMSTHFVLGAAHGLANLVLRTVLCHPAAAYEVNQAKRLKKAQGFPPGTDLKEAWLTFS
                     PTGDVWSTLLPAAAEASGLTSLQDLVARLCLLQVDPRFSALEQRRGMDYHRHRPQSLD
                     HTSPRAGLWSYDPVHKVSTMRMPGASADAERDEETVHRISADALECLGAALTDIEPLM
                     GESLRSCHLSWIPVNA"
     mobile_element  263224..264596
                     /mobile_element_type="insertion sequence:ISSav18"
                     /rpt_family="IS256 family (IS666 group)"
     repeat_region   263224..263239
                     /note="16 nt imperfect inverted repeat (10/16 nt)"
                     /rpt_type=inverted
     CDS             complement(263244..264521)
                     /codon_start=1
                     /locus_tag="SAVERM_225"
                     /old_locus_tag="SAV_225"
                     /product="putative IS256 family IS666-like transposase"
                     /protein_id="BAC67934.1"
                     /transl_table=11
                     /translation="MQQCPGATRLLTVVNEEGTTSHGSLIDDIVREGARRMLAAALEA
                     EVNAYISELADQRDEREHRLVVRNGYHQARKVTTVAGAVEVKAPRVNDKRVDESTGER
                     KRFSSAILSPWCRKSPKVSEVLPLLYLHGLSSGDFVPALEQFLGSTAGLSPATVTRLT
                     QQWQADHAAFGERDLSASDYVYVWADGIHLRIRLREAKSCAFVLVGVRGDGTKELIAV
                     KDGYRESADSWADLLRDCARRGMRAPALAIGDGALGFWKALAEVFPEARLQRCWVHKI
                     ANVANALPKSAQPGAKKALQEIYNAEDRDHALKAVAEFAKTYGAKFPKAVKKITDDVD
                     ELLAFYDFPAEHWVHLRTTNPIESTFATVRLRTKVARGAGSPAAALAMVFKLVESAQQ
                     RWRAVNAPHLVALVRAGAHFERGLLVERPTAAA"
     CDS             complement(264551..266317)
                     /codon_start=1
                     /locus_tag="SAVERM_226"
                     /old_locus_tag="SAV_226"
                     /product="putative reverse transcriptase homolog; similar
                     to GII intron"
                     /protein_id="BAC67935.1"
                     /transl_table=11
                     /translation="MTELAIAEPRMNGPEGDTEFWHSIDWSREETSVKRLRQRIFRAA
                     REGDMKQVRNLQKLMRRSRANTLTSVRRVCQVSTGKKTAGIDGQKALSPEKRGKTARQ
                     ILADPMSHPQPVRRVYIPKANGKRRPLGIPVIRDRVDQARFKNALEPEWEARFEARSY
                     GFRPGRGAWDAIEMIFNVAGRRTAKRLWVLDADLSAAFDHISHQHLMDSVGLFPGRRQ
                     IQQWLRAGVMEDGRFVSTPEGTPQGGVISPLLMNIALHGMGEVIGANRPWNAKTTSPT
                     LVRYADDFVVFCTTENEAIKAKQDLAAWLEPRGLSFNEEKTRVVHLSSGVDFLGFNVG
                     RFRQKLIIKPSRDALQRARKRISTTARENSGSPTESLVRALSPFVRGWSTYYRTVCSK
                     ETFNLLDAHTFEVLKRWAMRRHRRKPWGWIKRRYWGTFQPGRSSKWVFGTPEHYLPQA
                     SWMPIQRHTLVKDDASPDDQELEEYWGNRRRKRIQAVGEPKKILSLAYRQRGLCPRCG
                     LDLIDGVGFDPDDVQDWANWFTGSLRAIHVHHLTYRSKGGSDHPSNLELIHTTCHRQA
                     HAGDRKYDAHRRPQASLSRMRG"
     repeat_region   264581..264596
                     /note="16 nt imperfect inverted repeat (10/16 nt)"
                     /rpt_type=inverted
     repeat_region   266711..266714
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  266715..268155
                     /mobile_element_type="insertion sequence:ISSav19"
     repeat_region   266715..266732
                     /note="18 nt imperfect inverted repeat (16/18 nt)"
                     /rpt_type=inverted
     CDS             266779..268044
                     /codon_start=1
                     /locus_tag="SAVERM_227"
                     /old_locus_tag="SAV_227"
                     /product="putative IS701 family ISMmq4-like transposase"
                     /protein_id="BAC67936.2"
                     /transl_table=11
                     /translation="MTPEEMASVREDLEAFAAELFDGFFRADQRRWGQAYVRGLLLEG
                     RRKSVEPMAARLGEDGNRQALAHFITSSPWDPAHVRARLAWRMQDAIGAEALIVDDTG
                     FVKDGDASACVSRQYTGTAGKVTKCQVGVSLHLARDHASAAVNWRLFLPASWDPMSSE
                     ADPDKVARRTRCGVPDRVGHVEKWQLALDMIDETRSWGIDIPLVVADAGYGDATAFRH
                     GLEERKLPYAVGISSRHTAHPADARPVQPAYAGSGRPPAMQYPEPAQTMKDLVTAAGR
                     AAARAVSWREGSRPGKSVSGFKRMHSRFVALRVRPAGRGVRQSTDGPELPERWLLAEW
                     PATEPEPVQFWLSNLPSGMPLATLVRLAKLRWRIEHDYREMKQALGLAHFEGRTWNGW
                     HHHVTLVSAAHAFCTLQRLAQDPKDAAEE"
     repeat_region   268138..268155
                     /note="18 nt imperfect inverted repeat (16/18 nt)"
                     /rpt_type=inverted
     repeat_region   268156..268159
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             268251..269444
                     /codon_start=1
                     /locus_tag="SAVERM_228"
                     /old_locus_tag="SAV_228"
                     /product="hypothetical protein"
                     /protein_id="BAC67937.1"
                     /transl_table=11
                     /translation="MCSDQGTHTSSTKAVRMSLLHHDSRSEALAQLSCFRGEFYSCLT
                     ARSDALFELADAVLCGDGPVRSLAELSLVGEHRRGHGGLYAALARGRIDAGRLRRALA
                     EVPLPRAADGRLVLAVDVTCWLRPDAHTSPQRILCHTYGRGKDQHIPVPGWPYSIVCA
                     LEPGRSSWTAPLDALRLTPGDDTATVTARQLRDLLQRLITAGQWQTGDPDILIVADAG
                     YDAPRLGFLLRDLPVQVLARMRSDRVLRRAVPPRLPHTQGRPPRHGGEFVFGQPDTWD
                     TPDTETVTDTRLYGQATARSWNRLHPKLTHRSSWAAADGTLPIVEGTVIRLDIAHLPS
                     GATPKPVWLWWSGTDATPADADRLWQAYLRRFDIEHTFRLFKQTLGWTSPRSAPPRQP
                     TGGPG"
     CDS             269776..270012
                     /codon_start=1
                     /locus_tag="SAVERM_229"
                     /old_locus_tag="SAV_229"
                     /product="putative transposase"
                     /protein_id="BAC67938.1"
                     /transl_table=11
                     /translation="MVEVVADGREQLVVTGSRSREKAYLFTGEDLAAISPYLTDHIMR
                     FGTYATTELTARPVAFDPHLDVEFETEEEVPAAA"
     CDS             complement(270055..271758)
                     /codon_start=1
                     /locus_tag="SAVERM_230"
                     /old_locus_tag="SAV_230"
                     /product="putative secreted protein"
                     /protein_id="BAC67939.1"
                     /transl_table=11
                     /translation="MPRRSVMATRELRVRRTRSRTRRTAGACLLVAGCVITSSVPSAS
                     ASPQGGARLCATEPFPPSESTPPPILSGSDVWSFVSDPALHPMRVKVTANKPGTARGD
                     IFVAPFSADQMVGQTGALINDNSGDPVWFRPLPSTNLQNADFKVQTYYDGRRDRGQPV
                     LTWWQGTLALPPAYTNLPAGAPEQGGCYYIYDRHYRLLKTVFAHHGCYPDEHEFTLTR
                     RGTALFIASKPVPMDLTPYGGPKNGAIENSEIQEVDLATGRLLFSWNALDHLDPADSE
                     EPVSSASSSDGVWDAFHINSVDEGPDGRLLISARNMWAIYDVTKRSGRIRYQIGGRKS
                     DFTFGPNADFYWQHDARFRPGNRISMFDDGCCDLPDGTPEQVSHGLILNLDVRSRKAT
                     VDRTYYHQPPLESPTQGNTQALSNGNEFIGWGQSPYYSEYAGAGNTQGNGLQNLLYDA
                     KLPGSNISYRAFRNEWIGTPYYPPSTAARSDGGHSVVYASWNGSTQTRAWRVLAGSDP
                     HSLSVVVRRAPRSGFETAITTNAPGPYFQVKALNAQGKVLGTSHVVTLSSRQSTRDTK
                     R"
     CDS             complement(272429..273277)
                     /codon_start=1
                     /locus_tag="SAVERM_231"
                     /old_locus_tag="SAV_231"
                     /product="putative MerR-family transcriptional regulator"
                     /protein_id="BAC67940.1"
                     /transl_table=11
                     /translation="MPGRAPARPGRHLTFKSGRRFTVGGVTTYRISQLAERSGVPATT
                     LRFYEDAGLLPADRTPSGYRVYGEDAVERLAFISSAKLLGLALEEIRELLDVREEGVC
                     ASVRARMLPLAADRIAETDGRIAELRAFSAHLAGVHTELSGPAPSGACGPDCGCTTTS
                     PVAAGPVPITLSPTRPSRIAEPWRDTPVACTLGGAELGVRTEQWKQLVSKAEEREEIP
                     DGVRLSFPAGAELAGEVAALAAAEQGCCAFFDFTLHLTPAALQLEVRAPESAAGMLAD
                     LFGATV"
     CDS             complement(273444..273962)
                     /codon_start=1
                     /locus_tag="SAVERM_232"
                     /old_locus_tag="SAV_232"
                     /product="hypothetical protein"
                     /protein_id="BAC67941.1"
                     /transl_table=11
                     /translation="MSALDFYAHVAVCGEVRGVGLGAGPEAWEAALGATCLDVPGGGL
                     LRRDYGLVEINFSPDQPGRQGQMSCFGFGVKIQRLLYDQSPNTVPSPLSREYGEFAPR
                     VPFKQLQAAILALGRTIELDKHNTSSDMDCYRVSASAARIHVVADPDPYGSGDPDPDG
                     HQRGDVWSVDVW"
     CDS             complement(274210..274494)
                     /codon_start=1
                     /locus_tag="SAVERM_233"
                     /old_locus_tag="SAV_233"
                     /product="hypothetical protein"
                     /protein_id="BAC67942.1"
                     /transl_table=11
                     /translation="MGIGRRERMTSLLDTPYLVKEWELPSPIVLLSGDGHCWISLDYR
                     ACGPNGEPSVTWFDTDLDTELALASDFRMFVENLTAGSALGVDPGDSTSA"
     CDS             complement(274689..275168)
                     /codon_start=1
                     /locus_tag="SAVERM_234"
                     /old_locus_tag="SAV_234"
                     /product="putative regulatory protein"
                     /protein_id="BAC67943.1"
                     /transl_table=11
                     /translation="MEAAPGSAGNVMPGADVIETAVALDGDGSCIAEARQLAVEFLTR
                     VQSEYGVPVSARAMDLTQLVVSELVTNARKYAPGPVLMQLRLAGDLVEVVVWDSDPVL
                     PVARAADPGRIGQHGLEIVMAISQEFEVQREPVGKRITARIALPDTPGADITGRRPQ"
     CDS             275233..275721
                     /codon_start=1
                     /locus_tag="SAVERM_235"
                     /old_locus_tag="SAV_235"
                     /product="putative anti-sigma factor antagonist"
                     /protein_id="BAC67944.1"
                     /transl_table=11
                     /translation="MRARCWRKDCIGVPRQGTGAGWVRTRCARIRDPQSASPVEEVVT
                     DTHEAARPGLSIDHQAVDGIRIVVLRGEIDHANRDSLHEALLIPEGEAEPRTVADFRG
                     VTFMDSSGINVLITAHRAAQDAGGWLRLAGVQEPVQRVLALVGIDTLIPCHSTLEEAL
                     TS"
     CDS             275872..276393
                     /codon_start=1
                     /locus_tag="SAVERM_236"
                     /old_locus_tag="SAV_236"
                     /product="hypothetical protein"
                     /protein_id="BAC67945.1"
                     /transl_table=11
                     /translation="MRGSRHEHHATPAWHQTGRPRRHRHRHRRRNRSPHGCSPSNASS
                     RTRQAATQHQAVADRTGDATIGPDPEVRPPERPQANQSRGGPGLLLALALPILMRAAL
                     FALDAFEDRLFPPPAPADDESLAADTRSLALTTSPPRPARPGSDTARARHCAYDAVGE
                     SPAGQWHESRLRS"
     CDS             276877..278016
                     /codon_start=1
                     /locus_tag="SAVERM_237"
                     /old_locus_tag="SAV_237"
                     /product="putative DNA-binding protein"
                     /protein_id="BAC67946.1"
                     /transl_table=11
                     /translation="MLGRSFEELVGQDFHDLLHRDSYGHATPRTRCQLRDALLAGRTE
                     HGDSEWFARGDGTLVRLSWLVAPFSSESEGAGALMLLYGSNRGVSDEGDDEVPAPLTE
                     LDRLALLAETTTQLTSTLDVDEAMRRLAALTVPRLADWAVIDLLTERDEVRRALVTEH
                     KDGILVGREDLQGPMPPVPEESPMPLSRALRGAASSLAGPATYQGPPDSGIAVEQGRL
                     FSETGMHSAVIAPIRGLRDVLGALTLGRSTRPDAFTAADLPLLEDITRRAGLALDNAR
                     LYQRQRKVAETMQRHLLPQLPTVPGVGMTARYVPAPHASSVGGDWYDAFALTDNSHAL
                     ASATLSGTTSTPQPAWRRSATCCAPSHGPSPRPRPAPSSPSSTTP"
     CDS             278037..278444
                     /codon_start=1
                     /locus_tag="SAVERM_238"
                     /old_locus_tag="SAV_238"
                     /product="putative DNA-binding protein"
                     /protein_id="BAC67947.1"
                     /transl_table=11
                     /translation="MATMILATLTLGDDELWQLRWTNAGHPPPLLVSHDGRARYLTDA
                     HGILLGTGTIRPRPDVFTVLPPRTTVLLYTDGLVESPHHSIDHGLERLRRHAASLAHR
                     PLDSFCDLLLERVRPSDNDDDVAMLALRTPTRA"
     CDS             complement(278470..279057)
                     /codon_start=1
                     /locus_tag="SAVERM_239"
                     /old_locus_tag="SAV_239"
                     /product="hypothetical protein"
                     /protein_id="BAC67948.1"
                     /transl_table=11
                     /translation="MQGHRSNYVRPHCYCAACMGLGLRIGAFGPAVDEEGNTVPGSRA
                     VYPWSALPAVIGGDVDRDERPFAWFTHFLEAAGPVVVDEGDGENLWPRGIQHDDALFC
                     ETGVTGEFGLADGVAATQFQPGAGRTALHLGRHPVEQLLPSWDHRVLRFPGQIGAVEV
                     EDVVVLKDHFCCSSVPSHTLPGDGHAQEVRTGDRA"
     CDS             complement(279267..279635)
                     /codon_start=1
                     /locus_tag="SAVERM_240"
                     /old_locus_tag="SAV_240"
                     /product="hypothetical protein"
                     /protein_id="BAC67949.1"
                     /transl_table=11
                     /translation="MHIVLDDTAMAAAGQGNVLASRLIHRAHAESGWFLYAPACALVE
                     ADRARPGTAEHLASLPGITVLDLDLAAALAVARQKTWAAAHSQYAAQPTPERPDGAII
                     ATTAPNRWKGEPVRVLDLTP"
     CDS             complement(279644..279919)
                     /codon_start=1
                     /locus_tag="SAVERM_241"
                     /old_locus_tag="SAV_241"
                     /product="hypothetical protein"
                     /protein_id="BAC67950.1"
                     /transl_table=11
                     /translation="MGRSTMMSDANVRIPEEAKERLAAIAAAEGLSLRAYLARLAETL
                     LTPAERAERAEKALAALKEWNGYAPTAAEEQDLDSVLDRRLAQATGR"
     CDS             complement(280342..280782)
                     /codon_start=1
                     /locus_tag="SAVERM_242"
                     /old_locus_tag="SAV_242"
                     /product="putative secreted protein"
                     /protein_id="BAC67951.1"
                     /transl_table=11
                     /translation="MGVRTAYKFNRSAARAVAAASLAWRTVRAPAGVNRRAPTPPISV
                     ISGPKTTDVDGSVARLAIVPAPNTPDLPSEHSPDGAGTGRVRFPLVQWVLAPRTTWQA
                     RRLAADFGEGMDARTAWVMARLARHPDERDYAMAHLDDERRIAD"
     CDS             complement(281208..281585)
                     /codon_start=1
                     /locus_tag="SAVERM_243"
                     /old_locus_tag="SAV_243"
                     /product="hypothetical protein"
                     /protein_id="BAC67952.1"
                     /transl_table=11
                     /translation="MACDSAALRQPAPSPVLRLLWLRTPLPNLPVRASAADAFTEVLL
                     TDFTAGYCELHLRVLPLRYCSRRPLITAGHPVRSSVPSPSSNNLASKLHHRTVLRTAT
                     TGTAARQFVSARPCGLSWLREKP"
     CDS             281928..282242
                     /codon_start=1
                     /locus_tag="SAVERM_244"
                     /old_locus_tag="SAV_244"
                     /product="putative MerR-family transcriptional regulator"
                     /protein_id="BAC67953.1"
                     /transl_table=11
                     /translation="MTADDSHNRLEDDDYPAYTMGRAAELLGTTQGFLRAIGDARLIT
                     PLRSPGGHRRYSRYQLRIAARARELVGHGTPIEAACRIIILEDQLEEAQRTNAEYRRT
                     AE"
     CDS             complement(282829..283503)
                     /codon_start=1
                     /locus_tag="SAVERM_245"
                     /old_locus_tag="SAV_245"
                     /product="putative LysE-family efflux protein"
                     /protein_id="BAC67954.1"
                     /transl_table=11
                     /translation="MSVDLVGFLGVVLVAYVVPGPDFLVVVRSATEHPAKGRAAALGA
                     QSGLCVHMLAAAVGLSLIAARSPAVYDAIRLLGAAYLVYLGVRAVLAARRAARERAAG
                     REAVGGVEDGTDPRTPEEEAPAHGRWRSGFTQGFLTNVLNPKAALFFLSILPQFVHGG
                     GSTSRQIFFLGTLDIVIGVAYWFALVAVAARLRAFLARPKVRHGWELTTGWLFIAIGI
                     GVAAAA"
     CDS             complement(283694..284041)
                     /codon_start=1
                     /locus_tag="SAVERM_246"
                     /old_locus_tag="SAV_246"
                     /product="hypothetical protein"
                     /protein_id="BAC67955.1"
                     /transl_table=11
                     /translation="MVGVENGPRGPVFFSFEPAGIVPDIVCLSKSISGYGMPMALTLL
                     RPEYDVWKPGEHNGAFRGYNPAFLTGARALEGAALRPCGRGPARCAMRRTGEACCWRR
                     PGPTTRWPRSCRR"
     CDS             284429..286645
                     /codon_start=1
                     /locus_tag="SAVERM_247"
                     /old_locus_tag="SAV_247"
                     /product="hypothetical protein"
                     /protein_id="BAC67956.1"
                     /transl_table=11
                     /translation="MLAQSSGQSVAAVGMGLLTALGGFYLAWKAFQQDRDQVTAMSLG
                     TAVDQLAEAVKKQWDAEASVRRLNDPYPLPVAWRAADADLVQPWTLLADVARGWPGGP
                     PGDPAQWPTDAAGLAGADAQIGEVFAQRVPTRRLVVLGDPGSGKSMLLIRLLHDLIAQ
                     RPDDGPVPVLFSLASWNPTHRPLQSWLADQLRHTYPGLRAPAPSAAPQAGQIDLAQAL
                     LDTRRILPLVDGFDELPPALHAIALDALNQALPAKQPLVLASRAAAYREALARSEVLV
                     RPLNGAAGIHLLPLPADQAATYLRHDAGGEHTPAADRWNSVAAHLGTNTLVGQALSTP
                     LGLFLARTIYNPRPDILGAPAPVPHPDELYDTTIFPTRAALDTHLFNAYIPAAYTRHQ
                     PNPLRWSPSQAYRTLVFLARHLETNRNGSPDLAWWELHHANPAYIRRLTAGLMVGLGP
                     GLLLGLVYGVGLGLAAGIGLAAGLTYGLIGGGLGSAPSNIPSTRLRWSRRRFAGWLGA
                     GLALGLVGGLAFGLGIAGERGAWLATGILPGEHGFVGWLAFGLALGLIAGLACGLTFG
                     LTGEKPALTTMIGPATLLIQDLRTFLGGGLAYGLGAGFVGGFIGWLVSWLAFGAEDGL
                     AFGQAFGLAFGLGASLEQTAWGDWVIAKAYLAMWRRAPWDLMTFLQDAHQHRGVLRQV
                     GAVYQFRHLDLQRHLAQQPRSLPTYAGQPDSPSRLTGEQARSIHRRGNTRTGSLFD"
     CDS             complement(287461..287775)
                     /codon_start=1
                     /locus_tag="SAVERM_248"
                     /old_locus_tag="SAV_248"
                     /product="hypothetical protein"
                     /protein_id="BAC67957.1"
                     /transl_table=11
                     /translation="MATENCRRDLTAICKAADSGYLLQVVRDDGFEPLAEKHLSHWPD
                     WPTFPVDAAHAAGCELIMLGYVIWPDTVTPDSLIGWRAVPDQQAWSAKVGTFAQVQAA
                     GI"
     CDS             complement(288173..288562)
                     /codon_start=1
                     /locus_tag="SAVERM_249"
                     /old_locus_tag="SAV_249"
                     /product="putative secreted protein"
                     /protein_id="BAC67958.1"
                     /transl_table=11
                     /translation="MPGPKVTAAVGAVLSAATAVVTNLVTTRWSPALIAAAVVLVIAG
                     AAAAAASAAHGRSDSPPTARLTARRRGHLDRIRVAHGADAAVRIEATGSAAEVSNLEV
                     NIDNAEAIAKATGRGTISNSSIVQRNS"
     CDS             288726..292160
                     /codon_start=1
                     /locus_tag="SAVERM_250"
                     /old_locus_tag="SAV_250"
                     /product="hypothetical protein"
                     /protein_id="BAC67959.1"
                     /transl_table=11
                     /translation="MSQVFTDRREALAAVERLTGESSPLRVLVVQGVSGTGKSTLLRY
                     VLHHGRRGLRTVRLDVLDVVLAPLPVETDVVLRLVRSLAIQLSTAGPWWRRRRLRRQA
                     ELIGAEHPATITMIARGHGQITGVSAVADGAAPTAQRREAWVQAMLSIAARVRRPVLL
                     VVDTTELLYVFDDAAREDRARTAIGVGDWFVRDMLVRLLDVSARLRVILAGQDQLTMT
                     GLPDSAWQELELSPWSQDDVVDHFAALGLGLEPARQAYMMSGGMPLIAAAIADLCQSG
                     IGGEGAWLDQAAGQPTSTWLVDNILGRLSAEQRMLVQAACVLRVITEPALARLVADTP
                     LSAGWFTALARHQLLQTAPATNRAPRLVMHATIRGWLLEHLARADRDRIPDRRQLPRW
                     HRAAAEFYAALAEGRLSAEEMYHRFAAGDAAPTRCRLWEQAVLAAVTDGRLGDAFTLA
                     QTATVAAAEPAQPTVPHPALALAFHAQAHIALLQGHLHQADRLAADADRHYQQVPDTF
                     GQAQVAWMRGELAWREDRYDDAAAFWRRSLHTPGGITEPADRADLALALARAVCCIGD
                     LPALDTAVDTARHLAADATAPAPHPTDTTAHRLPMIPLTPTTTAQIRPVTLLRLQATG
                     AFLTSNYARADALITQGVRLAGTLGEPGRHEQALLHAVYASAALLRDDLDAAEEALKQ
                     GLQAARNCPNARCRINLLLRQARLARIRAQSGPGLPTHPNPAPAAVQISLKAATEAAH
                     QRALSERYVQAALDLALDLTDRASQADALDNLGYVALDRGDLNTAHQHHEQALTLYQH
                     TGNRLGQALALNNLGNVARERGDLDTAEQHHNQALTLYRQAGSRFGQASALDRLGMVA
                     KESGDLDNAEQHHNQALNLYQQIGHRSGQVAALGNLGNVARDRGKPESAKQYYEQAMA
                     SFQQIGDRSGQATALDHLGKLARDRGDLDTAEQHHNQALALFQQIGHRSGQATALDNL
                     GHVAEDRGDLNTAMQHFEQSLALERQTGDRLGQAHALDNLGHLAWCRRDLDTAEQHHN
                     QALALYRQTGSRPGQATALMGLGSVARGRRDLVTAKQRYEQALTLYQQTSNASGQAAA
                     LNNLGMVAQDRADLNTAKQLYEQALALYRQTGHYPGEQQVLRFINQLDGLAPPSGP"
     CDS             complement(292968..293723)
                     /codon_start=1
                     /locus_tag="SAVERM_251"
                     /old_locus_tag="SAV_251"
                     /product="putative integral membrane protein"
                     /protein_id="BAC67960.1"
                     /transl_table=11
                     /translation="MTPKSDAAQSLVGDVRALTPPPGTHPLVGGIDAELVDAKHSISG
                     QIPLAIGLVVVTTFVLLFLFTGSVVQPLRALALNAITLVATLGIMTRIFQDGHLSSLL
                     GFTAQPMEMSMTVLMFCIVFGLSMDYEVFVTSRIKELHAPGEDTESAVTNGLGHTGRI
                     VTAAACLLAVSFFAFGTAKLSFMQMFGLGSGLAILIDAVAIRGVLVPAAMRLLGDSAW
                     YAPGFLRRFHGRFGLSESAPESAAEPEPAVSRG"
     CDS             294014..294610
                     /codon_start=1
                     /locus_tag="SAVERM_252"
                     /old_locus_tag="SAV_252"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAC67961.1"
                     /transl_table=11
                     /translation="MEWDQVDLATADPQSVWKSVAMVPQDYTRWPLTCRENITLGMPS
                     DEGDAAVLRAAEEAGAMAVVAHLPDGLDTSLARSWWGGHDLSGGQWQRIALARAFHKD
                     APVLILDEPTSALDARIEHQVFSRLRELSAGRTALFITHRLANARVADKVIVLEKGAV
                     AESGTYDELLRIDGLFAELHRMQEGAERDIPTPRTTRI"
     CDS             294912..295244
                     /codon_start=1
                     /locus_tag="SAVERM_253"
                     /old_locus_tag="SAV_253"
                     /product="putative MutT-family protein"
                     /protein_id="BAC67962.1"
                     /transl_table=11
                     /translation="MPSGKLDQGDPLPAGAARELFEETGITVAPGHLRLVHVVHHRQD
                     DEVERIGFFFEATDWQGEPVNREPDKCLALTWFTVHELPDGIIEYPQAGLRGYLDETG
                     PLVAHNWE"
     CDS             295675..296976
                     /codon_start=1
                     /locus_tag="SAVERM_254"
                     /old_locus_tag="SAV_254"
                     /product="putative IS5 family ISFa13B-like transposase"
                     /protein_id="BAC67963.1"
                     /transl_table=11
                     /translation="MLQSSVPASMSSNSASLSCDCLAHRFGNAGDRPYRRPKYPSDMS
                     DAEWAVVRDAMPVPGWLEGRGGQPESYCHRQMVDAVRYLVAGGITWRAMPADFPAWDR
                     VYAFFRRWRDKGLTAEFHDRLRDRVRQAAGRDLEPTAGIIDAQSVKAAASVPAVTRGF
                     DGGKKVNGRKRHIVVDTLGLLLAVMVTAASVTDRDAGQTLLARLRERHWRVTRVWADG
                     GYTGRLVDFARDAWRIALTVVRRSDDTSGFTVLPKRWLVERTFAWLMHSRRLARDYET
                     RTDTSEAVIKWAMSTVMRRSRRSRSVLLLAGGAFAPGEPTSDGCIQRVAVDALEDTTH
                     GGLGRGDGAAVRLPAWATEPGQDVGRGVGGPLRDRGQGLRSGQDRARGQGEDEGEWVE
                     PGSLLCANVQRTSPAYPGIFAAQAEPTSPLRAGLCRPWGTL"
     CDS             296991..298436
                     /codon_start=1
                     /locus_tag="SAVERM_255"
                     /old_locus_tag="SAV_255"
                     /product="putative metallopeptidase"
                     /protein_id="BAC67964.1"
                     /transl_table=11
                     /translation="MSSVMSSAMPSLPSSPTGPSRTGRRLLVALLAMLATAGSTVAEA
                     GTPSGPAPGAAVRAAEPATPDRPSYDVKLRADGDGSHWAGRQTVSFRNASSRPLREVY
                     IRLWGNGEDGCGTSGRPSPVRVSHVRGGTPGRPGVKCTALRIALPRPLARGERTAVSF
                     DVALTVPARNNRFGREGAFRFLGNALPVLAVHDARGWHLDPYVSYGESFYTLASDFRV
                     RLDHPSALKVPATGSTWTRPGGTGRTVTHSVAKRVRDFAWAAGPFRTATQTSPDGVRV
                     KSYWSPNTPAAGVRLNRKDGVAAIDRFGREFGRYPYGEIDLVMTPGFAGGMEYPGLVI
                     LGTEEEGGATVHEIAHQWWYGVVGNDEYNSPWLDESFAQYANARYYRWDGFECSPDDS
                     WPSATAALTNSMAYWSTHRGEYFQVVYGIGPCVLADLEHVLGAGTMARLIKKYAHDHW
                     YGVSTTVDFKKAAQSMTHRDLGPFWRKHRIR"
     repeat_region   298509..298510
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  298511..299908
                     /mobile_element_type="insertion sequence:ISSav20"
                     /rpt_family="ISAs1 family (IS1629 group)"
     repeat_region   298511..298547
                     /note="37 nt imperfect inverted repeat (30/37 nt)"
                     /rpt_type=inverted
     CDS             298664..299872
                     /codon_start=1
                     /locus_tag="SAVERM_256"
                     /old_locus_tag="SAV_256"
                     /product="putative ISAs1 family IS1629-like transposase"
                     /protein_id="BAC67965.1"
                     /transl_table=11
                     /translation="MPARSSSLIARSLGQLAGTAPTVPDDLPGLLTCLAQVPDPRRDQ
                     GRRHPLAFVLSLAACAVLAGAKSLAAIAEWAADAPPNVLARLGGPCREPDRGPVAPAE
                     ATVRRVLQRIDGDALDTAVGSWLAGRERAAGQEENDSDRRPLPSLAVDGKTVRGARRT
                     DGTQVHLLAAMTGTGLVTAQREVDATTNEITVFQPLLAPLNLHGTVVTFDALHSQTAH
                     ARFLVEDKHAHYIALIKGNQPTLHQWLKALPWREVPLLDKTRATAHGRDEIRRIKAAA
                     VAGIAFPHAVQAVQIERRRRIVTTGKVTLERIYGVTDLTAEQADATEIARRVRGHWGI
                     ENKIHHVRDTTYAEDASRVRTGTAPRAMASLRNLAIGALRLANQTNIAAGLRHHTRDA
                     NRPLITLGIM"
     repeat_region   299872..299908
                     /note="37 nt imperfect inverted repeat (30/37 nt)"
                     /rpt_type=inverted
     CDS             complement(299873..300469)
                     /codon_start=1
                     /locus_tag="SAVERM_257"
                     /old_locus_tag="SAV_257"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAC67966.1"
                     /transl_table=11
                     /translation="MTPADPTSPPGTIVTRGLRRTYGDVEAVQGLDLTVAQGELFAFL
                     GPNGAGKSTTIGMLCTTLRPTTGHAQVAGADITRSPHDVRRQIGVVFQESTTDDDLTA
                     QENLRLYADLYGIYLYSARLLSVLGCPCLPLVCRHTPNDIDSHFARSDVPVSCSYALN
                     LSESQAAGDGPAGRVGGIVMDLDAVDAQGRVVQVMCPG"
     repeat_region   299909..299910
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(300466..300885)
                     /codon_start=1
                     /gene="mcjB1"
                     /locus_tag="SAVERM_7586"
                     /product="hypothetical protein"
                     /protein_id="BAU68358.1"
                     /transl_table=11
                     /translation="MSGQLTLEPSTAIPWNQRPAALVTVTAARLLARVSPRRLRQVLE
                     LASRGARPADLPQALQARNAVVSVSVTIAGPRCLERSIATALLCRLGGTWPQWCTGVT
                     TRPFAAHAWVAVDGDAVGEDPDAVTDFHLVMSVPARR"
     CDS             complement(300882..301145)
                     /codon_start=1
                     /locus_tag="SAVERM_258"
                     /old_locus_tag="SAV_258"
                     /product="hypothetical protein"
                     /protein_id="BAC67967.1"
                     /transl_table=11
                     /translation="MMNFALAPEVSVTDTEHGTVLLDERTGRYWLLNGTGALALRALL
                     DGTSPQGVVASLCQRFPDAGTAQVEQDVDNLLHALRTAKVAAS"
     CDS             complement(301142..303052)
                     /codon_start=1
                     /gene="mcjC1"
                     /locus_tag="SAVERM_259"
                     /old_locus_tag="SAV_259"
                     /product="putative asparagine synthase"
                     /protein_id="BAC67968.1"
                     /transl_table=11
                     /translation="MPAVRLPHLLLTLVEGTGMEFLVLPDHPAGAAALALMPTAGPPP
                     THVIEHHSGRPWIVGCWNEEDVMVTAVGPHRVALLGRTTADADVLTRRLRDVRSVRDL
                     DGLAATAAGSFHLVASVNGEVRVQGTLSAACQIYYATVAGVTLAADRPQALADRIGAD
                     IDEDQVALALLSPFGPPWPLSERSLWRGVCSPPTGHCLEIGRDGTGRTRQWWTAPDPD
                     RPLGNGDMIRQALAEAVATCTAGQEVVSADLSGGLDSTSLCFLADADRHDAHLVTVHY
                     QALGRSSDDRYWARQAEAALPGARHLLVGPGQAPDWYAPLAHAVHDREGPLTFVRSRA
                     TTEHLARLAAAHGSRRHLQGIGGDELFHPSPMALHALVRRHPLAALPHLRALRSMRRW
                     PLTTTARTLASAPSYTQWLAACSNFPADRHDWGAGADWEPLPKLPPWATPHAAATVRR
                     QLLAALAATPQPLATLPVQHEMIRLTRINGNATRRNSHIGAHTGVTFHAPFTDDRVLE
                     AILAVRLEDRVALGQFKPMLGTALRSIVPAGLLSRTTKGDASAELYAGLRRRRGELLK
                     LMDDSHLVRMGFVDADVLRTVLRGLHADTRPLMPLDSTLACELWLRTLSPADTARATA
                     VPVPSPRTVKEI"
     CDS             complement(303121..303240)
                     /codon_start=1
                     /gene="mcjA1"
                     /locus_tag="SAVERM_7584"
                     /product="putative microcin mature peptide"
                     /protein_id="BAU68359.1"
                     /transl_table=11
                     /translation="MTAETSYETPILTEIGDFADVTRATYRGFWVDFLGGWWF"
     CDS             303674..304072
                     /codon_start=1
                     /locus_tag="SAVERM_260"
                     /old_locus_tag="SAV_260"
                     /product="putative transposase"
                     /protein_id="BAC67969.1"
                     /transl_table=11
                     /translation="MGRAGPVAFLTDEQRRNYGTFNQVPDDGQLAGYFLLDRDARRRA
                     MTCRGARSQLGYAVQLGTVRFLGTFLDNPEDAPAEVVAYVAEQLGHPGSVLAGYGAER
                     TRWDHQIAIKDAYGYRDLKGDAWWKLRDGD"
     CDS             304104..304334
                     /codon_start=1
                     /locus_tag="SAVERM_261"
                     /old_locus_tag="SAV_261"
                     /product="hypothetical protein"
                     /protein_id="BAC67970.1"
                     /transl_table=11
                     /translation="MLGQGQYVPLDLMIEGESQRMSERDALRGLRALMWVVIAIEVPV
                     YLVWLVEVSYLTGQQLPRGTEEEDGKPRADTD"
     CDS             304527..305000
                     /codon_start=1
                     /locus_tag="SAVERM_262"
                     /old_locus_tag="SAV_262"
                     /product="hypothetical protein"
                     /protein_id="BAC67971.1"
                     /transl_table=11
                     /translation="MQADAMAVAVMELQGAAAANRLLWEGPAERGRTFLLTLLAFAGG
                     AARARIAGGTDVQSGLVGFGQAAELLSRERVASKQTVAAVREPLAQAATAAAPLMRCS
                     APAVVAATEQLLNALADVENTARLEAALEAFGRAVNVATPPRLSWWARRRAVSSG"
     repeat_region   305275..305282
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  305283..307013
                     /mobile_element_type="insertion sequence:ISSav5A"
                     /rpt_family="ISL3 family (ISFsp1 group)"
     repeat_region   305283..305310
                     /note="30 nt perfect inverted repeat"
                     /rpt_type=inverted
     CDS             complement(305311..306945)
                     /codon_start=1
                     /locus_tag="SAVERM_263"
                     /old_locus_tag="SAV_263"
                     /product="putative ISL3 family ISFsp1-like transposase"
                     /protein_id="BAC67972.1"
                     /transl_table=11
                     /translation="MILAECGELLKTMFPHLEGVLVEEVSPEGGVLHIVARTVESVPV
                     PCPDCATPSVRRHSGYQRRLADGAVGGRQVSIELTVRRLFCDDQRCARVTFAEQVDGL
                     TVRYGRRTPQLRCLLSAIAVALAGRAGERLAARLPVPVSRTTLLALVMALPDPYAETP
                     RVLGVDEFATRKGHKYGTVLVDCETHAPIDLLPDRESATFAAWLTDHPGVEIICRDRG
                     GAFADGARTGAPDAVQVADLWHLWHNLAETVKSLVSKHSSCLREPALASESPPEVLHP
                     PLSHAGRLAERARRHHAAVHDLLGQGLTIRAVARRLELSRNTVRRYARAVTWEELATG
                     RWQNLPSTLDPYKSYLHQRWHEGHTSGAKLHAELRERGFTGSYSVVRDYLRRFRRTSG
                     DRPPPARPPGVRKVTGWITRNPDRMNDDDQQKLKAILARCPELEAATGHVRSFAAMMA
                     IRSASRLPEWIATARADEHHGLRGFADGLLADLDAVILGLSTEWSSGCVEGRVTDIKL
                     LKRQMAGRAGLPLLRKRVLLVAADRRQHRVTNQTAH"
     repeat_region   306984..307013
                     /note="30 nt perfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   307014..307021
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(307092..309302)
                     /codon_start=1
                     /locus_tag="SAVERM_264"
                     /old_locus_tag="SAV_264"
                     /product="hypothetical protein"
                     /protein_id="BAC67973.1"
                     /transl_table=11
                     /translation="MTPATPTPPSSTPPSWPQCGHGTTPEDPAGCRGIRVSGHTACLA
                     HLSDADRDAYLAGLSPGNNVDHRGTSFSQDLLDALLDALRDPDTGDPRLGVARFRSAT
                     FQRDVGFRSATFQKWADFGSATFQGNAGFRLATFEGDAGFGSARFEGDAGFGSARFEG
                     DASFVSATFEGDASFVSATFEGDASFVSATFQSAASLGWAAFQGDVKFESATFQGDAV
                     FGGADFRGDARFGLAAFERNARFGLARFRGIASFWLVTFHGDAWFRSAIFRGDASFVS
                     ATFQSDTDLEAATFSDHTRFDRATFFGDARFVEATFRGDTSFVSATLQSNANFLGVTF
                     ERDAKFESSIFQGDATFVSATFECDACFEQVGFERSASLGPLVCAGRVKLSGAVFGCP
                     VTLSFATRCLECRRTRWSSTAELRLRYATVDFAHAVFEYPLTIAAEADPFVLHNGRPV
                     AEQSLIDAPDIEVRIASLRGVDAAHLVLSDVDLSGCLFTGTVHLDQIRLEGTCSFASV
                     PRRTHWRRWRPLRFTQRRALAEEGFWRASQPTPVPGWNAAVAGAVHAGPAQLAPVYRA
                     LRKAFEDSRNEPGAADFYYGEMEMRRHDRTGSTRTERGLLHGYWLLSGYGLRASRALG
                     WLAAAMLVTIVLLMGFGLPKDSPKQVATGTVPPGDGKVTLEIDKADPQNPTGDRFTSE
                     RFEKALTGTLNSVVFRSSGQDLTTAGTYIEMASRVTEPVLLGLAVLAVRNRVKR"
     CDS             309794..310207
                     /codon_start=1
                     /locus_tag="SAVERM_265"
                     /old_locus_tag="SAV_265"
                     /product="hypothetical protein"
                     /protein_id="BAC67974.1"
                     /transl_table=11
                     /translation="MGTRLRLRRADFSDGRCERKLTQKVPVSRPGGVQGLITNTYLSP
                     TEYDLLASLPAAVLSKTRFSVPPLGVDVFDGPLQGLVLAEAEFTTDEETQSFIPPSEC
                     VAEVTDDARFTGGRLVETSRQELLGWLAEYGLRPQ"
     CDS             complement(310455..311114)
                     /codon_start=1
                     /locus_tag="SAVERM_266"
                     /old_locus_tag="SAV_266"
                     /product="hypothetical protein"
                     /protein_id="BAC67975.1"
                     /transl_table=11
                     /translation="MPHVVLRLRESSGCSYLNRLADANRLPVQFRPILLGHNRHHRRD
                     DNRPGRWTPETLCRLSALTGRTAAELSHAIPALAVIGEPAENRLQSLSGQAVEVLRRP
                     ACRRCMARRGFHGLVVRTIPPHEAVCLRHQRWLLGDEQYRLHALPELQQANRRHCRLV
                     RRTRASILAREYAVARDCLRDWFQDGKPSALRQRWNKRIDQLGEDPYGDETPVAPPSP
                     G"
     CDS             311330..311680
                     /codon_start=1
                     /locus_tag="SAVERM_267"
                     /old_locus_tag="SAV_267"
                     /product="hypothetical protein"
                     /protein_id="BAC67976.1"
                     /transl_table=11
                     /translation="MLEDPAAHGVDLDCTMVLHELTGDEWPATRAHAEEFVLPHLREH
                     RVRLVQVARASRSLEITVIDDSRQPQRIVERGPWALWDEYESGGTVPQQGGIRLCSLH
                     AKGNWRMPLSPTTC"
     CDS             complement(312030..312479)
                     /codon_start=1
                     /locus_tag="SAVERM_268"
                     /old_locus_tag="SAV_268"
                     /product="hypothetical protein"
                     /protein_id="BAC67977.1"
                     /transl_table=11
                     /translation="MQSAGDVGYEHAQVGEEYWAGLPLPWNESGKDIQITRAKFTHVP
                     KGLKVIEYRAFNGDDTDGNVLFARTDGKGSVGDLFKARNYAGHPMTVKAKTGSHVYYV
                     ARVKVTGPIHDNLSGCSYWYRQGSTEFQQQLDCSTIVRLGKPLKYEG"
     CDS             complement(312589..314877)
                     /codon_start=1
                     /locus_tag="SAVERM_269"
                     /old_locus_tag="SAV_269"
                     /product="putative secreted protein"
                     /protein_id="BAC67978.1"
                     /transl_table=11
                     /translation="MSSVSRGRGTTTAIQVLSTIVLATGLTVAPQALTPGHPASAADV
                     SCTTYSVSTYVFEPATSSNAASKRVLHKYMEWGPKSPDTDLLDTLYTASLPMTSKVFT
                     GGGNGIIYEATGGGQVKSYKDNTATGGSLLTPVKTYSFNWSSAKQILANGHWILVIAS
                     DGTMDVYKQSSPDSGDGTITKVMDGAKSSVTSAIADADDAWMINSAVQWLKDGTIQQA
                     AVTSLPPGPANLPPGPGIRLEAATSIATGVDAAQAWAPGPNAISTQSVTSDPDTTGQI
                     RSFTTGPWTSADSDVRSGILGDVMADAGPCLTDPDQDTVPYFGTPPVADTDVPTAQES
                     SDTAPSTPSNTITGRFTLGSGQPASGLTVMVTASDVDTGSDTATGGTEPLLGKATTAS
                     DGAWTLTLPSTLPANVKQAMDDNGGALNLNATTTATTSSGVQVLGADTLTAVPEQSKT
                     ALAAGTDASARAAEAINDNHTVPLIPDTVDDTAAKEPTADQEKQTFAAQTKADPQATG
                     EMTPMWQSDHSTLAASYNPYLVGGKDISAETVTPHASGSCDTVKYKQTSKIKYTVVGE
                     AHANWDSKASFDYDDTMNSAIDTAVNSNGDWKLGGSMQISSETGVSTGYPNKGSYYAH
                     QYQVPIEYNKYKKQRICSGTVRATWYTIEPGRYKVPSGGSVGKIGKDVSAKDGSGNYG
                     RAPKSYHAKVDNGTYFQLTRKKSAKFGNAVNFMGVGLGVTTGYDTNHKQKIIAGTRRN
                     ATHLIWGKNGPVHDKPGVFYSN"
     CDS             315325..315852
                     /codon_start=1
                     /locus_tag="SAVERM_270"
                     /old_locus_tag="SAV_270"
                     /product="hypothetical protein"
                     /protein_id="BAC67979.1"
                     /transl_table=11
                     /translation="MRPWRPWSCPYDDLMRQADPKPYWNTNVARHPGILRAVPKTGTA
                     SATAAQPLLDYINRRYPLTQTTPLDANRFRANAVPEAEPGDIIAYDWQNDGEVDHLSL
                     VVDIADGQYPEIAEWGVVDWNPLGVINRNATTPYAKRGWTYSEKNHNWLQSVEETRNV
                     SAKLIHIDTRNVTTF"
     CDS             complement(317520..317873)
                     /codon_start=1
                     /locus_tag="SAVERM_271"
                     /old_locus_tag="SAV_271"
                     /product="putative secreted protein"
                     /protein_id="BAC67980.1"
                     /transl_table=11
                     /translation="MGVERGAMLDELVSAAAAAGGSAVVQAAGTDLWNGFRGRVAEWF
                     GRGDAVRESRELERLDRSASELSTAGQDEVERLRVRHEAVWQSRIETLLEDLDGVERD
                     QAVAELSKLMAQARP"
     CDS             319056..320099
                     /codon_start=1
                     /locus_tag="SAVERM_272"
                     /old_locus_tag="SAV_272"
                     /product="hypothetical protein"
                     /protein_id="BAC67981.1"
                     /transl_table=11
                     /translation="MCLEQRQGHRRVVPHPGDRRPARRDRPPPSRAASGPARGRTSNP
                     LAPNGRESSMTNGRIHTDWVETVSQDGLHLMQTRLEVRVPTSEGRKFITCGLARKTYV
                     VKDGIACRVSSYALGRDLGSPGNYDFEIVSATGGPPIRRFFNWDGVPAEILEGALFDA
                     HEGLDDGEYIVRIAAGMTTSWDSGTGQSIELHVPCHELAFVVVGSAPQEVRARTGGPW
                     AARPSVEIPVVDWRDQPTAEAAWEAYLNGSRISLDAYGIFSPQHLMRNQRDTALEILR
                     SEGYAIPRTPEPAETPGTWLGHWGGAWMPADVLAALHTVPDDTAQRAWYQGAKESLDI
                     AWDMHLLWTTDVF"
     CDS             320615..320959
                     /codon_start=1
                     /locus_tag="SAVERM_273"
                     /old_locus_tag="SAV_273"
                     /product="putative DNA invertase/recombinase"
                     /protein_id="BAC67982.1"
                     /transl_table=11
                     /translation="MGQTLAAAGGLQRDLQRELTYDGLRAAEAKGSKGGRRPAVAAAK
                     AETVRTAYLEGRSIAALARDHGVSRGAIRTAIADLQHLGEMEWIGPVGQGLFGATDGG
                     RPSQAAAHAGLV"
     CDS             complement(320979..321200)
                     /codon_start=1
                     /locus_tag="SAVERM_274"
                     /old_locus_tag="SAV_274"
                     /product="putative IS630 family transposase"
                     /protein_id="BAC67983.1"
                     /transl_table=11
                     /translation="MERWFGLLTDKLIRRGVHTSVKALEDDIRAWIDSWNENPRPFTW
                     TKTADEILKSLTDYLSKVTPPATENQQGT"
     CDS             321655..322395
                     /codon_start=1
                     /locus_tag="SAVERM_275"
                     /old_locus_tag="SAV_275"
                     /product="hypothetical protein"
                     /protein_id="BAC67984.1"
                     /transl_table=11
                     /translation="MAELAYLAGWKHHDLGQEGAAQRYYQVGYQLACEADPHGHAAWM
                     MRALAHQALSLKQPHHCVDLVEGALTRGLGHVDGQTEALLYITHARAYAVTDEKSAAA
                     RALLAAEDALLRDDVPQPSYSRVSGPAAGSVASHTARTLTDLADLADHAGTEQQHRDA
                     LIRWDLKKYKRVHALTYADLGDSLAAQARADEAVAAWSQALTLMEGMTSDRTRKAITS
                     LRSPLSVYQRRKVPGAVELARRARQALA"
     CDS             322432..322938
                     /codon_start=1
                     /locus_tag="SAVERM_276"
                     /old_locus_tag="SAV_276"
                     /product="putative MutT-family protein"
                     /protein_id="BAC67985.1"
                     /transl_table=11
                     /translation="MAQRTTDDLPNALPPALESMTLLVAAVIVHDQATNRVVLLQRSE
                     NAKFAQGMWDLPVGKSEPGEPITETAVRELHEETGLTVKPEALMVAHIIHGSWGVEAP
                     NGFLTVVFATHEWTGEPENREPRKHSQVRWVDADAIPEECVDTTASALHHYLSGGAQV
                     SLDGWLPK"
     CDS             323014..323400
                     /codon_start=1
                     /locus_tag="SAVERM_277"
                     /old_locus_tag="SAV_277"
                     /product="putative terminal protein Tpg homolog"
                     /protein_id="BAC67986.1"
                     /transl_table=11
                     /translation="MHALLILHAAGYRWEVVDSLAALRLAVPGRSAAYTARSRVTPLG
                     VRESITARDQSSFFAARSFLSSTTCSSSHHAARLLQAQQDGTDEDDLRQIAAEALGEV
                     YFRDNGRRAQSLEVKLTDLVDLKFEL"
     CDS             complement(323714..324121)
                     /codon_start=1
                     /locus_tag="SAVERM_278"
                     /old_locus_tag="SAV_278"
                     /product="hypothetical protein"
                     /protein_id="BAC67987.1"
                     /transl_table=11
                     /translation="MAFAELPDIPGALLRTSVLFLGERNQVRQSVTSVYTELTKEAGK
                     RGGPAALRAFYRMQGALIGRAQGIAMGRAQGLLIGRAQGAIVAASVSIAGTQLYNRVR
                     GRGCDSTAVPTPMPAGENGAGAEVPTQGQEDDA"
     CDS             324309..325121
                     /codon_start=1
                     /locus_tag="SAVERM_279"
                     /old_locus_tag="SAV_279"
                     /product="putative endonuclease"
                     /protein_id="BAC67988.1"
                     /transl_table=11
                     /translation="MGEDHSMASLDELPPYRRAQLLWRWAHEGVAFVEHLVFDAAKEP
                     CCLPSPPPGPPGRTVAVPGDDGRFHLERAGLMLCGQAEATGAWGHRQHCGWVERWDGP
                     QEWRGGRDDGTSVWGSLIVEWPVRASGPGVDPGSVDRPERCPGGAYELLHLWPPRPAR
                     TASVRRLRAALVDALGPDCHLCGLYPGAMVDHDHQTGRVRGLLCAYCNRLLEECPHLT
                     DCPRADYLLAPPADALNLMYPAGQQWRPKESTRLRVIEQLGFDPFEDLRPPL"
     CDS             325362..325622
                     /codon_start=1
                     /locus_tag="SAVERM_280"
                     /old_locus_tag="SAV_280"
                     /product="hypothetical protein"
                     /protein_id="BAC67989.1"
                     /transl_table=11
                     /translation="MAAGPLCERGVFSLTFFTSMVWGSTASPGAPSRYRPLGRLSRSC
                     GRRKKTRRVYRPLSGSGCLAGPATRGRAGRARRTGAVAGREQ"
     CDS             325633..326067
                     /codon_start=1
                     /locus_tag="SAVERM_281"
                     /old_locus_tag="SAV_281"
                     /product="hypothetical protein"
                     /protein_id="BAC67990.1"
                     /transl_table=11
                     /translation="MWPRDLEHLRELALEFRIMHLKSELNAALGRFSIGIGGLDDRYP
                     TILSVAFLQLYNHLAEDATIRECANETCRRNFVRQRGRAEYGQNRTSGIKYCTRECAR
                     AQAQRELRRRRRQQNSPLQQPRSEKPAPQDSPEAVGQAGGER"
     CDS             complement(326189..326509)
                     /codon_start=1
                     /locus_tag="SAVERM_282"
                     /old_locus_tag="SAV_282"
                     /product="hypothetical protein"
                     /protein_id="BAC67991.1"
                     /transl_table=11
                     /translation="MDTARLRSLIDGVLLTQYRRYTEKELPALCERLGLPSPSAGDTK
                     HKRLVASLKACPDDRLPDVAEAVLEQEELDQAERMALLASDTKIARLAAPRAPRVVRR
                     PKKK"
     CDS             326629..327654
                     /codon_start=1
                     /locus_tag="SAVERM_283"
                     /old_locus_tag="SAV_283"
                     /product="hypothetical protein"
                     /protein_id="BAC67992.1"
                     /transl_table=11
                     /translation="MSHKSIHEHLLISARKWARTAVDAYLEEPIDQDFAVHHMAVAVE
                     HASKAYLASIAPVLLASEKQPSVDDLLVLSGNEDKTKKGRAGLKTIGGEGAILRAAQL
                     LGPGHKGPAKLKELRESRNGITHMGWGQPVTECRELLAAGIEHINALLKALSTEPDGF
                     WGTHLEACTALVAQAMSEMEIRYHAKLRQARERFAETTRRLSEAEIAELASSLSALPT
                     AHSSRSKTEARTVESGSLTHWDHETRAPMSCSTLSARVSCMMCGPARAAMRRARPRRS
                     SAARRCEPPPHRARRPGQSDRARTGRRPGTSAERLPGPAHRRRLPRRKGSPRLRRERT
                     QVRGRLR"
     CDS             complement(327842..327994)
                     /codon_start=1
                     /locus_tag="SAVERM_284"
                     /old_locus_tag="SAV_284"
                     /product="hypothetical protein"
                     /protein_id="BAC67993.1"
                     /transl_table=11
                     /translation="MAAASRRSPRRSQAVGPELVAGQVANRFHAAWSVPRASRTAATT
                     DGCALP"
     CDS             328293..328691
                     /codon_start=1
                     /locus_tag="SAVERM_285"
                     /old_locus_tag="SAV_285"
                     /product="hypothetical protein"
                     /protein_id="BAC67994.1"
                     /transl_table=11
                     /translation="MQGTARRRAGERSADDVDAEGAGQGGQLVVVSLADRAYAPTFGR
                     AGLRRIRFHNLRHSTATLLLEQGVDLVVIKELLGHAHIGVTATVYAHLRLRLQRDAID
                     LLGNALRNPDETAIRPDDGDGPPLCAAPVH"
     CDS             complement(329452..336546)
                     /codon_start=1
                     /locus_tag="SAVERM_286"
                     /old_locus_tag="SAV_286"
                     /product="putative large secreted protein"
                     /protein_id="BAC67995.1"
                     /transl_table=11
                     /translation="MAVRRARLVSVGFAGAVLAGLLSTVSVVSPIQAAAASDDPTPVV
                     PSQSLGSVPAQQTEEVGKALPAPKWPSAAEATVDLSEAAAGEPGTVSPEPSASASGGV
                     GDGESTQVGEVVEVAPVAEDLGTEAQLSLSRLADESTPSPSPSVSDGSEPSTPPTAEA
                     SPSPEPSESASDEPIQDPVSPDQVEVRVLDREAVAPAGGIGLGLQVSRTDGVDAPGQV
                     QVDIDYSGFKYAYGADFASRLRLVKVPACALQTPDAESCADREFVPVDNDTDSGTLTA
                     TVTAAADTGSAGASAQLMREAGSSSASVYAVTSSSSSDAGDYRASTLSPTGSWEVSTG
                     SGSFNYSVPIQVPAPPMGSAPSLAMSYDSQSVDGRTSASNNQASWSGMGWDLNVGFIE
                     RRYRNCTEDGLPTIGDMCWDSPNSAKEPDGAAYVISLNGTTSELIQDNNGSGAYHLKN
                     DPGWRVQRLFDGHGAGRNGEYWVISTQDGQRYYFGWGRSERTSTATASVFTVPVVGND
                     AGEPCHDQFPEPCTQAWRWNLDRAVDANEVETMYFYDKEYNHYRSVANTDKAREYVSS
                     GYVKEIQYGWSSQITDGKVPAKVELSHVNRCIERVQENDPLRDEPAACPAFDDKPGSY
                     PDVPVDLMCDGTSADYNCAGKTYFPTFFSTDMLWDIKTYVSDQDGTGWDLVQQYQNKY
                     GMPNPDGTIGKTLWLDYIQRKTYGDGDDIVLPVINFNRTDLDNKVGSAELNFPRIKEI
                     HGDLGATTTVSYGFANACDIDHLPAQASNTQDCYWQKWTPEGETDSKTGWFKKFLVTQ
                     VQVDPTVTTNQDGAPVMTTSYTYEDGAGWHFTNDPLIKDEDESWTDWRGYQEVQVTTG
                     AGAGQKTKKSWLYRGLSGDRTSKADASATKTVTVDDGDGNNYTDDSWLSGRILSTSLR
                     DDTGTSHERTYHKYWDHNTAQYDGLPDARFVREKETTTNTKVSSGWREHTVETEYDDT
                     EGASTTFGLPMRTDDWGQSSVSDNRCTTYGRAYNTDNYDSTGAQRWTVLQDQVKHYSV
                     GCSSIADSKQDGYASTLYDNATSVDANKPVDGNPTESRTYTKSGSYRSTWSGYDDAGR
                     VMWSEDGSHNRTLTKYSPANTWPLNGVIVTTPDPDGALPAHTALTSTAWTSRFWGKPT
                     SIQDANGNVTKMSLDAAGRLVEVWRPTETGSSPSMKFSYTIPTSTNSAGVPDAVDGYP
                     HVATHVLQSGTTYLSSHAYVDGLGRARETQTPMGNGVDAATGNEVPNRQVSVTRYDSA
                     GNVTGTSAVFRNQGTAGSGGPSSAKVEDLPSYTDLVLDWAGRAITSRLQVNGASQDAG
                     RVDTTYDGDFTSVKNKVDAAADTYTDVYGQVSKVVEHTGSATYTTAYTYTAKDELIKI
                     TDPRGNDTSYTYDWAGQRTATDDSDAGVSSTEYDKNGQISKITSNGGKTVLDYGYDAL
                     GRKTAVRSGDTELAAWTWDGLNITGGKGQITSTTSRDTNGNTYTTKTGEFDVRGRPLK
                     TTVTIPDTVKGLAGSYTTGFTYDAADHVTSVAYPAAGGLPAETVNATYDGYGRPLRLQ
                     SALQTYIRSTGYDAYDRLTDRSYGVDSVLPGIGAAAQRTYSYDDSNGTRELKSVATTT
                     TLNKVVSERQKDTYTYDLAGKLTELREQASGQTAQSQCFLYDDQARLTNAYTHTTTGI
                     CADKTKTASDFKGTAPYQTAYTYDRLGNLQSITNTDSAGTATLHDYLYPGYDDTGTWT
                     TANANQPHGVRKIDHKTGSTTTKSDQLYYFDDGTMKQRVEPGITTDYTWTPQGQLEAV
                     KTTKSSGSELTRYAYDADGNILVRTTPQETVASIDGMELRTTNGTTVTATRVYASGTA
                     TVAMRTTEGTTATNGKVTYLMADTQASTQLAVDASTGASTRRRYTPFGDERSGTLPTG
                     TDNGFLGKTEDTSTGLSLLGARAYDPNLGRFLSPDPLATPYAPQNLNAYSYATNNPIS
                     YSDPSGLCRRDICGDGYPVAGDGERAGYTGQHPGEHACTSCNSGNGGYLLAGVVPSDW
                     DKAQEFYDRVAEIIVSWPAGWTDWNYKPHEDPLADLRVGQVVYNACEDVGGCPDGIDP
                     QRDMLNAAVAIELPGTNGRGSSKKAAGPCKCFLAGTDILMADGSTKDIEEVELGDKVQ
                     ATDPKTGETGPREVTRLITTTGDKHFNKLSIATEDGAEELTATHEHPFWSPSESAWIT
                     AGSLEPGMTLLTDDGDTVIVTGNRAFTQHATTYNLTVNDLHTYYALAGTTPVLVHNSS
                     CSTNAQILGDNMTAAGTIRPAETAAHHIVASASPKAASARAKLASVGIDINDADNGVF
                     LPRGSASPNLTGASVHSRIHTNNYYGYVNDMMSGVRTANEARDVLNHIRNQLNAGYWP
                     "
     repeat_region   336637..336640
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  336641..337854
                     /mobile_element_type="insertion sequence:ISSav21"
                     /rpt_family="IS630 family (ISRj1 group)"
     repeat_region   336641..336653
                     /note="13 nt perfect inverted repeat"
                     /rpt_type=inverted
     CDS             complement(336652..337179)
                     /codon_start=1
                     /locus_tag="SAVERM_287"
                     /old_locus_tag="SAV_287"
                     /product="putative IS630 family ISRj1-like transposase"
                     /protein_id="BAC67996.1"
                     /transl_table=11
                     /translation="MIPRTFPPAPAWSPDGHRIKAELDYSRGPEKTWVYGALRVRDGQ
                     QITMTASSRNSVFYQQFLQQIEDANPTGELWIVTDNLSSHNSLSTRTWLEDHPRIHHA
                     FIPVGACWLNLQEGWWRIFRKAALAGRSFANPDDIEHATALATSQLNSRANPWIWGRP
                     APPTRRLRRRYVYTV"
     CDS             complement(337203..337778)
                     /codon_start=1
                     /locus_tag="SAVERM_288"
                     /old_locus_tag="SAV_288"
                     /product="putative IS630 family ISMac13-like transposase"
                     /protein_id="BAC67997.1"
                     /transl_table=11
                     /translation="MVLRARPGRDEDERAVVRRLSRARKAPRDAVMRARMIELSWSGL
                     RVPAIAGELDCSQKTVRCWLHRFNRSGLQGLDDLGGQGRKRRITEEERSRIISLVKTV
                     PPGRLRWEPVGELWAFDESGPPEWTLDSLAAAARAEGVEVGRSQVRRILLAEGVRWRR
                     TRSWTRSKDPDFVPKGQGSSASTPTRPTTRR"
     repeat_region   337842..337854
                     /note="13 nt perfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   337855..337858
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  337859..339284
                     /mobile_element_type="insertion sequence:ISSav4A"
                     /rpt_family="IS701 family (ISAzvi8 group)"
     repeat_region   337859..337874
                     /note="16 nt perfect inverted repeat"
                     /rpt_type=inverted
     CDS             337911..339185
                     /codon_start=1
                     /locus_tag="SAVERM_289"
                     /old_locus_tag="SAV_289"
                     /product="putative IS701 family ISAzvi8-like transposase"
                     /protein_id="BAC67998.1"
                     /transl_table=11
                     /translation="MDAHEVNRARATLALFVADVFASVPRKDQRAKGDCYLRGLMLDG
                     RRKSIQPMAERLPDGNEQNLQQFVNQSTWDPVPVRRRIAERMVAQIGPDAWAVDDVSF
                     PKDGKMSVAVAHQYCGALGKQANCQVAVSVHAVSDTASCPLQWRLFVPQEWAHDAPRR
                     QKTGIPPEVGHREKWRLALDIFDELAGWGLVPPVVVADAGYGQNADFRDGLDGRGIGY
                     VAAIRSDVTVHPHDAEPFAPPWSGNGRKPQPRYRDKPSSVAALATGHGRQAFTEVTWR
                     EGSRGPMRSHFLSLRVRPAGVKSRRLAQAAATDENCWDGVLPEVTLLVEWPEGAEAPT
                     DYWLSNLPDTLSLAELVRLAKIRWRIEHDYRELKHGLGLDHFEGRSWTGWHHHVSLVT
                     AAHAFLTEQRLAPKAGTADSPSTRPSTPSRTC"
     mobile_element  339207..342900
                     /mobile_element_type="insertion sequence:ISSav22"
                     /rpt_family="IS3L family (IS469 group)"
     repeat_region   339207..339223
                     /note="17 nt perfect inverted repeat (13/17 nt)"
                     /rpt_type=inverted
     repeat_region   339269..339284
                     /note="16 nt perfect inverted repeat"
                     /rpt_type=inverted
     CDS             complement(339271..339735)
                     /codon_start=1
                     /locus_tag="SAVERM_290"
                     /old_locus_tag="SAV_290"
                     /product="putative IS3L family IS469-likee transposase"
                     /protein_id="BAC67999.1"
                     /transl_table=11
                     /translation="MSPHLDAVRVERVWAAGGVVRIAACTRELTVACPDCGRGSARVH
                     SRYSRTLADVAVGGRPVVIGLSVRRLFCDGPGCGRRTFTEQVEGLTVRYQRRSPLLQH
                     LVQMAGVLLAGRGGARLLQILKVPLSRTSVLFHLMRLPLPAAATPRVLVGLR"
     repeat_region   339285..339288
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(339819..341939)
                     /codon_start=1
                     /locus_tag="SAVERM_291"
                     /old_locus_tag="SAV_291"
                     /product="putative IS30 family ISLxx5-like transposase"
                     /protein_id="BAC68000.1"
                     /transl_table=11
                     /translation="MRAWMATRAMISWLRASSTRVRRPLRVSLGSGAGSRGAVVRVMW
                     RAGSRKILRSRRSARKSDRSGGWTECRRAASVPSRTAVMWLLVISRRSVIPSAAQAFR
                     TGAYSRDPFCCFTTGQDLATFFDCHRLAFAHFGGVPMSIVYDRTKTVVRRHVAPGEAV
                     PLHPEAVAFAGHYDFDVDVLAAYRPQGKGRVERQVGIVRDHVLAGRAFSSIEEINAAF
                     AAWVPLRRAKVHGTHGEVIGHRAVRDHTALRPLPTTPYLVTQRHLRHVGKDCLVAFDA
                     NLYSVPARKIRPRQLVEVRATKSQVTLHSTIADRDGQTMLAVHPRAVGRGARIVDETH
                     WDGLAEEAAAAVGVSQAAGCRWFCHGGGMPPMDLAPQSGRYLSFHEREEISILKAQGI
                     GVRETARRLGRDPSTVSRELRRNAATRGGRLDYRASVAQWKADLVARRPKTAKLAAND
                     RLRDYVQARLSGQVSRPDGTVLGPESPRWKGRNKPHRGDRQWVMAWSPEQIANRLKVD
                     FPDDESMRISHEAIYQALFVEGRGALKRELVACLRTGRALRVPRARSKRKAWAHVTPE
                     VLISERPAEADDRAVPGHWEGDLLIGLERSAIGTLVDRTTRYTVLVHLPRQDGYGVVP
                     RTKNGPPLAGYGAVTMKDALAATIGTLPEQLWRSLTWDRGKELSAHAQFTIETGVPVY
                     FADPHSPWQRGVGVQVNVALARFP"
     repeat_region   342884..342900
                     /note="17 nt imperfect inverted repeat (13/17 nt)"
                     /rpt_type=inverted
     CDS             343063..343689
                     /codon_start=1
                     /locus_tag="SAVERM_292"
                     /old_locus_tag="SAV_292"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68001.1"
                     /transl_table=11
                     /translation="MPLERIVSTALQIVDDEGADALSMRTLAQRLGSGTATLYRHFDN
                     RAALVAHVVDRMFGAVELNGDELLAMGWQQALRTVAHTMFEALARHRNAARLLVEEIP
                     LGPNAMALREHCVAALLDSGFPPRLAAHAFATLSRYVLGFAIQVNGHGGGGQLADAQV
                     SAVFQSVDPALFPATVTVAGSMPVPIEDEFSFGLELLLSGLAHLRDDA"
     CDS             complement(343805..345154)
                     /codon_start=1
                     /locus_tag="SAVERM_293"
                     /old_locus_tag="SAV_293"
                     /product="putative oxidoreductase"
                     /protein_id="BAC68002.1"
                     /transl_table=11
                     /translation="MPVLIVIAIYAVRIARAPLDPRLKKRHVGPLSVTTGAVMLYLAW
                     DWLRPEGLSAVYFVGEFAGVLSAYLMSCTLVLATRLMWLEQWFGGLDRMYRQHKRYAV
                     WSILLLTPHLLLHFFSGFDGSQYGYAHRTASVGMGHLLGAVSAIGLLLLVLISLGQVG
                     RILRLPYERWLFLHRLTGLLLLSALLHGWFLDLIINGSTPLLAIYVTMATVGMTAYAY
                     DELVLRHREPRADYTIHRVERPTPDILDLTLTPTGKTALPVTGGQFVYLRVGGWHEHP
                     FSVAGTQADGSVRLTIRALGRGTRGLYTDVSEGHPATLKGPYGMFDHTLGGPRQIWIA
                     GGIGIAPFLGWLTHPGAEPAQTDLFYCAATAEDAPFLSELTAAAAHRPEFRLHPTFSR
                     SHGRLTAERIQAEAGPITPDTHVFLCGPASMIENLTRGLHRQGVPRQHLHAEHFAFR"
     CDS             complement(345361..345771)
                     /codon_start=1
                     /locus_tag="SAVERM_294"
                     /old_locus_tag="SAV_294"
                     /product="putative invasion protein"
                     /protein_id="BAC68003.1"
                     /transl_table=11
                     /translation="MPDPSHNSLVTPPRRRHPGSTLMILTITLACLIALIFGASGVLN
                     TLALPKARELAAETGFSVAAYRRIGVLQLAGVAGVVLGLAVPPLGGLAGAGLLLLLAG
                     AVVVHLRQGDPVAKLVPAAVCAVLVASYLAALFA"
     CDS             complement(345826..346056)
                     /codon_start=1
                     /locus_tag="SAVERM_295"
                     /old_locus_tag="SAV_295"
                     /product="hypothetical protein"
                     /protein_id="BAC68004.1"
                     /transl_table=11
                     /translation="MTPHRPDAEVVDFSERIVISQPALDGCCATPWSTIPSAICGAEP
                     TSRPASRRNSPAPGRGRGTLRAGMDGRRQAPT"
     CDS             complement(346092..347669)
                     /codon_start=1
                     /locus_tag="SAVERM_296"
                     /old_locus_tag="SAV_296"
                     /product="putative FAD-binding monooxygenase"
                     /protein_id="BAC68005.1"
                     /transl_table=11
                     /translation="MNNPQAIDVLIIGAGPSGSALAIDLVRRGLDVRIVDRSPHAFDG
                     SRAKGIQPRSLEVLEDLGALDDVLAGGDTYPKLGLHAGPIGVPWKMFPHKEATPDVPY
                     PNTWLIPQFRTDRALHARLSELGREVEFGKELTELTQDEDTVVAKVVGADGVEEIVAR
                     YAVGADGGSSAVRKQLDIGFVGTTDESDRVLIVDASVSGLARNRWHMWPGLGGKLIGA
                     CPIPDSDMFQWMIRLTPDEKPPQEIGAIIDRIHSHTRNRHIQLHEIHWKSVFRPNIRL
                     AEHYGRGRVFLVGDAAHVHTPAGAQGLNTGMQDGYNLGWKLGQVLAGADPALLETYEA
                     ERQPIAAGVLGLSTEKWGGIAKLDPSSMKRGKDEQQLSLTYYGGPLAPDGMRTGTLHV
                     GDRAPDAQLLGADGAETRLFNLFQGPHFTAIAYGPGAARDLELLDWPTTGAQLKRLTV
                     GSAAGGGRAFSDPKNTLQSAYGLTGDTLLLIRPDGYLGHIATRDFLTTTQAAVRAMAP
                     QAKTRTMSQPSHTYPLA"
     CDS             complement(347666..348571)
                     /codon_start=1
                     /locus_tag="SAVERM_297"
                     /old_locus_tag="SAV_297"
                     /product="putative alpha/beta hydrolase"
                     /protein_id="BAC68006.1"
                     /transl_table=11
                     /translation="MKYFVASVEDRKLTADSRKALRGSFIELSDGVTHYELTGPEDGE
                     VVLMAGGLTIPLFYWDGLVSELHARGLRTLTCSAYGRGYSDRVQARYDETLFTRQLAE
                     LTDRLGLTARPLHLVGTSMGALVSMTYAAQYRSSLSTLTIVGPAGLAKPQLTSPHRLL
                     RNDWLADLIARRRGRQILQGHLGHNVRDPELGGKLTEMVLDAFRFEGSLYAVFDTLQH
                     LPFTGRDDLFRRTGALGIPTLLLWGDEDDVTPLTQFDTARALLKPQKHHVINKCGHMA
                     PYERPRDVADQLVPFVSARTERLDS"
     CDS             complement(348591..349424)
                     /codon_start=1
                     /locus_tag="SAVERM_298"
                     /old_locus_tag="SAV_298"
                     /product="putative alpha/beta hydrolase"
                     /protein_id="BAC68007.1"
                     /transl_table=11
                     /translation="MSTWSEPQPDSRFVVVDGLRIHYKRAGHGPALVLLHGSASSLQH
                     FDRATDLLSESFDVIRSDLPAFGLTGPRPDRDYRVPAYAATVTGFLEALGVPCYALAG
                     NSLGGNIAWNVALDHPERLTGLVLVNATGYPEKTVPAGMRLTRNPLVRPLLRRVMPRG
                     AIERSLRESVGPSSQIVDDAMVDRAHQLMSRPGNRSAFVDFCNTDQPDRSAQIPRITV
                     PTLVLRSASIDGQHFARDIPGAQELVHPHGGHLLPEEEPEWVADAIATFLGSCADTPA
                     N"
     CDS             349710..350726
                     /codon_start=1
                     /gene="lipW"
                     /locus_tag="SAVERM_299"
                     /old_locus_tag="SAV_299"
                     /product="putative secreted esterase/lipase"
                     /protein_id="BAC68008.1"
                     /transl_table=11
                     /translation="MTLRRVLSGLSAAATLGAAAAISTRRRALAAVPHELRHPVLFLP
                     LNFGNPVTLAIARRLVPLVGAATRPGVRVERRTLPATTDDLPVGVLTYQASGQAPRAA
                     LLWIHGGGTVMGAARQENTWCSRVADELGALVVSVDYRLAPENPYPAALDDCFRTLRW
                     LHANAAALGVDPARIAVGGESAGGGLAAAVVQRAHDSGVPVRFQLLLYPMLDDRTALR
                     VDPPNSAIYTWTPDSNRFAWTSYLGRPPQDRDDRPYIAAARRRNLDGLPPAWIGVGDI
                     DLFHDEDVDYARRLSEAGVACELRLESGMYHGADALLDGKAPSMTAFRTAALDALRTA
                     LAKP"
     repeat_region   350970..350971
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  350972..352397
                     /mobile_element_type="insertion sequence:ISSav6A"
                     /rpt_family="IS256 family (IS1164 group)"
     repeat_region   350972..350994
                     /note="23 nt imperfect inverted repeat (17/23 nt)"
                     /rpt_type=inverted
     CDS             complement(351026..352264)
                     /codon_start=1
                     /locus_tag="SAVERM_300"
                     /old_locus_tag="SAV_300"
                     /product="putative IS256 family IS1164-like transposase"
                     /protein_id="BAC68009.1"
                     /transl_table=11
                     /translation="MTAPDSLPLHALAEDNLAAASPDLLRAMVKTFADALMSAEADAL
                     CNAEYGQVSDERVNHRNGYRPREWDTRAGTVELAVPKLRQGSYFPHWLLERRRRAEQA
                     LISVVATAYLLGVSTRRVEKLAESLGVTQLSKSQVSAMAKHLDERVAEFRNRPLDQGP
                     YAFVRVDALTQKVREGGRIINVHALIAVGVNADGHREILGIDVATAEDGAGWLAFLRS
                     LTARGLKGVQLVVSDAHTGLVAAIGAVLPGASWQRCRTHYARNLLSQVPKSAQPWVAT
                     LLRTVFEQPDTDAVQAQMRHVLDALEAKFPKAAAHLVAAQHDLLAFTAFPREIWRQIW
                     SNNPQERLNKEIRRRTDVVGIFPDRTALIRLVGAVLAEQNDEWTEARRYMGRELLAKA
                     RLHPIESETDETELPTELTA"
     repeat_region   352375..352397
                     /note="23 nt imperfect inverted repeat (17/23 nt)"
                     /rpt_type=inverted
     repeat_region   352398..352399
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             352678..353949
                     /codon_start=1
                     /locus_tag="SAVERM_301"
                     /old_locus_tag="SAV_301"
                     /product="hypothetical protein"
                     /protein_id="BAC68010.1"
                     /transl_table=11
                     /translation="MRCWPARCPASCPVFGVDVSVWVRSDAECSPGRGYYYHPSRHSA
                     GQPIVAGWAYSWLVGLELKTNSWTAPVDARRLVPGENPNTVAARQIRGLLQQSPELCL
                     QAPLFVFDDGYDSVRPALELTAVPAQILVRVRSDRSFYADPPPRRRTAAGRPRRHGAK
                     FACPDPTTWPAPGRRPHVHGRAVRSSDRADVAPPARQDPAARRPRQPRPRPIIPGTLV
                     RLTVDRLPGRNRAPKTLWLWWTEPPGHTPDPDLLWRAYTRRFDVEHTFRFARQTLNWT
                     LPRPRTPEQADRWTWLVIAAYTQLRLARTLVADHRLPWEKPLPPARLTPGRVRRRFRH
                     VQAVVGTPANPPQPCGRSAGRPPARARTPPPRSQNSRKTRDSPPAGIKAKLRHSRRRD
                     ARSWLAERNKSRPRGGCRVEAFSLQRSMEPP"
     CDS             354545..354832
                     /codon_start=1
                     /locus_tag="SAVERM_302"
                     /old_locus_tag="SAV_302"
                     /product="hypothetical protein"
                     /protein_id="BAC68011.1"
                     /transl_table=11
                     /translation="MAGRWQCRSRSQSSPRWQRIIRPVGRARRLSGYSPGMVWSWLSA
                     RRTWRSIRQNTSRATQITWMSAATRPLCWTKTGVTARGPLKSLLNRRLVWG"
     CDS             355009..356106
                     /codon_start=1
                     /locus_tag="SAVERM_303"
                     /old_locus_tag="SAV_303"
                     /product="putative IS110 family IS1547-like transposase"
                     /protein_id="BAC68012.1"
                     /transl_table=11
                     /translation="MSAVDALSSDREEHCPVILLGVDPHKSTHTATAVELESNQQVGT
                     MRIEASLTDYRRLLAWAKRWPQRKWAVENANGLGRHLAQWLIARGESVVDVPAAATSR
                     VRELSRGGRRKNDQIDAAAAATVACLQGDGRDVEPEDHTTALALLDERRVNLAQARVR
                     TVNQLHALLRDLLPGGAPTQLSADLAAKLLRSVRPAGDVETVRKDIAWDLVAEIRKLD
                     KQLTDNAARMQSLVEASGSALMDTPGIGPVMAARLIGRTRQAHRFPTSAAFANYAGAA
                     PVEIASADKARHRLSRSGDRQLNSVLHTIAVVQIRMPNSPGHAYYQRKLSEGKTAKEA
                     KRCLKRRLADHVWRVMIADERKAKSLPAHGT"
     CDS             complement(355951..357105)
                     /codon_start=1
                     /locus_tag="SAVERM_304"
                     /old_locus_tag="SAV_304"
                     /product="hypothetical protein"
                     /protein_id="BAC68013.1"
                     /transl_table=11
                     /translation="MIDTPIRTYIAQHTDGLAVSGSAVYAFWQAVGLFGLVGGFFHST
                     GARITYSLWGAASVGMVWSASPADGRTVATGIAVLAWTIASVFALRGLSLRPVIHTAF
                     QPHIALLGIAAPALLRSTAALRTGLLVLAASLSLMPLTHDSGAWWALRLIAGAASALV
                     FMIATSAMLAGLAAHMTGWAFGGVGAGIALSGLMVVAVQQAGSWQTAWFACAVLTVLL
                     TVAAWNLVPRGAAATAPAATAAAERPRTHRWFTALLTSYVLEGIGYIIAGTFLVAALQ
                     QGAPGWIGSGAWIVVGLAALPSCAVWMRLARLHRTHETPGHNHNLRSLPNPGCLCVLS
                     SPMGREGLGFSLVGDHDAPHVVGQAAFQAPLRFLRRLTLREFALVVRVSG"
     tRNA            357776..357847
                     /anticodon=(pos:357808..357810,aa:Val,seq:cac)
                     /gene="trn1"
                     /locus_tag="SAVERM_t1"
                     /note="codon recognized: GUG"
                     /old_locus_tag="SAV_t1"
                     /product="tRNA-Val"
     CDS             357868..359805
                     /codon_start=1
                     /locus_tag="SAVERM_305"
                     /old_locus_tag="SAV_305"
                     /product="putative membrane protein"
                     /protein_id="BAC68014.1"
                     /transl_table=11
                     /translation="MMRTGSLLSVRGRDTLPIFVGLGRPRDVGGVSLSAAKDESPRDI
                     WTLARRRRINDPLAITFVTLLLGGLVALGWVSGNVERVNTMWVGAEVAADGSVRVTEV
                     IDYDFGYPDATRHGVYRDVPGLYSDQETAKVVATMDGHRVPWEFDAGDYYEEPDGRRE
                     IATRVKVGDPDRSVTGVHRYRIEYTLTDVVKNGKLAWDAVGTGWRVDRSDVEIHVVAP
                     YDLTGTRCVQGTNGSEDGCTAKKAAPGHLAVTLDKLKGREGVTLYTSRGAKLTGAKPA
                     LPALPSGKAVGAAVPHPLWVGLLAFLFALACALVTVQLLRFLGRDRIAEEGTDGAPGR
                     TRRVDLDRRAASLTPSLVPPEGLTPAQGGILLSEGVGHHHKVAWLLGAAADGHITVEG
                     TDQHPTLRRRDPADAPADPVARVVFGSIFSGRDTCTLGWYDPQFRSAWESLTRALEQW
                     QADSGLWDAAAARRSRLGRPVGLAATLLGFVVAGLGAWVGGGRNAVGWPILAVGLIAV
                     SVGYALRRRSWELETRSPRGAALWLRTEAFRRYLADPAALQADEPLDEERMELYTAWA
                     VALDVGQAWEKAIADSTTVPEHRSAVTSRIAPALAVGLLLHTARASTAPASSSGGGGG
                     GGGGGGGDVGGGSGGGGGGSW"
     CDS             360375..361958
                     /codon_start=1
                     /locus_tag="SAVERM_306"
                     /old_locus_tag="SAV_306"
                     /product="putative transcriptional regulatory protein"
                     /protein_id="BAC68015.1"
                     /transl_table=11
                     /translation="MARRKQVDPTMALLETAIKATAKGGIGKLRQRSRGQVPYYEEYP
                     ALKRETWRPDIRAAVLANQRVGLHRKLMKTAAAADLYPTSIGTDAIVYPSPGPSPLDI
                     LPLTNEGKPVPGTFRLGVSLIRSAVRNADDTTDDRWSERDWQQAAQRAFTALGEQHRN
                     SPGSVGCCWLPACARACAWPATTDWTSAGSSRRPGPASATPCGNPLAPPDTDSTGLDT
                     AADALVELLSALARRQHQHRSRTVARLTTVINSRLLPDDLQHMALYYRAKAHRDLGDS
                     PASRAGMQAVADSQGRLAPAARRGLAHLARMAGDFPTALTTAHTLGWEGRHHRVQGDT
                     WWPHGDMDRAAAAYAAARDEAEHHGVTGERGNSQAHRAFALAFTDPAVADSELALAEQ
                     LLAGVDLRATTLITHIAALARDAGRTDADIDDRAQVLRAEIRTAGVTYTELALDLTLA
                     FHHAVRNDQDQVATTIAWLRENTRSGAFPYYSEIAAFMAGLPLPQASSTRWIDDEPAT
                     RQRWHALVTNRRQHLHTQR"
     CDS             362562..363170
                     /codon_start=1
                     /locus_tag="SAVERM_307"
                     /old_locus_tag="SAV_307"
                     /product="hypothetical protein"
                     /protein_id="BAC68016.1"
                     /transl_table=11
                     /translation="MTIGRVWFAAGVTQDLEIVAFESAEAFQAWLGQNHAVSPGIWLK
                     LRKKGPGIAALDYTQALDVALCYGWIDGQKAKFDDQWWLQRFTPRKPRSKWSKANRDK
                     VAALIEQGRMHPPGQAEVDRAKADGRWEAAYDGAKTATVPDDLTAALTADPAAAEFFE
                     TLDRQNRYAILYRIQDAKKAETRARRIEKYVAMLAKGEKLHP"
     CDS             complement(364046..364411)
                     /codon_start=1
                     /locus_tag="SAVERM_308"
                     /old_locus_tag="SAV_308"
                     /product="hypothetical protein"
                     /protein_id="BAC68017.1"
                     /transl_table=11
                     /translation="MSITLNHTIVPAVDNEAAARFFASVMGLDYRGADRHFAPVQVND
                     SLTLDFMSVENPVGHHLAFDVDPSSFDSILDRLRTAGVPYGNDPSEPDNGRIDHPLCP
                     RGLYFTDDAGNLYEVMSPR"
     mobile_element  366773..368534
                     /mobile_element_type="insertion sequence:ISSav23"
                     /rpt_family="IS3/IS5 family"
     repeat_region   366773..366783
                     /note="11 nt perfect inverted repeat"
                     /rpt_type=inverted
     CDS             366810..368000
                     /codon_start=1
                     /locus_tag="SAVERM_309"
                     /old_locus_tag="SAV_309"
                     /product="putative IS3 family ISVisp1-like transposase"
                     /protein_id="BAC68018.1"
                     /transl_table=11
                     /translation="MDRCCGMGSPEGIEAALAAKFGTLFPHLDERQRRLAIGAEARSL
                     GHGGIRLVARTAGVREGTVSRGVTELESGEAPLGRVRRSGGGRKRAVDLDPGLRPALL
                     ALVEPDVRGDPISPLRWTTKSTRQLAAELTRQGHRVSADTVAAVLREEGFSLQGNAKT
                     IEGAQHPDRDAQFRYINDQAKDFQAAGDPVISVDTKKKELVGNYKNAGHEWCREGDPV
                     RVRTHDFPDADLGKAIPYGIYDLAADAGWVNVGTDHDTAAFAVASVRRWWHAVGRDTY
                     PRSHRLLITADAGGSNGYRTRAWKFELAALAVETGLEITVCHFPPGTSKWNRIEHRLF
                     SHITMNWRGRPLTSHEVIVNSIAATTTRTGLTVRAVLDTAVYETGVRISDGQLNALPL
                     SRHD"
     CDS             368148..368522
                     /codon_start=1
                     /locus_tag="SAVERM_310"
                     /old_locus_tag="SAV_310"
                     /product="putative IS5 family IS1373-like transposase"
                     /protein_id="BAC68019.1"
                     /transl_table=11
                     /translation="MVTELAAARAAQREADLHQRRGGDRQKTPAVGLYTGRRPGLTLV
                     DRLLATILYQRFKLPQVVIAPLFTVTPVTLNPAISQTRRLLHDIGHAIEPAETPLATL
                     DDLIDLATHLGIPAPEIKTASY"
     repeat_region   368524..368534
                     /note="11 nt perfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   368535..368536
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  368537..370300
                     /mobile_element_type="insertion sequence:ISSav24"
                     /rpt_family="IS4 family (ISFsp6 group)"
     repeat_region   368537..368558
                     /note="22 nt imperfect inverted repeat (21/22 nt)"
                     /rpt_type=inverted
     CDS             complement(368620..369621)
                     /codon_start=1
                     /locus_tag="SAVERM_311"
                     /old_locus_tag="SAV_311"
                     /product="putative IS4 family ISFsp6-like transposase"
                     /protein_id="BAC68020.1"
                     /transl_table=11
                     /translation="MPCSALPATGRPPTLAGSCTTWAPACWLVLWDKGFDANAFLAAV
                     HDTGARFLGRLRANRRTPVLSRLTDGSYLSVIGTVPVRVVEAQITVIYDDCSFTNSYR
                     LVTTLTDARRYPAPALVALYHQRWEHESAYFALRHTITDGRVLRSGDPVGVEQEMWAL
                     LALYQALRTVMVEAAESRPGTDPDRCGFTIAIHTARDLVVQAADVIKPGALGTRTTAS
                     SATGSWPGSSRTGAPASAPEKSGHRSPGTPNAKTTAAPTKAAWSPTLTSPSSNPIPTC
                     PPSRTTIDTHRPPTGADSASWTSFTQNPTASGTLATSPATSATSPSARCTDSSTDGP"
     CDS             complement(369344..370132)
                     /codon_start=1
                     /locus_tag="SAVERM_312"
                     /old_locus_tag="SAV_312"
                     /product="putative IS4 family ISFsp5-like transposase"
                     /protein_id="BAC68021.2"
                     /transl_table=11
                     /translation="MAEGRFAPGHLGELTQVIPFDLVDAVLDETRCVQRRLRDLPSRV
                     GVYFLLAMCLFPEVGYRLVWHKLTAALTGVGFEVAEPTAKALRDLRRRLGAEPMKRVF
                     ETLAGPLAQPVTPGVRFGPFRMASFDGCSSIKLPDTERNVEWFGPGSRGGYPMLELMT
                     LVETGTRALIGAVFGTPSDGETSYARRLLHHLGPGMLAGPVGQGFRRQRLPRRRARHR
                     SQVPGPAARQPTHPGPEPTHRWLLPLGHRHRPGTRRGSADHRDL"
     repeat_region   370279..370300
                     /note="22 nt imperfect inverted repeat (21/22 nt)"
                     /rpt_type=inverted
     repeat_region   370301..370302
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(370323..370796)
                     /codon_start=1
                     /locus_tag="SAVERM_7574"
                     /old_locus_tag="SAV_7574"
                     /product="putative IS630 family IS885-like transposase"
                     /protein_id="BAF64417.1"
                     /transl_table=11
                     /translation="MPGRSRGRLSVAGLLCYRPALPARLCYRLRRHTGRKGERRSLGE
                     SDYIHLLDGAHHLLKAPLIVVWDRLNTHISKTMKALVAGRDWLTVVLLPGYAPELNPV
                     EDLWAHIKRSLANLAARTLNELETLLRRRLKALQYLHGILDGFLAGTGLALDRPN"
     repeat_region   370987..370995
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  370996..372771
                     /mobile_element_type="insertion sequence:ISSav1A"
                     /rpt_family="IS4 family (ISFsp6 group)"
     repeat_region   370996..371032
                     /note="37 nt imperfect inverted repeat (36/37 nt)"
                     /rpt_type=inverted
     CDS             complement(371009..372637)
                     /codon_start=1
                     /locus_tag="SAVERM_313"
                     /old_locus_tag="SAV_313"
                     /product="putative IS4 family ISFsp6-like transposase"
                     /protein_id="BAC68022.1"
                     /transl_table=11
                     /translation="MPVQCSTVTLTSSITVADGIFAPGHLGELTQQLPFELVDDVLER
                     AGGAQHRLRLLPSRVGVYFVLALALFPQLGYVRVWDKLTAGLRGILHRRPSEKALREV
                     RRRLGVAPLRLLFETLAGPVAQPITPGVRYRCWRTVAFDGCSSTKAPDRPRVCAWLGK
                     HKHRYGTDGYPMLKIMVLCETGTRALLGAVFGPTPEKETGYAEQLLPLLDGGMLLLND
                     RGFDSDDFLAKAAATGAQLLVRLKGTRTPARWALLPDGSFLTRINGTRLRVIDAHIAV
                     TTAKGLRLEGHYRLATTLTDHRRYPAVELVELYHERWEIESAFYSLRHTLQCGLVLRS
                     QDVAGIQQELWAHLTVYQALRRAMVEAVETLPGTDPDRASFTVALETAKEQLITAANV
                     LPDAGPGRITSALLHDLLPPRQARVNPRRVKCPISRYAAPPDQAQAFGASRITSIAVT
                     VHSSAGTGSDGRRDHTLQLLRTNPLRTWRACEIARGIGLDDARGLRAELGRWVREGIL
                     RRTGRGIYTLEPEWITPDLHHPSVPPHLTTADRP"
     repeat_region   372705..372706
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  372707..374011
                     /mobile_element_type="insertion sequence:ISSav25"
                     /rpt_family="IS3 family (IS1372 group)"
     repeat_region   372707..372717
                     /note="11 nt imperfect inverted repeat (10/11 nt)"
                     /rpt_type=inverted
     repeat_region   372735..372771
                     /note="37 nt imperfect inverted repeat (36/37 nt)"
                     /rpt_type=inverted
     repeat_region   372772..372780
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             372788..373066
                     /codon_start=1
                     /locus_tag="SAVERM_314"
                     /old_locus_tag="SAV_314"
                     /product="putative IS3 IS1372-like family transposase"
                     /protein_id="BAC68023.1"
                     /transl_table=11
                     /translation="MRERAVRMYRTADPKPQIKKLAVDLGVHPEALRGWIRQAEADAG
                     ERDDRLTTDERAELAALRKENAQLKRANEVLRTASAFFAAQLDPTRPR"
     CDS             373063..373980
                     /codon_start=1
                     /locus_tag="SAVERM_315"
                     /old_locus_tag="SAV_315"
                     /product="putative IS3 ISAav4-like family transposase"
                     /protein_id="BAC68024.1"
                     /transl_table=11
                     /translation="MTALLDEHPHLGVECVLRELHLASSTYYRWRHAEREPCERRRRD
                     AELTEQIKQIHTDSGGIYGSPRVHAVLKREGVHVGRKRVERLMREADIAGISPRRKGF
                     TRRDPKATLAPDLVERDFTAPAPNRLWVTDLTMISTGEGPLWLSAIRDAFSRRVVAWE
                     TSARADADLVLTTLEYALASREVEPGQLVHHADHGCQYTSVKLTTRLVRAGVEASMGS
                     VGDSYDNALAENLWMLIKTECIRGRTFTTRAEANLALFEYIDGFYNSRRIQKRLGYLS
                     PVEFEEKHYADQATAERTNLKPRQPALAS"
     repeat_region   374001..374011
                     /note="11 nt imperfect inverted repeat (10/11 nt)"
                     /rpt_type=inverted
     CDS             complement(374009..374506)
                     /codon_start=1
                     /locus_tag="SAVERM_316"
                     /old_locus_tag="SAV_316"
                     /product="putative IS630 family ISBs2-like transposase"
                     /protein_id="BAC68025.3"
                     /transl_table=11
                     /translation="MRYPDGGGLTAEQRKRREEVRMRAADLFEGDVKVPCIARELRVS
                     EKSVYQWRRAWALNGREALRSQGPPGYDCRLGPHLQAKLATWLDEGPAAHGWRDDQVW
                     TAARVRTLIGRKFHLSYSISGVTRLLHRMGFSVQMPARPAAERNEDAITAWREATWQE
                     VKPSG"
     repeat_region   374012..374013
                     /note="target sequence"
                     /rpt_type=flanking
     repeat_region   374641..374644
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  374645..376826
                     /mobile_element_type="insertion sequence:ISSav26"
                     /rpt_family="IS982 family (ISCef2 group)"
     repeat_region   374645..374661
                     /note="17 nt imperfect inverted repeat (16/17 nt)"
                     /rpt_type=inverted
     CDS             complement(374674..375582)
                     /codon_start=1
                     /locus_tag="SAVERM_317"
                     /old_locus_tag="SAV_317"
                     /product="putative IS982 family ISCef2-like transposase"
                     /protein_id="BAC68026.1"
                     /transl_table=11
                     /translation="MTNNLDTLATALYARIDDELKASPWLAPWRPAIGITPTLSDAEL
                     ITLAVMSALLGYTSERRWLRRVGRDFGHLFPYVPQQSGYNKRLRAAFSLLTSMIRIVA
                     RDTSLWSDDVWLVDSTPVGCGCSRETAKRSDLAGWAQYGYCASHSRYFWGLRLHLVCT
                     LGGLPVLFALTGADERETLRDMLDTAPDVLAAHPGQTIIGDKNYFGREFERGLAERHL
                     KLLRPARKGEAEPTGSHLFKPLRQVIESINQTFKGQLNLERHGGKSPAGVSARVLCRI
                     LALTAAIWHNDQTGQPIKRSLTAYDH"
     CDS             complement(375668..376615)
                     /codon_start=1
                     /locus_tag="SAVERM_318"
                     /old_locus_tag="SAV_318"
                     /product="putative ISL3 family ISPpu12-like transposase"
                     /protein_id="BAC68027.3"
                     /transl_table=11
                     /translation="MGDMDVTTLYSIGELSRRTGLSVRTIRFYSDSGVVAPTTRSPAG
                     YRLYDLDALLRLELLRTLRELGMDLATIQRVLDRELSVAEVAAAHADAMDVQIRTLQL
                     RRSVLRVVASRGSSPEETKLMHRLTQLSGEERRRLIDDFMDGTFGTVDADPAAVAMVR
                     AATPDLPDDPTGEQVTAWVELAELVGDEDFRARMRRTAVRQAAGRPLDIECDAGEELM
                     EFTRQKVAEAMEAGIDPLNDRGAPVIDDLVHRFAEVLARTPDTEFRDWMAQQFEETHD
                     PRVDRYWQLVWIVNGWHVVPNLIPVYPWLIQALRNSRDA"
     repeat_region   376810..376826
                     /note="17 nt imperfect inverted repeat (16/17 nt)"
                     /rpt_type=inverted
     repeat_region   376827..376830
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  376831..378256
                     /mobile_element_type="insertion sequence:ISSav4B"
                     /rpt_family="IS701 family (ISAzvi8 group)"
     repeat_region   376831..376846
                     /note="16 nt perfect inverted repeat"
                     /rpt_type=inverted
     CDS             376883..378157
                     /codon_start=1
                     /locus_tag="SAVERM_319"
                     /old_locus_tag="SAV_319"
                     /product="putative IS701 family ISAzvi8-like transposase"
                     /protein_id="BAC68028.2"
                     /transl_table=11
                     /translation="MDAHEVNRARATLALFVADVFASVPRKDQRAKGDCYLRGLMLDG
                     RRKSIQPMAERLPDGNEQNLQQFVNQSTWDPVPVRRRIAERMVAQIGPDAWAVDDVSF
                     PKDGKMSVAVAHQYCGALGKQANCQVAVSVHAVSDTASCPLQWRLFVPQEWAHDAPRR
                     QKTGIPPEVGHREKWRLALDIFDELAGWGLVPPVVVADAGYGQNADFRDGLDGRGIGY
                     VAAIRSDVTVHPHDAEPFAPPWSGNGRKPQPRYRDKPSSVAALATGHGRQAFTEVTWR
                     EGSRGPMRSHFLSLRVRPAGVKSRRLAQAAATDENCWDGVLPEVTLLVEWPEGAEAPT
                     DYWLSNLPDTLSLAELVRLAKIRWRIEHDYRELKHGLGLDHFEGRSWTGWHHHVSLVT
                     AAHAFLTEQRLAPKAGTADSPSTRPSTPSRTC"
     repeat_region   378241..378256
                     /note="16 nt perfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   378257..378260
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             complement(378281..378862)
                     /codon_start=1
                     /locus_tag="SAVERM_320"
                     /old_locus_tag="SAV_320"
                     /product="putative secreted protein"
                     /protein_id="BAC68029.1"
                     /transl_table=11
                     /translation="MSDRNTLIRSLHDVGLAAWFGGSLMGAVGLNGAAKDQSETARAR
                     ARIASSGWAKWTPVNAAAIGAHLFGGGGLLAVNAHRVAAQKGVGASTTAKTLVTAAAL
                     AATAYGRVLGKKVELAASSDPQDAKEAARHPIDIDSAQRQLAFAQWAVPALTGCLVVL
                     NALHGEQQRPEEQLPGMWERARSAATPFIPQHS"
     CDS             complement(379220..380458)
                     /codon_start=1
                     /gene="prpB1"
                     /locus_tag="SAVERM_321"
                     /old_locus_tag="SAV_321"
                     /product="putative magnesium or manganese-dependent
                     protein phosphatase"
                     /protein_id="BAC68030.1"
                     /transl_table=11
                     /translation="MTLAGTLAAAEAAAPVESLDVVARMLKEHLGAASVSFLITDFTG
                     GSVVRLGAAGSVETDEPAQRITLRGTLYDDVIRTQRPSVEAKGQGALVRIVAPVTNRG
                     DAIGLLELFLPAAPDAEVMREIGETAHALAYIVIANRSFTDVYQWGRRTTPLSLAAEI
                     QHRLLPASLACEAAQFAVAGALEPADHVGGDTFDYVIDRDTVQLSVTDAMGHDVDAAL
                     LATLAVGALRRARRAGADLAEQARQADQAMREHGHKGYVTGQLLRISLIDGTTEFINA
                     GHPWPLRMRNRQVREITPKIDMPFGFHAPHSYQVQSLDLRPGDRLVMLTDGMLERNAG
                     SLDLSDLIIRTRALHPREAARTLIAAIVDANDGHLQDDATVMCLDWHGTNHSQRDAAT
                     GADLTDASRPSRTGRTTPGR"
     CDS             complement(380736..381536)
                     /codon_start=1
                     /locus_tag="SAVERM_322"
                     /old_locus_tag="SAV_322"
                     /product="hypothetical protein"
                     /protein_id="BAC68031.1"
                     /transl_table=11
                     /translation="MIAEDTQPPAHGREFQPRPDTTDALSTPVVDAPASATGQLAARQ
                     PAAGLEGGVERATAALKPRLRGWLHAGVFPLALVGGIVLIAVSRSAAAVAACSVYALS
                     ACLLFGTSAVYHRGTWGARGEAVLRRMDHANIFLIIAGTYTPLAVLLLPGGEQLVLLA
                     VVWAGALAGIAFRVLWIGAPRWLYTPCYIVLGWVAVFYLPDFARTGGTAVVALVIAGG
                     LLYTAGAVVYGLKRPDPLPAWFGFHEVFHALTIAAFTAHYTAILLAAT"
     CDS             complement(381592..381924)
                     /codon_start=1
                     /locus_tag="SAVERM_323"
                     /old_locus_tag="SAV_323"
                     /product="putative MerR-family transcriptional regulator"
                     /protein_id="BAC68032.1"
                     /transl_table=11
                     /translation="MTADNPHNRLDDDDYPAYTMGRAAELLGTTQGFLRAIGEARLIT
                     PLRSPGGHRRYSRYQLRIAARARELVDQGTPIEAACRIVILEDQLEEAQRINSEQRRA
                     AARHTAGV"
     CDS             complement(383053..383349)
                     /codon_start=1
                     /locus_tag="SAVERM_324"
                     /old_locus_tag="SAV_324"
                     /product="putative ArsR-family transcriptional regulator"
                     /protein_id="BAC68033.1"
                     /transl_table=11
                     /translation="MDFRPGPSLPPWWRTRPHCVLVAGARYSREIGEVCVCELPPAFD
                     LSQPTISHHLKLLRQVGLIDCERRGTWVYYWVLPGLLDKLAAFRRVGRHPWWHA"
     CDS             complement(383431..384198)
                     /codon_start=1
                     /locus_tag="SAVERM_325"
                     /old_locus_tag="SAV_325"
                     /product="hypothetical protein"
                     /protein_id="BAC68034.1"
                     /transl_table=11
                     /translation="MSMVGGQWPGAVERLAQQLGAAQAADRRVKEAKATAARQSPSST
                     GLERAEYQRRLRAHVQTPEHKAAAHAISVAVALMKAHDAALLRSAHTLLARRANGQRL
                     PRRLPRPLVLPGGYAPQWWISSIDSTYAGIWRAIPSPGPELRLGSPNDPLVQEVAKQA
                     RLLQASRVGYRGRDDLYEAFHPDGTREGGEPVPPIRGLSPETSRRTNLALGRGDGIRI
                     QPSRMEEAGQMHTDYFAVWDRSRAYAAAVLALLRAHA"
     CDS             complement(385228..385533)
                     /codon_start=1
                     /locus_tag="SAVERM_326"
                     /old_locus_tag="SAV_326"
                     /product="hypothetical protein"
                     /protein_id="BAC68035.1"
                     /transl_table=11
                     /translation="MDIADAQKLAWENKINQGFNTTDIPLEFGLLNAEVGEAFTAWRK
                     GLPDHGEELADVFLYLVAIAEMQGVDLGEEVRREIEKNARRVYTPGVGGALVRTGGE"
     CDS             complement(386051..386746)
                     /codon_start=1
                     /locus_tag="SAVERM_327"
                     /old_locus_tag="SAV_327"
                     /product="hypothetical protein"
                     /protein_id="BAC68036.1"
                     /transl_table=11
                     /translation="MCMEIGYATARGVPVILLTTDFQDYSGTPAGPGTVFPDPLLDIL
                     ATRIIRAPRLGAPPDLPGSSRFADFAARNHAQIQHAIEVRVDAALQLPVPASSAVPSR
                     TGSTVYAESSPYTPAHHKLPGTGARPGITVRRPTRFAATDPEAATRADWAAALSSDRI
                     VVDACGPETPPNAALLIGASCATAQPVAAYLPRSTYTHASGREPNHRNLMIQYGVGHT
                     LRSAEEVTAWIGP"
     CDS             386768..387076
                     /codon_start=1
                     /locus_tag="SAVERM_328"
                     /old_locus_tag="SAV_328"
                     /product="hypothetical protein"
                     /protein_id="BAC68037.1"
                     /transl_table=11
                     /translation="MGDRDEGADVAEPVAVEFTAPASSSRSTAYSTTAWRTRPTRRVT
                     HTAVPRLYAEMVAKDRRLRLAGYEIYRFGGFELTAPGGEQILAAFFTELLGRHRKPPL
                     "
     CDS             387129..387536
                     /codon_start=1
                     /locus_tag="SAVERM_329"
                     /old_locus_tag="SAV_329"
                     /product="hypothetical protein"
                     /protein_id="BAC68038.1"
                     /transl_table=11
                     /translation="MREEAEQVQAALGASERALQRLVDARATVAEVLAEPPSVVAEPV
                     SGAVAGAVVPRRTGDMAASVLAPDYQQILSVLESEAGREGMRCQQLAVALGLQAVPAK
                     VEGLRSKAKRLVERGWALQVRPGVFTALAMPTV"
     CDS             complement(387639..387947)
                     /codon_start=1
                     /locus_tag="SAVERM_330"
                     /old_locus_tag="SAV_330"
                     /product="hypothetical protein"
                     /protein_id="BAC68039.1"
                     /transl_table=11
                     /translation="MNAWRMLAPEIHPTPKSTKHVGRAQVVIGGTARETQVRFDAEAR
                     AWATTGPTTTAKNRAAVPAQPGPTQLQKPTAPAALPVRSDSSRRCRSDWDKAIGHLQG
                     "
     CDS             complement(387951..388265)
                     /codon_start=1
                     /locus_tag="SAVERM_331"
                     /old_locus_tag="SAV_331"
                     /product="hypothetical protein"
                     /protein_id="BAC68040.1"
                     /transl_table=11
                     /translation="MEGRRRVRVADEVGIDADPDAIGARLLILLEEVNATMRQLARYW
                     DKIRESGDPKTSPAIDALMEILFMGRRVRMHVFLVAQSATARALGGQEVREQFTTRIL
                     AS"
     CDS             complement(388386..388766)
                     /codon_start=1
                     /locus_tag="SAVERM_333"
                     /old_locus_tag="SAV_333"
                     /product="hypothetical protein"
                     /protein_id="BAC68041.1"
                     /transl_table=11
                     /translation="MGCPTARGARAADTHLRFSRDLVADLITQKLALEGVTFSWHPAE
                     RKPYVLVKKTRKSPAEAAFKDPKVRDLVAKAAEPAPIIGSGGKPVSVDLDADSPHILV
                     YASTVGGKSVILRCIACQMIHRGS"
     CDS             388722..388958
                     /codon_start=1
                     /locus_tag="SAVERM_332"
                     /old_locus_tag="SAV_332"
                     /product="hypothetical protein"
                     /protein_id="BAC68042.1"
                     /transl_table=11
                     /translation="MRVGCASASCSGTTHSRINSRRSRDSSPYAMPPTARAEAAPIPP
                     VSSVARVASPVLPKVLEGVREVATSRPRRTPKAR"
     CDS             389084..389704
                     /codon_start=1
                     /locus_tag="SAVERM_334"
                     /old_locus_tag="SAV_334"
                     /product="hypothetical protein"
                     /protein_id="BAC68043.1"
                     /transl_table=11
                     /translation="MRLFADHVSGPPSAERFAGPLWLRERPGGLNEIEWRLRPGLPAF
                     VLYHARMTSSMSLLLACCGNAFDSTLAAMREGTEEHLPKEMAKHWTSFAHMVANGQRG
                     DLSDLGITLVTDPVDGVKGGCVATIVSPRGSESELKDALTRVIRGAASAIGEGVEAAE
                     RSPRIHGLLAAQSDHAVLDDRLETIAATGFRFGATRSLLDLDWPTE"
     CDS             complement(389694..391292)
                     /codon_start=1
                     /locus_tag="SAVERM_335"
                     /old_locus_tag="SAV_335"
                     /product="hypothetical protein"
                     /protein_id="BAC68044.1"
                     /transl_table=11
                     /translation="MNTVGMAVSLLHQRALTDAAAYRSGRRRDKDVARRITGAMMRYE
                     AFIALQRPLAEGLALFAEFDLSSFGTLPRLCPVLARVADYFGPGAIASFEPEEHQDAV
                     TRNVLDVILGSTRRQRQVVTRRCDVLVRPADPEDGGYLPGYLLVKALWSAGIGVDARL
                     GDPELFFSYAIEYLYTDLGLIAHLLDEDDNQRAVDKMIEYFVRRVIDFGRADHAANLD
                     EFLASHRDRKMYTEFDAWARHSNRRWNVDDATADLGADRLIALHDETLEHAPDEDLVR
                     NIALMFQRTVLSLGRHPVTVTVDERDRYTVTDGEQSVMSGTYASGLPVGTVVDGHVDV
                     SIDAHTGCAAIVLSIGDDAPVYWFSDDASEDWRHSFQVARAALSRAEGEGEELLTLLR
                     DVAKEASGVIYPLEIARDRATGATKVFTRLAAAVLNAAMANRTPDLDAVARSAAILEP
                     AGLAGVFDRIRYVRALAWGGLVMSTGALPDVDTARRLFEEDRDIHRVAETFDEAMDLI
                     RRTGVDKLGNPLYTVRDGRPVFIL"
     CDS             complement(391476..392177)
                     /codon_start=1
                     /locus_tag="SAVERM_336"
                     /old_locus_tag="SAV_336"
                     /product="hypothetical protein"
                     /protein_id="BAC68045.1"
                     /transl_table=11
                     /translation="MTWLDLPPHSRCSNCNRKFVHDGRRAVCLSRLNALLPPTPTASS
                     PSTRSAPNRATTCAKISSLTRPRIAVARSLSVQRAGSSNEPSTSRFNAIRQHRAVRCR
                     SAVRCLETSVSATKVRLPGLSRSDALELGEFVDRGAIAFHHEPVPEGSFGDLGVVTVV
                     VAASAYTLKGMVSYLLYRHRGTSFEEVVEIEHPDGRIERRTLKWRDTSSESIDSALAK
                     ELASATGIPWDQDGR"
     CDS             392309..393166
                     /codon_start=1
                     /locus_tag="SAVERM_337"
                     /old_locus_tag="SAV_337"
                     /product="hypothetical protein"
                     /protein_id="BAC68046.1"
                     /transl_table=11
                     /translation="MIVSDAGYDVTCLAWVLRDLPVEMVGRVRSDHVMRLPKPPRVHG
                     VNGRPPKHGPKFRFTKPETWPEPAITTVTDTTNYGKAETQAWDRVHPRLTHRSSWLDH
                     DGELPLVEGTLMRLKVEHLSKDRDTPPVWLWSSKTGATPDDVDRFWQAFLRRFDLEHT
                     FRFAKQTLGWTTPKLRTPEAADRWTWILIVAHPQLRLARTLAEDLRRPWEKPTTSDRL
                     TPARVRRGFRNIRAHLACPTRVPKPRGAGAGRPPGAKNKHRAPRYDVGKTVKRPETLK
                     AIGKPGRSW"
     CDS             complement(393683..394816)
                     /codon_start=1
                     /locus_tag="SAVERM_338"
                     /old_locus_tag="SAV_338"
                     /product="hypothetical protein"
                     /protein_id="BAC68047.1"
                     /transl_table=11
                     /translation="MSTPTATRLQAADADVTVLSNTAFVTDWSRRYFGPWWNAFEVPT
                     SSVCAGPLVTADVDEKAYADLAALLASVPHSEATYAKARLLLARDSTGTITAVSPDEQ
                     LAYRSEQLGGHVTISGHAPQPVALAASRIAREMIRAALLRDGWTLLHASAVVRDGRAL
                     LAFGDKGAGKTTTALLVASRCAQLLANDRVFIKRIGADLRVLPWPSAAAIGLGLLDAL
                     GLYDVVRDRLQAGEHLHPTQHQDVTDALLAGRREPLWEPGGKRERKVQVFPDQFASWF
                     GMELATGGRAAALLFPRIDPAAVPALVDGERTLGEDDFMSGATEDRYPDHFGLAHGID
                     GGGSDLARATVAEHLAALPHHQVVLGHDVGANADFLAKLSDSP"
     CDS             complement(394813..395724)
                     /codon_start=1
                     /gene="ldhA"
                     /locus_tag="SAVERM_339"
                     /old_locus_tag="SAV_339"
                     /product="putative lactate dehydrogenase"
                     /protein_id="BAC68048.1"
                     /transl_table=11
                     /translation="MGSVGVVGAGAVGQTVAATLVASGICPRLLVVSRTVEQARALAA
                     DLDDMRQTTGSPVQPEARRVADLIGCHAVVVAVRAAFTNTRAADVRMGGALTNAPVIR
                     ALATTLRGYQGTVLVVTNPVDLMTRLFAETSGCPRVYGIGSNLDSARYRLTLAHLLDV
                     PATTVHGHVIGEHGDGAVVCASSTTVNGTPAAVPLAEVRAELRTRPGQISAGVGRTRS
                     GPAGAVLSTLRKALGLVDGTEELTAEHRGDWLGIPLRFTAGQPVACLPALNADEDAQL
                     AATATKLRDAYQALRPSGPTPNSQETT"
     CDS             complement(395736..397091)
                     /codon_start=1
                     /locus_tag="SAVERM_340"
                     /old_locus_tag="SAV_340"
                     /product="hypothetical protein"
                     /protein_id="BAC68049.1"
                     /transl_table=11
                     /translation="MHGSSRQVGRSSTGQPGAPPQPPCAHPPGAPGGIHPLPLEAYVS
                     TTAVSTSPGPVPPVPDADEVFAFAAREIAAAAAGLWPRADVDLGDHVPSVTGYVRRIR
                     VDGRTLYAKYAFLGVSLVSLLRGACGPWPDVRAAQQAYVQRPGALMDREAAQLRLLAQ
                     LDSPRVCPVAGLARGVLFTESVTGPTLADLLLQRPHDAADLLEGLFGELRRLHRPSAA
                     RLLGPARGIGEHSIRGTFQRKFNGLSGPTYVERLGAERCAPGDRALVVGLLRDVVVRL
                     HRLQATGLPQQASRRVLAYGDLKPEHVVFPEGTSGQPVFIDPGLLLAPPTVDAAKLIS
                     RTVLLLAAARPGAGTGQQAMRGVGAFAAARADVLPARVRRSWLRELLVLWLMDSVNIL
                     TTYLSAPGVLPMPGRGSALIGRAVDLCRMADQLSSELAAGADTRAVWESALGLAQAVA
                     A"
     CDS             complement(397379..397615)
                     /codon_start=1
                     /locus_tag="SAVERM_341"
                     /old_locus_tag="SAV_341"
                     /product="hypothetical protein"
                     /protein_id="BAC68050.1"
                     /transl_table=11
                     /translation="MSTKRSLLHRDHPWIGRDVEDTATGRRGVLRAIAPDGDRPRPVA
                     WLLPAGGGMEWTTDPGALANPAPLTADMHPKEER"
     CDS             complement(397612..398019)
                     /codon_start=1
                     /locus_tag="SAVERM_342"
                     /old_locus_tag="SAV_342"
                     /product="hypothetical protein"
                     /protein_id="BAC68051.1"
                     /transl_table=11
                     /translation="MTRTPDTRENITVAASASAAVLYVCAERSKLTPTLAADRAEAEG
                     RDFAEARGLTITEVVTDPYGDPDPCHRDGWLRVRELAESGAVRVVIVRWPACIAPEPS
                     HELRHREIRWLQDHCVQVRYSWEPLATGGGEAK"
     CDS             398215..399555
                     /codon_start=1
                     /locus_tag="SAVERM_343"
                     /old_locus_tag="SAV_343"
                     /product="putative regulatory protein"
                     /protein_id="BAC68052.1"
                     /transl_table=11
                     /translation="MARRPRTPNAALAALMQSGGIGNAQLARRVNAAGRELGLRMHYD
                     KTSVSHWLAGSVPKLEARPAVTEALSRLLGRPVTCAEVGWETEEKPAGERDFVAGVID
                     LSRADMDPTRRGVLKTGMYAAALAVPRYEDVAGRLESATAGRTVHIGRSDVETVRTMT
                     DKVADILDQVGAGHARPMAAAFLVNTAGPYLRASGTDEVQRDMRAAVADFVYLTGWMA
                     MYEDQQGLGQTYYLRALELAGAAEDHVTYCRTLRGMSLQATHLGHGKKGLELADAAAE
                     AAPSAGPRLVAFLCGQQAAAAAMTNARNTALARLREAESALSRADDRRDAVGGYDQAA
                     YFFHEAHVRWHLGDKDGSIASLRRSNTARSPLERQGRLHCLGVTAERQFRMRHIEAAC
                     QTWGTFLDEHVTISSARGDEHLKTMLKALPAYRRVAGVRELEERARHVATLKTA"
     CDS             complement(399603..400892)
                     /codon_start=1
                     /locus_tag="SAVERM_344"
                     /old_locus_tag="SAV_344"
                     /product="hypothetical protein"
                     /protein_id="BAC68053.1"
                     /transl_table=11
                     /translation="MGYTAVHPVWGRLDASMDDLGCDRAWTDVHRVKGLRLACPECGG
                     RVFARASQHVVRHFYHQVRPPDCELANESPEHHLLKLELVVAARAAGWRAELEVSSEV
                     RNWRADVMVFDEHDRPFMALEAQLSPMTQDEARMRTDRYARDGVAVCWVALQDRPWER
                     VVPSLRVRSPRRRGETWTVWHGMARYDWAPRTLKAKAKWVHITCPLGDAIRWILDGRV
                     HAHTGANGTVWWTAPAYEDLVLARAQMEAEAEAVRRVAAAERRRQEAEQRAAAAEQHR
                     QDAERRALEWQAELLEWQAELQRLAGFFQRTGLDATVWEAFTQMVRSASGKAIMYGDQ
                     SPAHGNGLLVYARPRWTGDGFTLAGVVCPDLEALIEWPAELTILVPNQTWLSRIQAAA
                     RSPLKVAVLNPVTGRSTFIRVTAPDVVPVRPNGPDRG"
     CDS             401070..401894
                     /codon_start=1
                     /locus_tag="SAVERM_345"
                     /old_locus_tag="SAV_345"
                     /product="hypothetical protein"
                     /protein_id="BAC68054.1"
                     /transl_table=11
                     /translation="MYAAARQPEGEGQAAESRATGVYRERAERRRRTRGTGEARGDGW
                     QRTEEDEQLLRLATRYSTLTLHQAAYACWGGRIEAARRRVRLMVEAGLLHRLAVADVG
                     IRLESEGRTVLSEREVHAAEAVPGRAAELLADLGVHQVPVGVRRGEILAVPVGARAVH
                     WPDLVVVLPGGRLAAFEVELTAKPAAALRTILRAYKQARRPVAYLATEPVVGQLQGGP
                     GPGGRWVNGVAQELELLPPGGPGPGADGHLQVRPFTAVDPAVARRTAQQAARLRGG"
     CDS             402923..404059
                     /codon_start=1
                     /locus_tag="SAVERM_346"
                     /old_locus_tag="SAV_346"
                     /product="putative secreted protein"
                     /protein_id="BAC68055.1"
                     /transl_table=11
                     /translation="MQHLSTPLARTLGAAALLSAAAAWGAASIRYEADGPRLDVLVPL
                     ALAAVFVVGWLMASRSAPPVKLLPSTAPPREKVPGKLGAVRRDWGLVAAAYLTVWAPF
                     AAANSAYGGRGSQLGALYCLLTFIVGAVLSLCNLALLQSNLGRSQRMLKEDAAAGSVH
                     AIRVRFGTPVLEMYRYPTGQGAGRIAASTTYGVELVHESDSGEQRTIRLRAMKAAQSD
                     KVGDKHLTYAASQLVGHGGWLCWPARWRDIAGTNKDLKVPAAFASDSGHVVWGEMQQD
                     DYAYYLRDGAAPLCETDPRLAVAPLPRPSRYFPKVHASHLRVAAVGALLAVPFLLDAV
                     PYWAGLLLGVVSGALGLLAGMTMDGVGVDQEPWTVRTTSHPSLQ"
     repeat_region   404536..404537
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  404538..405963
                     /mobile_element_type="insertion sequence:ISSav6B"
                     /rpt_family="IS256 family (IS1164 group)"
     repeat_region   404538..404560
                     /note="23 nt imperfect inverted repeat (17/23 nt)"
                     /rpt_type=inverted
     CDS             complement(404592..405830)
                     /codon_start=1
                     /locus_tag="SAVERM_347"
                     /old_locus_tag="SAV_347"
                     /product="putative IS256 family IS1164-like transposase"
                     /protein_id="BAC68056.1"
                     /transl_table=11
                     /translation="MTAPDSLPLHALVEDNLAAASPDLLRAMVKTFADALMSAEADAL
                     CNAEYGQVSDERVNHRNGYRPREWDTRAGTVELAVPKLRQGSYFPHWLLERRRRAEQA
                     LISVVATAYLLGVSTRRVEKLAESLGVTQLSKSQVSAMAKHLDERVAEFRNRPLDQGP
                     YAFVRVDALTQKVREGGRIINVHALIAVGVNADGHREILGIDVATAEDGAGWLAFLRS
                     LTARGLKGVQLVVSDAHTGLVAAIGAVLPGASWQRCRTHYARNLLSQVPKSAQPWVAT
                     LLRTVFEQPDTDAVQAQMRHVLDALEAKFPKAAAHLVAAQHDLLAFTAFPREIWRQIW
                     SNNPQERLNKEIRRRTDVVGIFPDRTALIRLVGAVLAEQNDEWTEARRYMGRELLAKA
                     RLHPIESETDETELPTELTA"
     repeat_region   405941..405963
                     /note="23 nt imperfect inverted repeat (17/23 nt)"
                     /rpt_type=inverted
     repeat_region   405964..405965
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             406594..408870
                     /codon_start=1
                     /gene="katB"
                     /locus_tag="SAVERM_348"
                     /old_locus_tag="SAV_348"
                     /product="putative catalase"
                     /protein_id="BAC68057.1"
                     /transl_table=11
                     /translation="MSEANPLKRAARKITNSLQDNGATPEEGIPGRPGPESPSVAEPT
                     EPRDPLPPKPDQSGPDTVSPTGQPTGADQARMAQSGSYLTTAQSTRLYDTDHSLKAGP
                     RGPVLLQDHHLREKVMHFDHERIPERVVHARGAAAHGVFQSYGTAASVTKAAFLSEDK
                     ETPVFVRFSTVLGSRGSSDTVRDTRGFATKFYTSEGVFDLVGNNIPVFFIQDAIKFPD
                     VIHAGKPHPDREIPQAQSAHDTFWDFVTLHTEATHHTLWNMSDRGIPRSYRMMEGFGV
                     HTFRLVNAEGATTLVKFHWKPKLGVHSLVWEEAQITNGVDPDFHRRDLADAIEAGAHP
                     QWELGIQTFPDTPDQTFEGIDLLDPTNLVPEELAPVQPVGLLTLMRNPSNFFAETEQV
                     AFHVGHLVPGVDVTDDPLLAGRLFSYLDTQITRLGGPNFPQLPINRPHAPVNDMLRDG
                     MHQTAVHRGVAPYRPNSLDGGCPFLAGADTGAFVETPVRVPEAAKVREAPESFADHFS
                     QPRRFWLSMSPIEREHIIAAYTFELGKCYEQAVKERALQVLANIDPNLCAEVATGLGL
                     PAPQPTVPLAEVEASPALSQVGGTWPTDGRVIGIVIGPDGDLRGVSAVREAVLDASMV
                     PLVVAPAGGVFGSGEGMVTVQRTYATARSVEFDAILLAGTPGVGGDAYGARDAKAFPA
                     PAQQATGDPRVGLLVSEAFRHGKAVGAWAGGEAFLEASGVPLDAPGVVVGDSGTGALA
                     QLTGLLGKHRAWDRFRAV"
     CDS             408998..409465
                     /codon_start=1
                     /locus_tag="SAVERM_349"
                     /old_locus_tag="SAV_349"
                     /product="hypothetical protein"
                     /protein_id="BAC68058.1"
                     /transl_table=11
                     /translation="MQTFLPFPDFAASAAALDPRRLGKQRVEALQLLRGLMVPGYGWR
                     HHPAVRMWTGYEEALVRYGLEVCCVWTAAGRADTCAGSLMTDFTAHRADVGVRTQERL
                     AADGELPPWLGNPAFHRSHRSALRRKDPGFYAPLFPDVPEDLPYVWPASDRSR"
     CDS             complement(409830..411953)
                     /codon_start=1
                     /gene="prpD"
                     /locus_tag="SAVERM_350"
                     /old_locus_tag="SAV_350"
                     /product="putative magnesium or manganese-dependent
                     protein phosphatase"
                     /protein_id="BAC68059.1"
                     /transl_table=11
                     /translation="MPDAASTDFPAGFGPEALESVLLQFARESGASLSAIYLLSPDEP
                     ALQLAVLSGISWRIAVPWARVTLEAATPVADAVRERHLVWIGSEEERARRYPKLALVL
                     PHPFALAAAPITTGPTVWGGLVLHWPASHPPTLSSHERDAIAGVCERLGVIMRQAANS
                     GHPVVPGLEPRILPPSQTRTAGHHEAQAAVGFAERLPDGCCALDVDGRITFITTAAAD
                     LLGVGVFDLLGARPWEALPWLDNHVAEDRYRSAALSRLPTSFTTLRPPDHWLSFHLYP
                     DATGISVRIVPNPSAHTPDPPRLVHPAPPVEPGRANALYSLTHLAVALTEAVRVCDVV
                     NRVADQVLAAFGARALALMTAQEGRLHIIGYRGYTADLMDRFDATPLTADTPAAHVLT
                     TGIPCFFASFAELKRAHPAAVLQDGMASWAFLPLITSGRAVGSLVLAYDQPHLFTPQE
                     RAVLTALAGLIAQALDRAHLYDAKHQLARNLQAGLLPHTLPRIPGLEVAARYLPASRG
                     MGIGGDFYDLIRLDETTAAAAIGDVQGHNVQAATLMGQVRTAVHATAGAAPGEVLART
                     NRLLTDLDSGLFTSCTYIVLDMTHHHACLATAGHPPPILRHPDGHVEVLHLQPGLLLG
                     IDPAAEYPTTEVSLPPGTVLALYTDGLIEAPGVDIEDAIHSLANQLAHADTLSMEAIA
                     DSLVDHARQSAFRSDDIALLLIHSR"
     CDS             complement(412866..413366)
                     /codon_start=1
                     /locus_tag="SAVERM_351"
                     /old_locus_tag="SAV_351"
                     /product="hypothetical protein"
                     /protein_id="BAC68060.1"
                     /transl_table=11
                     /translation="MAARSSSPSTQRVGGASFGRCAERKTSRTGVTTSTPIASPVHQT
                     DHVGQNWSALSTPAWARVPLPVVALTSIPVNAPRKINASASRERSNSRRNPVRRSSMY
                     EQTGARVFPDTITSTAQTDGPRETLTRSAPSAIPGQTRGPPRSGLARAIPVGGHSGVT
                     WPRTSC"
     CDS             413661..414347
                     /codon_start=1
                     /locus_tag="SAVERM_352"
                     /old_locus_tag="SAV_352"
                     /product="putative secreted protein"
                     /protein_id="BAC68061.1"
                     /transl_table=11
                     /translation="MPHVARLMSNCASLAAATAVLAVSFQLNLEPAEAQRRVRPRLVL
                     FATSALGMTVLFTYEQMTHRSPQVYALYLLLFISYLGFAIVDFLVQAVSQSRSTRRSS
                     VRIGLRMAAAGCAFTLVYAVYKLTVLISLGLGFHLVSDHSGCSSLVSTPCVFSVTSPA
                     LAALLICVGRTLTAVVYPVSQARRRRWEAQSFEALGPLWQDLSAAMPNIDPDFTRPLR
                     TTPTSCSNVG"
     CDS             414815..416212
                     /codon_start=1
                     /locus_tag="SAVERM_353"
                     /old_locus_tag="SAV_353"
                     /product="hypothetical protein"
                     /protein_id="BAC68062.1"
                     /transl_table=11
                     /translation="MSLLHHDARHEAFDFTSHFREDLYTCLTRRGDTLFELCDAMLCE
                     DGPVTSPVDLTLLAEHRRGHGALYDALNQGRIDAVRLRKALAMLPQPKAADGRLVLAV
                     DVSAWLRPDAPCSPDRLFCHVSGRSGRSSDQFIPGWPYSFVAALETARTSWCQLLDAV
                     RLGPDDDVAEVTAAQVRRVVTDLIGQGQWEDGDDDILVVFDAGYDAPRMAYLLDSLPV
                     EVLGRMRADRVMRRPAPSPKEYAVSYPQGGRPPKHGKEFRFARPDTWGDPDAETVQVT
                     DRYGAAKAMAWDRIQPRLTTRSAWIDHDSELPIIEGTLIRLQVDHLPGGGDPLPVWLW
                     SSKTGMTSTDVDLRWQAFLRRFDLEHTFRFVKQTLGWTRPRLRTPEAADRWTWLVIAA
                     HTQLRLTPARVRRGFRNLRPHLHSPARAPKPSTPGLTTTAPALFSSCRVAAAASSGPR
                     TTVPAAGPRPRSRAS"
     CDS             416987..419176
                     /codon_start=1
                     /locus_tag="SAVERM_354"
                     /old_locus_tag="SAV_354"
                     /product="putative secreted protein"
                     /protein_id="BAC68063.1"
                     /transl_table=11
                     /translation="MRCMLLKAGVCGSAAVLALVTSPIVARAATLEPRIDLKVLVVDD
                     GGPATGAITAELDSAGTPYTRVKLADSGRPQINAAFLSDTVSGRPRAKYQAVVLPNDN
                     PFGAGSAEMATLATFEQTFGIRQADAYTYARPEVGLNYAQSPGYIGSLDGTTAQVTSA
                     GNSGSFGYLAGSVPFEDNAPDVSESYGYLAVPLAQQQAGATFTSYVDAPIPGSSARGS
                     LVGEYAHEGRRELVVNFVYNQYQEQYRLLSRGIVEWLTQGIHLGADRNYFAVHVDDVL
                     LGDDRWNTSLNCTPGDVDCTPGGGATPDPIRMTAADAQYAKQWSAGHGLTLDMVFNGG
                     GSEDYKAEHGGADPTADQLIADKSAFRWVNHTYQHPFLGCVQDVSVVPWKCSTDASGK
                     IQWVSQADITSQITQNRTWAGGKGLALDNTELVTGEHSGMKVLPQQPDDNPNLAPSLN
                     ATGVKWLASDNSRDPQQRQIGSALTAPRFPMNVYYNAGHATEEVDEYNFVYTSRANGG
                     SGICEGSSTTTCLSAPLDPQTGYTSYIVPLESRIALGHALSNDPRPVYMHQSNLAEDR
                     IAYPVLDKILGDYTSLYAANTPLVNLRMKDIGTELKYRAAWAAAVKNNQVTAYRIGNT
                     VTISSPNGTQTSATMPAGTTQKQLIGSTAFGAAYAGQLSGWTTPGTLQTSITLQLTTQ
                     ATPAAPTGTGTGTGTAKVAAPAPALRVPSGVASPVPAGPGDTARRKR"
     CDS             419179..420861
                     /codon_start=1
                     /locus_tag="SAVERM_355"
                     /old_locus_tag="SAV_355"
                     /product="putative glycosyltransferase"
                     /protein_id="BAC68064.1"
                     /transl_table=11
                     /translation="MINGHDGTTGTRRAQPSQRARRDTGIGGYGDLAVTDRTRPAFGD
                     TPPSGTARAIAAINTGTTRVTMLTEGTYPHSHGGVSVWCDQLVQGMPDVNFQILAVTS
                     DGREPLTWETPAHVSKVVSIPTWGPTPTGRAPRGRRLRGFLDTYEMFLLALLDPGPGS
                     GSCAGPSTLERFAEGLYGLAARARSGELTAALRTEAAIRTLAAVWNRPHVPTHAARPT
                     MHDVLTATDLLEHALRPLAAAPPRHGIAHAVSGGLAALPGLLAQHLHGTPLLLTEHGV
                     YLRERYLGYGAGGYHWPVKALLLGFFRLLAQETYARAALITPGSHYNRRWEERGGTAP
                     DKIRTVYNGVDPGAFPPAGPEPEIPTLAWAGRVDPIKDLETLIRAFALVRREMPQVRL
                     RLFGGTPSGGQAYRERCQALSRDLGIAEAVAFEGRVEDIRDAYAAGTVVMLSSISEGF
                     PFTLIEAMSCGRATVSTDVGGVREAVGDAGLVVPPREPEAMARAALELLRAPARRART
                     GEAARLRVIEQFTLRHTIDSFREIYGALGAGEDRTHLAEDPAPRARRAGGEW"
     CDS             420855..422207
                     /codon_start=1
                     /locus_tag="SAVERM_356"
                     /old_locus_tag="SAV_356"
                     /product="putative membrane protein"
                     /protein_id="BAC68065.1"
                     /transl_table=11
                     /translation="MVNRPGDDRTVLLRLPTPPQRPTWADDPLDELAERLADVCGAAV
                     HPDEIAAVLESDGLTHQQITTRYSRRDLFAIAEELYTRVPRRFPDPGPGPDPWRTSPW
                     QCLLRGMLFGLPGLAYLLGAGLLPGRVTGLAASALVAWAWNQALAHRAYVRLAAGGRR
                     AAARCLLLGAPAGVTAAAAAALAVSGAGAAPAFAAGEALYLAAATVLLVLGREQHLLI
                     ALVPTAAGAACIPLWHPGPVPVAVLLLATVAAAALSAVREIVRSLRTTSSAAPGTPRL
                     TASVPYGLFGLAGGALTLMAPAAGRPAAVVLTLSMGVAEWLLYRYRSLTLTALRHSRT
                     PWGFRLRAVGVLALCLTGYLAVLAAPALVTGVPPLPLLALGAALWVALLLQAAGIAWP
                     SAVACLAAAVAEVALSGGANRGPGLLSPATAELAACGCATAVLLAVACTRMGRTTAHR
                     "
     CDS             422345..423352
                     /codon_start=1
                     /gene="galE4"
                     /locus_tag="SAVERM_357"
                     /old_locus_tag="SAV_357"
                     /product="putative UDP-glucose 4-epimerase"
                     /protein_id="BAC68066.1"
                     /transl_table=11
                     /translation="MTSSAPVTVAVTGAEGFIGSHLVEALIASGHRVRAMAQYNSFSS
                     YGWLETLPQDVMDSVEVVLGDVRDAGSVQHLLTGTEAVYHLAALIAIPYSYQAPHSYV
                     ATNVTGTLNVLEAVRRLGIPRMVHTSTSETYGTAQTVPITEDHPINTQSPYSASKAGG
                     DRLADGYYASFGIPVATLRPFNTFGPRQSMRAVIPTVIGQVAAGERTIALGDLRPTRD
                     FMFVKDTAQAFLAVGTAPAEAVVGRTFNAGTGGEISVGDLVTLVGKLMGAELEVREDA
                     QRIRPAASEVMRLVCDASRLRAATGWEPAHSLQEGLEQTVRFFSDPANLARYKTAIYN
                     V"
     CDS             423399..424112
                     /codon_start=1
                     /gene="mpg1"
                     /locus_tag="SAVERM_358"
                     /old_locus_tag="SAV_358"
                     /product="putative mannose-1-phosphate guanyltransferase"
                     /protein_id="BAC68067.1"
                     /transl_table=11
                     /translation="MHAVILAGGKGVRLRPYTTALPKPLVPIGDQHAILEIVMRQLVN
                     SGFTSCTIAIGHLGHIIRAYVGNGSQWGLRVDYSTEDSPLGTMGPLLTMLDRLPEHFL
                     VMNGDILTDLDFRAVLRSHQADSAPLTIATYCRKVRIDFGVLTTDGKQVVGFTEKPTL
                     DYRVSMGVYGLSRSTLDGYTPGLPLGFDELVLDLLRDGTPPAAHEFDGYWLDIGRPDD
                     YDRANSEFTTHRDLLLKGA"
     CDS             424117..425016
                     /codon_start=1
                     /locus_tag="SAVERM_359"
                     /old_locus_tag="SAV_359"
                     /product="putative NDP-hexose 4-ketoreductase"
                     /protein_id="BAC68068.1"
                     /transl_table=11
                     /translation="MRILVAGSTGFLGRHITEHLLALSGVRVLRAGRSPGADLRVDLT
                     TATVSALAADLHALAPDAVVNCAGAVGGGPLLLAETNARGPAVLCEALTAADLPVRLV
                     HLGSAGEYGTTPGQPLGEDSATCPQGAYGATKLAGSLTVAEAALDAVVLRVFNPLGPD
                     SPGTSLPGRLADELLRAGPDGTVRVGDLSAYRDFVDARDVAHAAALATTAPGPLPRIL
                     NIAGGSATQVRKVAEGLARISGFHGRIDENGTGSQRSSAISWQQADITAAATALGWHP
                     ERTLDTSLADLWTSRTGTPPTPA"
     CDS             425013..425681
                     /codon_start=1
                     /locus_tag="SAVERM_360"
                     /old_locus_tag="SAV_360"
                     /product="hypothetical protein"
                     /protein_id="BAC68069.1"
                     /transl_table=11
                     /translation="MTHGRLLVPLYVHPAVDPAAWQALTRVPSRLYGVVLNVADGPGA
                     TRDPAFAAAAGALRAAGIRVLGYLDTAYGTRPHQTVLTELRHHVSWYGTDGVFLDQAS
                     AEAGLLPYYRVLGDEARDHGVGTVALNPGMHPDSGYASIADLLVTFEGNWQTYLTSAA
                     PFWTAAHPSARFCHLIHGVPDGLCDLAARTARIRRAGVHCAVPGEGANPWAALPPAVR
                     RGTT"
     CDS             425823..426356
                     /codon_start=1
                     /locus_tag="SAVERM_361"
                     /old_locus_tag="SAV_361"
                     /product="hypothetical protein"
                     /protein_id="BAC68070.1"
                     /transl_table=11
                     /translation="MCAAWPPAIGNSGSPASWAASTRSSSAPRRPRRRPSPHRFVKEV
                     LRMWSPPLILVRRARASFDLGTTRLEKAQNYLVSPHMIHRDHRYWQQPDTFDPDRFLP
                     GVPHGPTDRSCYVPFGWAPKKCIGNDIGTTQLMGLCYLICTRYRLSVPNSDTLPMACR
                     FAPVPQRFNGRLALAWN"
     CDS             complement(426615..427010)
                     /codon_start=1
                     /locus_tag="SAVERM_362"
                     /old_locus_tag="SAV_362"
                     /product="putative secreted protein"
                     /protein_id="BAC68071.1"
                     /transl_table=11
                     /translation="MACSGRVRARGRRRGGQKVMRSRSASSTERGCTATVVVTALLIV
                     GVSACGGEATVDCTGGSYTVECHPVAQPADSTPGTTVPAPALTPSGTCPSDWGEFYKA
                     VHNRSLDWACPLPSFLGPPPDTAAPLPSP"
     CDS             complement(427297..428631)
                     /codon_start=1
                     /locus_tag="SAVERM_363"
                     /old_locus_tag="SAV_363"
                     /product="putative membrane protein"
                     /protein_id="BAC68072.1"
                     /transl_table=11
                     /translation="MAEALNGSFKAELIEHQGPWRDADQVERSVVQWVGWYNTERLHS
                     ALDCLPPRGIRDPALPISGSNERRLKPRKPAATKLGAAHNGLYVTALGLLLAQYTFCG
                     YDASSHLSEETTQAQISAPRGIVRSIWVSWIAGFILLAGLTSAIQDYAGTQSSSTGVP
                     PAQIFLDVLGADGAKALMLIVIVAQLFSGSAETAAASRMVFAFSRDGAIPFAATWRRV
                     SPRTKTPAAAVWLSVGSALVLAAPSLYSPTAYAAVTAINVIGITPGPPWRTRPRGSCG
                     TAPSMPSTPSATSTGTGPHSWPSTTPSSTAPPFGRSHLCGHQPEAGANPRIRSNPYTT
                     SLDAAHGYFAEGTRLTAVATLGGAAYRRYAQQTRRSSPPRAAGGGVMWIFLVLGLLPI
                     VLLLWTFAGQVNQQMDSQFAGEVIALSVHRVTLTTGMRTDYVLTTVGSSPCR"
     CDS             complement(428654..429688)
                     /codon_start=1
                     /locus_tag="SAVERM_364"
                     /old_locus_tag="SAV_364"
                     /product="putative IS110 family ISLxx2-like transposase"
                     /protein_id="BAC68073.1"
                     /transl_table=11
                     /translation="MIGVDTHKHVHVAAVMDTIGGILATLTIPTDTGGFQQLADWAGS
                     FGDVVAFGIEGTGSYGATLTSFLRRAGHKVGEAGRPDRRLRRMNGKSDTLDAENAARA
                     VLAGFATATPKTADGEAEMIRQLKIAHDQAVEQRATAMVTIKAILVHASDALRRETVG
                     KTQISLARQLAALRPRRLEGPEDALRHTLRTLARRWQYLDAEAKELTKMIGDLVQRVA
                     PQLLEPFGIGVDTAAEILVVTGDNPERIKSEAALAKLAGIAPVPTGSGMTAGRHRINH
                     GGHRQLNAAIYRTVIVRMRFHHPTIGYVARPTAEGKTKREIIRCLKRYVIREVYHLLR
                     PAPRRASAAS"
     repeat_region   429910..429918
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  429919..431694
                     /mobile_element_type="insertion sequence:ISSav1B"
                     /rpt_family="IS4 family (ISFsp6 group)"
     repeat_region   429919..429955
                     /note="37 nt imperfect inverted repeat (36/37 nt)"
                     /rpt_type=inverted
     CDS             430053..431681
                     /codon_start=1
                     /locus_tag="SAVERM_365"
                     /old_locus_tag="SAV_365"
                     /product="putative IS4 family ISFsp6-like transposase"
                     /protein_id="BAC68074.1"
                     /transl_table=11
                     /translation="MPVQCSTVTLTSSITVADGIFAPGHLGELTQQLPFELVDDVLER
                     AGGAQHRLRLLPSRVGVYFVLALALFPQLGYVRVWDKLTAGLRGILHRRPSEKALREV
                     RRRLGVAPLRLLFETLAGPVAQPITPGVRYRCWRTVAFDGCSSTKAPDRPRVCAWLGK
                     HKHRYGTDGYPMLKIMVLCETGTRALLGAVFGPTPEKETGYAEQLLPLLDGGMLLLND
                     RGFDSDDFLAKAAATGAQLLVRLKGTRTPARWALLPDGSFLTRINGTRLRVIDAHIAV
                     TTAKGLRLEGHYRLATTLTDHRRYPAVELVELYHERWEIESAFYSLRHTLQCGLVLRS
                     QDVAGIQQELWAHLTVYQALRRAMVEAVETLPGTDPDRASFTVALETAKEQLITAANV
                     LPDAGPGRITSALLHDLLPPRQARVNPRRVKCPISRYAAPPDQAQALGASRITSIAVT
                     VHSSAGTGSDGRRDHTLQLLRTNPLRTWRACEIARGIGLDDARGLRAELGRWVREGIL
                     RRTGRGIYTLEPEWITPDLHHPSVPPHLTTADRP"
     repeat_region   431658..431694
                     /note="37 nt imperfect inverted repeat (36/37 nt)"
                     /rpt_type=inverted
     repeat_region   431695..431703
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             432038..434323
                     /codon_start=1
                     /locus_tag="SAVERM_366"
                     /old_locus_tag="SAV_366"
                     /product="hypothetical protein"
                     /protein_id="BAC68075.1"
                     /transl_table=11
                     /translation="MMGPFEQPRCGGSKQMRLDGKTAPSDLQLKIVLHGTRPPLWRRL
                     LLPSDTSLGTLHDAIQVAFGWHGGHLHLFTDEFGRGYGDAARLTDIDLGFGRGVGDED
                     TTALGDVLAEEGARLRYVYDFGDDWEHGITLEKTLPRPVGAERTVRCVGGRRADAPAE
                     DIGGVSGLAEVLGFLDTPDGAFDGPYGELVAELRAAGYDPAAFDRDAITARLAEVTPD
                     TVSGKAKPPAGDRSGRGGVRRLTAEDVALCTCGQCGVGDPVDAGVDGPAEDVPVLRPV
                     TLAPQEDLVAAVRGVPLFDAALRLAAWCHEGRQVTAGRVLRPALAREAVEELQLWKLA
                     GHDSPYADAVARSRALKSLRSAKDVAVLDDPWWLAVDGEMITIRGGRASGGAATDFTG
                     EDLLEFWAATMGDLLEEIGETGVLDGWHGELGELTAEIADGLVGLLYDAPDDAWVDGD
                     DLRAKARERGENGPEFDLFRALFAASFRALGEGLALLGAVEYESGDGDDSAEETLRTL
                     LNAVVGQKPGGSGTLPSASDWSRDDRRGDRMRLTPLGRYGLRAYLMECGVPAPLLGEY
                     AEADAGALLQGLLGYSPEELRREVEGWLEHRTAADAAVGLLDACAGADHEAAAKRAVA
                     QLVLADLDDPRALRVLRKAADSDVEGCRQVATATLGAHLEGEAPVDPARAEEAGLWLL
                     IDGLSILAGAGETEELVRGFLENGNTAPEALEQRVDELWRVEHPATAQVLAELGEGLR
                     GVDKRLAKRMRTAANKAQSRR"
     CDS             434410..437262
                     /codon_start=1
                     /gene="helZ1"
                     /locus_tag="SAVERM_367"
                     /old_locus_tag="SAV_367"
                     /product="putative SNF2/RAD54 family helicase"
                     /protein_id="BAC68076.1"
                     /transl_table=11
                     /translation="MRSVPPLAAPESAAWARSLLNYGWAAVFLPGEPARLGRLLLWRP
                     AGAAAAEGMAPTDIETEAAELVLPHGRSVRRRKVEGYALPVALAVAALSGAQPPHPSA
                     SAWQAAARFALRLLADGRLHPALTPAGYDTWQAGPFTAAQRRTLDALAGAFPPHAHCL
                     PEPGPTPLRITKPSALVRRFCDAVADELVRTPAAPLAMGALPYAWRETRTVPVLHEWA
                     EETAAAFTADVRVSLRVDVPEGRRRQFRAVLQLHTVADPALVVEAAQLWNEPAETEHL
                     LGPRAEIETLLALRRGAHAWPPLDRLLRDAAPDQLRLTDDEAFDLLGDATDRLRAAGI
                     DVHWPRELVKALTATAEIGQRSAPGSSAGGMLDANTLVDFRWRLSLGGDPLTEAEMDA
                     LAETRRPLVRLRDQWVVADPKLVARARRRRMEPLTPMEGLGAALTGEMERDGETFRCA
                     AVGALGDLVARIRDPESRTPAPQPTALKATLRDYQKRGLAWLAEMCELGLGGCLADDM
                     GLGKTITLLALHLHRQTEPATAGPTLVVCPASLLGNWQREAARFAPATPVRRYHGGDR
                     HLKDLAGNEIVLVTYGVLRRDRETLAENAWSLIAADEAQHVKNPYAVTARELRALPGR
                     ARVALTGTPVENNLSELWALLDWTTPGLLGPLTAFRDRHARAIESGEDPQAAERLSRL
                     VRPFLLRRRKSDPGIAPELPAKTETDRVVPLTAEQASLYEAVVRETMAKIAEAEGIAR
                     RGLVLKLLTALKQICNHPAQYLKEHSLRQSTPLNGRSGKLDLLDELVDTITAEGESVL
                     VFTQYKQMATLLEKHLAERGVPTLFLHGGTPVTAREEMVDRFQRGEVPVFLLSLKAAG
                     TGLNLTRATHVVHYDRWWNPAVEDQATDRAYRIGQDKPVQVHKLIAEGTVEDKVAKLL
                     EAKRALADAVVGSGEAALTELSDADLAELVALGRQS"
     CDS             437259..438503
                     /codon_start=1
                     /locus_tag="SAVERM_368"
                     /old_locus_tag="SAV_368"
                     /product="hypothetical protein"
                     /protein_id="BAC68077.1"
                     /transl_table=11
                     /translation="MSPSIPGPRRAPARGRRAFAATWWGQAWVTALEDSTLDSGRLSR
                     GRTYARQGMVGPTTVAPGQVKAPVQGSRPRPYRCSVHLSVLTDTQWDTLLDTIAARAG
                     HLAALLGGEMPGELVDDARRAGVPLLPQSTELDPDCSCPDWGYPCKHAAALCYAIAAT
                     IDADPFVLFALRGRDREEVITQLRARRTAAQATSTPPAPAGLPAAGAYTAWGALADQP
                     PSLPELPEPAPHTAALPAAPPPGTGLSAADLERLMADTAARAARLLTGDTTSLHLSQH
                     EDAARIASSNCGPEWFHRLIQNTGAKPAAFARLTRAWRYGGPTGITVAEQPRTPDPTA
                     MTAARTALTETLTEMTTPPVALRAWRNRLTLADHGIQLRLGPDTRWYPYLQDDDGDWW
                     PAAPADPDPVTALTSVWQQTER"
     CDS             438792..439298
                     /codon_start=1
                     /locus_tag="SAVERM_369"
                     /old_locus_tag="SAV_369"
                     /product="hypothetical protein"
                     /protein_id="BAC68078.1"
                     /transl_table=11
                     /translation="MANSCSMADLATQVLPVASALAGVALTLAGNMYLERSKWRRSRH
                     TEQEARSLQAYADLLQGATDIARTLRQAAEQLEEGHNVDMQAIAAVIDDHIGQLRRQG
                     TIVRLVGPRSAFDLVKGLEDQVAPIYRLLIEVGRSGDGSALVQPARRLMRTRDEITDH
                     LRMAGGLT"
     CDS             complement(439342..439959)
                     /codon_start=1
                     /gene="int2"
                     /locus_tag="SAVERM_370"
                     /old_locus_tag="SAV_370"
                     /product="putative tyrosine-family recombinase/integrase"
                     /protein_id="BAC68079.1"
                     /transl_table=11
                     /translation="MHRPRRAHVQTCGPHRSAAGEVLGCVVDLHEGVLTVRQALQRVG
                     GELLIVAPKTQRSARRVALPAECVTALRGQCARQIADRKAAGANWKGTVQGLVFTTKN
                     GTPIVPRNLNRSFEVLCVRAGVRKVRFHDLRHTCASLLHEQGADARMIMEVLGHSSIR
                     VTTDIYTFVRLDSQRSAFDRVGDALRGDGNDPDDDDGAAGVLVAV"
     CDS             complement(439970..440566)
                     /codon_start=1
                     /locus_tag="SAVERM_371"
                     /old_locus_tag="SAV_371"
                     /product="putative oxidoreductase"
                     /protein_id="BAC68080.1"
                     /transl_table=11
                     /translation="MTTIAVLGNGRVGGNLATALTRAGHEVTVADRTPGAAADTARTA
                     QIVINATPGAGSLDRLAALRDELRDKILVDVSNATNDGPDGLPADLIYPGSSLAEHLQ
                     EALPETRVVKTLNTMLFPVMTAPATLTQTPTAFLSGEDPQAKQTVRELLTDLGWHKEW
                     IADLGGIQTARATEAAILFVPHVIGATGFTPFAISIAR"
     CDS             complement(440608..441426)
                     /codon_start=1
                     /gene="suhB2"
                     /locus_tag="SAVERM_372"
                     /old_locus_tag="SAV_372"
                     /product="putative myo-inositol 1-monophosphatase"
                     /protein_id="BAC68081.1"
                     /transl_table=11
                     /translation="MSETLQTTAVAASDADLLAQTANAVRAAGSALRERFGEVVRYQS
                     REELMRALAANDDTALDILRPRLTSLRPDAGWVEDELDGGALPPGEWWVVDPAEGNVN
                     HLHALPEWAVTATLVRENQPVLTAVHLPLTGETYTALTGAGAHVDGRPLHVSPAADLG
                     LSIVATSQARPDEDEKVVRRVGSSITAMLFDALVVRTAVPATLHLVNVAAGRIDAFWQ
                     FAGARADLLPGALLVTEAGGQISDAQGRPWTPQSESFLAAAPGIHAEAVATLSH"
     CDS             441565..442470
                     /codon_start=1
                     /locus_tag="SAVERM_373"
                     /old_locus_tag="SAV_373"
                     /product="putative LysR-family transcriptional regulator"
                     /protein_id="BAC68082.1"
                     /transl_table=11
                     /translation="MQLDLNLLAALDALLEEGSVAGAAARLHVTAPAMSRSLGRIRRT
                     TGDQILVRTGRTMTPTPYAIAVREQVHELLHQVQGVLAPSRELDLATLERTFTLRWHD
                     SLVALSGPALLAAVRGQAPGVRLRFVAESSIDTPELRRGEVDLEANANRPSAPDIRAE
                     NVGETRLVIIVRQGHPLTRVKTVTAQRYAAADHVTVSRRGNLSNALDDSLARLGLTRR
                     VVATAPTEAAALEFARGSDLLISVPEATTRSAVADLGLVVLPLPLELPSAPIYLSWHQ
                     RYDTDHAHTWLRGLARTALAMGGAS"
     CDS             443421..443774
                     /codon_start=1
                     /locus_tag="SAVERM_374"
                     /old_locus_tag="SAV_374"
                     /product="hypothetical protein"
                     /protein_id="BAC68083.1"
                     /transl_table=11
                     /translation="MRPVRQRRADTGFSAETRSVPSGGIEWPRSRKTPTALSAHTTGP
                     ARPKWVPSIATTSIPAQRAPAVRTAEAGPRRRSNRARTGRTPSRVRASHNAVPLIVTT
                     SIESSAAVSLRQTAR"
     CDS             444076..444585
                     /codon_start=1
                     /locus_tag="SAVERM_375"
                     /old_locus_tag="SAV_375"
                     /product="putative IS605 family IS606-like transposase"
                     /protein_id="BAC68084.1"
                     /transl_table=11
                     /translation="MGWQRRVTHAPQSHTLSPRVAMLWEASRSVWATTPHPRQMKSPW
                     STRFRLSLREFNGERDHVHLLVHYPPKVAISRLVGSLKGVSARRLRQEFPNHIRKYPW
                     GEHFWSPSYFAASCGGAPLSLIKEYINNQKRPSLGQQRRPVDPRGSEQRQKALPPGRE
                     RSGFRARSC"
     CDS             complement(444528..445748)
                     /codon_start=1
                     /locus_tag="SAVERM_376"
                     /old_locus_tag="SAV_376"
                     /product="hypothetical protein"
                     /protein_id="BAC68085.1"
                     /transl_table=11
                     /translation="MVSALQARLPELGERMAQRIRSDVDAYKDASLIPFDSLRRSCTA
                     NADLLLYQLGRAGAQDPSPARETGRLRAEQGVPLADTLHAYRIGFEFLWTDILAEARN
                     RPEVTDAQLVSQSAEIWALFGRYAEAVAAAYRETTAELTSRRQARRSALVEALFTGVI
                     ADRTLWEAARELGLPDRGPYVVAAAAADAPGEEPLAGTEAALRQAQIPFAWRLLPDQQ
                     IGLAALPTATAESTCLSILRRAGARVGVSPCFHSLGDTPQALRFARLALAGLQGTGPG
                     VARFDDNPLAMVVAAAPAEAAHLVEVVLQPLLDLPAAERARLLETLEHWYAAAGSATD
                     AARSLFVHPNTVRYRLRRVEELAGRSLSDPRAAADIGAALLAVRRAGASPSDVIQHDL
                     ARNPERSRPGGSAF"
     CDS             445913..447400
                     /codon_start=1
                     /gene="fadD1"
                     /locus_tag="SAVERM_377"
                     /old_locus_tag="SAV_377"
                     /product="putative acyl-CoA synthetase, long-chain fatty
                     acid:CoA ligase"
                     /protein_id="BAC68086.1"
                     /transl_table=11
                     /translation="MANLAEFLVETARRQPERPALRLGGQVTSYAELDQRSARAAALL
                     RAEGVRPGDRVALMLPNVPEFVVLYYGVLRAGAVVVPMNPLLKTRETEYHLRDSGAQM
                     LFEWHQAPGEGAQGAAAAGVRHMAVEPAAFAGLLAGHAPLPEVSEPDSEDVAVLLYTS
                     GTTGRPKGAMLTHTGLRHNTEVNAVDVQRMTAEDVVVGCLPLFHIFGQICAMSVTVRA
                     GASLTLIPRFDPQTVLDAIARDRATIFEGVPTMYAALLQHPSEADVSTLRMCISGGAS
                     LPVEILHGFERRFGCVVLEGFGMSETSPVVTFNHPDRPRKAGSIGTPIKDVQVRLLDE
                     KGQDVTPGEIGELAVRGPNVMKGYWNRPEETAATIPDGWLRSGDLAHRDEDGYLYIVD
                     RKKDMIIRGGYNVYPREIEEVLHEHPAVALAAVVGLADAHLGEEIAAAVVLRPKAQAT
                     PDELRQFVKERVAAYKYPREVWLVDTLPTGPSGKILKREISAPTG"
     CDS             complement(448119..448310)
                     /codon_start=1
                     /locus_tag="SAVERM_378"
                     /old_locus_tag="SAV_378"
                     /product="putative IS5 family ISFa13A-like transposase"
                     /protein_id="BAC68087.1"
                     /transl_table=11
                     /translation="MDAIRYLVAGGISWRAMPADFPDCGRVYAFFRRWREHGLIAEFH
                     DRLRGKVREREGRESEPTA"
     CDS             complement(449403..449558)
                     /codon_start=1
                     /locus_tag="SAVERM_379"
                     /old_locus_tag="SAV_379"
                     /product="hypothetical protein"
                     /protein_id="BAC68088.1"
                     /transl_table=11
                     /translation="MAEWALRYEGITLGLLQQLVICGCIELPLLEGLLLACDSPLPRG
                     TGLLVSD"
     CDS             complement(449586..452924)
                     /codon_start=1
                     /locus_tag="SAVERM_380"
                     /old_locus_tag="SAV_380"
                     /product="hypothetical protein"
                     /protein_id="BAC68089.1"
                     /transl_table=11
                     /translation="MLSPAEPLRRPAQDGLWGGRVGAQTFSAAGHRALTEPVAQRALS
                     GRGQEVPTAARTLIERATDLSLGHVRLHTGPAVRTAARAAGVAGFTLGPDIAVATGPG
                     EGAPDRLLRHELMHAAQQTMTRRGGAAGTAPTELRAAAEEQAARAAERPERAEPPVAV
                     GPHVAAAAEGWLNSTADVRNYGMTQLLDELNAVNEWLDRQTTSTPEDDTMLAAKAAIE
                     AELARKNRAMAAPDRTRRGRRPRGAAPAAEELPQQVPMPRVLAERTSTVPADAVEART
                     EVDRITAWLQRPDLSRQDRALLRQELKELAPHLAADLARASGERRQARLTEAFTPVAE
                     QSSGLVDNLRTIEGIRPSVEQPGMAYVIHRDEMLLFPQELADQVREQTVAALADAARG
                     IRTMNAATDERMRHHLHLNYEEQPYVGFAGSVVGGEEPYEVQDRVRDPWLEAVAALRD
                     FDKARRQGALVAMGEAVLAATAQAEQARAVVNAGVGKAEAAAGDIADALTTVRNLSYT
                     VALAAGAIIAAPLAASAVAGMGATGLTATALTTAGTAGMVGAGGAGLGFVGGAGGEAV
                     SGGSARQVLRAGLEEGQRVGIEGLQTGAGAGAATGFARNLGLHAVRMSRAQTMVRSAV
                     AQGGGNVVGGLTGAALNAPPEGMTRAEAALRGVLPNLGLGALGGFAGGYSQGLSSPAM
                     RRLVGVGLPAAAEGGVEYLRTGDAEHAFTTAARSAAIGSLLHERAGLGAGAERRAFEF
                     GHGVRTRAGNIGRGIAARVRPLALGLSLGLSQVRALRMAGTGGTAPVVELGVPGARSS
                     LQDVPTTQGADVVLAGDFAGPSAEQKAQPGAPSATVAEPTAQPGAPSSAAAEQPSAPG
                     QTASTLGLDAARFAAPEMAKDLATLKNSYLRAIADLDAVRAQARTLGLSERETNAFLR
                     MWGECPTPMTAEEVGQEMGAWSTLRKQSLPSAVSSAEETLPVTLKASVLPHYSSKSAF
                     MEAMRRRLLAQRASGKESLLDFLLDADGQWQKGSFIARSGRPMRGRYALSDPDRQIVQ
                     AGHMLSDWYVKAMSRRDHLMLEDADLNWMSGFTEASGSVTSKSAVLIEGYPVDIPTAR
                     LWEAHGKLPAGTVSAAPVVEPPAF"
     CDS             453216..454730
                     /codon_start=1
                     /locus_tag="SAVERM_381"
                     /old_locus_tag="SAV_381"
                     /product="putative phage tail sheath protein"
                     /protein_id="BAC68090.1"
                     /transl_table=11
                     /translation="MTTQFSYPGVYIEEIESPVRPIAGAETSVTAFVGPALFGPTSPT
                     TVESWADFEKEFGGLWQGSELSYAVYQFFLNGGSKAIVVRVGEGVEYAGVDLKNGVKL
                     KAKAPGAAGKKLKATVTLDANDNKRYTLLISDGTTSESYDVTIDPALRNRWLDRQLAT
                     SQLVERDTETFDKRPDAVTDESFTGGKDATFTPAHVLGDATKLPHTGLAALADVEIFN
                     LLVIPAQLAKPSGTDDRDTKWAPVVDAAVRLCEEQRAMLLLDPPFGWDSPETAVTGAR
                     AGMPVGGLAGRNAAVFFPKVVISDPLSGGNLEVGPAGTVAGVIARTDTRRGVWKAPAG
                     TDDGGLLGVRSLAFRLSDQQNGTLNKLGVNCLRTVPVYGNVLWGSRTCRGGDAVSDPW
                     KYIPVRRVALHIEESLFIGTKWVVFEPNDEPLWSSIRLNIGAFMNRLFRQGAFQGPTA
                     KGAYFVRCDASNNPQDDINDGIVTIDVGFQPLSPAEFVHIRIQQKRDDATAQGS"
     CDS             454732..455262
                     /codon_start=1
                     /locus_tag="SAVERM_382"
                     /old_locus_tag="SAV_382"
                     /product="hypothetical protein"
                     /protein_id="BAC68091.1"
                     /transl_table=11
                     /translation="MAQFTVNAARLDPYKNFKFRVKWDNRYVAGISKVSALKRTTEVV
                     EHRDGGDHSSARKSPGRTKYEPITLERGVTHDPEFEAWANKVWNYANAQAAPDQRDRE
                     VSLAGFRKDLVIEVYNEAGQKVLAYQVFRCWVSEYQALPDLDANANAVAIQQLKLENE
                     GWLREASVTEPGEPSF"
     CDS             455295..456008
                     /codon_start=1
                     /locus_tag="SAVERM_383"
                     /old_locus_tag="SAV_383"
                     /product="hypothetical protein"
                     /protein_id="BAC68092.1"
                     /transl_table=11
                     /translation="MPGMSTVSAAELLDAWEAGWGRDPLRRGLALLGVARGTTPAAAA
                     DVPVGRRDRGLFALRAALFGTAVDAVSRCPECETEVEVAFDQEELLGRLGQADPEACD
                     AVTVREGDREIRVRMPTSTDLAAVLDTGDPAPEEALVRRCAPVGEPAPAADVVAEAWV
                     AADPLVDVRLGVGCPGCGLAWEEPFDIVGYLWAELDAWGRRTLLEVHELARAYGWTQA
                     QTLALSPWRRQCYLGLVGT"
     CDS             456005..456901
                     /codon_start=1
                     /locus_tag="SAVERM_384"
                     /old_locus_tag="SAV_384"
                     /product="hypothetical protein"
                     /protein_id="BAC68093.1"
                     /transl_table=11
                     /translation="MTGPLARLVDRSRSPVAGLRPRPASRYEQRSPAAGPPVLEGGLE
                     DVGPRPVTGPPTAAEPAAHRDASAVRVPGPTESAAHRHDPAVPATRVIEPADHGPSVT
                     GLSVTETVATKPSSTDADLLGPDLTTRALSAVPALPVVREDAPARGDGTPQPLPLLLP
                     VRVEAPVPPADSLRTTPELGRPAADPRTNLVRNPADEGPPPVPPPPRDNVRNTPVVLE
                     RPLLYPHARPPALATDAPPSTAPEAEPAVVVEVSIGRLDVRTPPSPAPPQTPARPPAA
                     LRADHARALENYLRRRAEGELG"
     CDS             456898..458088
                     /codon_start=1
                     /locus_tag="SAVERM_385"
                     /old_locus_tag="SAV_385"
                     /product="putative secreted protein"
                     /protein_id="BAC68094.1"
                     /transl_table=11
                     /translation="MSNSLALAAVTATLRARLFSRLGGPQVTVAPPNKAPDAASGDHV
                     NLFLYRADLNPAFRNADPPGWQPGESPKPVLPLVLHYLLAAYSNDEGKAHELLGAAML
                     ALHDAPVLSGDEIRAATATALPGSDLHLQPERVKITQETLSQDDIAKMWTAFGTPFRM
                     SSAYQVTAVLIDSALPGAAPMPVLRRGADGRGPLARPGTGSPALLGIRYAAAGQVGAL
                     PGEQVALLVENLPAVALTARLRHLRVTQSVNVPLATPATGASEVALTLPATGLPAGLW
                     AVDLGPAAGGSVRTNELALGVTPAVTALAAAAAGGTPVRTKVTVTAAQPVLPGQQAAV
                     LVGARQLAVGLLTAAAKPVSVTAVLPSGKTRVRLRVDGVDSEIVDRAHGTFRTGPTVE
                     VTIP"
     CDS             458085..459584
                     /codon_start=1
                     /locus_tag="SAVERM_386"
                     /old_locus_tag="SAV_386"
                     /product="hypothetical protein"
                     /protein_id="BAC68095.1"
                     /transl_table=11
                     /translation="MSLGVPADLRWEEANNRYLKASLTWLRARLEAVAHSDRASDAPD
                     TKDAPPQTGSARRRRRGRTPELPPAAVDLPDGGPGGSRRGRAPEPLTAVPDAGDLDAL
                     ATTRQDAAAPSDLAPPALVRLAERFGLTDFERDVLLLVVAPAVDPGVGAAIAAAHGDP
                     QATAPTFALALRLFDDARWDVLSPLRPLRRWRLAEVVPAPAGPLLTAPLRPDDRIANL
                     VRGLNHLDERLTSVLEPVADPAAGVASPASVRRAEDAVVAAVLADTPDGRFPVVHLVG
                     SDADSAVLVAVRAFARLERELYRLRTGLLVRGGQGQQDPDTVALLWHRESLLMPVALL
                     LDGTDADPDDPALVAAVRRLLSRSGGPVVLAARQVSPVDGRSTAVVDVDVPPPDEQRA
                     LWAAATGLEPAGAPAELAGQFRLGLPALHRVATAHRPEGLSAEDGGDRLWGGLPGRRP
                     ASPGVAGAAHRAPRSLGGPGAAGAADGGAAADGRSCAARRHRVWGLGLR"
     CDS             459466..460251
                     /codon_start=1
                     /locus_tag="SAVERM_387"
                     /old_locus_tag="SAV_387"
                     /product="putative AAA family ATPase"
                     /protein_id="BAC68096.1"
                     /transl_table=11
                     /translation="MPRAHWADLVLPEQQTEVLRRMAGHVRHGATVFGDWGFGERTNR
                     GQGVTALFSGPSGTGKTFASEVLAHELGLDLYRVDLSAVVNKYVGETEKNLRQVFDAA
                     ESGGSLLLFDEADALFGRRSDVQDSHDRYANIEVSYLLQRMEAYRGVAVLATNLRAAL
                     DPAFLRRLRFVVEFPVPGAEERRLLWAAAFPDSVPLADDLDLGRLADLPTTGAAIQAI
                     ALGAAFLAAACGRPVDTAMLLTAAHAEFRKLDLPLPVLAGEAP"
     CDS             460571..461251
                     /codon_start=1
                     /locus_tag="SAVERM_388"
                     /old_locus_tag="SAV_388"
                     /product="hypothetical protein"
                     /protein_id="BAC68097.1"
                     /transl_table=11
                     /translation="MTSSFLPGTPVVPRGAIVLLDPATGAVLRVIALQYNPDTLTRTL
                     QPQGVGAEAGERSEALRLKGPALETVKVDVELNATDQLEDPSGADADSVARHGLLPVL
                     AALDLLVNPTARALLDQDAAARSGAFEIAPVEAPLTVFVWSRDRVVPVRITEFTVTEE
                     AFDSQLHPIRAKVSLGLRILTVDDLGFGHRGGALFLAHQRRREQLAALHRSARPATAV
                     LGTPPGGG"
     CDS             461251..461568
                     /codon_start=1
                     /locus_tag="SAVERM_389"
                     /old_locus_tag="SAV_389"
                     /product="hypothetical protein"
                     /protein_id="BAC68098.1"
                     /transl_table=11
                     /translation="MFTPASRYHGVEVARYEPPDGGDPIPYVRRRLLPDPAGLTPAGF
                     HTVSEGDRLDRIAAAAFGDPELFWRIADANPVLDPPELTDRPGRRLLIALSAAAAGST
                     HGF"
     CDS             461558..462664
                     /codon_start=1
                     /locus_tag="SAVERM_390"
                     /old_locus_tag="SAV_390"
                     /product="hypothetical protein"
                     /protein_id="BAC68099.1"
                     /transl_table=11
                     /translation="MASEMLLALRLGPVLAEPVPREVADALLSVQVTEGVGRSGGFQL
                     EFATAKRSLLFAELLPQGALDPPARAQIVLTVLGRSTVLMDGVVTRHEVAPSAEPGQA
                     KLTLTGEDVSRMMDVVDFSGVKYPGLPPEERVAVIVAKYTAYGLVPAIVPSVFMVAPN
                     PLQAVPSHQGTDLAYVRQLAAQAGYQFFVAPGPLPGVNIAHWEPPNKLGLPQEPLLVN
                     CDAASNVESLSFSFDGFSATQYVVLIQNPETKFPVPVPVPDVSPLSPPMGRRRPLPLK
                     VQPIHGLAKLTPPQAAGVALARAADSFEVISGQGSLDVLRYGQPLRARRPVPVHGAGA
                     AYDGTYYVRSVTHSIKRGAYTQQFTLTRNAFGPL"
     CDS             462705..463295
                     /codon_start=1
                     /locus_tag="SAVERM_391"
                     /old_locus_tag="SAV_391"
                     /product="hypothetical protein"
                     /protein_id="BAC68100.1"
                     /transl_table=11
                     /translation="MTNMDDIGYVESPGFFSPAQREDAEPPGARRFYGKYRGSVVNNV
                     DPLGTGRLLVSVPDVFGLFPTSWAMPCVPLGGLQSGMFVRPPQQAGVWVEFEGGNPDH
                     PIWTGFFWGGRAETPATAGTLVPGSPVFLVETSGKSKIAVSDSPVTPMKGGGVLLQSP
                     SASITVDSAGVTITAANISLNGLVDINNGALVVKTA"
     CDS             463306..463653
                     /codon_start=1
                     /locus_tag="SAVERM_392"
                     /old_locus_tag="SAV_392"
                     /product="hypothetical protein"
                     /protein_id="BAC68101.1"
                     /transl_table=11
                     /translation="MPGFALTTAAALTCAHQGQLTLTPGQQQVLAGGAPVVTTADVNV
                     VAPSCVLSSSTPPTPCVKVDFSLAASTRVFVQGRPLVVQPAGPGTGLGLSAAQVSQGP
                     PVVSTVQQRVVAA"
     CDS             463650..464039
                     /codon_start=1
                     /locus_tag="SAVERM_393"
                     /old_locus_tag="SAV_393"
                     /product="hypothetical protein"
                     /protein_id="BAC68102.1"
                     /transl_table=11
                     /translation="MSAHPDYARTHLDFPFHVDARGRSAGTSDEGHVRDLIEQLLFTV
                     PGERVNRPDFGSGVLQLVFAPGGQELAGAVEYSLQASLQRWLTDVIQVERVEVEAEEA
                     ELRITVGYVLLATGEPGTAVVERGTGP"
     CDS             464036..466855
                     /codon_start=1
                     /locus_tag="SAVERM_394"
                     /old_locus_tag="SAV_394"
                     /product="hypothetical protein"
                     /protein_id="BAC68103.1"
                     /transl_table=11
                     /translation="MTGVPDTRPCLPGERADRTRESGLGAVVAVDVDAPGRTLRVLLL
                     GAAPDPVPGAECVRIEGPGRAVRAVSVRVEGSPPPTRRATLLVTVDRLGDRSPYTLRL
                     VDPDRPGAPFPGFDPRHSGAEFTFTADCAEEADCAAVADSPVPATPVPALDYLVKDYA
                     SFRRLILDRLSLVSPAWADREVPDLGITLVELLAYVGDQLSYRQDAVATEAYLHTARL
                     RTSVRRHLRLVDHRLHEGCNARTWVHLAAEEPAVLRAGTYWFATALPGVRPLVSEAQL
                     RGATTYFERYEPVVAADLVLRPAHNEIRLWTWDGEECRLPAGTTSATLVDPGTGKERE
                     LELAPGDVLVLEEVRGPVTGVPGDADPRHRQAVRLTDVEEITDPVRGQRLLRVVWAEE
                     DALAFPLCLATVGGERCCLFEDVSVARGNIVLVDQGSSGTPPLRLTAPTTATGPASCD
                     DLGRPRPRTEAPLRWLPRLDTGPLTRRSPHPDPARTAAAQVRALEGIPARAAEAVADM
                     YRRASAPPTDADLALARTLWGARAVADAGLETARDAAQRRAALTLLRARSAALLARRT
                     ARLTRLAARARAGVPLDTDTAAEVAAGWGPVLAAGLDPGDPRVAGPASAALVQDPRAA
                     LPQLTLTSAGEHWEVRADLLDSDSDDPHVVVEAEDDGTARLRFGDGQLGRAVTGGQEF
                     LAAVRVGNGPAGIAGSGTVVHVVVSAPTDARVTAVRNPLPATGGTAPEPVADARLFGP
                     TQYRHRLERAVTADDYSALAGEPAGVQRAATDLAWNGSWYEADVAVDALGRVDPPAAL
                     LDAVRDRLERGRRIGHDLRVDAPRTVAVEVRLQLCLAPDARRAAVERAVRARLGNGVG
                     GLFHPDRLTFDSDLYPGRLVAEAMAVPGVVAAAVERLGRAEAPLPLVPDDGVLAFGPL
                     EIPAGGADPSGPGAGVLWIDLAGGR"
     CDS             466862..469465
                     /codon_start=1
                     /locus_tag="SAVERM_395"
                     /old_locus_tag="SAV_395"
                     /product="hypothetical protein"
                     /protein_id="BAC68104.1"
                     /transl_table=11
                     /translation="MCATGEGSCCCTTGAGTPLPTDNPPGAARLRARAGTHATFLASM
                     TRALSGSAHPELAELSTRDPADPALALLDAWACVGDVLTFYQERIADEGYLGTATERR
                     SLVELGRLVGYRPRPGLAADGWLAYTLDPDPADVEVTVPAGSQVQSVPDPGAQPVVFE
                     TAEDLVARPSWGALRVRTRRPMPMTRECALGLRVVYVDGVSAGVAPNDRLLFHFDDGK
                     LPTLRIVESVHADALAGTTAVALVRISDKFEKACRETVGRTGRAAFVRLDVLRVRAAP
                     FGTAAPQKLKSTGEVGATAAAVPEFEEWPLDPALYTVGTKPEEERRRLWLDGDHPRIL
                     RGSWIVIESADGWGTPFQATDVRSRGLAHYGITGKVTVLDLPTTWYDNPADGTPLLSL
                     HRGLTVHAQAEPLTLADGPFTDGLTGSAVDLDRVITAPPPSRTVLISGAPVDGGAPAG
                     EVAHVLATHTVTDPNRPGATPYTVLELAAGLRHTYRRDTVTVWGNAVRATHGETREEP
                     ALGSGDASRPGQTFTLAAHPLTHVAAPAADGGQAELTVRVGESAWSETDEIAHAAPAE
                     HAYELRADDTGTATVTFGDGRRGSRLPTGTANIAARYRVGLGRAGNLRAGQLSQLRAK
                     PLGIDAVVNPLSTGGGTDADTDAALRGRAPLPTLAMDRLVGLRDYADFTLARAGIGRA
                     AAARLTVGGRELVHVTVAGVDDAELDPDTAVVTSLLAAFRRYGDPGVPAAVAPRTRWN
                     LVLQARIGIAPDRSAVLLEPRVRAEFERVFAFGARELGRSAYVAEAVAALQGVPGVVF
                     VDVRRFGATLGTTPADAAEVTGVAQRVLARPARVEFGAAPPTEVVRPADLVVAAPGLP
                     GFVVLNLEVAR"
     CDS             469462..471561
                     /codon_start=1
                     /locus_tag="SAVERM_396"
                     /old_locus_tag="SAV_396"
                     /product="hypothetical protein"
                     /protein_id="BAC68105.1"
                     /transl_table=11
                     /translation="MSSPPPDRLYDLLPAVHRGRDEEQGFPLRALLRIVEEQVRVIEE
                     DLDTWYANWFVETCEDWVVPYIGALVGTRPPPPGSSPGAVRALSPRQDVADAVANRRR
                     KGGAAALEAVALDSSGWPARAVELYRHLVRAQHARHVRLDRPATFAVRDPLACARLGG
                     PFDDAPHLVDVRRPNSTQTRGLHGIPSLALFVWRLRAFPVTRAPAFCIDQRYSRYLVN
                     VLGIDTRLFAPAPQGPAPARVSGPGDVPHPLGREEFEAAVTEYYGPGRSLEIWRDSPD
                     NPVPAEQIIVADLTDWRYRPRPGQVVVDPVLGRIAFPADEAPEDGVWVSWHYGFADAM
                     GGGAYRRPQTPVGERKLYAVGGEDDLGSITAALRQWRADKAADPSLHDALIEIRDSAD
                     YTEALRIDLDEDDRLEIRAARGERPVVRLLNQKANRFDALTVRATAKKPPPGTVADCP
                     PPATRRPQLVLDGLVVSGRSLDVVGQIGEVLVRHCTLVPGWELDHDCRPRWGEEPSVE
                     LRRTTARLRVEHSIVGTIVVDQDETKGNPLTVEILDSIVDATSHDLPAVTAPEDRFAH
                     AELTLRRCTVLGDVRVHALPLGENSIVTGCLHTLRRDTGCLRYSYAPVSHPGPPRYRC
                     ATDPARPHFTSTRYGHPGYCQLHTACDPLISTGAEDGAELGAFHDLYQPQSLSNLVGH
                     LAEYVPLGVEAAVITAT"
     CDS             471571..472863
                     /codon_start=1
                     /locus_tag="SAVERM_397"
                     /old_locus_tag="SAV_397"
                     /product="hypothetical protein"
                     /protein_id="BAC68106.1"
                     /transl_table=11
                     /translation="MHGDFSNITFSPDRSYSTVFDLQGRVGLDANRNEQTAILLHYLR
                     TAMADLVGPYAGPATSLGFEISDIGTGGFSIGAGRYYVDGILVENPAKVTYAEQPHAY
                     IDLDDADRLPSGSYVVYLKVWERHVTEVEDPSLHEPALGLHQPDSASRAQVVWQVRAL
                     PLKSRQNPVHRIAAEHAPDRGTGVLDVRTSRDDSSADDPCTASPDASYTGENQLYRVE
                     IRRGGTAADGATFAWSRDNGSVIHPVRPLGGTKMRLTSPARDRHTALEPGHWVEVVDD
                     AISLRRDLGLPAGAPPLHRIDDIDPDTLTVILATTPDPPVSPDRHPYLRRWDHTPLDT
                     DSGGAIPITEGPWIPLEHGIEIHFQPSAAREPAHEYRCGDHWTFAARRTLGTAIWPYP
                     GGSGPHGVRYHLAPLAVVAGSKVSPLRTSFAVPLTSGV"
     CDS             472897..474789
                     /codon_start=1
                     /locus_tag="SAVERM_398"
                     /old_locus_tag="SAV_398"
                     /product="hypothetical protein"
                     /protein_id="BAC68107.1"
                     /transl_table=11
                     /translation="MIRALIDRGRTGHDAAAVLHSRGHPLDAGIRQTMEMAFGHDFSQ
                     VRVHSDPQAHALTRRMNARALTLGDHIALGQDWYSPDSADELRALAHELAHVVQQRSG
                     CAEPPAPSPHTETEHEAVAAADTVMGGGAARVRGRTGIGVARQAVESDPSDLSDTQLE
                     QEWLLAAAWLVDHSMLESDYFTVAKYVKSLEDAMRGRAGGAHRAQSEGTLPLEPLRPS
                     ILQVPLRSPVGAAGSSGAVPAAPRPVVATPLDIPAEGVDMPWVGRGKGISSSELGYLR
                     DSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAAYVNDTLEHHHVG
                     QGSRAVPLPSRLHDAYTVFHPQRRVVSTPQGGLRPIPPPRSHADAQTNLNSHVEAGRI
                     SGPGIDPTKPPTVPAVPPASEVAGQRATPPAAVPRMFGGGRIRGLVGGTILGGLQLLA
                     GYLSAKLQDHFDQQRWERERETIQAQVERELDGMSLEITDRYLDAPGREVFAVVAITS
                     TALRTVQVYATGIQSEVVDQTVYLGSKLASVELGSAARSERHEEVRQIAAPLNLGFPT
                     TTYTTTTLYSFAVPSPDLIALRWRALERLRDLDLQAPASQTAQAAAAVQEERTRLSAW
                     LRPSAD"
     CDS             complement(474824..475045)
                     /codon_start=1
                     /locus_tag="SAVERM_399"
                     /old_locus_tag="SAV_399"
                     /product="hypothetical protein"
                     /protein_id="BAC68108.1"
                     /transl_table=11
                     /translation="MSETPETPTAVLLITVWFEPASPTLRARVIQAVDVHTPGETMVL
                     VGRDAVLGVVHEWLDACAHDRPNPPSGAT"
     CDS             complement(475108..475824)
                     /codon_start=1
                     /locus_tag="SAVERM_400"
                     /old_locus_tag="SAV_400"
                     /product="putative transcriptional regulator"
                     /protein_id="BAC68109.1"
                     /transl_table=11
                     /translation="MSTADTFAPRLCLLGRFTLTYGPTTLDVGTAAQRLLAYLGMRHH
                     GTRTVVAGTLWPDVPEERAHGSLRTALWRLHRGREPLVCSEGDTLALAESVTVDARTL
                     MNSALHVVGTSPPAPAPPRDLLFAGDLLPGWDEDWVLFERERLRQLRLHALDSLAHRL
                     LAEGHHALALEAALESVRIEPLRESAHRAVVAVHLAEHNVLEAIRHYRAFKDLLRIEL
                     GIAPSLGFTSMLPACALIRD"
     CDS             476025..478859
                     /codon_start=1
                     /locus_tag="SAVERM_401"
                     /old_locus_tag="SAV_401"
                     /product="putative LuxR-family transcriptional regulator"
                     /protein_id="BAC68110.1"
                     /transl_table=11
                     /translation="MDETTVVTGGVPGAGTGPAGDTEFPPVGRECERALLDGLLDALT
                     ERGGALLLSGDPGTGKSMLLGYTAGRCRTTVLRARGVESEAVLPYTVLADLLLPLRPY
                     FTELPPGQRRALEGCLALADVAGPNPYAVCAGALGVLAAAGEVRPLLVVVDDLHWVDP
                     SSRQVLQFVARRLTTERVALVMAVQPGAEEDGPWASVPRVALGPLAEDDCWTLLRRHG
                     LDRTDPAADRLVRLSLGNPLVLVEYAGMLARMRATGATQWDEMWEAPGPLVERAWRGQ
                     LRALPHRTREALVYVAACRTPDLALLTKALAADGTDLDALDAAERTGLVRIRDGVCEL
                     RHPVLRPVVLGQCTTARRLQVYRRLAALSSDELRTWYLAAAAPGPDEAVAGRLAADAE
                     QARRRNALAAAACAWHRAAELSPDPADAARRLLEAARDAFCGGTARDAARWCEQALVH
                     SRDPRLTADIGLLRGQACTWLGDPARAHRLLVDAARAVEPVDRPRACLLYGAAVAPAM
                     MDGRLRHASDIAARCQELADDGRDTQRRHAAVMRAKAQALGGDVPTGRAALLALLDES
                     HSPVAMDIARGPEERQIAMDIAQGLSWTDDGEAARPVLDAVIECTRRDSSPTLLSYAL
                     LGRCEVEMWSHWQQARADAAEALRWAEEFGLLAMSGYALIQLARLDGLRGDTAACEER
                     IARYEHWCGGRLRGLDMFARGTLGAAALTAGDPDTCRTHLEAAFRMADGMGLVNPSLM
                     PWVADLAEASLRTGARERAVAVADWLAERAEATALAWPAAAYARCRVMLARTAQEAAD
                     WLATAELAHSKREMPFERARTRLVAGEVLRRFRRPSAAQEPLLAAQRTFTALGAAPWA
                     ARARAEVAAAGHRTAVRQTEPSLTELLTPQEFQVARAIGEGLSNVEAAAALFLSRKTI
                     EAHLTRVYRKLGIRSRSDLARCMAHAGAVG"
     CDS             complement(479076..479630)
                     /codon_start=1
                     /locus_tag="SAVERM_402"
                     /old_locus_tag="SAV_402"
                     /product="hypothetical protein"
                     /protein_id="BAC68111.1"
                     /transl_table=11
                     /translation="MRSWMLTQIEALAHRTAVPPVAGDDPAAKAEVVRLLDVLGYDAV
                     DIGALANAWHCEPGTLVYVWPYLGERSQRITKEEARLWFREIPGEPTPADWVKELIDQ
                     AVRGPVGGSFAALPFRTRWCPRRSPTSPPRWRRGLCPQVRRPRQRSRLKKAPSPTPPR
                     PRRRLPRPVRRAPPGRRRRRGAQA"
     CDS             complement(479883..481349)
                     /codon_start=1
                     /gene="pntB"
                     /locus_tag="SAVERM_403"
                     /old_locus_tag="SAV_403"
                     /product="putative pyridine nucleotide transhydrogenase,
                     beta subunit"
                     /protein_id="BAC68112.1"
                     /transl_table=11
                     /translation="MTSLKASHAADLVAALLFILSLAGLSQHRTSRAGVVYGIAGMAL
                     ALVATVVVAARSITAGAVALIVLAMALGAAMGLWRARRVEMTQMPELIAVLHSFVGLA
                     AVLVGWNSYLEVDSHGSAQTRIGANLLGIHHAEVFIGIFIGAVTFTGSIVAFLKLSAR
                     IKSRPLMLPGKNALNLGALAAFVVLTIWFAISPNLPLMIAVTALALALGWHLVASIGG
                     GDMPVVVSMLNSYSGWAAAAAGFLLDNNLLIVTGALVGSSGAYLSYIMCKAMNRSFLS
                     VIAGGFGIAAPSGGEEEQGEHREVRAAEAAEMLAQARSVIITPGYGMAVAQAQHPVAE
                     LTRQLCERGIEVRFGVHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTSVVL
                     VIGANDTVNPAATEDPGSPIAGMPVLRVWEAEQVIVFKRSMASGYAGVQNPLFFRENS
                     SMLFGDAKQSVEEILHALSTDSRHDAAPAARQATVASH"
     CDS             complement(481356..482912)
                     /codon_start=1
                     /gene="pntA"
                     /locus_tag="SAVERM_404"
                     /old_locus_tag="SAV_404"
                     /product="putative pyridine nucleotide transhydrogenase,
                     alpha subunit"
                     /protein_id="BAC68113.1"
                     /transl_table=11
                     /translation="MSAQKPSHHPPRRIGVVAESVSGETRVAATPATVRLLLGLGYEV
                     VVESGAGEASGFGDQAYADAGAGIGEAWDADVVLKVNAPSDAEICRLRKGATVVALLT
                     PAQKPELLQALADAGVTALALDAVPRISRAQSMDVLSSMANIAGYRAVIEAAHAFGRF
                     FTGQVTAAGKVPPAKVLVAGAGVAGLAAIGAASSLGAIVRATDPRPEVADQVKSLGGE
                     YLPVEAVQESSTDGYAKATSADYDRAAAQLYHEQAEDVDMVITTALIPGRPAPRLLTA
                     EDVAVMKSGSVIVDMAAAMGGNVEGTVPGRTVVTDNGVTIIGYTDLASRLPAQASQLF
                     GTNLLNLLKLLTPGKDGQLTVDFDDVVQRAVTVVRDGDVTWPPPPVAVSAAPAAQPAA
                     APVAPEPKQSNLTPAWRFGLIGLGMLAMFLLVAFAPTQLAGNFTVFALAVVIGYYVIG
                     KVHHALHTPLMSVTNAISGIVVIGALLQIGHESWIVTTLSFVAILLTSVNIFGGFAVT
                     RRMLSMFSKG"
     CDS             484188..484907
                     /codon_start=1
                     /locus_tag="SAVERM_405"
                     /old_locus_tag="SAV_405"
                     /product="putative acetyltransferase"
                     /protein_id="BAC68114.1"
                     /transl_table=11
                     /translation="MRSPPRRRLSRLVYGTIHAGAARLLHRLRWSTDRRRLRLLRLRE
                     RLVGLPVNAASAPTAAAEPRDAAGRPPVRAATPADAEGITRMRSAYVLSAPFTEDWVR
                     QCTDELAPRLTPEGAARAFVVDAPDGTMAACALGLIHPVLPAPAYPRGRAARVQIVAT
                     QPEFRRRGYARAVLSALLDHLGDVEDVTLFELHTSPEAAPLYRELGFSGSPALMWMTR
                     HRERAGAVAGAQPDSTWMPPQ"
     CDS             484941..485378
                     /codon_start=1
                     /locus_tag="SAVERM_406"
                     /old_locus_tag="SAV_406"
                     /product="hypothetical protein"
                     /protein_id="BAC68115.1"
                     /transl_table=11
                     /translation="MCLYVTDEDDRPLQLHSVYSPGHPWHMIGGAMDLGERPWDAVVR
                     EGREETGMTAVGPARLLATVFGLPREGRSYSTLQLIFDGGRLTAEQIRGITLNSREHD
                     EARVLPLAEWEALMPARDFVRLRAVEEARRTGVAAYVDTWGHA"
     CDS             485375..485860
                     /codon_start=1
                     /locus_tag="SAVERM_7575"
                     /old_locus_tag="SAV_7575"
                     /product="putative dipeptidase"
                     /protein_id="BAC68116.1"
                     /transl_table=11
                     /translation="MSASSIVLMSDRRVAAIPVQERGEVLLDARVRGLVVDDRKQDAA
                     GAWALVRRGVLTRLQQAQSLLPGGVQLLFIEGYRPPSTAPRTPSPVSASSGRSSRPSA
                     RPCSRCRTRTPPPASTSPPGEQKWAAIVAHRGEVARARSLPGILARLPEETRRAIIAT
                     E"
     CDS             complement(486648..487415)
                     /codon_start=1
                     /gene="pteH"
                     /locus_tag="SAVERM_407"
                     /old_locus_tag="SAV_407"
                     /product="thioesterase"
                     /protein_id="BAC68117.1"
                     /transl_table=11
                     /translation="MNSPLTEHNSLWIRRFHPRPDSHVRLVCLPHAGGSASFYFPVSR
                     SMPESVDVLCVQYPGRQDRRTEPLLDSVPALADKVYEALLPWTDRPIALFGHSMGASL
                     AYEIARRLEQERGITPATLIASGRRAPSTHRDETVHLRDDDGLVAEMRGLSGTDPQLL
                     GDEDVLRMILPAIRADYRAAETYTWEPGPPLTCPVTCLVGDDDPKVTVEEAAAWSGHT
                     DGPFMLRVFPGGHFFLARHQTEIVRLMATQLEVLDRP"
     CDS             complement(487512..489155)
                     /codon_start=1
                     /gene="pteG"
                     /locus_tag="SAVERM_408"
                     /old_locus_tag="SAV_408"
                     /product="putative cholesterol oxidase"
                     /protein_id="BAC68118.1"
                     /transl_table=11
                     /translation="MIAHQPLSRRRMLGVAALGAAALAGQTTITAAPRAAAATATSGS
                     GGTFVPAVVVGTGYGAAVSALRLGEAGVPTLMLEMGRLWNQPGPDGNVFSGMLKPDKR
                     SSWFKTRTEAPLGSFLWLDLANRDIEPYAGVLDRVNFDQMSVYLGRGVGGGSLVNGGM
                     AVTPRRSYFEEVLPQVDAEEMYTKYFPRANSTLRVNNIDKSWFEQTDWYSFARVSRRQ
                     ASNAGLSTTFVPNVYDWDYMRREADGAVPKSALAAEVIYGNNHGKVSLDKSYLAAALG
                     TGKVTIETLHQVKTIRQQNDGTYLLTVEQRDTGGKLLGTKEVSCRHLFLGAGSLGSTE
                     LLLRARETGTLPGLSPEVGGGWGPNGNIMTARANHMWNPTGTKQSSIPALGIDDWDNP
                     DTPVFAEIAPLPAGVETWVSLYLAITKNPERGTFVYDAAKDRADLRWTRDQNAPAIAA
                     AKSLFDRINKANATIYRYDLFGKQIKAFADDFCYHPLGGCVLGKATDDYGRVTGYKNL
                     YVTDGSLIPGSIGVNPFVTIAALAERNIERVIKQDIADS"
     CDS             complement(489621..490319)
                     /codon_start=1
                     /gene="pteF"
                     /locus_tag="SAVERM_409"
                     /old_locus_tag="SAV_409"
                     /product="putative LuxR-family transcriptional regulator"
                     /protein_id="BAC68119.1"
                     /transl_table=11
                     /translation="MTPLLTAFTAAHRPPNLFRPSFLTGGTLLLIPAPATPGLCMASL
                     DKTLTIQQANQEFFRQFNGSSEDICGRNFRDVVHPSVQQPLVRQFSNLLEGKNHRFVT
                     PVIAVGPGEESAFTVPLTAVAVRGGLPDTTAILVMMPTAGDAEQTRVVPKRKKILSTM
                     DARILEGIAAGVSTVPLAASLYLSRQGVEYHVTCLLRKLKVSNRAALVSRAYSLGVFK
                     VGTWPPEVVDDFVK"
     CDS             490599..494192
                     /codon_start=1
                     /gene="pteR"
                     /locus_tag="SAVERM_410"
                     /old_locus_tag="SAV_410"
                     /product="DnrI/RedD/AfsR-family transcriptional regulator"
                     /protein_id="BAC68120.2"
                     /transl_table=11
                     /translation="MPLPPTANASATTTGQAELQLSVLGPMSARLNGHDLPLGPPRRR
                     TLLALLLIRLGRVVPTELLVEELWGDGAPRHAVATLQSYVSHLRRSLHTKAGTGQISV
                     LRHRTPGYVLDLDPEQVDAWRFERLVTDGRRLLEQRDPRTAHARLTEALGLWHGSPYA
                     EFDSHPPLSDECTRLEQIRLTAVESRAEARLALGAAEEVAADLDGEARRHPTRERLVG
                     HLMTALSRLGRQAEALEVYERTRSHLVEEFGVDTAAELRRVRNAILRPGPGASAPSKK
                     LSPTPLESTRASPVPLAMNESGDDGVQNSEGFVGSWDGRTAVTPRRHGTTVETNDANG
                     TDDADAAVEREGITGTGARPEARTDVPPGTRADAAGTQAGTAQWRPAPGPEHELAATP
                     EAGKSPESESGWTAAPSPFTGRSQELDRLTTAAASAVVGHGHVAGVLGPPGVGKTRLL
                     LELAARLESMEAPEKGSRLEVVWSHCFPGEGVPAYWLWTQILRRLSATRPDAFRDATE
                     PFGALLAPLMPERSAARTEGPKGASDWFQARFLAHDAVCEVLLALAGQHPLVLFLEDL
                     QWADTASLDLLRLLSTRCQGHPLSIVLTTRKFEAESDATLRRMVSDVLRGPRTETLQL
                     CGLSLQAVGALVEAHAGSGVDPKVVEVLHRRSGGNPYLVMQLLSLVGDARKLRRPDAV
                     DALLAHIPTGVREALRQRFAGLPEPVLRVLRLCAVIGAEVDTDLLHRTATRDEPVIAG
                     LESAIRAGLLGEDPHHPGRLHFAHALVQETLVDELPREDRHRLHARVADALSARRRGQ
                     VQDEEIERVAHHSWHARSALPAAEVLPRLLLAAEHAEQSMAYEQVEIWLRRAVHLVGF
                     LPPDDPATGRLEQDLHIQLGQVLATTRGYGHPEAETALTRGRALSTAAHAPEDPSVLW
                     ALCTAYLVTGRYDASRQFSGLLRDISRQTWEPVAALGATYGEGIVLHVRGMLPQALAE
                     LERGVGIADRFANKDHGLSRTFQHDPRVSCRSYNTFTHWLLGHRQTAGARRRELLSLT
                     RYESRPSDRSFALYVDGVVAAWEGDTRTALASSDEGARVAGEHGLVYWKAMLGVVKGW
                     GLAHAGDHEDGLALMHTSLAELGQSKTHIRHPLHLGLLGQAQHHGGRIEEARTTFRKL
                     LAAVEQRRERVYLHPALPATPLLHELLGHGADEALTDRGPGRDGPNSGRRA"
     CDS             complement(494248..494442)
                     /codon_start=1
                     /gene="pteE"
                     /locus_tag="SAVERM_411"
                     /old_locus_tag="SAV_411"
                     /product="ferredoxin"
                     /protein_id="BAC68121.1"
                     /transl_table=11
                     /translation="MRITIDRDRCIGSGQCAMTAPGVFTQDDDALVALVPGHEDGAGD
                     PRVHDVPMACPVQAVAIFED"
     CDS             complement(494487..495701)
                     /codon_start=1
                     /gene="pteD"
                     /locus_tag="SAVERM_412"
                     /old_locus_tag="SAV_412"
                     /product="cytochrome P450 hydroxylase"
                     /protein_id="BAC68122.2"
                     /transl_table=11
                     /translation="MTETEIRLTGSPAPSFPQDRTCPYQPPKAYEERRGESPLTQVTL
                     FDGRPAWLITGHAEGRALLVDPRLSSDWGHPDFPVVVRRTEDRGGLAFPLIGVDDPVH
                     ARQRRMLIPSFGVKRMNAIRPRLQSLVDRLLDDMLAKGPGADLVSAFALPVPSVAICE
                     LLGVPYGDHDFFEECSRNFVGAATSAEADAAFGELYTYLHGLVGRKQAEPEDGLLDEL
                     IARQLEEGDLDHDEVVMIALVLLVAGHETTVNAIALGALTLIQHPEQIDVLLRDPGAV
                     SGVVEELLRFTSVSDHIVRMAKEDIEVGGATIKAGDAVLVSITLMNRDAKAYENPDIF
                     DARRNARHHVGFGHGIHQCLGQNLARAELEIALGGLFARIPGLRLAVPLDEVPIKAGH
                     DAQGPIELPVVW"
     CDS             complement(496283..497482)
                     /codon_start=1
                     /gene="pteC"
                     /locus_tag="SAVERM_413"
                     /old_locus_tag="SAV_413"
                     /product="cytochrome P450 hydroxylase"
                     /protein_id="BAC68123.1"
                     /transl_table=11
                     /translation="MPEPTADAPTVPKARSCPFLPPDGIADIRAAAPVTRATFTSGHE
                     AWLVTGYEEVRALLRDSSFSVQVPHALHTQDGVVTQKPGRGSLLWQDEPEHTSDRKLL
                     AKEFTVRRMQALRPNIQRIVDEHLDAIEARGGPVDLVKTFANAVPSMVISDLFGVPVE
                     RRAEFQDIAEAMMRVDQDAAATEAAGMRLGGLLYQLVQERRANPGDDLISALITTEDP
                     DGVVDDMFLMNAAGTLLIAAHDTTACMIGLGTALLLDSPDQLALLREDPSLVGNAVEE
                     LLRYLTIGQFGGERVATRDVELGGVRIAKGEQVVAHVLAADFDPAFVEEPERFDITRR
                     PAPHLAFGFGAHQCIGQQLARIELQIVFETLFRRLPGLRLAKPVEELRFRHDMVFYGV
                     HELPVTW"
     CDS             complement(497529..498785)
                     /codon_start=1
                     /gene="pteB"
                     /locus_tag="SAVERM_414"
                     /old_locus_tag="SAV_414"
                     /product="putative dehydrogenase"
                     /protein_id="BAC68124.1"
                     /transl_table=11
                     /translation="MTKALYEIGETPPLGEVPRQMYASVIRQNRFGEPKQAFRTEVVD
                     TPAVGRGQVLVYVMAAGINYNNVWSSLGEPVDVIGMRQRQGQPEDFHIGGSEASGVVW
                     AVGEGVRSVTVGDHVLLTSGQWDEAAADIRMGTDPLVSESIKAWGYETNYGSFAQFCR
                     VDEYQCHPKPAHLSWEESAAFLLTGPTAYRQLFGWQGNTVRPGDPVLIWGGAGGLGSM
                     AIQLVRLAGGIPIAVVSSEDRSEYCRRLGAAGTVNRRDFDHWGRLPDAGDAEASARFL
                     RGARGVGKKVWEILGERKSPRIVLEHSGQDSLPTSMYLCDNAGMVVICGGTSGYNGDV
                     DLRHLWMRSKRLQGSHYADTRQCREVINLVGAGMLDPCLSVCDGFQDIGRMHQMMHDN
                     VHPPGNMAVLVNAPRRGEIALELAAA"
     CDS             complement(498846..508904)
                     /codon_start=1
                     /gene="pteA5"
                     /locus_tag="SAVERM_415"
                     /old_locus_tag="SAV_415"
                     /product="modular polyketide synthase"
                     /protein_id="BAC68125.1"
                     /transl_table=11
                     /translation="MSSKEDRLLEYLKRVTGDLRQVRERLREVEEKDDDPIAIVGMAC
                     RYPGGVRSPEDLWHLVAAGGDAVGDFPADRGWDVEGIYDPDPDARGKTYARRGGFLYE
                     AGEFDPGFFGISPREAVAMDPQQRLLLETTWETFERAGIDAESVRGSRTGVFVGSGYQ
                     DYVNLLVGVGGESDGHLGTGNSASVMSGRIAYTFGLEGPAVTVDTACSSSLVALHWAI
                     QALRNGECSMALAGGVQVMTTPTAFVEFSRQRGLAPDGRCKAFGAGADGTGWAEGVGM
                     LLVERLSDAVRNGHEVLAVVRGSAVNQDGASNGLTAPNGPAQQRVIRQALASAGLSPA
                     QIDVVEAHGTGTTLGDPIEAQALLATYGRERTEDRPLWLGSLKSNIGHSQAAAGVGGI
                     IKMVMAMRHGVLPQTLHVDEPTPHVDWSAGAVRLLTEAVEWPETHHPRRAAVSSFGVS
                     GTNAHTIIEQAPPAQDEGPAGALVDGPLAWVLSARSDAALRAQAARLRPSARGEVRPQ
                     DIGLSLATTRAAMRHRAAVVGDNREELLSGLEDLATGTPSSRVLLGRPAGGKTGFLFS
                     GQGSQRIGMGRELYAAYPVFAAAYDEVCAHLDAPVDVDAETLHRTGGTQPALFAVEVA
                     LFRLLESLGVRPDFVVGHSVGEIAAAHVAGALSLDDAAKLVSARAALMQALPAGGAMV
                     AVQATEEEVLPHLTDGVSIAAVNGPSSVVVSGDETAALAIAAGFAEQGRKTSRLKVSH
                     AFHSPLMDPMLAEFAEVVRGLAFEQPQLPVVSNLTGQPVEAYTPEYWVRHVRETVRFA
                     DSVRTLHDLGVKTFIEIGPGGVLSGMAQGCADDIVTVPVLRADRPERQAVVTALAHLH
                     THGVSVDWHSFFAGARRTDLPTYAFQREWYWVDAPESAAAEADPVDAEFWETVERGDL
                     QALAETLDIGAGDTFGDVLPRLSSWRRQRKEQSTVDDRRYRESWKRLGELGPAGIGGT
                     WLLAVPAEENEQTAAVRTALTARGATLKTLVVDAASHRAGLAGELAGIGPVDGVLSLL
                     VNGDPVLPTLLLVQALGDAGVDAPLWCLTSGAVAVSGSDAVRDARHAQVWGLGRTVAL
                     ELPRRWGGLIDLPESVDDQAAVRLADVLEQALTGRWEEDQLAVRASGVFARRLAHAPA
                     RAATRRWQPRGTVLITGGTGALGGHVARWLARGGAEHLVLTSRRGADAPGAAALRDEL
                     EVLGARVTFAACDVADRDAVAALLAQHVFTAVVHAAGVADAGTVDATTPAAFAAALAA
                     KVGGAAHLDELLGDQELDAFVLFSSISGVWGSGGQAAYAAGNAFLDGLARQRRDRGLT
                     ATAVSWGPWADGGMVADGDDEERLRRRGLRAMTPASAITSLQRALDRDETLLTVADVD
                     WSRFIVPFTLGRPSPLLGDLPEVRAALAVDTPAAGHGSGALAESLAALSHQDRARALV
                     DLVRTHAAAVLGHRGAGAVEADRPFRDIGFDSLTAVELRNRINKATGLSLPATLIFDH
                     PTAADLAAHLLAELTGGQHEAVAAAATAAVLDEPIAIIGMACRYPGGVRSPEDLWELV
                     ASGRDAISRFPGNRGWDVEALYHPDPDHPGTTYTTQGGFLHDADEFDPAVFGISPREA
                     VAMDPQQRLLLDTTWEAFERARIAPHAMRSTTTGVFVGSGYQDYTGRPLKVPDGVEGY
                     IPSGNAASVISGRLSYTFGLQGPSVTVDTACSSSLTALHLAMQALRGGECSMALAGGV
                     MVMAGPSAFTMSSRQRALSADGRCKAFSSSADGTGFAEGVGLVLLERLSDARRNGHEV
                     LAVVRGSAVNQDGASNGLTAPSGKAQQQVIRQALANARLAPDEVDAVEAHGTGTRLGD
                     PIEAQALLATYGKERSEGRPLWLGSLKSNIGHTQAAAGVGGVIKMVMAIRNGILPQTL
                     HVDEPTPHVDWAGGNVRLLTEQTAWPDQDRPRRAAVSSFGMSGTNVHTIIEQAPQTAT
                     AAEVEQPPAAQDATAAQPLDVFPWALSAKTDRSLREQARRLLNHLDRTEGLTLPDVGR
                     ALVTTRTQLEQRAVVVGQDRHELRAGLAALADGKPADTVVQGTASASGKVAFVFPGHG
                     SQWTEMARELLDTSPVFAEQAKACAEAFAPYLDWPLLDVLRAEPDAPDVADVEVAQPA
                     LFTVMVSLAALWRSYGVTPAAVVGHSQGEVAAAYVAGALTLDDAARIVALRSRSLTKL
                     IGKGAMLAIAMPAERVRARLEKYGDRLSVAAVNGPAALTVSGEPDAVDELLAELEAEG
                     VRVRKVRGATGAGHSTQVESLRPELLHLLAPVAPGAAEVPYYSTVTGTVLDTTTLDAE
                     YWYRNARHTVEFEWTVRTLLADGHGVFVECSPHPLLADAVQEIAEETGADAVTGSSLR
                     RGQGGMDRFLRSVSELHVSGVHVDLTAPFAGRPVRRVDLPTYAFQPQRYWLESADPVP
                     AGTDPVEAGFWELVENTDLSGLADELGADDAALVGPALPVLSAWRRRSREKSTVDGWR
                     YRVSFRRLTDHAAPGLNGLWLAVLPAGLADEQWAPCVVGVLAAHGAKVRVVELPVDCD
                     RSQAAKRLAEELRGEQPAGVLSMLGLAPGCHPAHPTLSASLATTVTLLQALGDVDVQA
                     PLWCATRGAVSTGVTDPLRDAGQAQLWGLGVVAALELPRRWGGLVDLPEELDEHALRR
                     LAGVLAQHDEDQLAVRVDGVYGRRMVRARPADEESATPWKPRGTVLITGGTGGVGRHL
                     ARWLAGAGAQHLVLTSRSGPDAPGAQELHAELTALGAEVTIAACDMADRAAVARLLAG
                     IESRHPLTAVLHAAGTARSSMLADAGLDEFAEAAASKVTGAIHLDELLDGRELDAFVL
                     FASGAGVWGSGGQASYASANAFLDALALRRRARGLTATSVAWGGWAGGGMVDDAVQER
                     GERRGLGVMAPELAISALREAVEHDEAALTVAPIDWEKFLPAFTVGRPSPLLADLPDV
                     QRLLEAEQAVGEGTSAGAALATELAALAPVEQEERLLEHVRAQSAVVLGHASAEDVLP
                     TAHFLELGFDSLTAIDLRRRLSAATGLRLPSGLAFDHPTPARLAKHLLTRLQSTGSAA
                     AEERPADMLVQLYRHASENGTAAEAMGMLMEAARFRPSFERPEELDRRPAPVRLSQGD
                     HPLALMCFSPYVVPAGAHQYARFAAPFRDRLDVWALVHPGYEKGEPVPSDPDVVFRLH
                     AQTVRECAGGKPAVLLGYSSGGWIAHGVAAHLEAMGERPAAVVMVDSFSREVPFDHQV
                     LNAMAQAHSQRLDFMRSGGEQLTAMGRYMRLFDDWAAPQIAAPTLLVRASEPMLAGAG
                     DGDGRAAPPEHVDTIVEVTGNHYSMLEDHAGTTAAAVDSWLADAVTDASGPVAPADAT
                     TA"
     CDS             complement(508951..527388)
                     /codon_start=1
                     /gene="pteA4"
                     /locus_tag="SAVERM_416"
                     /old_locus_tag="SAV_416"
                     /product="modular polyketide synthase"
                     /protein_id="BAC68126.1"
                     /transl_table=11
                     /translation="MDLSQTRRQLGELEAKDTEPIAIVGMACRYPGGVASPEELWQLV
                     ASGGDGVSGFPTDRGWDLDTIYDPEPGRTGRTYVREGGFLYDAGEFDPAFFGISPREA
                     LVMDPQQRLLLQTSWEALERAGIDPVTARGTRAGVFVGTNGQDHAYLQRQGDSDSEAH
                     LVTANTAAVVSGRISYALGLEGPAVTVDTACSSSLVALHLAAQALRRGECSLALAGGV
                     TVMATPNTFIAFSAQRGLSPDGRCRAFSSTADGTGMSEGIGVLLLERLSDARRLGHEV
                     LAVIRGSAVNQDGASNGLTAPNGPSQERVIRQALENARLTASQVDAVEAHGTATTLGD
                     PIEAEALLATYGQEHSDDRPLWLGSIKSNIGHTQAAAGVAGVIKMVMAIRNGVLPQTL
                     DVDEPTAQVDWSAGGVKLLTEAVAWPESDHPRRAAVSSFGVSGTNAHTIIEQAPALDR
                     EPAAEPAGAPAAGALPWVLSAKSDAALRAQAERLLSFLEDGRSGGTGPGRSPADIGFS
                     LATTRTAWDRRAAVVGESLEELTEGVRALASGTPSAAVVRNAARHGDKTGFLFSGQGS
                     QRLGMGRELYDAFPVFAAAYDEIRAHLDVALDADAEQLNQTGCTQPALFAVEVALFRL
                     LESWGVRPDYVAGHSVGEIAAAHVAGVLSLGDAARLVSARAALMQALPAGGAMVAVQA
                     AEDEVVPHLTHGVGIAAINGPRSVVVSGAEDAVLAIVEVFTQQGCKTSRLMVSHAFHS
                     PLMDPVLEEFAEVVRGLTFSEPRIPVVANLTGRLAEAYTPEYWVRHVREAVRFADGIE
                     TLGELGVTTFVEIGPGGVLSALVQGCFDDGTDIVTVPSLRADRPEPYALVTALAELHV
                     SGAELDWHAFFPGARRVDLPTYAFQQQRYWLEAREAETATVDAVDAEFWASVESEDAQ
                     SLAATLGLNPEELDVVVPKLSAWRRRRREQSVVDGRRYQLAWQPLNGLSAGDLSGSTW
                     LFAAPEGDEWAGTVRTALAGRGAHLIPLTVGADADRASLTDELTRVAGEAGSLDGVLS
                     LLATDEIASPEHPALSQGFAQSVALAQALGDAGVDAPLWCATRGAAATGRSDDAPLSA
                     VQNQVWGLGRALALEHARRWGGLIDLPAAVDERAAGRIAAVLSQGADAADGQEDQVAV
                     RATGVFTARLAHARSGVGRPWSPRGTVLITGGTGALGGHVARWLAGAGAEHLVLTSRR
                     GADAPGATALKAELEELGARVTLAVCDVADRDALAALLAEHTFTSVFHAAGVEQFAPF
                     DELTPADFARTMAAKAHGAAHLDELLGDRELDAFVLFSSIAGVWGSGLQTAYAAGNAF
                     LDGLAARRRARGLTATAIAWGPWADGGMVTDADEAHLRRRGVVTLPAALAVTAVQRAL
                     DCDDTAVVVADIDWERFIGPFTFGRPSALLSELPEVRRAGAVTAAVTAAPADVGATPL
                     AARLAGLPEAERTHTLIDLVRAHVAAVLGHSSAAEVEPDRAFKALGFDSLTAVELRNK
                     VNTATGLALSPTLVFDYPNATALARFLQSELLGSQAVVEQEQHAAADDEPIAIVAMSC
                     HLPGGVDSPEALWDLVTSGGDAISEFPSNRGWDVEALYDPDPDRPGKTYARDGGFLYG
                     ATDFDAGFFGISPREALAMDPQQRLMLETSWEAFERAGIAPAQLRGSRTGVFVGMAYQ
                     GYGADVRRTPEGVEGHRLVGGASSVVSGRVAYTFGLEGPAVTIDTACSSSLVALHLAM
                     QSLRNGECTMALAGGVTVMAGPSVFVEFSRQRGLSPDGRCRAFGADADGTGWAEGVGM
                     LLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLTAPNGPAQQRVIHQSLASAGLAPR
                     DVDAVEAHGTGTRLGDPIEAQALLATYGQGRDGDRPLWLGSLKSNIGHTQAAAGVAGV
                     IKMVMAMRHGILPRTLHADEPTPHVDWSAGDVRLLTEAVDWPESDRPRRAAISSFGVS
                     GTNAHTIIEQAPATAELPPTPDSGALVPWVLSGKGEPALRAQAARLADHLDANDGWTA
                     SDIGLSLASRETFEDRAVLLAQGSDKLRQALTALAAGQPAANVTLGRARSEGKVGFLF
                     SGQGSQRIGMGRELYEAFPVFADAYDEVCARLEAPVDVDAETLHRTGCAQPALFAVEV
                     ALFRLLESWGVRPDYVAGHSVGEIAAAHVAGVLSLDDAVRLVSARAALMQALPVGGAM
                     VAVQATEEEVLPHLTDEVGIAAINGPRSMVLSGAGEAVTAIAEVFVGQGRKTSRLKVS
                     HAFHSPLMDPMLEEFAEVVRGLTFHQPQVPVVSNLTGRLAEPYSPEYWVRHVREAVRF
                     ADGIETLGELGVTTFVEIGPGGVLSGMVQDCVDEAVTVPVLRGDRPEQQAVVTALAEL
                     HVHGVSPDWQALFPGAHRVTLPTYAFQRERFWLDGEGDLAAAGTPTDAADSGFWDSVE
                     REDAESLAATLGVSADASLGAILPRLSAWRRQRREQSVVDGWRYRVTWKPLGALPQPG
                     ASGTWLLVVAGESEWTASVRTALDERGLELVTLVAGPGTDRGTLARELAGVGPVTGVL
                     SLLAEDESASAGDPGLSHGLAATLCLVQALGDVGVDVPLWCATRGAVATGRSDRVDRP
                     LQSQVWGFGRAAALEHPRRWGGLLDLPELLDARTAARVAAVLGQTAEDQVAVRASGVL
                     GRRLVRAARATGPAQGWSPRGTVLITGGTGALGGHVARWLAGAGAEHLVLTSRRGPAA
                     PGAAELVAELEELGAAATVVACDAADRDALRALLAQHPVNAVVHAAGVGDHVMIEDSD
                     PAGFAGSVAAKAAGATHLDELLAGQELDAFVMFSSGAGIWGGAGQGAYSAANAYLDAL
                     AEHRRAHGRTALAVSWGGWAEGGMAGVGDGEEMLRRRGLPPMRPALAISALQQALADG
                     ETALTVADFDWERFIGPFTVTRPSALFSDVPEAGRALEAPAPGGAEAGNALAAKLTGL
                     PAAEQDRTLVDLVRTHAAAVLGHDGTAAVEPGRAFNDLGFDSLSAVELRNKLTADTGL
                     KLPTTLVFDYPNATALARFLRAELLGSRGAARQEQRTAAVGDEPIAIVAMSCRLPGGV
                     GSPEDLWQLVTSGGDVISGFPEDRGWNVEALYDPDPGTPGKTYARDGGFLYDAGDFDA
                     ALFGISPREALAMDPQQRLLLEASWEAFERAGIDPASLKGSRTGVFVGMSYQGYGAGL
                     PQVPEGVEGHLLTGSAASVVSGRVAYSFGLEGPAVTVDTACSSSLVALHLAIQSLRNG
                     ESTMAVAGGVNVMAVPAAFVEFSRQRGLAPDGRCKAFGAGADGTGWAEGVGVVLVERL
                     SDAVRNGHEILAVVRGSAVNQDGASNGLTAPNGPAQQRVIRQALASAGLTEADVDAVE
                     AHGTGTALGDPIEAQALLATYGQERPEDRPLWLGSLKSNIGHAQAASGVAGVIKMVMA
                     MRHGVLPRTLHADEPTPHVDWSAGAVRLLTEAVGWPDTNRPRRAAISSFGVSGTNAHT
                     IIEQAPVAEPAAVAPVEVSSATVPWVLSGKSEAALRAQAERLLTLTADGAEPSLTDVG
                     FSLATTRAALEHRAAVVGADHGRIAEGLRALASGAPAPGAVLGRADAGQVGFLFSGQG
                     SQRIGMGRQLYEAFPVFAEAYDEVCAHLDRHLDRPLRDVAFGENGHEDGEELNRTAFT
                     QPALFAHEVAVHRLLESWGVRPDYLAGHSVGEIAAAHVAGALALEDAAALVTARAALM
                     QALPAGGAMIAVQATEDEVLPHLTDDAGIAAINGPQSVVVSGTEDAVAAVADFFAREG
                     RKISRLTVSHAFHSPLMDPVLEDFARVVGGLRFETPRTPVVSNLTGELIDAYTADYWV
                     RHVREAVRFADGIRTLGELGVTTFVETGPGAVLSAMAQGCLDGAVAVASARSGSPEPE
                     AITGALAQLHVHGVPVDWRAFFAGRGARRADLPTYAFQHQRYWLETTAPTAAAGTDAV
                     ETGFWETVEREDAQSLAATLELPVEQLDAVLPRLSAWRRQQRRESAVEGWSYRTGWKP
                     LSGLRAHELRGNWLFLVTEDTEAFEAFEWTAAVADGLAARGARLVRVTVDPAADRGAL
                     LRQLGEAVRESPLDGVISLLGIDERHHAGHPALSVGTVLTLALVQALGDAGIDAPLWA
                     LTRSAMSTGRADAVPSAAQNAVWGLGRVAALEHAPRWGGLIDLPDTVDDRIAGRLAAV
                     LAQSAEDQVAIRDRGVFGRRLSHTAARRNTRAAQGWSPRGTVLITGGTGALGGHVARW
                     LAGAGAEHLVLTSRRGPDAPGAAGLVAELEATGVRVTVAACDVADREALAALLAEHPV
                     NAVVHTAGVDHMEPLEAMTPGACADVLSAKAAGALHLDALLAGQELDAFVLFSSIAGV
                     WGSGHQAAYAAANALLDGLAERRRAQGLPATAVAWGPWAGGGMAEADGADERLRRRGL
                     IPMPAALAVAGLRRALDSGEATATVADVDWERFLPPFTVGRPSALLGDLPEAERILTA
                     DSTAGGPGTAAASPLADRLARMPETEQHALLVDLVRTHAAAVLGHNNAGEVEADRAFK
                     DLGFDSLTAVELRNKLKAETGLALPPTLVFDHPNAQALARQLRTELTGLTIAAAPEAA
                     AAPAEDEEPIAIVGMACRYPGGVRSPEDLWHLVAAGGDAVGDFPADRGWDVEDIYDPD
                     PDARGKTYARRGGFLYEAGEFDPGFFGISPREAVAMDPQQRLLLETTWETFERAGIDA
                     ESVRGSRTGVFVGSGYQDYAARAFNAIDDSEGFFGTGNSASIMSGRIAYTFGLEGPAV
                     TVDTACSSSLVALHWAIQALRNGECSMALAGGVMVMSTPRAFVEFSRQRGLAPDGRCK
                     AFGADADGTGWAEGVGMLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLTAPNGPA
                     QQRVIRQALTSAGLTAADIDAVEAHGTGTRLGDPIEAQALLATYGQERPAGQPLWLGS
                     LKSNIGHTQAAAGVAGVIKMVMAMRHGVLPQTLHVDEPTPHVDWSAGDVRLLTEAVAW
                     PESERPRRAAVSSFGVSGTNAHTIIEQAPPVPAEEATVTPAPALLPWVLSAKSSAALR
                     DQARRLLAFVEDGMSLADVGFSLATTRSALRHRAAVIGESGDGFRRGLGSLAAGMPSP
                     GVVQGRPGGKVGFLFSGQGSQRIGMGRELYEAFPVFADAYDEVCARLEAPVDVDAETL
                     HRTGCAQPALFAVEVALFRLLESWGVRPDYVAGHSVGEIAAVHVAGVLSLDDAVKLVS
                     ARAALMQALPAGGAMVAVQATEDEVLPHLTDGVGMAAINGPRSVVVSGAEDAVLEIAE
                     VFTRQGRKTSRLKVSHAFHSPLMDPMLEEFAEVVRGLTFHQPQVPVVSNLTGRLAEPY
                     SPEYWVRHVREAVRFADGIETLGELGVTTFVEIGPGGVLSGMVQDCVDEAVTVPVLRG
                     DRPEQQAVVTALAHLHTHGMSVDWNVFFAGARKADLPTYAFQHEPYWVDAPQIAAAAE
                     AEPVDAEFWETVERGDLQALAETLGVGAGDKFGDVLPRLSSWRRQRKEQSTVDTWRYG
                     ESWKGIPDRVPEGPARIGLWLVPVSAAQLGDDWVTACLRGLTERGLAPLPVPVEPATG
                     REDLAAQLTRAAGDETVAGVLSLLAVDCGAAPAAAALTVGVALSVLLVQALGDAGIGA
                     PLWCVTRNAVGVSTADEATDPYQSQVWGLGRVAALEHAPRWGGLIDLPDTVDDRIAGR
                     LAAVLGQSAEDQVAIRDRGLFVRRLSRLPAALSERSWSPRGTVLITGGTGALGGHVAR
                     WLAGAGAEHLVLTSRRGPAAPGAAGLKAELEEAGVRVTVAACDVADREALAVLLAEHP
                     VNAVVHTAGTAEAGMLAETSLGDFAATVAAKALGAVHLHELLGDQELDAFVLFSSISG
                     VWGGGGQAAYSAANAFLDGLAQHRRARGLAATAIAWGPWGEGGMVADAGDEERLRQRG
                     LSVLRPDRAISALHGALSGGDGTVTVADVDWERFVVPFTIGRPSALLSDLPEVGDALA
                     EKRTERAAEPSALKAKLSTLSEGERQRLLVDTVCAHAAAVLGHSGSAAVDPDLAFRDL
                     GFDSLTAVELRNLLSADTGLTLPATLVFDHPTPEAIARYLRSELADETGPEEVSVFSE
                     LDRLESVISTAASAEQTVRSGVRRRLQELLSLVNSAGEQGAESADAQRQLQDATIDDI
                     FDLIDQDLEIS"
     CDS             complement(527468..532975)
                     /codon_start=1
                     /gene="pteA3"
                     /locus_tag="SAVERM_417"
                     /old_locus_tag="SAV_417"
                     /product="modular polyketide synthase"
                     /protein_id="BAC68127.1"
                     /transl_table=11
                     /translation="MNEDKLRDYLKRTTTDLRQARRRVRELEARAQEPIAIVGMSCRF
                     PGGVGSPEELWRLLAEGEDAISQFPVDRGWDVDALYDPDPEQPGKVYTRQGGFLHDAA
                     DFDAEFFGISPREALAMDPQQRLLLEAAWEAFEHAGIDPAGLKGSRTGVFAGLMYHDY
                     GFTPGVLPEGVEGLMSTGNSGSVASGRIAYTFGFEGPAVTVDTACSSSLVALHLAVQA
                     LRTGECSMALAGGVTVMAGPSAFVEFSRQRGLAPDGRCKSFAAAADGASWSEGTGLLL
                     VERLRDARRLGHKVLAVVRGSAVNQDGASNGLTAPNGPSQQRVILEALAGARLSAEEV
                     DAVEAHGTGTSLGDPIEAQALLATYGQERERPLLLGSLKSNIGHTQAAAGVAGVIKMV
                     LAMQHGVLPKTLHVDRPTPRVDWSVGSVDLLTEAIAWPETDHPRRAGVSSFGISGTNA
                     HIILEQAPEPEAGDPADDTAEGEGVAEELLRARTTVVPWVLSAKNGAALREQAQRLLS
                     SVDLAAASPADVGFSLAATRSALEHRAAVVGADGEELRAILTALAAGEPAAQVVTGRA
                     GADRGKVGFLFSGQGSQRIGMGRELYEAYPVFAAAYNEVCALLDLPVDVDAETLHQTG
                     STQPALFAMEVALFRLLESWAIRPDYVAGHSVGEIAAAHVAGVLSLGDAARLVSVRAA
                     LMQALPAGGAMVAVQAAEDEVLPYLTGEVGIAAINGPQSVVVSGAEDAVMAVAEVFAA
                     QGRKTSRLKVSHAFHSPLMDPMLEEFAAVVRGLTFGEPRIPVVSNLTGRLAEPYTPEH
                     WVRHVREAVRFADGVRTLHELGVTTFVEVGPGGVLSALAQGCLDDADIVTVPALRTDR
                     PEPQALTLAVGQLHTRGVSPDWQALFPGALRVDLPTYAFQRERYWLKGTTAVDVSSAG
                     LDSSGHALLGAVVETAGAQDVLFTGRLSPADLPWIAEHTVGGVPVLPVAAFVELALSA
                     GRQAGFPYLEQLDVDAPLVLAEQGAVRIQVQIGADDDPDRRSVRVFSRPAAGSSGEPW
                     VRHVTGKLTRNAPAPEFDQMIWPPTGAEPGDVEGRPGLRAAWRAGDELYAEAELPVTE
                     RDRADRYALHPVLLDAALGMATSDRAADPGEVLMPHAWSGMSVHTPGPGAVRIRIRPV
                     GDDAVAIELSDADGSPVASVASVRTRTMTAQQVLASRVAHQDWMFEIDWVEHTAASAP
                     ATAAVADWAVLGDEGVHSDIDALRKAVDGGAATPAHVLLPCAPSEGDAAAATRGALAG
                     VLSVVQEWVADERFSDARLVVMTRGAVELDGTALDLAHVAVSGLVKSAQTEHPDRLLL
                     VDADDSVTNGGTVTDGGVDPALAAALAALDEPQAAVRDGKLYVPRLARITPPEEPTGH
                     AWDPEGTVLLTGATGGLGRSLARHLVAERGARRLLLASRRGPAAEGVGELVAALSELG
                     AHVDVAACDIADRDALAELLASVPAEHPLVAVVHAAAALDDGVITALTPGRLDTVLRP
                     KADGALHLHELTRDLNLSAFVLFSSLAGVLGSAGAAGYAAANAFLDGLARQRRAAGLP
                     GTSLAWGLWTDNGGMGDRITDADRNRMGRAGVVPFSPAEGLALFDAALTVDRPVIVPV
                     RLDVPGLRAMARAGMLPAVLRGLVGDTGAAAGEAAAAGTTALARRLAGIPEADQEKVM
                     LDLVRHQAAAALGHATAARIEPTTAFRDIGFDSLTAVELRNRLKAATGLRLKPTLVFD
                     HPNPVAIARLLHKDLVLDLTAEAPPVLGELDRLEAQLAALAPQDAVRDKITARLKALL
                     WKWTDTHQDAAANTADDGHGTDRDFDLDLDRIDAATDDEMFDLIDQELGSH"
     CDS             complement(533011..543705)
                     /codon_start=1
                     /gene="pteA2"
                     /locus_tag="SAVERM_418"
                     /old_locus_tag="SAV_418"
                     /product="modular polyketide synthase"
                     /protein_id="BAC68128.1"
                     /transl_table=11
                     /translation="MANEDKLRHFLKRVTADLQETRRRLRDYEDAAGEPVAIIGMSCR
                     YPGGVDSPEDLWELVAGGRDAVSEFPADRGWDLDALYDPDPESRGTSYAREGAFLRDL
                     ARFDAGLFGISPREALAMDPQQRLLLETSWELFERAGIDAASLAGSRTGVFAGVMNHE
                     FLAALQNSPQDLEGYLGTGTSGSVASGRVAYTFGLEGPAVTVDTACSSSLVALHLAVQ
                     SLRNGECSLAVAGGVTAMVGPATFVGFSRQRGLAPDGRCKPFAAGADGTGWGEGAGLL
                     LVERLSDARRNGHEVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALAAAQLTTAQ
                     VDAVEAHGTGTRLGDPIEAQALLATYGQGRPDDKPLWLGSIKSNIGHTQAAAGVAGII
                     KMVMAMRHGELPRTLHVDAPSVHVDWTAGAVRLLTERTPWSASDQPRRAGISSFGISG
                     TNAHTIIEEAPSAEAFAQDTGAPEGPEEGAESAEPVASEAARPAAGGPVPWVISGRTE
                     EALRAQAERLLSRTDAEVPPLDVAFSLATTRTALEHRAVLQGETPAELAEGLRAVASG
                     SPARGVARGLSGTGGRVGFLFSGQGSQRLGMGRELYASYPAFAAAYDEVCAQLDAVVD
                     VDSEELHRTGAAQPALFAVEVALFRLLESWGIRADYVAGHSVGELAAAHVAGVLSLDD
                     AAKLVSARARLMQALPAGGAMVAVQATEDEVLPHLTDAVGIAAINGPRSVVVSGAEDA
                     VTAIAEAFRQQGRKSSRLKVSHAFHSPLMDPILEEFAEVVRSLTFHRPQIPVVSNLTG
                     RLAEPYTPQYWVRHVREAVRFADGVRTLNDLGVTTFVEIGPGGVLSALAEGCLDDDVV
                     TVPALRADRPERVALVAAVSELHAHGVSPDWHAFFPGARRVDLPTYAFQYERYWLDAS
                     PAAPGGVRAAGLGSADHPLLGAAVSLAGGDERLLTGRLSLRTHPWLSDHAVLGTALLP
                     GTAFVELAVRAADEAGCALLEDLTLEAPLVVPEQGGVAVQVWVGAVDGTGRRPLTVHS
                     RPEDDSDLPWVRHATGFVTEGSEEAGAAAADRTLTAWPPTGSEPVDLDGFYDRLAALG
                     LAYGPAFRGLRSAWRTGEDVFAEVALPDGTDTGSFLLHPALLDAALHAIGAGGADGSL
                     VAEADGPLLPFAWSRVSVRATGASTLRVRLAPAGTDAVSLLVADGAGEPVASVESLTL
                     RAVSAERLRKRSGDAMFTVERAPLTLPSDDADGTAVAYVPDLAALAEADGPSQPDVVV
                     VPCPDGPEGATEAERVRAVSTDVLRLVQRWFAEDRTPRLVLMARCDDLAHAAAGGLVR
                     SAQAENPGRIVLLETDRPDEAAALVPGVVLSGEPHVVVREGEVSAPRLARAASLATED
                     AVTGRADEAASALVEGAASRLGTVLLTGAAGALGKTLARHLVTGHGVRRLLLVSRRGA
                     DAPGAADLKAELAALGAEATWAACDLAERDALARLLAATPVDSVVHTAGVLDDGVIAA
                     LTPERVGAVLAPKADAVLNLDELTGPSTTFVLFSSAAGVFGNPGQGNYAAANAFLDAF
                     ARHRHAQGRPTVSLAWGLWEQEGAMADALDEAGRSRMARSGVLPLPTEDGLRLFDAAL
                     ASNEPVLVPVRLDTAALRNRAAETVPALLRGLVRVSLRGTAQRAAAGSLAERLAGLAA
                     DERDEALLELVRGEVAAVLGHSSSRAVQPTYAFQDLGFDSLTAVELRNRLATATGLRL
                     PATLVFDHPTPAALARHIGTELLGEAPAVTARAAARQTATAADEPIAIVGMSCRLPGG
                     VRSPEDLWRLVASGRDGITRFPDNRGWDVDGLYDPDPERLGKTYARDGGFLHEAAEFD
                     AGFFGISPREALAMDPQQRLLLEASWEAFERAGIDPATIRGSRTGVFTGLMYHDYGQG
                     PRQLPEGVEGLLTTGGSGSVASGRVSYTFGLEGPAVTIDTACSSSLVALHLAVQSLRN
                     GECTMALAGGVTVMAGPTVFVEFSRQRGLSPDGRCKAFAAGADGTGWGEGVGLLLVER
                     LSDAERNGHRVLAVVRGSAVNQDGASNGLTAPNGPAQQRVIRQALASAGLKPADVDAV
                     EAHGTGTTLGDPIEAQALLATYGQERPAGQPLWLGSLKSNIGHTQAAAGVAGVIKMVM
                     AMRHGVLPQTLHVDEPTPHVDWSAGDVRLLTEAVAWPDSDRPRRAAVSSFGVSGTNAH
                     TIIEQAPTTEELPLTSDSGAAVPWVLSGRTEAALQAQAAGLVSFLDDHDGDNDRDDVG
                     EAAFAADVAYSLATTRAAFEHRAVVVGQTLQELRQGLAGVAGGATPPGVVTGTAHTGG
                     KTVFVFPGQGSQWVGMAAKLLETSPVFRDRIDACERALAPHVDWSLTAVLRGTSEVEQ
                     DRVDVLQPVLWAMTVALAEVWRSFGVTPDAVVGHSQGEVSAAVIAGAISLEDGARVVV
                     RRSLAVRELQGRGAMASVTLPDEKARELVGRWTGRLGIAAVNGPATVVVSGDTDALDE
                     FLAHCQQDAIQARRVAVDYAAHSPQIERVEAQASEGFAGISPLPGSVPFYSTVTGGKL
                     AADELGSGYWYRNMRQTVRFHDAIRAALADGHDVFVEVSPHPVQLAGIQDAIEAADAD
                     AAVVPTLRRRDGGRNRLMLALAQALVHGVAIDWDAVLPGARRVDLPTYAFQHERYWLE
                     AGAPAGDVRAAGLDAADHPFLGAAVELPDAGGHLLTGLLSLQAQPWLADHAVLGTVLL
                     PGTAFVELAAHAAAETGCDLVEELTLQAPLVLPEHGGVALQVLVGAQDDSGRRPLSVH
                     SRAGDDGPWIRNATGVLAAGGAPSGTDLSNWPPADARPVDLDGFYDRMADLGLSYGPL
                     FQGLRAAWRGHDAVYAELAVPDLAQTDAFGVHPALLDSALHALGAGGLVPAADGPLLP
                     FAWSRVTVHGTGAAGLRVRLSQVGGDAVRLEAADGTGRPVVSVESLTLRPVSVEQLRP
                     SSRDSLFTVQWAPLAATADARTPVVQAYDGIAALLAAPTVETGAQADTDAVVVPCPGG
                     SGTDVERVRSVLAEVLWLVQWWQAEDRAARLVLVTRGAVAAGDESAQGDPVQAAVWGL
                     VRSAQSENPDRIVLLDTEQNADVEQVAATVVPRLVASEEPQAALRGDALLLPRLARAA
                     ADAPRATPDFGTGRVLLTGASGALGGLVARHLVAEHGLRSLLLMSRRGADAEGAAELQ
                     EELTAAGAEVLWAACDVADRDALAEVLSGTPVTAVVHTAGVLDDGVIGSLTPERMEMV
                     LRPKVDAVLNLHELAGDVSAFVLFSSLAGTLGTPGQANYAAANAFLDAFARRRRAQGL
                     PAVSLPWGLWQRTGTMTEDLGGADRTRLARGGVLPLSDEDGLELLDAALALQEPLVVA
                     ARLDLAALRNATAPVPPLLRALVGGRLRRTDRAAAVPLAQRIAGLPESEREEAVLDLV
                     RSEVAAVLGHSSAKTVQPDQAFGDLGFDSLTAVELRNRMNQATGLRLPATLVFDHPTP
                     AVLAQRVLKDLPGGTAGTAPVFDELDRLGAALDGAGADGIDNITRTKINMRLQALLAR
                     WNGNEPADPGGAGGAEDEDDLSSASDEELYELLDDELGIS"
     CDS             complement(543777..567017)
                     /codon_start=1
                     /gene="pteA1"
                     /locus_tag="SAVERM_419"
                     /old_locus_tag="SAV_419"
                     /product="modular polyketide synthase"
                     /protein_id="BAC68129.1"
                     /transl_table=11
                     /translation="MVESELNATGNRDCSASADSADGIAVIGLACRLPGAADPAAFWR
                     LLSEGADAITDVPPDRWDGAVVADASAPDRTGIRRGGFLDSIGDFDAGFFGLSPKEAA
                     AMDPQQRLVLELAWEALEDAHVRAATLRSTRTGVFVGAMWDDYATLHHRSGLTAISPH
                     TVTGLHRSIIANRVSYFLGLNGPSLTVDSGQSSSLVSVHLACESLRKGESTIALAGGV
                     NLNIVPESALGAAKFGGLSPDGRCFTFDARANGYVRGEGGGIVVLKPLARAVADGDPV
                     YCVIRGSAVNNDGGGDGLTVPLQSGQEQVLRLAYERAGVNPADVGYVELHGTGTKVGD
                     PIEAAALGAVLGTGREPGRPLRVGSAKTNVGHLEGAAGITGLLKAVLSLNHRELPASL
                     NFGTPNPAIPLDRLNLRVQTEHSEWAAEDGRPLLAGVSSFGMGGTNCHIVLASGAAVE
                     AGEGATAGGGAAPTFWPLSAKTASGLRAQAAALLAHTEAPLGLALPDVGWSLATGRTA
                     FEHRAVVVGEVRDDFLRALRELSTGGIDAALTTGRAGPRGELAFLFSGQGSQRAGMGR
                     ELAESVPAFASALDEVCAHLDPLLPRPLREVMFAPVGTGEAAELDQTLYTQTSLFAVE
                     VALFRLLESWDITPDVLMGHSIGELAAAHVAGVLSLADACALVAARGRLMQALPAGGA
                     MIAVQAAEDEVRARIGERTDRVSIAALNGPDSVVVSGDEDLATEIADAFAALGRKTSR
                     LRVSHAFHSPHMEPMLAEFRNVAEGLTFHAPRIPIVSNVTGRLSEEPSGYEGCTAAYW
                     VRHVREAVRFADGVARLDEQGVRTYLELGPGGVLASMARAGADSESLFVPALRTRRPE
                     AQALLAAVASLHVHGVEPDWDALFGGGRGARRKVALPTYAFERQRYWLDGDTTSPVAT
                     TGWAPVAPQPDAIAETDSAPVGALGRRLAGLAESERDEAVLDMVRAHIAAVLGHAEAR
                     QVETEWTFKDLGFDSLSSVELRNQLSEATGLRLPSGLLFDHPTPAALARHLAAQSLGG
                     GDAAAAAPATVADPHEPIAIVAMSCRLPGGVSSPEDLWRLLASGGDGISGFPTDRGWD
                     VETLYDPEPGTPGKSSTRHGGFLHEAAEFDAGFFGISPREAAAIDPQQRLVLETAWEA
                     FERAGIDPATLRGSRAGVFIGATAQDYGPRLHEPADGVEGYLLTGTTTSVASGRVAYS
                     FGLEGPAVTVDTACSSSLVALHLAVQSLRSGECTMALAGGVTVMSTPGMFVEFSRQRG
                     LSADGRCKAFAAGADGTGWAEGVGMLLVERLSDARRNGHQVLAVVRGSAVNQDGASNG
                     LTAPNGPSQQRVVRQALAAAGLAPADVDAVEAHGTGTLLGDPIEAEALIAAYGQGRDG
                     DRPLWLGSLKSNIGHTQAAAGVAGVIKMVMAMRHGVLPRTLHVDEPTPHVDWSASGVR
                     LLTEAVEWPARDLPRRAAVSSFGISGTNAHVIVEQAATSEEPARGTAVAGPVPWVVSA
                     KSDVALREQAGRLLSFLDAEGVGGAGVRPEDVALSLATSRAVLERRAAVVGGDLAELR
                     QGLEALASGASGAAPVGGAVGGRVGFLFSGQGSQRIGMGRELYAAYPVFAAAYDEVCA
                     FLDAPVDVDSEELNQTGTTQPALFAVEVALFRLLESWGIRPDYVAGHSVGEIAAAHVA
                     GVLSLEDAAKLVSARAALMQALPDGGAMVAVQATEDEVLRHLTDGVGIAAVNGPRSVV
                     VSGAEDAVTAVGEIFAGRGRKTSRLKVSHAFHSPLMDPMLEEFAAVVRGLTFSESRIP
                     VVSNLTGRLAEVYTPEYWVRHVREAVRFADGIETLGELGVTTFVEVGPGGVLSALAQG
                     CFDDGTDIVTVPVLRADRPEPYALVTAIGRLHTHGISPDWQVLFPGARRVDLPTYAFQ
                     RERYWLDAPRAATAGAPDAMDAEFWDSVESEDRASLGALLGLEPTELDVVASKLSAWR
                     RKRREQSTTDGWRYRITWQPLDDMVRAAPSGTWLYVVSEETAWTEAIRAGLTELGVAL
                     VPFAVGEDTDRDALARAFADAGQEQADGILFAAAQGEAGANALQRLVLLVQALGDAGI
                     EAPLWCLTSGAVSTGTADLLTDPVSAQLWGLGRIVALEQPQRWGGLVDLPAELDSRAL
                     ERLAGLLAQADEDQLAVRASGVYGRRLVRAPLSAAPADAPWSPRGTVLVTGGTGALGG
                     QVARWLAGAGAEHLVLTSRRGPDAPGAAELKAELEELGAQVTVVACDAADRDALAELF
                     GRYIVNAVVHTAGVLDDGLVESLTPERLNHVLRPKVDAALHLHELTRDRQDLDAFVLF
                     SSMTGVWGNGGQGAYGAANAFLDALAEHRRAQGVPALAVAWGSWADGGMADGAAGDHL
                     RRRGVRAIAALPAISVLHGALTHGETSMTVADVDWERFVPAFVGTRPCPLLLGVPEAR
                     EALEARARAAQSPEVPVSALVQRLLGATPGEQGRILLDLVREQAATVLGHTGKGAFEA
                     DRTFRETGFDSLTAVELRHRLNTATGLRLPTTLVFDHPTPTALARHLGEELLGRHGLE
                     TAAAQATAAAAADEPLAIVGMSCRLPGGVQSPEDLWELLSSGRDAMSGFPTDRGWDID
                     ALYDPDPDRPGKTYSREGGFIQGADRFDAGLFGISPREALAMDPQQRLLLETAWEAFE
                     RAGIALASVRASRTGVFIGTNGQDYANGLRNAPEEIEGYALTGKAASVVSGRISYTFG
                     LEGPAVTVDTACSSSLVALHLAAQALRSGECSMALVGGVTVMTTPDLFVEFSRQRGLS
                     PDGRCKAFAAGADGTGWGEGVGLLLVERLSDARRNGHQVLALVRGSAVNQDGASNGLT
                     APNGPSQQRVIRQALASAGLTPADVDAVEAHGTGTRLGDPIEAQALLATYGQEHSDDR
                     PVWLGSVKSNIGHTQAAAGVAGVIKMVLAMRHGVLPQTLHVDEPTAHVDWSAGAVRLL
                     TEPVQWPGTTGPRRAAVSSFGIGGTNAHTIIEEAPAAAAAEPAREHRPVPVPWVLSAK
                     SEVALRAQAERLLAFATDDVSPVDAGFSSATTRSALEHRAAVIGSDPAELRAGLEALA
                     AGEPAANVVAGRAHSADKVGFLFSGQGSQRLGMGRELYAAYPVFAAAYDEVCALLDAT
                     VDVDAETLHQTGSTQPALFAVEVALFRLLESWGIRPDYVAGHSVGEIAAAHVAGVLSL
                     EDAAKLVSARAALMKALPAGGVMVAVQAAEDEMLPHLIDRAGIAAINGPRSVVISGAE
                     DAVTAIAEVFAAQGRKTSRLKVSHAFHSPLMDPMLEEFAEVVRGLTFSEPWIPVVSNL
                     TGRLTESYTPEYWVRHVREAVRFADGVLTLHELGVTTFVEIGPGGVLSALVQGCLDDG
                     TDIVTIPALRADRPEPQALTTAYAQLHVSGAEVDWHAFFPGARRVELPTYAFQRERYW
                     LDAPASAGDMRAVGQGEAGHPLLGAAVPLADSVGHLLTGRLSKHTHPWLVDHAVSGVA
                     LLPGTAFVELAITAADAVGCDLLEELTLETPLLVPERGGVALQVHVGADDGSGRRPLT
                     VHSQIDDGDAYAHEDDSERAWVRHASGVLTVATGGPVDGSLTAWPPVGAEPVDVDGFY
                     DRLAGMALDYGPVFQGLRAAWRSGDDFFAEVELPGAERTDAGAYGLHPALFDAALHTV
                     WLGAVEPEAGTGNGLLPFAWSGVRLAAAGASDLRVKVSRAGTGTSTVSLVLADGTGGP
                     VAEVDSLTLRPVPADQLRAGSGSDDAVFGLKWTPVSLPSAPDGMRIETYEDLAALRAT
                     DPPADTEADAAAAADAVVVPCPTGTGADLATRVREVTHAVLELVQWWLAEERPGRLVL
                     VTRGGDLAQSAVCGLVRSAQTENPDRIVLVETSSDAHAGAGSGVDDADLARVLPGLIA
                     SGEPQAAVHADDEVRVPRLVRVAVPDAEPELPGLGSGTVLLTGASGGLGGLFARHLVA
                     EHGVRSLLLVSRRGGDAPGAAELTADLTAQGADVTWAACDVADRAAVRALLAGPGQSL
                     SAIIHTAGVLDDGIIGSLTPERLDAVFRPKVDAALNLHDLAGELSGDLSAFVLFSSVA
                     GTLGTPGQANYAAANTFLDALAEHRRAAGQRATSLAWGLWAQDSESAMTGSLDHTDLT
                     RIQRMGLAAIPSSDGLRLFDAALALDRAVVAPLRLDLGGLQGTVPPVLRGLRGTVRGT
                     ARRTAQTAPKGSLGQRLAGLAEAEREQVVLDLVRTEVAAVLGHAGAQSVGADDSFKDI
                     GFDSLTAVELRNRLNSAVGMRLPATLIFDYPNPLTLAHFLTGEAAGGEAATAVPTTLS
                     TATGTADEPIAIVGMACRYPGGVQSPEDLWQLVFSGRDAVSGFPEGRGWDVEQLYDPN
                     PDQWGTSYTREGGFLHDAADFDAEFFGISPREALAMDPQQRLLLETSWEAFERAGIDP
                     ATVRGSRTGVFAGVMYHDYGGRVHTSPPGLEGYLVNGSAGSIASGRVSYTFGLEGPAV
                     TVDTACSSSLVALHLAAQALRSGECSMALVGGVTVMAGPSVFVEFSRQRGLSADGRCK
                     AFGAGADGTGWAEGVGMLLVERLSDARRNGHKVLAVVRGTAVNQDGASNGLTAPNGPS
                     QQRVIRQALANAGLSSDEVDAVEAHGTGTRLGDPIEAQALIATYGQERSEDRPLWLGS
                     LKSNIGHSQAAAGVGGVIKMVMAMQHGVLPQTLHVDEPTPHVDWSAGAVQLLTEAVEW
                     PASDGPRRAAVSSFGVSGTNAHVIVEQAATSEVTARGTAVAGPVPWVLSAKSDAALRE
                     QAGRLLSFLDAEGVGGAGVRPEDVAYSLATSRAVLECRAAVVGEELGEFRQGLEGIVS
                     GAAPVGGAVGGRVGFLFSGQGSQRIGMGRELYAAYPVFAAAYDEVCALLDATVDVDAE
                     TLHQTGSTQPALFAVEVALFRLLESWGIRPDYVAGHSVGEIAAAHVAGVLSLEDAAKL
                     VSARAALMQALPAGGAMVAIQATEAEVLPHLTHGVGLAAINGPRSVVLSGSEDAVLDI
                     AEVFAQQGRKTSRLKVSHAFHSPLMDPMLEEFAEVVRGLTFSEPRIPVVSNLTGRLAE
                     VYIPEYWVRHVREAVRFADGLHTLHELGVTMFVEIGPGGVLSALVQGCLDDGTHIVTV
                     PALRADRPEPYALVTAVGQLHTHGISPEWQALFPGARRVDLPTYAFQRERYWLDAPQA
                     SGDVRAAGLGAADHPLLGAAIATADSDGAVLTGLLSLGTHPWLADHAVNGIVLLPGTA
                     FVELAIRAGDETGCGWIEDLTLELPLVVPERGGVTLQVAVGPEDESGRRQLSVHSRVD
                     DRSWLRHATGVLSSAEAPSAAKLGAWPPAGAEAVDLTAFYEGMAAAGLDYGPVFQGLR
                     SVWRDGDDVFAEVELPDESAAEAAAFALHPALLDAALHALAAGGLVSLDDSPALPFAW
                     SGVVVQAAGAAMVRVKLSRTATGSVTLAVADGAGDPVASVESLSLRAASAEQLPGAVG
                     GDQLFGLEWTRFTLPSATDALMIETVADFDALRESEGTPDVVVVPCPAGSGRETADRV
                     HSTTSEVLALVQWWLAEERAGRLALVTRPGDLAHAAVWGLVRSAQSENPDRIVLVEAE
                     ETDEAVRVLPAALASGEPQFAVRDGEVFVPRLVKATRSATGTATGTPDFGVGPVLLTG
                     ASGALGGLVARHLVAEHGVRSLLLLSRRGAEAPGAVELEAELAAWGAEVRWAACDAAD
                     RDALAEVLAGTPVTAVVHAAGVLDDGVIAALTPERMEKVLRPKTDAVLNLHELTSDLS
                     AFVVFSSVSGILGSAGQGNYAAANAFLDAFAEARRARGLPATSLAWGLWEQGSGMADR
                     LDQADLARLKRVGLAPIAVDEGLRLFDAALALDRAVVAPLRLDLGGLQGTVPPVLRGL
                     RGTVRGTARRMAQTAPKGSLGQRLAGLPQAEREQVVLDLVRAEVAAVLGHASAQAVQP
                     EHAFQDAGFDSLTSVELRNRLNAATGLRLPVTMVFDHPTPVALSRFLLAETLGVQEQA
                     EAAIAAVTGTDEAIAIVGMACRFPGDVRSPEDLWRLVASGGDAISGFPEDRGWDVENL
                     YDPDPDRSGKSYVRHGGFLHEAAEFDPAFFGISPREALAMDPQQRLLLETSWEAFERA
                     GIDPATVRGSRTGVFAGVMYHDYGGRVKTAPEGMDAYLGSGSAGSIASGRVSYTFGLE
                     GPAVTVDTACSSSLVALHLATQALRSGECSMALVGGVTVMATPSTFVEFSRQRGLSAD
                     GRCKAFAAGADGTGWAEGAGMLLVERLSDARRNGHTVLAVVRGTAVNQDGASNGLTAP
                     NGPSQQRVIRQALANAGVSSEQVDAVEAHGTGTKLGDPIEAQALIATYGQERPGDRPL
                     WLGSLKSNIGHAQAAAGVGGVIKMVMAMRHGALPRTLHVDEPTPHVDWSAGDVRLLTE
                     AMEWPETDHPRRAAVSSFGISGTNAHVIVEQAPDTAELPPVPDSGKAVPWVLSGRTEA
                     ALRAQAERLLSLVPEMDLPPADIGFSLATTRSAMEHRAAVVGESRDELLEGLRALAAG
                     SPSTRVVLGEPGAGGKSGFLFSGQGSQRIGMGRELYDAFPVFAAAYDEVCALVDAPVD
                     VDSEELNQTGTTQPALFAVEVALFRLLESWGIRPDYVAGHSVGEIAAAHVAGVLSLED
                     AAKLVSARAALMQALPADGAMVAVQATEDEVLPHLTDGVGIAAVNGPQSVVVSGAEDV
                     VVAIGEAFRERGRKTSRLKVSHAFHSPLMDPMLEEFAEAVSGLSFNEPRLPVVSNLTG
                     RLAEPYTPEYWVRHVREAVRFADGLHTLHELGVTTFVEIGPGGVLSALAQGCLDGDIV
                     TVPAVRTDRPEPQAVVTALAELHAHGVSPDWRALFPGARRVDLPTYPFQYERLWLEAP
                     EEYTGTAAATGLGLGAAEHPLAGAAVALPGAGGFLVTGRLSLRTHPWLADHTVMDSVL
                     LPGTALVELAVRAGEEAGCAQVEDLTLEAPLIVPERGGVAVQVWVEAEEEPGRCALSV
                     HSRREDAPDDAPWVRHAVGRLTDALPEPPHGADLGAWPPAGAEAVDLTGFYEGLDGLG
                     LGYGPVFRGLRSVWRSGDDVLAEVALPEGTEAGAFAVHPALLDAALHAVGAGGLVPVL
                     DGPLLPFAWSEVGVRAAGATALRVKLSRTGTDAVSLTVADASGGLVATVGSLSLRPVS
                     REQLLAAGGSGRRADDSLFGLAWQPAVLTETDAAAGLDVRSYADLAALSTEPALPDVA
                     VVTVVPCPAGSGRETADRVHSTTSEVLALVQWWLAEERAGRLALVTRPGDLAHAAVWG
                     LVRSAQSENPDRIVLVEAEETDEAVRVLPAALASGEPQFAVRDGEVFVPRLVKATRSA
                     TGTATGTPDFGVGPVLLTGASGALGGLVARHLVAEHGVRSLLLLSRRGAEAPGAVELE
                     AELAAWGAEVRWAACDVADREAVSGMLNGLGEQSLSAVVHTAGVLGDGIVASLTPERM
                     REVFRPKVDAVLNLHECTRDMGLAAFVVFSSVAGMVGSAGQASYAAANSFLDAFSAHR
                     RREGLPAISLAWGVWEQSGAMTDGLVEADRARMARSGVLPLPPEEGLRLFDAALASDE
                     AVLAPVRIDTGALRAGEAPPVLRALVPAAAARRTARAAAAPSASSLAERLEEMPEAER
                     EKTVLDLVRAEVAAGLGHASDRTVRPEHAFQDLGFDSLTAVELRNRLNKATGLRLPAT
                     LVFDHPTPALLARHVFMAAAGAAEPALVDSLLADLDRVEQELVTTLAASEARDRILSK
                     LQGLLAIAGEFGKAPAQEGPGTGGSDLESATDDEVFDLLGKEFGIS"
     CDS             567663..568697
                     /codon_start=1
                     /locus_tag="SAVERM_420"
                     /old_locus_tag="SAV_420"
                     /product="putative Tn3 family ISXc5-like transposase"
                     /protein_id="BAC68130.1"
                     /transl_table=11
                     /translation="MPVEFLSHDQVSRYGRFASAPTPGELEQFFRLDAKALESARSKR
                     APANRLGWAVQWGCVRMLGVFPTEDLSVVPEVVVRFAAEQLGVDPGEFAAYGARRQNR
                     YEHAWEIRDAYAYRESPAAEAQVREFLATRVWASWEGPRALFDRAVGWLVDNRVLLPG
                     ITTLTRLVAEVRAQENAALYRTLDEAVPEKLRQSMRDLLKVPEGRRVSELERLRRSPM
                     GVSGSADRLAFSERIRMEAVAMFTAGPGSTDIAKELRVSVQSVQRWRSGLAGDRPGRG
                     AVPQPVSVELSETLFAALDEERAKGFAPSWTIRYLHHDFPIFGQRYAYKWSQGCLHSF
                     GRSAQGYRDQ"
     CDS             568699..569952
                     /codon_start=1
                     /locus_tag="SAVERM_421"
                     /old_locus_tag="SAV_421"
                     /product="putative lipoprotein"
                     /protein_id="BAC68131.1"
                     /transl_table=11
                     /translation="MGEALITLCTRSTRLAATAGVLGGVLAVTALGGTSNAATSGNGA
                     GNHPTSQARINQAGAQEASDARIEITPGQGTYSVGTNHPVSVTVTSGKLTKVTMTAVA
                     TGAEIPGTLSTDGTSWKPNGRLERATKYQIAAEAGDVKGRSTTGSATITTVSPANDFI
                     GHLSPEDGSTVGVAMPVTVNFDKAISDKAAVQSEIRVSSSSGQRVVGHWFNDHRVDFR
                     PENYWRPGSTVTVTLNRHGIQKTVTFKIGRSQISTVDAKTKQMTVVRDGKTIKTIPIS
                     SGSPEHPTYNGQMVISEKFRQIHMNGASVGLTEKNGKPSYDIKAVPHAMRLTDSGTFI
                     HGNYWGTDSVFGEANTSHGCVGLKDVRGDSHGRQPAAWFFDHSIVGDVVIVKNSEEKT
                     MLAPDNGLSDWNMSWSEWVAGSPAT"
     CDS             complement(570215..570763)
                     /codon_start=1
                     /locus_tag="SAVERM_422"
                     /old_locus_tag="SAV_422"
                     /product="hypothetical protein"
                     /protein_id="BAC68132.1"
                     /transl_table=11
                     /translation="MPSTGTGVWSRWTARRWMWRTWANEEFFGRQAGGRGESAFAQAR
                     VVALAECGTHAVFGAVIGPAVGGRAELSRQLFPQLGEGKLLLADQGFYGFELWQTARA
                     TGADLLWRLRSSAAVPGLQVLDDGSYLSSIRAEADRTVLTAGAQSANRSDRLRRLRLP
                     AGAGLVTLHEAERRPLPAFLLI"
     CDS             570940..571578
                     /codon_start=1
                     /locus_tag="SAVERM_423"
                     /old_locus_tag="SAV_423"
                     /product="putative IS30 family ISCmi3-like transposase"
                     /protein_id="BAC68133.1"
                     /transl_table=11
                     /translation="MKYTTTAPTADCAVRPSRSRRSERPAEAADRAVPGHWEGDLIIG
                     TGRSAIGTLVERSSRSTLLVHLPRLEGWGENPPVKNGTSLGGYGAIAMNTALTASMTQ
                     LPEQLRKTLTWDRGKELSGHAQFALDTGTKVFFADPHSPWQRPTNENTNGLLRQYFPK
                     GTDLSRWSSTDLEAVAMAINNRPRKTLGWRTPAEVFEEQLRSLQQPGVATTN"
     CDS             571598..571915
                     /codon_start=1
                     /locus_tag="SAVERM_7576"
                     /old_locus_tag="SAV_7576"
                     /product="putative IS3 family ISAav40like transposase"
                     /protein_id="BAD67173.1"
                     /transl_table=11
                     /translation="MKLTTGLVRAGVEASMGSVGDSYDNALAENLWMLIKTECIRGRT
                     FTTRAEANLALFEYIDGFYNSRRIQKRLGYLSPVEFEEKHYADQATAERTNLKPRQPA
                     LAS"
     CDS             complement(573907..574845)
                     /codon_start=1
                     /gene="sig3"
                     /locus_tag="SAVERM_424"
                     /old_locus_tag="SAV_424"
                     /product="putative RNA polymerase ECF-subfamily sigma
                     factor"
                     /protein_id="BAC68134.1"
                     /transl_table=11
                     /translation="MDIAAIDRFEASQGRLASLAYRLLGSAADAEDAVQDTFLRWQAP
                     YRERVEVPEAWLTKVVTNLCLDRLRSAQARHEQAAGAWLPEPLLDSDPMLGPADTFEQ
                     RESVSLAVLTLLERLSPVERAVYVLREAFSYSHAEIAGILDITESASQQHVHRARIRV
                     AAERRRGSETDPASARRVVEEFLAAATSGRTERLVALLTDDVTAVSDGAGLSKRLLHY
                     KTRERVASYVRAGFKPTPAKRRLAGGSPAFYIALVNGSPAVLAVVDDRVVGAVAFEVS
                     DGKVASLRGIAAADRLARLNEAWRQHEPDAPAINAW"
     CDS             complement(574856..576046)
                     /codon_start=1
                     /locus_tag="SAVERM_425"
                     /old_locus_tag="SAV_425"
                     /product="putative oxidoreductase"
                     /protein_id="BAC68135.1"
                     /transl_table=11
                     /translation="MKHRIVVLGAGYAGAFAAGNLARRLSPADTEITVVNAVPDFVER
                     MRLHQLAIGQDLAFCNLADVFASTGVRLRLARVTGVDPDRRTVAVTGEDGDGELAYDT
                     LLYALGSSVAHHGVPGVAEYAFDVTGRSSALRLRERLAGLGEGGTVLVVGEGLTGIES
                     ATEFAESRPDLSVALAARGELGAWLSPKARRHLRQAFDRLGITVHEHTGIEAVEPTRA
                     IAADGTSIPADVTMWSAGFAVHPMAAASGLEVAETGQIVVDRTMRSVSHPDVYAAGDC
                     AYAIGDNGRPLPMSCASAGFTNMQATAAIIARLTGSEVPTTGLKYHGNHISLGRRDAI
                     FQMVDGDGRSKPWYLGGRTAARLKSGVLKGAGWSIAHPTFGMPKRKRRLATAPDRAGV
                     KVAA"
     CDS             complement(576232..576603)
                     /codon_start=1
                     /locus_tag="SAVERM_426"
                     /old_locus_tag="SAV_426"
                     /product="hypothetical protein"
                     /protein_id="BAC68136.1"
                     /transl_table=11
                     /translation="MLQDATVTAIRSVLALLRRVTEARRGGVSRESQLRHHADWFTSC
                     ASDEDAHALLQAGFGLGAPRHIAVPYADPEQIPGRTSWWGAEPVELARTLVQSGRTSA
                     RHGTGRIERNDAQRPGSAPST"
     CDS             complement(576830..577165)
                     /codon_start=1
                     /locus_tag="SAVERM_427"
                     /old_locus_tag="SAV_427"
                     /product="hypothetical protein"
                     /protein_id="BAC68137.1"
                     /transl_table=11
                     /translation="MSGAPQFLPSQSLPEVPYADFARSLGLGGVRVEKPGDVESAWRQ
                     ALACDRPFVLDFRTDPAVPPIPPHATLEQIEAAATAILEGDSDRAGVVKQGFKAKVQE
                     MLPGGHRNK"
     CDS             complement(577719..578180)
                     /codon_start=1
                     /locus_tag="SAVERM_428"
                     /old_locus_tag="SAV_428"
                     /product="hypothetical protein"
                     /protein_id="BAC68138.1"
                     /transl_table=11
                     /translation="MRSAVSKVEESIEVAVPVSTAYNQWTQFEEFPQFMGGVERIEQQ
                     TATLTHWVTKVGGVTREFDAEIVEQIPDEQVSWTTVGGDVHQAGVVTFHRLDDRRTKV
                     MLQMDHDSKGVVDAVGDKLGVVKHQVSEDLKRFKSFIENRGQESGAWRGQV"
     CDS             579136..579753
                     /codon_start=1
                     /locus_tag="SAVERM_429"
                     /old_locus_tag="SAV_429"
                     /product="hypothetical protein"
                     /protein_id="BAC68139.1"
                     /transl_table=11
                     /translation="MSERHEPRHEPAGQTRPRLVPLPEEHWDARTRKLLAGAAHDPGG
                     RIPNIFTTLVRHPDLYEQFMPFGGQLLRRGRLPARLRELLILRTSCNTGTRYEWGRHL
                     TLAKAAGVTDGDINRITEGPEAPGWTDLERHLIRAADELNSGATLSDATWEALTEHFG
                     DAELIEIVMLVGQYHMVAFFLNATGVELDPGFDSTGFTEGDRNHG"
     CDS             579746..580549
                     /codon_start=1
                     /locus_tag="SAVERM_430"
                     /old_locus_tag="SAV_430"
                     /product="putative dehydrogenase"
                     /protein_id="BAC68140.1"
                     /transl_table=11
                     /translation="MGEGHPEQAAPRLAGRKVLVVGAGTRPDGDPRAPVGNGRAIAVL
                     AAREGADVACADVAAPAAAATAELVHSEGALSVAVVGDATDAKQSAAMVAEAVRRLGG
                     LDALVVNVGVGLGTGLDGSSPEDWDQVLSLNLRAPFLAAKHALPAMADGGAVVFIGSV
                     AGLRAATNSPAYDSSKAGLFGLTRHVAKEGGARRIRANLVVPGLIDTPMGRQASAQRA
                     SRTASFERIPLGRQGTAWEVAEAVAFLLSDRASYITGQSLVVDGGLSAV"
     CDS             complement(580610..581254)
                     /codon_start=1
                     /locus_tag="SAVERM_431"
                     /old_locus_tag="SAV_431"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68141.1"
                     /transl_table=11
                     /translation="MAARRPPTKRDDQREASRRRLLNAALEILAEEGYRGLTVKKVGD
                     RAGVSRGMVNYHFMSKAGLVEAVVADIRETFIDLLRSQPGYARMNGLESVLAKLDQLF
                     ARLAEPEPGVRARALLVLLVEAVGSADGMKDLMAEHLSLVRTGVEEDLRRGIADGSIR
                     PDVDVVAQAFLVESIARGVLLQYQLDSARTRLVDIARAARETLVLGLTATRGAD"
     CDS             581626..582858
                     /codon_start=1
                     /locus_tag="SAVERM_432"
                     /old_locus_tag="SAV_432"
                     /product="putative secreted protein"
                     /protein_id="BAC68142.1"
                     /transl_table=11
                     /translation="MHRMKVRAIPTAVTAALLVTAAHPAAGAAAPAEAVPTRFTVDTT
                     SDAVDADPSDGRCRTASGTCSLRAAVMAANSRPGSTIALPSGRYRLTIPPDPRLITGD
                     HPDPTTGDLNVDAPTTITGAGARATVIDANHLDRAFRLRADTRMSDVTITGGEARQRE
                     LPFTDTGGGGIANERHLTLRRVAVTGNSAGYGGGVFNVPDSHLDLVDSTVSGNAAGEA
                     GGIRFDDSGTVTNSTIAGNRVTDPGDRPGSLGGYGGGIDIRGLGTVEILDSTITGNRS
                     SHHGGGINIAPAYLDSLPAPIPDIVDLPLGRLVLRNSIVAGNTADCAKAFAIIASRGH
                     NIDGDGSCRLTATGDLPRRDPLVGPLADNGGPTDTTALLPGSPALDAADGCPATDQRG
                     VARPQGTACDIGAYEYTP"
     CDS             582893..584755
                     /codon_start=1
                     /locus_tag="SAVERM_433"
                     /old_locus_tag="SAV_433"
                     /product="putative carboxylesterase"
                     /protein_id="BAC68143.1"
                     /transl_table=11
                     /translation="MRSSSSRPALATAVTVVAALLLSLTTPPVTAHADADHDSLVVRT
                     DRGWVRGAAGRDRGRIFQGIPFAAPPTGDLRWRPPRPAARWSGVRDATASAHPCPQLP
                     LTLLPDGGPVLPGESNRTGSTTEDCLYLNVWTPARTMVRPLPVLVWLHGGGNAYGAGS
                     DYDGSALAARGVVVVTVNYRLGALGFLAHSALSAESADRASGDYALMDQQAALRWVRR
                     NIGAFGGDRSRVTLGGQSAGSSDACVHIASPTAKGLFHRAIQQSGSCAADGGLTPPTL
                     DAAERKGSDFAATVGCTDPATAAACLRAVPTTELIRSTGTGAASLWGPNTGPHILPRT
                     PHAAWAEGRVNAVPTLSGNTHDEYRYFTALYVDLLGGGPLTPASYAALITLQHGDRAA
                     AVLGTYPAAAYPSPNLAYSTVGTDQRFACPARADSRLYSSRAPVYAYEFADSQAPPFI
                     PAPHTPQGAFHASELAFLFPTDAVPPLTPAQRRLSAMMTAYWARFAATGDPNVPWAPT
                     WPRYTADGDRIQVLTPDRTGPTTGFAADHHCTFWQPPTPRGRCGDVDVGPGPGRVPER
                     AAGPLTPWPTVSGSVWSRRSPSPALTPRTTASCTGPCRNASRTRPCCRSRAKRY"
     CDS             584755..585144
                     /codon_start=1
                     /locus_tag="SAVERM_434"
                     /old_locus_tag="SAV_434"
                     /product="hypothetical protein"
                     /protein_id="BAC68144.1"
                     /transl_table=11
                     /translation="MARFDDWVTDPEVTLDRVRAFVADPGRVGERFLYRYLVTTTSGT
                     TGHRGVFLLDDRAAAVARALSLRAARRTLTASATARLLAHRERSAHIVATSGHLAACT
                     PGAAGCCRRTARCPTWWTNSTGTGPCS"
     CDS             585449..585874
                     /codon_start=1
                     /locus_tag="SAVERM_435"
                     /old_locus_tag="SAV_435"
                     /product="hypothetical protein"
                     /protein_id="BAC68145.1"
                     /transl_table=11
                     /translation="MPMGAADPALRPRRQGLLRPDACACGDPLPSIKVRGRVADLLSF
                     PRRGGGTVRIVPMAFETLLESIPDIDLFQIVQTSPTTLRVRIRSTTGADRERLWTAVR
                     QELAALLGAHGADQVSVERAHEPPEQSPGGKYRVVMPHS"
     CDS             complement(585858..586517)
                     /codon_start=1
                     /locus_tag="SAVERM_436"
                     /old_locus_tag="SAV_436"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68146.1"
                     /transl_table=11
                     /translation="MTEAPVQNRGARSRDAILDTAGELMARYGYAATSISMISAACGL
                     PTSSLYWHFGSKDGIYIAVLERARTELLAALPPAEVPGADVIQRLDTFLAEVRDAFER
                     HPHGLRLLLGLGMVQQDASAAAVAEVRQYRDALVVWARESVSAVFGLRDRPEVADELA
                     RFTLRMASGTAVALWFDPGTALETGSLRVALLALAAHHGVPVRDAPGEDAPSRGVTNG
                     A"
     CDS             complement(587625..590051)
                     /codon_start=1
                     /gene="prpM1"
                     /locus_tag="SAVERM_437"
                     /old_locus_tag="SAV_437"
                     /product="putative magnesium or manganese-dependent
                     protein phosphatase"
                     /protein_id="BAC68147.1"
                     /transl_table=11
                     /translation="MHDITFRGDGEFPEPGSEADVLLDACGRVAAWGPGAQQMLGCPA
                     REAVGRSADEFLYDPADAADIVRRWEKGARRGSLVLRQRSGKPLAAQIWVRALTSANG
                     DPQWLVQAARTAVLRTYEYGRALLKGLFTDSPFNIDIFDTQLRFVGLNIAERRAGVFQ
                     GTEYSGHTMREMAPPGLLDVDALEARQRRVLETGKALIDTEVVGHPVANSPREYVWSE
                     SILPLRDPSGRVIALGHVVSDVTQRVRSRERLVLTNEAAIGIGTTLDLWRTARELAEV
                     AVPRFADICFVDLLDSVFPGREPTEGRPPRPPLFRRAACSGAAEDTGSDAAGEVKVGD
                     ANLWATAPGSPFLDALTKGESVLLADDQLQNCPAAVGLRHSPDDGPKIHSWLLVPMFA
                     RGVVLGAVVFLRSGNPRRFEPDDVLLAEEIVTRAAVCVDNASRYHRERTTALTLQRSL
                     LPQRLPSASAVRTASCYLPASGHTGLGGDWFDVIPLSGARVALVVGDVTGHDLQSAVT
                     MGRLRSAVRTLADLDLAPDELLTHLDDQMNRFLDERSDEGPLATGATCLYAVYDPVSR
                     RCLLARAGHPPPAVLSVNGAVDFVELPGGPPLGLGGIVFEKREIAMDDGDVLVLYTNG
                     LLQPRAQDLDAGLHRMRDTLSRTPPSATPQEVCDTLVRELLPTCHKDDVAVLTARVSG
                     LASDRHVTWKIEAQDELVGRARDLTTQQMARWGLEEESFTTELIVSELVTNAIRYGEE
                     PITLRLILDRNVICEVSDGSSTSPHVRRAQDTDEGGRGLYLITQLTRSWGTRYGERGK
                     TIWAEQPLRC"
     CDS             complement(590678..591778)
                     /codon_start=1
                     /locus_tag="SAVERM_438"
                     /old_locus_tag="SAV_438"
                     /product="hypothetical protein"
                     /protein_id="BAC68148.1"
                     /transl_table=11
                     /translation="MDTTTTTATAAAVGWNLLIARDDLSIAELADAPVPEVRDGEALL
                     RVDQVGLTANNVTYAALGDSFRYWQFFPASREGWGIVPLWGFAEVVDSRVEGIEPGSR
                     YYGYLPSASHLLVRPGRVDERGFRDASPHRQTLPRPYNAYALTTGDLAYEADREDLQI
                     LYRPLFWTSFMLADWLVDNAWLGAATAVLSSASSKTAYGAAFLLQGRGCEIVGLTSRR
                     NVAFTESLGCYDRVLAYEDVVQLPNRPTLYADFAGDERLTASLSAHLGDALVHHVVVG
                     ITNQEPGPAGTLAETGPGMFFAPDQMRKRTGEWGRAGLDRRFADAWQRFAPVAEGWVD
                     VVHGQGPQALTQVWREVQSGRTAPRTGHVVIF"
     CDS             complement(592072..592773)
                     /codon_start=1
                     /locus_tag="SAVERM_439"
                     /old_locus_tag="SAV_439"
                     /product="hypothetical protein"
                     /protein_id="BAC68149.1"
                     /transl_table=11
                     /translation="MADRVGGVAAAGSADCRSGGRRRHDNFSTYRAHPWRRSEHTMDS
                     GKRLFFSDREGLRREVARLERTHRRLAGTDEQGRPFTALDPAVRVWVLVTLYECMTAM
                     RELSGRPLAPPELDQIYGEFRAVCTEFGLSDDLFPVTAADVPAYMDRTIRERLEYSEP
                     VRYLLFDMLREAPAPRRLGHLKPAWPLVRTVAAHVIGALTIADLPEAFRERFSPPRTR
                     RAALLSLILHRGIAC"
     CDS             594232..595248
                     /codon_start=1
                     /gene="rpoA2"
                     /locus_tag="SAVERM_440"
                     /old_locus_tag="SAV_440"
                     /product="putative RNA polymerase alpha subunit"
                     /protein_id="BAC68150.1"
                     /transl_table=11
                     /translation="MLIAQRPSLTEEVVDEFRSRFVIEPLEPGFGYTLGNSLRRTLLS
                     SIPGAAVTSIRVDGVLHEFTTVPGVKEDVTDLILNIKQLVVSSEHDEPVVMYLRKQGP
                     GLVTAADIAPPAGVEVHNPDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQVGQEIG
                     RIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVEL
                     FGLARELNIDAEGIDMGPSPVDAALAADLVMPIEELELTVRSYNCLKREGVHSVGELV
                     ARSEADLLDIRNFGAKSIDEVKAKLAGMGLGLKDSPPGFDPTAAALGADDDADAGFLE
                     TEHY"
     CDS             595471..596031
                     /codon_start=1
                     /locus_tag="SAVERM_441"
                     /old_locus_tag="SAV_441"
                     /product="putative ISL3 family IS466A-like transposase"
                     /protein_id="BAC68151.1"
                     /transl_table=11
                     /translation="MLFPGIDVRLEGVVVTGTLLFVDAAACGRPPYCPNCRWRGRRIH
                     SPYHRSLSERPLAGQKSVVRLRVRRFFCDRKSCARRTFVKQVDRLTERHRRSSLGLKE
                     WLTTVAVELGGRPGERVCRKLNLAAGRTHLVGLLEEPPVPGPRSAGRAHRCARPGDRL
                     GPAPPHSVLTPSASRVPPCWYLFPIL"
     CDS             596538..596843
                     /codon_start=1
                     /locus_tag="SAVERM_442"
                     /old_locus_tag="SAV_442"
                     /product="hypothetical protein"
                     /protein_id="BAC68152.1"
                     /transl_table=11
                     /translation="MADVKVGLYVSLQAKPGKEEDVADFLRKGLDLVQEEPGTVAWFA
                     VRLNATAFAIFDAFPDVSGRQAHLAGRLAAALMERAPDLLAQPPSIEQLDILAHKLP"
     CDS             596972..597148
                     /codon_start=1
                     /locus_tag="SAVERM_443"
                     /old_locus_tag="SAV_443"
                     /product="hypothetical protein"
                     /protein_id="BAC68153.1"
                     /transl_table=11
                     /translation="MFNDRLHLVHRGQANDSLWESVYDGSSWTTDTPIPGRHSWRGPA
                     LATYRGALHCLATG"
     CDS             complement(598312..600774)
                     /codon_start=1
                     /gene="wapA"
                     /locus_tag="SAVERM_444"
                     /old_locus_tag="SAV_444"
                     /product="putative cell wall-associated protein"
                     /protein_id="BAC68154.1"
                     /transl_table=11
                     /translation="MAGQGQHRPHRRLPPDANGNLASTTDTEGKTTVFRYDAWGRVDK
                     ITTAEGRVTVFTYDDANRVTSMLRGTGFNSDGHTGPTWTYAYTSDSVTAAGTTTATDP
                     ETHATKYQHDSDGQVSDVTDAMGHKRSTKFDANHSIDTSTDAMGSGTTPGNVTDYGFN
                     TRNNLETITQPTGGKTVNHWQTIAGADVPKDSTNPDGEKTDFTYDAVGNTMSVAQTGT
                     GGGNVSYTYNPASPTCGGFAGQRCTEKTKMTAAKTVTTTFHYDSAGNLDTVTPPAPLA
                     KITYTYDALGRTKTVTDARGVTVTYTYDNRDRTRIVDTTNKARVEYWYDGDGNLTQRT
                     DSTGTIKYDFDPLQRETIRTLQDGSQTLLAYTPSGNVDYYQDPAGTVDYTWNEVNKLA
                     ELKDPAGRVTTYKYNNNDVRTTTTYPGGTVQKVDPDNSSRPKTIKTTSPKGTPVDLAY
                     SYGYGTSGTTEGSKIRSSTDNVTGLKTTYTYDGAGRFSYAEEKKGTTLNSSWLYCYDL
                     AGNLTSQGTAAGCPGATTYTVNDAQQLTAKNGSTTNWSYDKIGNETAGASTPEGTRTA
                     EKWTDHSQLTSLTVGGKTYTGQYGSTDQSERIRLGDTYFHNGPIGLAGTSTAGVDTGF
                     NREPGGTLNSMTTGGKAYCYLTDALGSVIALTDETGAKVNTYAYSPRGVTRASTSEKN
                     PQPYRFAGGYQDVTGLYHYGARYYDPNIGRFNSPDPSGQEENPYLYAEGDPVNRIDPN
                     GLFSFSDALDTGSDIFGVVTGCLAGVTAAAETGSIAYAAAVGGVVGAGVGSAVGVGLA
                     VVGSCALGGAAGFYGAEILTYG"
     CDS             complement(601030..601425)
                     /codon_start=1
                     /locus_tag="SAVERM_445"
                     /old_locus_tag="SAV_445"
                     /product="putative Tn3 family ISXc5-like transposase"
                     /protein_id="BAC68155.1"
                     /transl_table=11
                     /translation="MAGPPRSATRSRTTADREDSAHPAPDRADEPGYRRQIKVQANLQ
                     EGHHALARRAGQLYQRYQDGMEDQIGALGLVLNALVLFNTRYMDAALTQLRADGFEVR
                     DEDVARLSPFMRHHINVLGRYSFQLPDLE"
     CDS             complement(601349..601615)
                     /codon_start=1
                     /locus_tag="SAVERM_446"
                     /old_locus_tag="SAV_446"
                     /product="putative IS21 family IS1474-like transposase"
                     /protein_id="BAC68156.1"
                     /transl_table=11
                     /translation="MPDTQNAGPSTSVTAAAVSTAGSVYSMMAPTSPVMAPPSPGRRR
                     EPGSLGAVRAYDVIRMLSRDGRPTPLGDAITYYGGSRRLCTSCA"
     CDS             601641..601862
                     /codon_start=1
                     /locus_tag="SAVERM_447"
                     /old_locus_tag="SAV_447"
                     /product="putative IS630 family ISMma10-like transposase"
                     /protein_id="BAC68157.1"
                     /transl_table=11
                     /translation="MVVVAVGCALTSVPTAGGVVAEPVCVRRLTDQEGQKLQQIVRRG
                     SASSVRFRRAMMLLASAGGNRVPVIAQLV"
     CDS             complement(602829..603446)
                     /codon_start=1
                     /locus_tag="SAVERM_448"
                     /old_locus_tag="SAV_448"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68158.1"
                     /transl_table=11
                     /translation="MPTSTRRARERANTRERIIEAALHVLETEGIAALTIRRIATDVE
                     YSAPVVYQHFANKDALVLELVAHGHRLMLSEFSQAAQEPDTDRRMTRIASQYVRFAGE
                     HPHLFQVMNDPMVDADERRRVAEPVIDVLKELLTSWSAAHDVVLADFDQACEILWGTL
                     YGIASLSYLGSVGNDRARYLAEQALHTILLGWRTETPANGRPASS"
     CDS             603569..603973
                     /codon_start=1
                     /locus_tag="SAVERM_449"
                     /old_locus_tag="SAV_449"
                     /product="hypothetical protein"
                     /protein_id="BAC68159.1"
                     /transl_table=11
                     /translation="MIYHINRVTMKATATPEQIEGVLESWRNQGRSNPAIKSFVVGRN
                     HGGDYTYGAVFVVEHLDGLFAYLTHPTTYQTDHLGLHLVERLEIFDVSDDDDPDLNAK
                     IQELHRRRNELNPQIAGMLADVPTYTGSGVDD"
     CDS             604002..604904
                     /codon_start=1
                     /locus_tag="SAVERM_450"
                     /old_locus_tag="SAV_450"
                     /product="hypothetical protein"
                     /protein_id="BAC68160.1"
                     /transl_table=11
                     /translation="MAKHVIIGAGSIGTNVARLLAEGGESVRIVTRSGSGPEHPLVDR
                     VAADASDPSRLTELSRGAGVIYHCANPPSYTVWERLLPPLQTAAITAAKANDAVLALT
                     GSLYAYGPQPGGRMNEHTPMAATGHKGRLRRRMWEQALAGGIRTVEVRGSDYIGKDAN
                     GIYSLLIKSALQKGKAAWITGHLDMPHTFTFNGDMAQALITLASEERAWGRPWHVPSA
                     PAVTIRELARRYAVAAGRPPIKLIQIPRSVTRTAGLIVPIAREMAEMDYQWYAPFHMD
                     ATETTETFGLTATDLDTAVRNEVG"
     CDS             complement(605005..605373)
                     /codon_start=1
                     /locus_tag="SAVERM_451"
                     /old_locus_tag="SAV_451"
                     /product="putative anti-sigma factor antagonist"
                     /protein_id="BAC68161.1"
                     /transl_table=11
                     /translation="MTDAFHIDVPHTDAALAVIALSGEFDIAAAPAVRARALELIANG
                     HPDLVADLSGVTFCDSSGLGALVGIWRCAKDADGSLTLAAIPDRLSRLLSVTGMDAFL
                     PAYSSADAALAARQGNRTTA"
     CDS             605510..606031
                     /codon_start=1
                     /locus_tag="SAVERM_452"
                     /old_locus_tag="SAV_452"
                     /product="hypothetical protein"
                     /protein_id="BAC68162.1"
                     /transl_table=11
                     /translation="MFAVKESRVRVVGEIAATPTGEALELVLHLGESLRGVRVESSDA
                     TARPDGLDFLAELPARGEWHTTALVRPSVEGEEAGGLFHPGAEPGESGPARRLCAWRE
                     SAPRITDIEDPEVHRTLRRSLEDLGAPAHLRPAAPRTHGGRRRCPLVHGPVRPRLAAV
                     LVHGTAAGPCTPR"
     CDS             606058..606540
                     /codon_start=1
                     /locus_tag="SAVERM_453"
                     /old_locus_tag="SAV_453"
                     /product="hypothetical protein"
                     /protein_id="BAC68163.1"
                     /transl_table=11
                     /translation="MVTAVRARARAGSAWQACRGARRSSQHSSEGVRRMDEKEFLRTV
                     AERTGLSRQEAADLTWATLETLARRLSPGEARDLITELPEGLAEAVRRGTTDRIERFG
                     HHDSVRRVAERTMLKEEEADRGVRTVLAVLREAISEKEFNDLMSQLGTDFSQALESAG
                     "
     CDS             606685..607839
                     /codon_start=1
                     /locus_tag="SAVERM_454"
                     /old_locus_tag="SAV_454"
                     /product="hypothetical protein"
                     /protein_id="BAC68164.1"
                     /transl_table=11
                     /translation="MIMTADVPETSSGRSVRVALVADPGLPSEIARALAPRLPDHLRR
                     AVGARVRWQVDTMTAPLSVSEQADVSDIAEAVRSHLDGAEWDVAIFLTDFPRRARLYP
                     ISVEVDTALRAALISLPALGVRRLRRRVRQAVVDVVRELVAHEETPRHPEVIGRPPRE
                     PVPDTRPGPEQPQRYVVPGLRGHTRLVAGMVYANRPWRLFGSLSRALAGVFATATVLF
                     INSATWNLATALGAVQHAVITAGSAVALTLWIIVDHQLWERGTHLPARHHPLYPYNLV
                     TLVTIALAVVVLAAALFATLVAVSFLLLDASVLRKFIGRQVGVGDYLFLAWFITAIAM
                     IGGAFGTSLEGDEKVSDAAYGRRQRERQRMLRQMPRPERGERRGPDTTDG"
     CDS             complement(607861..608373)
                     /codon_start=1
                     /locus_tag="SAVERM_455"
                     /old_locus_tag="SAV_455"
                     /product="hypothetical protein"
                     /protein_id="BAC68165.1"
                     /transl_table=11
                     /translation="MNPYAPASGIEQRPGWSWLDEYLWCSCDIIADLAEGRLEQRPLV
                     ATVARLEAGERVLAVGPAQRVTWRALGDGRYMHQNAVAFGSPAFVLGSMASMATSALG
                     NSARRRAAANDAQPRCGARTPGLHVLDVLDVHGTMLRWSMHLGTSSTRRPSSALRALL
                     ELVDLHVIAL"
     CDS             608423..609064
                     /codon_start=1
                     /locus_tag="SAVERM_456"
                     /old_locus_tag="SAV_456"
                     /product="hypothetical protein"
                     /protein_id="BAC68166.1"
                     /transl_table=11
                     /translation="MATLLRRVCPHEGVRIAAVPAGFVLSRRPWTASVYRCAVVGPQS
                     EDRREVEGSRTPVASASSRLRPCRRRLSVVRCPRRAVPSQAVRSRFRPGTTRFLGDVL
                     VYQRHRDALHARVRHVIDDVHPGLGRGAARPVRIATHSLGGVIAVDMATANVPLWTES
                     LVTFGSQATFFHQPVPGDLLCQMIAFRMRKHQEAETGALPPETGFIAHAGQGW"
     CDS             complement(609036..610703)
                     /codon_start=1
                     /locus_tag="SAVERM_457"
                     /old_locus_tag="SAV_457"
                     /product="hypothetical protein"
                     /protein_id="BAC68167.1"
                     /transl_table=11
                     /translation="MGFGEDELRALAGTRSFERGSGYVDAVRGLEVGDGSVTAVVHGT
                     DIYEVELALGAGAGVSGRCDCPYGQEGNFCKHCVAVGLTVLRQAEAIPRQRADARTRA
                     SGLEAWLTALSRDELLALVREQVADDRELRRRLELRAAAARSDFGTVRERVLALIDPR
                     PFARYGYVTYADAAGYARQVAETADALCALTTSGQAARAVGLAEDAIRALGEAYEEID
                     DSDGVVGQAIAAVAGAHLEACGVARPDPERLAEWLVGHVLGEWNDATDLDPLDYADVL
                     GQAGLARLRQLAAEARRRSPRGWAEKYLMERLAKAEGDVDALVALYMKDLVPSGATHL
                     RIAEELGAAGRPEDALSWAERGLRDTVDEAHVDGRLVDYVCARYTRTGRKAETVAVRR
                     DRLLAERSLAAYQQLRAAARAADCWETERAAALAALREGTRQERGGWHRGPVLIDALL
                     DDGDLDTAWREAADRADDRQWQQLADLSRETRPADALAVYLRLVELLKGPTGDRVYEQ
                     MARLLLDVRSCHRSLGTEDEFTAYVADLRAELKRRRKLITILDRHGL"
     CDS             complement(611754..612434)
                     /codon_start=1
                     /gene="hspR18_1"
                     /locus_tag="SAVERM_458"
                     /old_locus_tag="SAV_458"
                     /product="putative hsp18 transcriptional regulator"
                     /protein_id="BAC68168.1"
                     /transl_table=11
                     /translation="MTRDDQPDPRVCGPAPASFLAAAAALDTIDDALRAAQTTRDGEP
                     SKPGQASSEQALAALLLLREVRDQLADWEPGLIEAAREAGASWADLAHPLGVASRQAA
                     ERRYLRVRPGKPGATGEQRVQATRDRRAADRTVSAWARTNAATLRQLAGQITALPDLP
                     AAAHAPLADLTAALADNDPAALVPRLKDTHPYLASGHPDLAARVDDLTRRIDQLRQNS
                     GNQRRNQP"
     CDS             612565..612999
                     /codon_start=1
                     /gene="hsp18_1"
                     /locus_tag="SAVERM_459"
                     /old_locus_tag="SAV_459"
                     /product="putative heat shock protein"
                     /protein_id="BAC68169.1"
                     /transl_table=11
                     /translation="MLMRTDPFRELDRLTQQLLNTTGTWSRPSAMPMDAYREGEEYVI
                     AFDLPGVSADAIDIDVERNMLTVKAERRPVTKADDAQMELSERPLGAFSRQLVLADTL
                     DTEHIKADYDAGVLTLRIPIAERAKPRKIAIGGRTERKEISG"
     CDS             613088..613483
                     /codon_start=1
                     /locus_tag="SAVERM_460"
                     /old_locus_tag="SAV_460"
                     /product="hypothetical protein"
                     /protein_id="BAC68170.1"
                     /transl_table=11
                     /translation="MVMRWEAFLHQVKERGDYETTREAERAARTVLALLGAHLVGEVR
                     AELAARLPESLALVLLNPLQAREPLSPERFVRATAAWIEGATEQTAAWDVSAVLSVAA
                     DAAGDELTRHILLQLPAGYDLLFGHPHPV"
     CDS             complement(613563..614081)
                     /codon_start=1
                     /locus_tag="SAVERM_461"
                     /old_locus_tag="SAV_461"
                     /product="hypothetical protein"
                     /protein_id="BAC68171.1"
                     /transl_table=11
                     /translation="MLTRSVRSGVYRLETSGLLPQCSRCGGDLIVSVVAPKNDTDGRP
                     IQLQLCSACDAEKPAAGALLFWFASGGGHDTERSEEGARLLMEWTGEAMAEYGWYWPG
                     TDVDAATSAPGLEHDEAAARDLMNPGTAGEFPEIDQRQQERDALRTELANAGSEQRTQ
                     LQAVWLLLGDHR"
     CDS             complement(614386..614700)
                     /codon_start=1
                     /locus_tag="SAVERM_462"
                     /old_locus_tag="SAV_462"
                     /product="hypothetical protein"
                     /protein_id="BAC68172.1"
                     /transl_table=11
                     /translation="MTTENCRRDLTAICKAADSGYLLQVIRDGSFEPLAQKDLSHWPD
                     WPTFPVDAAHAAGCELVMLGYMIWPDTVTPDSLIGWRAVPDQQAWSAKVGTFAQLQAA
                     GI"
     CDS             complement(614793..614951)
                     /codon_start=1
                     /locus_tag="SAVERM_463"
                     /old_locus_tag="SAV_463"
                     /product="hypothetical protein"
                     /protein_id="BAC68173.1"
                     /transl_table=11
                     /translation="MAPYAAWRGLWSARHQAYCYQPLGSAYDAIANCRRPLNAMRQMA
                     QPPMSPCC"
     CDS             complement(615205..615528)
                     /codon_start=1
                     /locus_tag="SAVERM_464"
                     /old_locus_tag="SAV_464"
                     /product="hypothetical protein"
                     /protein_id="BAC68174.1"
                     /transl_table=11
                     /translation="MLAAAGVLSMPLIWLLDSPDAGQLVGASIQAAVGVAALIGALFQ
                     HPASRTDDTAARTGVARASGGGTAVTGVECPQGRGSGSAQTERTGNATAGGDGSSAVS
                     SIDYT"
     CDS             615875..616378
                     /codon_start=1
                     /locus_tag="SAVERM_465"
                     /old_locus_tag="SAV_465"
                     /product="hypothetical protein"
                     /protein_id="BAC68175.1"
                     /transl_table=11
                     /translation="MTMTFTSAPKPVLVRAGEAETLQDGATSLITLLADANTTGSALT
                     ANRATLHKGSPGAPAHFHTRATEMFYVLSGSMRILLDDQVLTLGQGDFLTVPPTVPHA
                     FAPAPDSEAEMLVVFTPGMDRFDYYRLLERVYQGEASVQDIRDSSEQFDNHYFESPVW
                     QQELARR"
     CDS             618189..618728
                     /codon_start=1
                     /locus_tag="SAVERM_466"
                     /old_locus_tag="SAV_466"
                     /product="putative secreted protein"
                     /protein_id="BAC68176.1"
                     /transl_table=11
                     /translation="MRSSGRMAVSAMAVAMAALGVGSGAPASAAPTATPSCSGTECLS
                     LKPTRLTASQASLNVTQMQLENINAMASDAVTGEPIRGAKIVFATTGGRTLGTAYTDY
                     DGIAAIAAPENLGPGTLQELLGGYEAAMVGDGVHAPAGAHGAITIGTDQGPGVPGSPC
                     AVCSDRALKQDVVPVDWSR"
     CDS             618731..619111
                     /codon_start=1
                     /locus_tag="SAVERM_467"
                     /old_locus_tag="SAV_467"
                     /product="hypothetical protein"
                     /protein_id="BAC68177.1"
                     /transl_table=11
                     /translation="MRIFRRRSRTADRGDPARLRAETRESSGVAPVGPVNGYAVLETV
                     AALPISTWRYLWEPEGVRHLGPMAQDWHAAFGFNQDDTTIPVVDGLGVALVCIQALHR
                     RVEELTAEMDRLRQAASVNTSGAA"
     CDS             619319..619990
                     /codon_start=1
                     /locus_tag="SAVERM_468"
                     /old_locus_tag="SAV_468"
                     /product="putative oxygenase"
                     /protein_id="BAC68178.1"
                     /transl_table=11
                     /translation="MDHRSPVCTDAVWRLPVTVCRITQFLGEQTAGALLERAIDSAGD
                     TLQPSMIRDREVVPDFRRSRSRHDFAAPELMAAIDEVLEAVEHTLGVSCQHTEPSYSL
                     NAHNDGDFYRPHQDTSAEFAPRRLLTFVYYLHRTPRPFDGGELRVFDAALPLHTETAG
                     RWQERTWRDWEPEHDSIVFFLPTAWHEVRPVSCPSKQHADSRFAINGWLCSPDPANRG
                     NDASP"
     CDS             620530..621735
                     /codon_start=1
                     /locus_tag="SAVERM_469"
                     /old_locus_tag="SAV_469"
                     /product="putative secreted lipase"
                     /protein_id="BAC68179.1"
                     /transl_table=11
                     /translation="MTTTPFISRKGMTRRSMLGAALAAVPLAAVAGPAWADPAAPAVT
                     RLMLPVPTGPHPVGTVQLHLVDRSRPDDIAGPGHFRELMATVWYPARDVQRYPVAPWM
                     PAGALQAFLADAGFSALVRLGPLTAGHVGAPVRRSGRRLPVVVFSHGAHSHQGDHTVM
                     VQELASHGYAAVTVAHQYDTYTEFPDGRIAVPLHDGQAPTLPGDFAADLRFVLDCVEQ
                     LAAGCNPDVDHRELPAGLLGSLDPRRVGAFGWSKGGTATACATLADERIRAGLSLDGP
                     MQMNPPLAGDLDRPFMMMSAVFTRATDPEAAAFWSHLRGWRLNIQAQGAVHVSYGDNE
                     ALFPQVAKLLGWSGQQLQDVIGTLDPDQAVKIQQAYPLAFFDEHLRHRRGHLLDGPSP
                     AFPAVTFLP"
     CDS             621832..622614
                     /codon_start=1
                     /locus_tag="SAVERM_470"
                     /old_locus_tag="SAV_470"
                     /product="putative IS5 family IS493-like transposase"
                     /protein_id="BAC68180.1"
                     /transl_table=11
                     /translation="MLGAAVAGRSGGRRGRSRGSRRSARTAAPGRRPRRCRRGRPGRL
                     RASAPRSRAYCSEVVDDGAQPGERRIRRRIGGRRRRGGADVTDGLADHRAHRRLIERM
                     EAAGGERGESAGDQLRTSPRWIDGTGIRVRRPADGRKDREKFISGKNKQNAVKFMAVT
                     DADGRLLFCSPAEPASCTDITHARQFSLVKLLANGPVVEILADAGYQGLGAQTGGCVV
                     TPPHRKCKKNPPDWYEEMHERLRKAHSSRRIRVEHGIAHLKN"
     CDS             622993..623559
                     /codon_start=1
                     /locus_tag="SAVERM_471"
                     /old_locus_tag="SAV_471"
                     /product="hypothetical protein"
                     /protein_id="BAC68181.1"
                     /transl_table=11
                     /translation="MRKLIYGMNLTLDGYIAAAGDDIGWSGPPSDELFQWWLDQERAI
                     SLLLYGRKLWETMSAYWPTGDQQPNATPAEIEFARNWRDTPKVVFSSTVDKVDWNTRL
                     VSGDAVAEITRLKAEDGGPMRVGGAALAGAAMRAGLIDEYAIVTHPVLVGSGTPFFTA
                     LDSWASLNLVETRTFPGGVVLTRYETRR"
     CDS             complement(624344..625432)
                     /codon_start=1
                     /locus_tag="SAVERM_472"
                     /old_locus_tag="SAV_472"
                     /product="putative regulatory protein"
                     /protein_id="BAC68182.1"
                     /transl_table=11
                     /translation="MRPSTEPPQASVRLPHPPVHRDRLQPAPFLSSLAAEAGTYSPEV
                     GELLARNVGDLLTTVVTERLGRDAAPTDAGRQTLLQRIRHFINAHLADPALSAEAIAA
                     HHHISVRHLQRLFQAEGTTVNGWIRGRRLKECGRELSRPRRSRPAVSAVGLRQPRPLQ
                     PGVPRRLRHVAARMAGHGRCDRRCGSKTLRAWVSGRVLKSGAPVGRPRLRLGTRLRSG
                     RAGLTGRLVGDQQAACQASTSSVLGLRRVGRRAERFESSESGPPTTGRPRRSSATGVR
                     SGRRTGSGRTPRRRAVRRSGARRDGAGCGCRRRSGTHGARRPGRGVLVTLLQAAELLR
                     RPLVEDGAVGRSFTVRAVARPAYTACVA"
     CDS             complement(625518..626249)
                     /codon_start=1
                     /locus_tag="SAVERM_473"
                     /old_locus_tag="SAV_473"
                     /product="putative ISL3 family IS469-like transposase"
                     /protein_id="BAC68183.1"
                     /transl_table=11
                     /translation="MNEVLPQLNELLFSSVEGVLVESVEVIGTVVRVEARTTAGRAAC
                     VGCAYWAGRIQGSYLRFPRDLPTPGKCVVVPLRVRRFVCEEESCERMTFAEQVPGLTR
                     RFGRRTERLRSTLVSVGLALEGRAGARMTDAFKVPVSRNTLLRLIASLPDPATAVLRV
                     AGVDEYAQRKGRVYSIRVSSSGPVGPSVEGLSTKAPEKHLRRARVSSRLSRALSTTCR
                     YARPSGSMARPGRCTSPPGRSPRCR"
     CDS             complement(626420..627271)
                     /codon_start=1
                     /locus_tag="SAVERM_474"
                     /old_locus_tag="SAV_474"
                     /product="putative methyltransferase"
                     /protein_id="BAC68184.1"
                     /transl_table=11
                     /translation="MTDEQERVQPSGVWATAVGVARVRALETERENALFRDPLAQAFA
                     TAGGLWPSSPPLPDDEAARRRRLTVSFSIVIRTKFLDDLLQQASASGVRQVVLLGAGM
                     DSRAFRMDWPEGTRLFEVDTAAPLDFKASVLRQERADARCERITVAVDLREDWPGALA
                     AVGHDPAVPTVWIAEGLLIYLPEDAVELLLARISAQSAAGSRMGLTLGSRGVIERFGA
                     DAAPGSAASMWVSEMPDDPVGWLAGHGWEADSHTLRERAAAYGRPISTPPQREERPGG
                     LISAVRR"
     CDS             complement(627377..627523)
                     /codon_start=1
                     /locus_tag="SAVERM_475"
                     /old_locus_tag="SAV_475"
                     /product="hypothetical protein"
                     /protein_id="BAC68185.1"
                     /transl_table=11
                     /translation="MQPNEIIEVLNRPISQELLARDVTRSHIGMSTTKNAPKLPWPPS
                     RTGS"
     CDS             complement(627541..628107)
                     /codon_start=1
                     /locus_tag="SAVERM_476"
                     /old_locus_tag="SAV_476"
                     /product="hypothetical protein"
                     /protein_id="BAC68186.1"
                     /transl_table=11
                     /translation="MLRRDPDFSEFGGLTMSRTCHWLRPRDSSGHHRPHKEEGETCMA
                     IQRMDNVGIVVEDLDAAIAFFVELGMELEGRAEVEGLFADQCTGLDGVRCDIAMVRTP
                     DGHSRLELAKYRSPAVISAGPRNRPHNILGTHRVMFAVDDIEDTVARLRPHGAELVGE
                     IARFEDSYLLCYLRGPEGIIVGLAEQLR"
     CDS             628625..628882
                     /codon_start=1
                     /locus_tag="SAVERM_477"
                     /old_locus_tag="SAV_477"
                     /product="hypothetical protein"
                     /protein_id="BAC68187.1"
                     /transl_table=11
                     /translation="MWLRLAALAGWPADQTANFEIEFWARRALYDAGEISTHTFWSGM
                     LYGQLTAPPGSTLLYALRSTDAEMWTHTDEDVVRVSCLTEG"
     CDS             629473..629790
                     /codon_start=1
                     /locus_tag="SAVERM_478"
                     /old_locus_tag="SAV_478"
                     /product="hypothetical protein"
                     /protein_id="BAC68188.1"
                     /transl_table=11
                     /translation="MTLLSNVPHPLAEALDLSAWCSTLMTRTVYSARLGVNKPDPRAY
                     EAAVVAAGLPHPENTLFVDDRLENCAVAAQLGLRTLHFNGDSQALASHIPQMVPATGI
                     RRN"
     CDS             complement(629806..630354)
                     /codon_start=1
                     /locus_tag="SAVERM_479"
                     /old_locus_tag="SAV_479"
                     /product="putative IS630 family ISPlu10-like transposase"
                     /protein_id="BAC68189.1"
                     /transl_table=11
                     /translation="MTPPTSRTWARRGHTPVIRVRGRSQRRISIAALACYKQGERSRL
                     VYRSKRHVDHKRGGRRSFAWTDYRDLLIAAHQQLGAPIVLGWDNLNVHKDRRLREFIN
                     AHDWINCFFLPTYAPDLNPVEGVWSLLRRSSQANTAFTDPGHLMRALRHGLRQIQYRN
                     NLIDGCLAETGLTLTTKRQQAQ"
     repeat_region   629807..629808
                     /note="target sequence"
                     /rpt_type=flanking
     mobile_element  629809..630954
                     /mobile_element_type="insertion sequence:ISSav27"
                     /rpt_family="IS630 family (ISPlu10 group)"
     repeat_region   629809..629832
                     /note="26 nt imperfect inverted repeat (25/26 nt)"
                     /rpt_type=inverted
     CDS             complement(630351..630686)
                     /codon_start=1
                     /locus_tag="SAVERM_480"
                     /old_locus_tag="SAV_480"
                     /product="putative IS4 family ISXo14-like transposase"
                     /protein_id="BAC68190.1"
                     /transl_table=11
                     /translation="MSLPKLSEKLFTVLEQELGKGPVAHGWPDQTWTLSRIKTLIGRR
                     FHKSMTLSAIAQMLHRHGFSHQVPARRAVERNEETVTGWVKETWPQVETPWRRSGPGS
                     ASKTRPVSR"
     repeat_region   630931..630954
                     /note="26 nt imperfect inverted repeat (25/26 nt)"
                     /rpt_type=inverted
     CDS             complement(630951..631274)
                     /codon_start=1
                     /locus_tag="SAVERM_482"
                     /old_locus_tag="SAV_482"
                     /product="hypothetical protein"
                     /protein_id="BAC68191.1"
                     /transl_table=11
                     /translation="MYDGTPGSGGGNAHWPATGYYATTTRDCEDINLKVNATRSVRTC
                     FKATGSCNAWSTARAKQWALAATDVSDGSDFYIQFSGTAKSTGYIAYREEDGMNHLAT
                     PDDCY"
     repeat_region   630955..630956
                     /note="target sequence"
                     /rpt_type=flanking
     CDS             631222..631539
                     /codon_start=1
                     /locus_tag="SAVERM_481"
                     /old_locus_tag="SAV_481"
                     /product="hypothetical protein"
                     /protein_id="BAC68192.1"
                     /transl_table=11
                     /translation="MAGQCALPPPLPGVPSYKNAVSRQAARRSLPGSPSTPWRCWRPH
                     RRGHCRRWSSTGTHDYVVVFDADTDAVPVFTALGRWVGMAESSGTIGTLTEIHERVNG
                     GDA"
     CDS             complement(631562..631783)
                     /codon_start=1
                     /locus_tag="SAVERM_483"
                     /old_locus_tag="SAV_483"
                     /product="hypothetical protein"
                     /protein_id="BAC68193.1"
                     /transl_table=11
                     /translation="MVSKRRSAAPGRGSRAAVLGMVLPASDVGDHEELVAAEVHHHPG
                     VRALGVLVGGVLFRTPPRGPPAGNRSRTV"
     CDS             complement(631817..632638)
                     /codon_start=1
                     /locus_tag="SAVERM_484"
                     /old_locus_tag="SAV_484"
                     /product="putative methyltransferase"
                     /protein_id="BAC68194.1"
                     /transl_table=11
                     /translation="MTTTASQEAFLQAFHAEYPAVTAEAFGRGHAPDGRSSYEILCDR
                     VAGSMRVLDLGCGDGLLLEFLARRSGRQLAGVDLSPHSLALARRRPALSEAKLEEGRA
                     QELPFADDSFDACVSHMALMLMSEIEQVASEVARVLSPGGVLACVVGGGAVGGEAYER
                     FLALLRCTIEETPASQRIPALGDKRTRSREGLDEVLGPAGFTAVDWETVPIDLSAPGE
                     QVWAAVSSLYDLGPLDRATLDRLREAFFAEVRDMTTSEGHVPCAFKIHLATARLR"
     CDS             632948..633259
                     /codon_start=1
                     /locus_tag="SAVERM_485"
                     /old_locus_tag="SAV_485"
                     /product="hypothetical protein"
                     /protein_id="BAC68195.1"
                     /transl_table=11
                     /translation="MPAGRPSTENPAVPQPPPTPSLPRREPLHDGQTTQLTCLRTRVL
                     ATAYSSSDCWTQRTASSPTRPWQRSPAVTLPQPSPRRVPAGPGDAPQHPDPGRGRGSR
                     N"
     CDS             633243..633470
                     /codon_start=1
                     /locus_tag="SAVERM_486"
                     /old_locus_tag="SAV_486"
                     /product="hypothetical protein"
                     /protein_id="BAC68196.1"
                     /transl_table=11
                     /translation="MEAGIDTRTWEERHEEIRTYARDAYELPPQFDPATEVNRIRAYL
                     YDNYPQIAAALAVFLHEMPPTWREDLFHHLP"
     CDS             complement(633937..634218)
                     /codon_start=1
                     /locus_tag="SAVERM_487"
                     /old_locus_tag="SAV_487"
                     /product="putative secreted protein"
                     /protein_id="BAC68197.1"
                     /transl_table=11
                     /translation="MRTSIRIASVLAGRPLALGGVAFTAPPPTRTSRPASTRSSGSCR
                     AGRALSSDELHYEERWEPNHPATTVRTWTGVFAWSVISGLIGEPHRVTG"
     CDS             complement(634378..635061)
                     /codon_start=1
                     /locus_tag="SAVERM_488"
                     /old_locus_tag="SAV_488"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68198.1"
                     /transl_table=11
                     /translation="MTRQEATHTQRIPLNRDRVLRAAVALADATGIDALSMRRLAQEL
                     DVVPMALYKHVANKEELLDGMADAVVGEIDPPAAGPDWQRVVRGRILSARRVLLRHPW
                     AARVIESRTGPTPAVLAYLDSMAGSFRDGGLSADLTHHVMHAMGSRLLGFSQELFDTS
                     GPSGPPDPGLAARYPHIAELAATAAHDGGSTVGGGCDDQFEFEFALDLLLDGFESLRR
                     QGWTSARKT"
     CDS             635181..635900
                     /codon_start=1
                     /locus_tag="SAVERM_489"
                     /old_locus_tag="SAV_489"
                     /product="putative secreted protein"
                     /protein_id="BAC68199.1"
                     /transl_table=11
                     /translation="MSPDRRTAVAAGSLFLLTEAAAIAGAVLYRPLLGAADGRLAQGA
                     DTRALLGVLCEVVLVAAVAGTGAALFPVLRRHGEGLALGYAFGRLLEAAVIALGIVAV
                     LALVTLRRDAGAAAGADVALAAVHDWTFLLGPNIALGLNTVLLAYLAYRARLVPRFIA
                     VLGLVGGPLICASAVAVMFGAYAQLSVAGSAAALPVFAWELGLAGWLIVRGFGPGSGA
                     TSQADGEVADPVCVSVRPTRA"
     CDS             complement(636261..636563)
                     /codon_start=1
                     /locus_tag="SAVERM_490"
                     /old_locus_tag="SAV_490"
                     /product="hypothetical protein"
                     /protein_id="BAC68200.1"
                     /transl_table=11
                     /translation="MTLTSQVHRSVASGVRSFRRVQPSICLIIRNGCSRSNLRRNACQ
                     RRSMPCPDPVADDHSQTGSGSCPPGRKSASRHFNVPLMRGSSPVWSVHVERVVRRG"
     CDS             complement(636931..637317)
                     /codon_start=1
                     /locus_tag="SAVERM_491"
                     /old_locus_tag="SAV_491"
                     /product="putative transcriptional regulator"
                     /protein_id="BAC68201.1"
                     /transl_table=11
                     /translation="MKDTDLHAVGAETPTVFRADCPSRPILDQIADKWSMMVMALLER
                     PTRFNELKRGLEGVTQRVLTQTLRRLERNGMIRRKVLPTSPVGVEYSLTPLGESLREP
                     FGHLYDWTVEHSKEIQNCQRAYDSRG"
     CDS             637423..638256
                     /codon_start=1
                     /gene="echA1"
                     /locus_tag="SAVERM_492"
                     /old_locus_tag="SAV_492"
                     /product="putative enoyl-CoA hydratase"
                     /protein_id="BAC68202.1"
                     /transl_table=11
                     /translation="MRNDAYSTLRVSSEHGVARIILDNPPVNVIGATMMRELRTVLTT
                     LADDSSVRVIVFSSADPEFFLAHVDMRIGEKMDALQELAASAPADVNVFQAVGELIRH
                     QPQVTIVKLAGKARGGGAEFVAAADMAFAAAETAGLGQIEALMGIIPGGGGTQYLRGR
                     VGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAA
                     KRSLPADDLKEGLLGENDAWAATFSLPAAQQLISGGLKDGAQTPAGERDLEGLMRSVA
                     R"
     CDS             complement(639053..639388)
                     /codon_start=1
                     /locus_tag="SAVERM_493"
                     /old_locus_tag="SAV_493"
                     /product="putative secreted protein"
                     /protein_id="BAC68203.1"
                     /transl_table=11
                     /translation="MHDYSAALSAGTLAVIARVSLAIGKPFTLGIVKRTTPREAWGLK
                     PFIQTNVIITAVWTAAFTLTAVVLAFMAHAGNAHSTLAMLIQVVGFAVPMIFTVRYVS
                     RVQAKAGAR"
     CDS             complement(640006..640821)
                     /codon_start=1
                     /locus_tag="SAVERM_494"
                     /old_locus_tag="SAV_494"
                     /product="hypothetical protein"
                     /protein_id="BAC68204.1"
                     /transl_table=11
                     /translation="MSARFEEIDWRATFMGEISLRRRRDPVSGEDVYEVKLGDEYLMS
                     SLFTAGEVELARLGLAELPDGPLDVAVGGLGLGYTARTALDDPRVRSLIVVDALAEVI
                     DWHRRGLVPLGAGLASDPRCRLVRGDFFAMAAGSAAAARPVPADGAKVGGPVPAGGTA
                     RGASAAPRGLDPETPGRRFHAILLDVDHSPRHVLHPGHAALYRLAGLTAVAELLHPGG
                     VFALWSNDPPDEEFGSVLAEAFTETAAHVVNFDNPLQGGTAANTVYVARRYDG"
     CDS             641145..641333
                     /codon_start=1
                     /locus_tag="SAVERM_495"
                     /old_locus_tag="SAV_495"
                     /product="hypothetical protein"
                     /protein_id="BAC68205.1"
                     /transl_table=11
                     /translation="MARGGSITAEYGLEVLNTVIYLPRGEIFPITSSATLCNGFSRHR
                     DGSLQPPSHVGAGAVWRS"
     CDS             641343..641822
                     /codon_start=1
                     /locus_tag="SAVERM_496"
                     /old_locus_tag="SAV_496"
                     /product="hypothetical protein"
                     /protein_id="BAC68206.1"
                     /transl_table=11
                     /translation="MTGDWRMDRIGAALRGENPTVLRRLESGFAVIGDVQFLPGYSVL
                     LVDEPGVQRLSDLPKARRLSFLSDMDRLGEAVEHVCQRLDPDFRRVNLEILGNTDPFL
                     HAHVWPRFEWEPTELVGKPVWLYPGDRWSDEGFRLGPQHDVLRDGIESELDRLRSMG"
     CDS             642389..642613
                     /codon_start=1
                     /gene="int3"
                     /locus_tag="SAVERM_497"
                     /old_locus_tag="SAV_497"
                     /product="putative recombinase/integrase"
                     /protein_id="BAC68207.1"
                     /transl_table=11
                     /translation="MSSNGPACVPACPRVGPHRLRHALAGEMLRQGAGLAAIGQVLRH
                     QDLATTTLYAKVDFTALRAVAQPWPRTEAA"
     CDS             642610..643092
                     /codon_start=1
                     /gene="int4"
                     /locus_tag="SAVERM_498"
                     /old_locus_tag="SAV_498"
                     /product="putative recombinase/integrase"
                     /protein_id="BAC68208.1"
                     /transl_table=11
                     /translation="MTVLREALADYLRLRRSLGHQMAETAWLLPDFVAFMEDRGQTTV
                     TIAAALAWAKSREGEVVTTVSPRRVTAVRGFARQLIGTDPDTEVPPLGLLPYRQRWRP
                     PFLYSDADIAAVMAATDTFDPPLRAATYRTLIGLLAATGLRVSEAINLDRPQPKTQLG
                     "
     CDS             complement(643080..643727)
                     /codon_start=1
                     /locus_tag="SAVERM_499"
                     /old_locus_tag="SAV_499"
                     /product="hypothetical protein"
                     /protein_id="BAC68209.1"
                     /transl_table=11
                     /translation="MSSFNTHQRRVYDEDLPTRARHTNLRSCLVHFAPYGFRATYHHL
                     CLSAGIPKDLEKDPSSLIRAVEELHHARQLWLADERAYANRRRADKARGFRQVKRDES
                     WRGWQREWGNIAYCPEPTIHPDEPLPAVVERVLRSSVPPDEAPALTCRVCGNRDNTSV
                     WYDGAYRIHQLCRECGVSLAVQRAKAPDPRLAADHARKWKEIWRLRNESPRSYPS"
     CDS             643739..644002
                     /codon_start=1
                     /locus_tag="SAVERM_500"
                     /old_locus_tag="SAV_500"
                     /product="hypothetical protein"
                     /protein_id="BAC68210.1"
                     /transl_table=11
                     /translation="MPYHTRIALHFDSRFRLGRVLNESAARTKSEYRHHLHLAAPYAG
                     YWCQYVTDWVADKTRYRLTIDPTALAQRLAECPDLPITITLAR"
     CDS             complement(644154..645011)
                     /codon_start=1
                     /locus_tag="SAVERM_501"
                     /old_locus_tag="SAV_501"
                     /product="putative nuclease"
                     /protein_id="BAC68211.1"
                     /transl_table=11
                     /translation="MVDLGFVGPSRPANDYRFLSVTDGDTPNIAMAIRMVSIDTPESH
                     YGGAPATAQAALERAKTRLLDGTYDALPQDLRDYLVSRITPDAAQRHQSAGQAAAEAH
                     TAMVASRLAHPDGSQRKMAVIATGELVEGNGRLLAYTAPWFTGSASDPLPPRDDPRRR
                     TFNLDMVALGWAATFVIYPSIPPTKDLNLLLEEAEAAWTQQLGAWAQFGQDLLLGYEY
                     RACIKLGTKELTDPAAAIAQAYQRVCVDLRTLTEVGLYGYHQVPPQHRLWIWATDLEQ
                     ARKDLPISS"
     CDS             complement(645222..645671)
                     /codon_start=1
                     /locus_tag="SAVERM_502"
                     /old_locus_tag="SAV_502"
                     /product="hypothetical protein"
                     /protein_id="BAC68212.1"
                     /transl_table=11
                     /translation="MSPLHPSDHWLPPRPANRASRSSNTHLEPKVECGPSSVGVHVLE
                     WVHTSLVPERSADLHADAKPLKIVFTDDRGDPINPPVYKVTQTDPERVTLEVYTTAHR
                     CKWSVIVHWSVNGDDHKTKIPDKGQYVVTGTDAATEHRATDGELLRW"
     CDS             complement(646464..646712)
                     /codon_start=1
                     /locus_tag="SAVERM_503"
                     /old_locus_tag="SAV_503"
                     /product="hypothetical protein"
                     /protein_id="BAC68213.1"
                     /transl_table=11
                     /translation="MPAGTAGPAPAAGRELLGPGRQQRRDQRPPASEAHLNWSLITLM
                     SRRLTRKGHPDGWKKTGPMRKPGPTTLNQPRTSREMDG"
     CDS             complement(646906..647130)
                     /codon_start=1
                     /gene="infA2"
                     /locus_tag="SAVERM_504"
                     /old_locus_tag="SAV_504"
                     /product="putative translation initiation factor IF-1"
                     /protein_id="BAC68214.1"
                     /transl_table=11
                     /translation="MTKNKNVIEVEGKVVECLRSAMFTVELENGHQVLAHISGKIRKN
                     YIKIMLEDRVLVELPPYDLTRGRIVFRYRN"
     CDS             complement(648107..648520)
                     /codon_start=1
                     /locus_tag="SAVERM_7577"
                     /old_locus_tag="SAV_7577"
                     /product="putative IS5 family ISBce20-like transposase"
                     /protein_id="BAD67174.1"
                     /transl_table=11
                     /translation="MTTPPWIVDDDLWALIEPLLPPWPKRSSGPRPVDDRLCLQGFLY
                     ALHQDIAWQLLPLELELELELELGSGRADLLAAPGRAASTTGSATAKTPRCTSSRPLP
                     TSTTSRTPRPLPLVGLPPHLLETPQEVRIMIALRA"
     CDS             complement(648664..649314)
                     /codon_start=1
                     /locus_tag="SAVERM_505"
                     /old_locus_tag="SAV_505"
                     /product="putative monooxygenase"
                     /protein_id="BAC68215.1"
                     /transl_table=11
                     /translation="MRFHDGAVTDNGITLIDAWELPEDRIDESIARWRERVGLIHAAP
                     GFRDARLHRRLFPESRLGLVNVAHWDSIEARDEALADPGFTASAATAASYATVNGGWY
                     EVAAEFLAVGNGSGEGPGITIVNAFEVPAERIDEFLPHWLGRAELMTKAPGFRDNRLH
                     RAVVPDTRFQLVSIAHWDSPDAWRTADNDPRFQQSLSTSPDFAIADPALFRLVVEF"
     CDS             650027..650887
                     /codon_start=1
                     /locus_tag="SAVERM_506"
                     /old_locus_tag="SAV_506"
                     /product="hypothetical protein"
                     /protein_id="BAC68216.1"
                     /transl_table=11
                     /translation="METASLRAAPPPRFHPMASSAGPEDRDTEARSRPATRPLLLRIV
                     TVVGSSASFYLLLSVVPAYAQSAPGGGSDKAGLVTGALMLATVAGELTAPWLAARCGF
                     RVMLGAGLLLLGAPALALTVSQSMPCIVAVCLVRGLGFAFTLVAGGALTASLIPPELR
                     GEGLALIGVMAGVPSLVGLPLGAWLALHTEYGPVCSVAALIALVSIAAVPGLPGREAT
                     SAGSRYLVAGRVNSLAGVDFAGHTEQSNGLRAVILAKVRAWSTAVTRRRRPGGVVSTP
                     CTNGLLQPPV"
     CDS             complement(652300..653355)
                     /codon_start=1
                     /locus_tag="SAVERM_507"
                     /old_locus_tag="SAV_507"
                     /product="putative cinnamoyl-CoA reductase"
                     /protein_id="BAC68217.1"
                     /transl_table=11
                     /translation="MSTEDLSFPEDEKVLVTGGSGFVGAHTVVRLLREGHRIRVAVRG
                     PAQEAQVLAALRQAGVDRADLLEFAVADLSADDGWAQAMDGIAHVLHHASPFPPTPPE
                     TEDEVILPARDGALRVIAAARSAGIPRVVMTSSFAAVGYTLTPDDHYTEENWTDPNTP
                     GLPAYHKSKVLAEAAAWDYVKTNGGIELAVVNPTGIFGPQLVDRPSGSIGLIKALMAG
                     EMPVVPVWNFGVVDVRDVVDLHLRAMLHPAAAGERFLANSGSSSLFKIANILREQFPA
                     AADRLPATELTIDQVREAAKTEPALKDAAVLGGRIPEISHEKASSILGWEPLDVRDTI
                     VATAEALIELGAVTLPE"
     CDS             653742..654326
                     /codon_start=1
                     /locus_tag="SAVERM_508"
                     /old_locus_tag="SAV_508"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68218.1"
                     /transl_table=11
                     /translation="MTVTRTETTQRRPRADGQRNRARILEAALRLFVERGPDAPFTEI
                     AKQAGVGVGTVYRHFPAREDLIEAAYRSELDAVCAAAAELLEQAPPQDALRIWMDRFV
                     DYWATKIGLTEAIGAVVAAGRDPFAQSRGRVDEAVGTLLAATSAAGVTRPEVEPDDVV
                     VSLSGIAMVAPVLQDRDQVSRVLDLLYEGIRARP"
     CDS             complement(654353..654727)
                     /codon_start=1
                     /locus_tag="SAVERM_509"
                     /old_locus_tag="SAV_509"
                     /product="putative IS5 family ISSco3-like transposase"
                     /protein_id="BAC68219.1"
                     /transl_table=11
                     /translation="MGAMLYVDRTGIPWRYLPHDFALWETVYGYFAAWQKNGIFDQLI
                     CILRQLVRPAEGRNGEPSACVLDAQSVKTSANVPAAGQGIDAGRRGYCFAASTPGAGA
                     LWPLCDPDTPDLDEDDDGSEDP"
     CDS             654951..655112
                     /codon_start=1
                     /locus_tag="SAVERM_510"
                     /old_locus_tag="SAV_510"
                     /product="hypothetical protein"
                     /protein_id="BAC68220.1"
                     /transl_table=11
                     /translation="MRASTPKSDRWVSPRMSPSGSSGSAVSRTLEVRAKCRPNRPMGR
                     YGSLPRPAW"
     CDS             complement(655559..656608)
                     /codon_start=1
                     /locus_tag="SAVERM_511"
                     /old_locus_tag="SAV_511"
                     /product="hypothetical protein"
                     /protein_id="BAC68221.1"
                     /transl_table=11
                     /translation="MTTAADLSVFEQLDLPDTSLTRDTFAFAAQATPAFIHDHCVRSY
                     VFARAHAQNQGLRAGTDYDDELLFVSCVLHDLGLSEEGSNGDQRFEVDGADIAAAFLR
                     ERGVEEERIAVAWDAIALHTSEGIASRKGTEVALAHLGIATDILGIQRESLPAGLADE
                     VHALLPRQDLAHGFSDLIITQAVAKPHKASPTNFIGDLLRRHLPYGAYPNWYDLIDAA
                     GWGDKPVGVTARRRAETPQQVGTLFMEYLEAGDVEGLVSLYEPNAHFVPTPGTHLVGT
                     DAIREAMRQMVDSGARLKLEQREIRQVDDIALVSNNAILTGIGPEPVVSTTTEILRRQ
                     PDGGWVHAVDDPFFS"
     CDS             complement(656762..657562)
                     /codon_start=1
                     /locus_tag="SAVERM_512"
                     /old_locus_tag="SAV_512"
                     /product="putative hydrolase"
                     /protein_id="BAC68222.1"
                     /transl_table=11
                     /translation="MTSQHVVGRFFDVQGGQVYAHVREGDGPALIFLHYWGGSRRTWI
                     PVLQRLDPGQGFVAYDQRGWGGSTSVPGPYDLEQLADDAQRVVDALGYSRYVLVGHSM
                     GGKVAQILAARKPAGLRGVVLVAPAPPAPIGVTEQVQETVSHAYDNEEAVLQSIDLML
                     TRGGLTPELRRQVVEDSLRGGDEARLEWPRRGLVQDVSAGVSAIEVPVLVLAGSHDKV
                     DPPTVLADHLLPLIPTATLTVLKDTGHLSPLEVPDQVAAHIGAFVAQL"
     CDS             657798..658799
                     /codon_start=1
                     /gene="bdpJ"
                     /locus_tag="SAVERM_513"
                     /old_locus_tag="SAV_513"
                     /product="putative AraC-family transcriptional regulator"
                     /protein_id="BAC68223.1"
                     /transl_table=11
                     /translation="MAAPWTPCDIGAGRNIAAMNKHRVMVLAVDGVLPMDLGIPTQIF
                     NARPNTPYELTVCGDTEETVTTSAGFTLGLTAGLEALAEADTIIVPGFEDFRRPPRPR
                     VRAALKLAGRAGIRIASICTGAFAVASAGLLDGRTVTTHWASADDLEELYPRLRVDRN
                     VLYIDNDTILTSAGFTAGIDLCLHLVRKDLGAAVANDIARDIVAAPHRDGGQAQYINR
                     SLPTPQATTLANTREWALLHLEEDLTIPHLAGHAGVSPRTLTRLWRQETGVSPRQWLL
                     TARSNRARELLETTDLQVEQIAVRCGLGSGANMRARFRDALGVTPTAYRRTFQHQAA"
     CDS             658738..659214
                     /codon_start=1
                     /locus_tag="SAVERM_514"
                     /old_locus_tag="SAV_514"
                     /product="hypothetical protein"
                     /protein_id="BAC68224.1"
                     /transl_table=11
                     /translation="MTPSASHPRPIAAPSSTRLPDGEGQTGRHGTWAYGSDAHTPVDA
                     ARLLAWPRLASQDAERPGDWARIERTCRDGHTATWRAAEARLGRWGPDGNVRLAVATA
                     HPATLPAKATWYPATDLPRPGSPRVTESPCPPTTLAEIERIYGLRHWVEQSYKQVV"
     CDS             complement(659554..660030)
                     /codon_start=1
                     /locus_tag="SAVERM_515"
                     /old_locus_tag="SAV_515"
                     /product="putative oxidoreductase with iron-sulfur
                     subunit"
                     /protein_id="BAC68225.1"
                     /transl_table=11
                     /translation="MPMPSYSFVLNGERVTVEAPADMPLLWVLRDLLNVTGPKYGCGV
                     GVCRACTSHLDGGEIQPCVVPVADCADREVTTIEGLADGNRLHPVQQAWLDCDVAQCG
                     FCQPGQIMAAVALLKRTPRPSDADIDAIENVCRCGTYFRIREAIKKASVKFPRSGP"
     CDS             complement(660050..662125)
                     /codon_start=1
                     /locus_tag="SAVERM_516"
                     /old_locus_tag="SAV_516"
                     /product="putative oxidoreductase"
                     /protein_id="BAC68226.1"
                     /transl_table=11
                     /translation="MIYTLAASTLTVAAPLGCDTPAAEGAESVRARSDVLVTGADDEM
                     LVLEVTEANKVVVRLPRLEVGQGVTTAVAMMIAEELDARLVDVSIPLAEARRKGNQYT
                     GGSSSVSSLYGPARELAALARAKLVTAAARRWHIPARFLRTEGTRVIAPDGRSATFGS
                     LTASAARVGRPAVSSKPKPVSKHRVIGRPTPRIDARDIVTGRAQYAGDLAVAGAKPTV
                     VARPPTLGGRVRTLDDRAARAMPGVRAVVKVAGGVAVVADTFHHAFKARDALKITWVP
                     GPLAALSDAEIRARLQAAVPRFGTPPRGSAQTEAKFEFAFVSHAPMEVLTAVADVRAH
                     SAELWFASQSPMDARDSIASAIGLPASKVRVHVLRAGGSFGRRLNHDAALEAALVSKA
                     AGRPVKLMWSRADDIRHGRMRPADHHRIRASHAGGRVVAFAHSVATVSETNDGLSAGV
                     RPAAFARAAGPLPSHSGLYNFGSISGDWGSVDLAVPIGPWRSVSSGTSRTAEEIVVDE
                     VARALGKDPVAFRRTTLRGKAVRAVLDKVAAAGEWGRALPAGQAQGVAVHEEYGSCVA
                     CLAEIDATDPKNPRVTKVVMAADVGTAVNPSGLEAQLMGTAVDGISTVLRAGLHIDRG
                     AVRESSYADFRYARQRHAPLHFEAHIMPSRRAPGGAGELGVPAAAGAVANAYARATGS
                     RPRRFPLDF"
     CDS             complement(662516..663070)
                     /codon_start=1
                     /locus_tag="SAVERM_517"
                     /old_locus_tag="SAV_517"
                     /product="hypothetical protein"
                     /protein_id="BAC68227.1"
                     /transl_table=11
                     /translation="MQTLAAARRAAVRPPARAHLRRAEGRRGQRQQGRPPPAVTAEKA
                     DAVRTAYLDGQSIAALAREHGVSRGAIRTAVADLMPEHTTGPEDVPAPELPVLLDMPG
                     KVADFLREADLPDDQRSALAGGVTVRRGQGYTLRVNAAPSIHRELLARSQPLDGAQAV
                     PAQRKARREYENRVNALIAVGERS"
     CDS             complement(663079..663246)
                     /codon_start=1
                     /locus_tag="SAVERM_518"
                     /old_locus_tag="SAV_518"
                     /product="hypothetical protein"
                     /protein_id="BAC68228.1"
                     /transl_table=11
                     /translation="MHISEMFRPVRGTGHILDTLDVLHRDRLALRIHDGAFSAMDLTA
                     RPPRTGSCCPP"
     CDS             complement(663296..664171)
                     /codon_start=1
                     /locus_tag="SAVERM_519"
                     /old_locus_tag="SAV_519"
                     /product="putative hydrolase"
                     /protein_id="BAC68229.1"
                     /transl_table=11
                     /translation="MTRGGVRLSCRDWGGCGRPVVLLHGLAGHAGEWDTLAGALSPRY
                     RVIAVDQRGHGASERFPREVSRAAYVADVVAVLDQLALHRPVLVGQSLGGHTAMLTAA
                     AHPHLAHALVLVEAGPGGPNPRVQAEIGGWLDAWPTPFPSRESAVEFLGGGLVGEGWA
                     AGLEERDGWWPCFDREIMVASLAEIAQRSFWDEWARITCPVLTVLGQSGIISPQESET
                     MLRRLPVATAASVPGAGHDVHLERPAVLRHLIQEFLEENAAPRGPARRPGRGRDRGPG
                     RLRGGGRHLQPPPPA"
     CDS             complement(664226..664873)
                     /codon_start=1
                     /locus_tag="SAVERM_520"
                     /old_locus_tag="SAV_520"
                     /product="putative transcriptional regulator"
                     /protein_id="BAC68230.1"
                     /transl_table=11
                     /translation="MATREYKQFCGLARAMELVGERWSMLIVRDLLSGPRRYTDLRKG
                     LPAIPTNILSTRLKQLEEAGLATRRALPHPERAVVYELTDFGRDLEPALIALGRWGAR
                     TMTEPRPGEAITAEAVAMSFRTAFRPAAAQHVTVGFEVRMGEFTIRLQITDGVLAVGI
                     GEHPAPDLVIERLSGHPVRELMSGTKTPDEALADGSLRVDGDPALLARFAAMFRF"
     CDS             665000..665731
                     /codon_start=1
                     /locus_tag="SAVERM_521"
                     /old_locus_tag="SAV_521"
                     /product="putative secreted protein"
                     /protein_id="BAC68231.1"
                     /transl_table=11
                     /translation="MSKTLPPAARGMTPARAAPGLLAAAGITAGPLFLAAGLAQGLTR
                     DGFDFTRNALSQLSLGAFGWIQITVFFLTGLLVIGGAIAIRQELRDGPGGTWAPRLLG
                     AFGASFLLAGVFRADPGAGFPAGAPVGRVTSLSAHGTVHMLAGAGGYLALCAALLVLA
                     RHFTARRQPGWAMLARLVPVGVLAGFAASATTVAAFTAGAGLGLLGFSAVTARLTLPA
                     EREQPCSAARSNRTTPITARQETSA"
     CDS             665728..665937
                     /codon_start=1
                     /locus_tag="SAVERM_522"
                     /old_locus_tag="SAV_522"
                     /product="hypothetical protein"
                     /protein_id="BAC68232.1"
                     /transl_table=11
                     /translation="MTTPAKGPVSYFPAIEKKYGRPIAEWKDIIRTSPLTKHMELVAW
                     LKAEHGLGHGHANALVAHTLAEGSR"
     CDS             complement(666194..667279)
                     /codon_start=1
                     /locus_tag="SAVERM_523"
                     /old_locus_tag="SAV_523"
                     /product="putative Tn3 family ISSod9-like transposase"
                     /protein_id="BAC68233.1"
                     /transl_table=11
                     /translation="MSAWKVDGEGAGVRQEWSLEDVVACWTLVEGDRDLVANKSGPTR
                     LGFCLMLKAALRHVRRYFITVDNLRAAVRKLVNATFAARDAAWWGQGTACASDSKKFG
                     SWSSNFMTEYHARYGGNGVMIYWHVEKKNVCIYSKLKSCSSSEVAAMIEGLLRHCTDA
                     EIEANYVDTHGASVVGFALTELLNFRLLPRLKNMGSIRLYRPDDSPPGWPALGASLTR
                     PIKWDPIAQQYDQMVKYATALRLGTAEAEQVLRRFTRGGPKHPTYAALEELGRAVRTI
                     FACDYLASPDLRREIHGGLQVVENWNSANTVLHYGKDGALTGPDKEHAETSMLALHLL
                     CGPHSCTSHPAGAAGPGRAGLGEEAHR"
     CDS             668142..668879
                     /codon_start=1
                     /gene="cdh"
                     /locus_tag="SAVERM_524"
                     /old_locus_tag="SAV_524"
                     /product="putative CDP-diacylglycerol
                     phosphotidylhydrolase"
                     /protein_id="BAC68234.1"
                     /transl_table=11
                     /translation="MSENHWENQPGTPPDVTPECGQESDGERLYLWRQIVHWRSGTGG
                     SQCNPLIELDKQNHWSVMNGGATGASGWLLVPTDRKKGIECRDIWTHRDPNYWNAAWG
                     YVRSPYGSPTTTGLGINSKDKRTQDQLHIHIATFQSDAKTYLDARSPSEIATTPGDWA
                     KKLLTVPSDSKPGQVYRVLHVKDLATDNLFNLLQSNVVSSDQMGNQTMIVIPAKSGGF
                     YVLNSDISLSQGAAFGTGTCNHLLKCS"
     CDS             669258..669710
                     /codon_start=1
                     /locus_tag="SAVERM_525"
                     /old_locus_tag="SAV_525"
                     /product="putative IS630 family ISXo7-like transposase"
                     /protein_id="BAC68235.1"
                     /transl_table=11
                     /translation="MGEPIFKLYRVRFTEPGVGKYLMRWGLTFPRPDKRAIQQDPEAV
                     RIWREETWRAIPARAKAENGVVLFADQVGIRSDQVELHFLPSYSPDLNPDELVDADLK
                     RSLPHTHRARNQTELASETRRFFHRRQHQPHIVRGYFCGRHVGYVIDE"
     CDS             complement(670688..671113)
                     /codon_start=1
                     /locus_tag="SAVERM_526"
                     /old_locus_tag="SAV_526"
                     /product="hypothetical protein"
                     /protein_id="BAC68236.1"
                     /transl_table=11
                     /translation="MQREWLFSLIPLTIGVVFLSFGVYGLRRAKALRRTGVTAPGRIV
                     RHDVRRDDDGARYHHPVAAWTTPDGLECEHSSRFGRGSIGGRFGVGALVVVRYDPENP
                     RRFEIQGWDSAIVDRTFTILGALLTAATLTVLLVRLLTL"
     CDS             671956..672573
                     /codon_start=1
                     /gene="sig4"
                     /locus_tag="SAVERM_527"
                     /old_locus_tag="SAV_527"
                     /product="putative RNA polymerase ECF-subfamily sigma
                     factor"
                     /protein_id="BAC68237.1"
                     /transl_table=11
                     /translation="MTGITLAGKPAARLGRLAGVRSVRKAPRELDEERLVRLVARGDR
                     AAFEELYRRTAPWMALRLRRRCADEQIVAEVMQETYLAVWRAAGAFAGSSAGGTAAGW
                     LWTIAARRLVDAFRRRAHHAEPPVAAALPDAAPAAEEEALATAVGGDVGDALRRLAPE
                     LRQVLQAMVLDGLSVRETAVLLGLPEGTVKTRARRARIAMREALA"
     CDS             672570..673388
                     /codon_start=1
                     /locus_tag="SAVERM_528"
                     /old_locus_tag="SAV_528"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAC68238.1"
                     /transl_table=11
                     /translation="MSVEHASMRIIDGYARGDTDIAADEVWALEAHLEACGVCRDRLS
                     AAVTAEAPAVAALVGTVWSGLEPQLAATATMPRQRRWSARLSRWMTPTMMPWLAMVVS
                     VTLLALLLDLVDTGFGEVSLVLLLAPILPVLGVAASWSRGLDPAYELTASAPRAGLYL
                     VLRRTASVLAVVVPVLLVAGWVTGVTAAQWLLPCLAFTSTTLALGGVVGVTRAAVSLA
                     AVWAAAVVAPTLATSRTTFALQTGSLPVWGLVLALGTAVVIARRGAYSVLGAHR"
     CDS             673385..674218
                     /codon_start=1
                     /locus_tag="SAVERM_529"
                     /old_locus_tag="SAV_529"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAC68239.1"
                     /transl_table=11
                     /translation="MTIGKEHHMMSAVSAAGIAPTAYAWQIQATGLKVRVGRKRMAVN
                     GVDLSLGTGVHGLLGPNGAGKTTLIRTLATVLRPTEGTLEMLGESAGGMGEHRALRRR
                     IGYLPQEFGYYKRFTVREFVEYMAWLKEVPKADIPAAVQRAVERVGLADRADERMKAL
                     SGGMVRRVGIAQAIVNDPTILLLDEPTAGLDPAQRLRFRELLQELGTDTCVLVSTHLV
                     EDVAAACTNVVLFAEGRLVFQGPPDELASVGGPEHMGDSPLERGYSAMLLNPEQGRGT
                     W"
     CDS             674215..675609
                     /codon_start=1
                     /locus_tag="SAVERM_530"
                     /old_locus_tag="SAV_530"
                     /product="putative secreted protein"
                     /protein_id="BAC68240.1"
                     /transl_table=11
                     /translation="MNVRVLRIELKRSVAPWAGAVVLTTALAFLYLIPGSWWTGTTAW
                     TAQWTSMALWTRSVLFYLWPLAVGLGALQGLRDHRSKMSELLTSTPRPARHRAATLAG
                     ATALTLASAFALLVLVGAVQVVANTEYTHLGWLPISLVGALSLVAGAVLGMGAGRALP
                     SVLTPPALAMGAFVFTVLLQTSLGRTETTTATGLPSTEPNRVSLLSPAVQEVRDALVT
                     LSASVHVGQTIWLLAMAATGFALLVAATPRARLLALTPVLAGAALALLVLPSDPRRMY
                     VVDEAAAELVCDGPVCVTKTQQARLADLAGPGKEVLRLLHGALGSQAPVSVRENTAVL
                     PEGSTPQWSRTTVLFDFDDDLIAAAKGEELTRALIAKGLVPGCTPVGWSGFGSDEFAQ
                     TVAVGWVLGDLRPLPGTPASLRREVNAKTRPVWKKLKALPRAEQLSRINAMRTAALSC
                     KGDAFDALNGGASR"
     CDS             675606..676181
                     /codon_start=1
                     /locus_tag="SAVERM_531"
                     /old_locus_tag="SAV_531"
                     /product="putative secreted protein"
                     /protein_id="BAC68241.1"
                     /transl_table=11
                     /translation="MRWLTLYARSRQIPASLAAVVISAVAVWALARNGSGGPGDPRLP
                     ALALATGTMAASIGLSGQDLALDRTAAIRWVPRRAAHVLLCGAVVGTALLTAQAMGED
                     MATTAFVVRDSAGLMGLVALGAALSGGRHAWTLPFAWLSFSFFAPPPTSVPMRVASWM
                     LLPPGTAAGTWTALVLAVVGTAAYAVAGPRR"
     CDS             676319..676693
                     /codon_start=1
                     /locus_tag="SAVERM_532"
                     /old_locus_tag="SAV_532"
                     /product="hypothetical protein"
                     /protein_id="BAC68242.1"
                     /transl_table=11
                     /translation="MVVATPAKGKRLTDAVGAQNIAFSRPAGERVTAFGCPATTPQRG
                     EELLYCPGNSQRAPEGEQRVPCDLGGGASGGPWLAGFNSAAGKGTVVSVNSDGEGDGG
                     TPMYGPTLDKTARAVYDAAQRG"
     CDS             676902..677138
                     /codon_start=1
                     /locus_tag="SAVERM_533"
                     /old_locus_tag="SAV_533"
                     /product="hypothetical protein"
                     /protein_id="BAC68243.1"
                     /transl_table=11
                     /translation="MAPRSSKSWSTTAAASPARSPQPSPHHRCSVGVHGAEWTWPSLV
                     MILSGHMEATTPLGARAGVGLFEVVMYSLAVRPG"
     CDS             677241..678026
                     /codon_start=1
                     /locus_tag="SAVERM_534"
                     /old_locus_tag="SAV_534"
                     /product="putative acetyltransferase"
                     /protein_id="BAC68244.1"
                     /transl_table=11
                     /translation="MKIVSLGFRTDLMLLKMGGAVVTDHGTHLVVRTPANPGFHWGNF
                     LLFEVPPQPGDAPRWSTLFEAEFPETQYRAFGVDGVAGLVGDTAEHQVLGVTAEVNTV
                     LTADRLVSPVAAPHADVRVLTGDDDWRQALELHFACYGLPSGSDGRHFAERRVAGYRS
                     LCEAGHGSWIGAFVEGRLRAGAGLFSDGSELARFQNVETHPDFRRRGLASAVIHHAAQ
                     RALLAPGIRKLVIVADPDDHAIRLYRALGFVDTERQVQLHRAG"
     CDS             678091..678423
                     /codon_start=1
                     /locus_tag="SAVERM_535"
                     /old_locus_tag="SAV_535"
                     /product="hypothetical protein"
                     /protein_id="BAC68245.1"
                     /transl_table=11
                     /translation="MDTDGQDHLPCPGAQAARRGSRPPPSVGQDLLDCELVTAPQQGV
                     DVATDLPGLQRFAQRLERDLEAVIAGLAQPWIAGVVEGHVNRVKMLMRHMFGLAGFDL
                     SRDRVLLA"
     CDS             complement(678456..678746)
                     /codon_start=1
                     /locus_tag="SAVERM_536"
                     /old_locus_tag="SAV_536"
                     /product="hypothetical protein"
                     /protein_id="BAC68246.1"
                     /transl_table=11
                     /translation="MINLQVRHESGTVLAGSGHGVAWDESLAEIDRSQFPMLAGVCPF
                     ADTVFNTWQLPMLVEELDRLPAARGGPWVDAVRALCRTAEEGSHRYVWFVGD"
     CDS             679055..679966
                     /codon_start=1
                     /locus_tag="SAVERM_537"
                     /old_locus_tag="SAV_537"
                     /product="putative Sir2-family regulator protein"
                     /protein_id="BAC68247.1"
                     /transl_table=11
                     /translation="MRMRPTLSWTPPEDLPPATTDVEPVARALSNGGVLVLSGAGIST
                     DSGIPDYRGEGGSLSRHTPMTYQDFTAGVQARRRYWARSHLGWRTFGRARPNAGHRAV
                     AAFARHGLLSGVITQNVDGLHQAAGSESVVELHGSLERVVCLSCGAFTPRRELALRLA
                     EANVGFEPVAAGINPDGDADLTDEQVGDFRVVPCTACGGILKPDVVFFGEAVPARRVQ
                     HCRTLVDQATSLLVLGSSLTVMSGLRFVRQAAQAGKPVLIINRDATRGDPHAVTRIAL
                     PLGTALTTVAGRLDIPADDEAAAQTRQ"
     CDS             680351..680782
                     /codon_start=1
                     /locus_tag="SAVERM_538"
                     /old_locus_tag="SAV_538"
                     /product="hypothetical protein"
                     /protein_id="BAC68248.1"
                     /transl_table=11
                     /translation="MDFELIEGAPEFGCLIAEVEETGERIRLTADGEPAGVLLAAAEL
                     ATLEYWAARHNKGARPQDEPADEYPPGPTSYGPYIGYSHPHGGMTLTRGRLVVAELRD
                     AETVAWLEEQAMYGRQGYMGPKQSAAFAEFLARQTPVGDEH"
     CDS             complement(681371..682687)
                     /codon_start=1
                     /locus_tag="SAVERM_539"
                     /old_locus_tag="SAV_539"
                     /product="hypothetical protein"
                     /protein_id="BAC68249.1"
                     /transl_table=11
                     /translation="MTNSLGPDSGSRSGSHVMVRRGLTKSKCAQAEMVWVALVLLLTA
                     LPVGWCGLKDFKDALTFPGCVTGAALMVAALIMLVGVAAVVDCWIRGPISNFGVVALI
                     STGVALLTNVLLAFQTWNDGERVVYKVLSIVLSVGSLLAVIQVWRRLDEIPTPKRVAA
                     ALIVSTIVAVANFSYQYLFQPHRREVAPLVQLNVGKAVLSADRKAFSVPVDIKLVNHS
                     DVSFYVLGAEFHAMGEDVTVSPTDLDRSKWREGAEQWARYREKHPLTRREVYQPGKLV
                     AAQQWIPAGHWVEAKDEALTRTVVQLPIDTHFDKLTFYATLSLARKDRLVMGNFGRPG
                     YSWRGVELPHWVKAGQEDNDTIIQTADMQENNAIDHYTRESRRVTTYWRFGLHGVDVA
                     PVIVPVGEEGRTFSEQTNREVRNRYGLIDVLAGPVEQTLDEIKSRR"
     CDS             complement(683712..684113)
                     /codon_start=1
                     /locus_tag="SAVERM_540"
                     /old_locus_tag="SAV_540"
                     /product="putative MerR-family transcriptional regulator"
                     /protein_id="BAC68250.1"
                     /transl_table=11
                     /translation="MKEMVRHTGVHERLLRYYEQQGLLAPARLPSGYRIYSESDVETV
                     RRIRCLLAAGLPTSLIAQVLPCIRTDDDRLVPTCPDLVAQLAQERERITRAIKELQAS
                     RTMLDTVIAAAPVQGAETLRSPQPDADEASY"
     CDS             684229..684993
                     /codon_start=1
                     /locus_tag="SAVERM_541"
                     /old_locus_tag="SAV_541"
                     /product="putative 3-oxoadipate enol-lactone
                     hydrolase/4-carboxymuconolactone decarboxylase"
                     /protein_id="BAC68251.1"
                     /transl_table=11
                     /translation="MKGSGPALLLAHGAGGGIDGNFGLVLDDLARDHTLIGPHYPGAG
                     GSPLATEPLDLDELADQLVASAVAAGQESFVVLGESLGSAVAVRIASRHPERVRALVL
                     TAGFPVADPVLALAAQLIKTLAGAGQWRDMARLACLSCLSPTDLADIAPADLDALVTQ
                     TLAGMPPGTVDHFDLVSRVDVRADLGHLSAPTLVVAPTGDRLVLPQSSYRLAAGITGA
                     KLIELPGAAHILNEADRTTWLRHVREFLGTLPAKSA"
     CDS             685826..686794
                     /codon_start=1
                     /locus_tag="SAVERM_542"
                     /old_locus_tag="SAV_542"
                     /product="hypothetical protein"
                     /protein_id="BAC68252.1"
                     /transl_table=11
                     /translation="MGPWRDPTSAQALAVSLRPSGRSHRPTQVRRPPMAAGASNSTAN
                     ADWGKANFNDIYNCPDPRPYFATLRSLEYQIPHHGQAVFRALTYALRWLHPDRTPLNV
                     VDLCCSYGINTALLNCRVTLSDLSTRYTSHHLSALPTRQLAAEDRTFFAARRRPEAAT
                     ATGIDSAALAVGYARAVGLLDHAFAENLEVTEPSPALRRTLAGTDLITVTGGVGYVFT
                     RTFTRLLDCMPTPPWVAAFVLRTVPYQPIADLLARSGLVTEKLSARTFRQRRFADSAE
                     RYAAFHALAVNGLHTADKEADGFYHTDLYVSRPAPDIAALPLARLL"
     CDS             complement(687276..688139)
                     /codon_start=1
                     /gene="folD2"
                     /locus_tag="SAVERM_543"
                     /old_locus_tag="SAV_543"
                     /product="putative methylenetetrahydrofolate
                     dehydrogenase and methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="BAC68253.1"
                     /transl_table=11
                     /translation="MSATQTAQLMDGTGHARRIVEEAAAKAAEISQRTGTAPCLATVL
                     VGDDPASVTYVRMKRARCAKAGIRSRHIALPATTTTAELIDSLSGLSGDPEVHGILLQ
                     HPCGPHIDERAAFEAIAPAKDVDGVTMHSFAAMSFGLPGFVSCTPGGIMRLLEAYDVD
                     LAGKHAVVVGRSAILGKPVGMLLLAKDATVTYCHSRTADLSAMVREADVVVAAVGRPR
                     LIRGEDIKPGAVVIDAGYNPGNVGDVDFDAVLTRARLITPVPGGVGPMTIAVLLEQTV
                     DAAANQLGVQQ"
     CDS             complement(688569..689843)
                     /codon_start=1
                     /locus_tag="SAVERM_544"
                     /old_locus_tag="SAV_544"
                     /product="putative serine protease"
                     /protein_id="BAC68254.1"
                     /transl_table=11
                     /translation="MSGGALFWCAVGQDSAQRVNRLTPTPRRNHPSSVAVLCADCVRS
                     RDVGDVVTRNVTKAGLLAVAMATMLGASACGGEAGAAAGGTGGTLPAHGKGEPVAPAG
                     DGASSGSASTSPGTVGKLSGIAQTAASPITRHVPWNLDILDQRSRPLNGKFTTTATGK
                     GVHVYVIDTGMDIAHKEFGGRARLGADFVGPKDSGDCFNEGGIGHGTFVAGIIGGARY
                     GVAPKAELVRVQGILCESEGGGSPAAAEAAVVKSVKWVTAHAQKPAVVNMSLNFDHRS
                     AAVESAVKKMVDAGIPTVVSAGNFHDDACKHSPAGVPGTIVVAASTSNDRAWSDGGSY
                     GSGYGRCVDLYAPGQKVTAALAGGGTTTENDGATSWAAPHATGVIALYLSAHPHATAH
                     EVHVWLDHTATRGVVRDVRSDTPNRLLNTGGL"
     CDS             complement(690137..690814)
                     /codon_start=1
                     /gene="ribA4"
                     /locus_tag="SAVERM_545"
                     /old_locus_tag="SAV_545"
                     /product="putative GTP cyclohydrolase II"
                     /protein_id="BAC68255.1"
                     /transl_table=11
                     /translation="MRDSRNATASSDSRNPTGLSATTVRTRVTVPLRFGDGCTVTADL
                     ATFHHLADGQEHVAVILGEPAAGRPPLVRLHSECLTGDVFGSARCDCGPQLREALERI
                     ADRGGVLLYLRQEGRGIGLYNKLDAYALQDQGLDTYEANTTLGLPEDARDYTAAAQML
                     AALGIFELDLLSNNPDKAAQLRTLGLTVTQHVPTGVFTTAHNIRYLRTKVVRTQHTLP
                     LTELTVG"
     CDS             complement(690909..691955)
                     /codon_start=1
                     /locus_tag="SAVERM_546"
                     /old_locus_tag="SAV_546"
                     /product="putative dehydrogenase"
                     /protein_id="BAC68256.1"
                     /transl_table=11
                     /translation="MDTMLAGRVHLDTKKFAMEEIPVPVPGPGEVLIEVKAAGVCLSD
                     LHLIDGSITPLHLNSNVLTLGHELSGVIHSLGPGLKRDLAVGTRVALQAGQPCGECAR
                     CVSGGTCVSFRGRGVDYDGGWSQYTIAREDTVVPIPDTLPFDQAAIIPDAVSTSYAAL
                     VDTVQVRSAQAVGIWGVGGVGAHAVRLARMMGATPIIAVDPLPNARARALAFGADVAL
                     DPSDPGFVEAVLRATDGLGLDYAFDFAGVPRVREQASPLLGNHGALVLVGITTEPLKI
                     SEKMTFNLKNKKVFGHYGSSFDHVYELIRLAGSGRLDLAPSITDHIPLADVPEAIHRL
                     ENKIGDPIRLILVP"
     CDS             complement(692180..693268)
                     /codon_start=1
                     /locus_tag="SAVERM_547"
                     /old_locus_tag="SAV_547"
                     /product="hypothetical protein"
                     /protein_id="BAC68257.1"
                     /transl_table=11
                     /translation="MTGAPPQEREPVTTSGTIAVTNLHGQIDGLAVRLSRADTGETSA
                     APLAVAQGAALIDLLNLRGHILGRVADYERAAELAEQLVHVAPEDGTALLARARTRAT
                     LHRFAEAVADLGAAGRNGAEEATVDAERAVVLQALGCYADAMALIRKAAERQSDFTTL
                     GALAVLQAERGEVSEAERLFGEARRHYQGTSPFPLAQLDFRRGVMWHREGDLDAARSC
                     YEAARRRVPDYAPALGHLAEVELLRDDPQAAVALLRPLTWASDDPEYAGHLAAALHAC
                     DRFQEANQWRERAAARYGELVLRHPEAYADHAADFWLTVGADAERGLQLALQNLAFRQ
                     TARAHALFQRAVLAQNRVAQNRVAQAAP"
     CDS             complement(693265..694434)
                     /codon_start=1
                     /locus_tag="SAVERM_548"
                     /old_locus_tag="SAV_548"
                     /product="hypothetical protein"
                     /protein_id="BAC68258.1"
                     /transl_table=11
                     /translation="MADHFSGPRAIADPASDIADVYAFPSPERPGNLVLVLNTFPASA
                     PTALFSDAITYRFRVRPVTPGSESADAAFNVGEDEYVFDFTFDAPQKVDGTDTLLQMG
                     TCHAPSGRKIAFQVGNEVPTEAEELKIFAGSRLDPFFIDFVGVMVTEATGKLGFRSDA
                     SNVLEGLNALSIVLEVDAAVLGPAADSLVAVVGETVTSGGRPVRLERMGRPEIKNVIM
                     SPKKFDTVNSDLEIRDLFNEEDAFSVRPDYASTYRARLNANLAFYDGLDGKTAWPLDE
                     QGAHPLTELLLADFLVVDLSKPFSEDGCFEIETALLAGRPHTTCGGRSLNDDIVDTLF
                     TLLVGGIDGERISDGVDQPTQPATHSFPYLNAPNPTPPDLGARLAAQMPPREEAA"
     CDS             complement(694471..695799)
                     /codon_start=1
                     /locus_tag="SAVERM_549"
                     /old_locus_tag="SAV_549"
                     /product="putative peroxidase"
                     /protein_id="BAC68259.1"
                     /transl_table=11
                     /translation="MSIEKGNALEIDDIQAAALEPRPTPYAGAYLALRIDDRRQGREL
                     LRRLTPALDSVAAFDPERQVSLAVALSFQGLKALGVPEESLATFPEEFREGMAARAEY
                     IGDIGESAPENWEGPLGSKDVHLVLGGLAPDAARLETVLLLVRDALRDLPGVVAIWQQ
                     DVHVGPDEKEPFGFRDSIGQPAIEGTGIPGTNPYEEPLRAGEFITGYKDETHGITPVP
                     QPEVLGRNGTYVAFRKLHTRVADFRQYLRDRAKDPADEELLAAKFVGRWPSGAPLALT
                     PDKDDPELGADPARNNAFMYGDDPEGLKCPVGSHARRMNPRDAVVTGEVRLHRMIRRG
                     TTYGPPLPKGVLEDDGADRGIMFAFVGAHLDRQFEFVQRQWVNDGKFIGSPAERDPLI
                     GVNDDGGFTVPRQPIRRRFKGLPPFVVNRGGEYCFMPGLSALRWIADLDT"
     CDS             complement(695916..696545)
                     /codon_start=1
                     /locus_tag="SAVERM_550"
                     /old_locus_tag="SAV_550"
                     /product="hypothetical protein"
                     /protein_id="BAC68260.1"
                     /transl_table=11
                     /translation="MNATVTKKAGKGATDGVVSEMATYFHIKPGHEQECAAACQRMVE
                     ALKQAPMAATIKTGLRDTRHVIFNNGTELLWATTFETEWEPYIDDAFLTVGFEHFVDW
                     MQHTTEWDTKIAPWIEKSGGLESLTGDKTREGFDEHIIANMAGMRWILQDGQQKATAY
                     WNPVSSLTMSEITKAERINAAFQEVLDDPAAEEALQHPALKPLLAQAAS"
     CDS             complement(696920..697507)
                     /codon_start=1
                     /locus_tag="SAVERM_551"
                     /old_locus_tag="SAV_551"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68261.1"
                     /transl_table=11
                     /translation="MEDRTDPRLLRSRDAMVSAATALLTEGGLEAVTHQTVATRAGVG
                     RATVYRHWPGLLDLRLAALEAGMPPLPPMPEELRAASGNDPRAELVHRLGVLAERWDD
                     EQSGAVLAAILGGSRHDEGMRRLRESLLNQIADALRPAVAVAVERGRLRSDVTPETFA
                     MATAGPLFFERFLAGNRLGRDTVEAVVDAAMRGWS"
     CDS             complement(697702..699213)
                     /codon_start=1
                     /locus_tag="SAVERM_552"
                     /old_locus_tag="SAV_552"
                     /product="putative transmembrane efflux protein"
                     /protein_id="BAC68262.1"
                     /transl_table=11
                     /translation="MSQNTVAAARGVETAPKNGAVDPSHQRRWWILVVISLAQLMGVL
                     DGTIVNIALPSAQRELGFSDADRQWVVTAYALAFGSLLLLGGRVADLVGRKVTFLVGL
                     AGFAAASMVGGAANGFGMLVAARAVQGGFAALLAPSALSLLMTTFTDPRERAKAFTVA
                     GSVAGAGGAIGLILGGVLTEYLDWRWTMYVNVVFAVVAFAGGAALLRRTSRDTSSKLD
                     IPGTLLVSAGLFCLVYGFSNAETHGWGSVATWGMLAAGTVLVGLFGWWQSKAAYPLLP
                     LRVLLDRNRGASFAALFVSGAGMFGVFLFLTYYLQQSLGYSALKTGFAFLPMIVASSS
                     ASAVAANVLVPRIGPKPVVPLGMAIAAVGLVWMTALDLNSGYVTQVLPQLVLVGIGLG
                     AVIAPAMSLATSGVAAADAGAASAAVNTVQQVGGSIGVALLSTMASDAVTDYLSGRNP
                     KDPDVLAQAGLEGYSTAYWWSAAVFVIGLGVTALLYRRGVPQQDENAAPVVHM"
     CDS             complement(700072..700701)
                     /codon_start=1
                     /locus_tag="SAVERM_553"
                     /old_locus_tag="SAV_553"
                     /product="hypothetical protein"
                     /protein_id="BAC68263.1"
                     /transl_table=11
                     /translation="MNATVTKKAGKGATDGVVSEMATYFHIKPGHEQECAAACQRMVE
                     ALKQAPMAATIKTGLRDTRHVIFNNGTELLWATTFETEWEPYIDDAFLTVGFEHFVDW
                     MQHTTEWDTKIAPWIEKSGGLESLTGDKTREGFDEHIIANMAGMRWILQDGQQKATAY
                     WNPVSSLTMSEITKAERINAAFQEVLDDPAAEEALQHPALKPLLAQAAS"
     CDS             701238..702260
                     /codon_start=1
                     /locus_tag="SAVERM_554"
                     /old_locus_tag="SAV_554"
                     /product="putative LacI-family transcriptional regulator"
                     /protein_id="BAC68264.1"
                     /transl_table=11
                     /translation="MGRRRPGAPTLEEVAAHAGVGRGTVSRVINNAAGVKESTRRAVQ
                     QAIQELGYVPNLAARSLAGQRADAVALVLTEPDWRQFAEPFFSEIVRSLGDALADTGM
                     QLLLTLVRSDAERQRFLEFARGGRVDGALLVSVHDGDLLPDMLVEAGLPTVLLGRRSG
                     DEYVSYVDADNVGGARSAVSHLLKRGRRAIATVTGPLDMHVAQCRLRGYQEALAMAGL
                     RGEPSWVAESDFTEESGRRAMAELIERHPEIDGVIAASDTTAAGALQALHAAGRRVPE
                     DVAVIGFDDFPLAQQTKPRLTTVRQPLEEIGRAMVRLLLEEVEEPAVAWHHVILRTEL
                     VVRESA"
     CDS             702503..703630
                     /codon_start=1
                     /gene="celA1"
                     /locus_tag="SAVERM_555"
                     /old_locus_tag="SAV_555"
                     /product="putative secreted endo-1,4-beta-glucanase"
                     /protein_id="BAC68265.1"
                     /transl_table=11
                     /translation="MRPSPPHARSARGLFGALLTALVSLAALLTTASVAQADTSICEP
                     FGSTTIQGRYVVQNNRWGTSEAQCITATDSGFRITQADGSVPTNGAPKSYPSVYNGCH
                     YTNCSPGTSLPAQLSTVSSAPTSISYSYVSNAMYDAAYDIWLDPTPRTDGVNRTEIMV
                     WFNKVGSVQPVGSQVGTATVAGRQWQVWSGNNGSNDVLSFVAPSAITSWSFDVMDFVR
                     QAVSRGLAQNSWYLTSVQAGFEPWQNGAGLAVTSFSSTVNTGGGNPGDPGSPTACKVA
                     YATNVWQGGFTADVTVTNTGSSPVNGWKLAFTLPAGQQITSSWSAGVSPSSGAVTASS
                     LAYNAQIATGGRVSFGFQGSYSGTFAAPAGFSLNGAACTTA"
     CDS             703943..704353
                     /codon_start=1
                     /gene="celS1"
                     /locus_tag="SAVERM_556"
                     /old_locus_tag="SAV_556"
                     /product="putative cellulose-binding protein"
                     /protein_id="BAC68266.1"
                     /transl_table=11
                     /translation="MTWMKSASQEPINDGDGKAALFPYGYGLTYDATDPTPTQGACTA
                     QFRTVSSWQGGYQAEATVKNTGSAALTGWTVDWDPAGSTITSLWNGSLTTAQDRATVR
                     NAAFNGSLRPGATTPFGFTANGPTDTPAPHCTSS"
     CDS             704446..706671
                     /codon_start=1
                     /gene="guxA1"
                     /locus_tag="SAVERM_557"
                     /old_locus_tag="SAV_557"
                     /product="putative cellulose 1,4-beta-cellobiosidase"
                     /protein_id="BAC68267.1"
                     /transl_table=11
                     /translation="MTHRTGRAPEHGPRPGRRRRRTTSVAAALVTLALGLAGQLAGHP
                     AAAAEAHADNPFAGASFYVNPDYTDLVGTSAAQTSDATLKARMQKVGTYPTAVWLDRI
                     AAITGGAANAGRKSLADHLDLALAQKKPGQPITATFVVYDLPGRDCSALASNGELPLT
                     QAGLDRYKSEYVDAIANVFKNPKYRDIRITTVIEPDGLPNLVTNTADPECAQAKSSGI
                     YVKGIQYALDRLHAIPNVYTYLDFAHSGWLGWDNNLSQTVQLYTDVAKGTAAGFSSAD
                     GLITHVSNYTPLEEPFLTDPDKTVGGNMVKSSKFYEWNPNFDESDFTGNVHRALVAAG
                     WPASTGMVIDTSRNGWGGTGRPTTESSSTTLDTYVNESRVDRRAHRGLWCNVSGAGLG
                     QPPQAAPSGSPDSHLDAFLWIKPPGESDGASSDIPNDEGKRMDPMCDPTYTAPNAGGN
                     KTGALPNAPLAGHWFAEQFAMLVRNAYPAVLTDGGGTPGGDTTAPTAPTGLKATAKTP
                     SSVSLSWTASTDDTGVSGYDLYRGGTKVTASPVAGTAFTDTGLSAGTAYSYTVRARDA
                     AGNVSAPSASLSVTTDTSGGTPDPSGGLKVLYKNNDSSATDNAIRPGLRIVNTGSGSL
                     DLSKVTARYYFTRDSGSPTVNAWCDYAAVGCSNVSLKVVPLTTPVPGADAYLEVGFTG
                     GTLAVGQNTGDLQLRMSKSDWSNFDEVGDYSRGTSTTYTEAAAIPAYLSATPAWGAPP
                     A"
     CDS             707738..708082
                     /codon_start=1
                     /locus_tag="SAVERM_558"
                     /old_locus_tag="SAV_558"
                     /product="hypothetical protein"
                     /protein_id="BAC68268.1"
                     /transl_table=11
                     /translation="MPGTPRTPNDAANGAPAKTSARRSRTRIGRLPCGNAARATSSVR
                     SGIFGNPSGCRDIHTTHTTARQVNGRADDHPAPTACPPQPRGIAQQSPGPPQATSWPL
                     SRPAHPGRDQIR"
     CDS             708335..708796
                     /codon_start=1
                     /locus_tag="SAVERM_559"
                     /old_locus_tag="SAV_559"
                     /product="putative secreted protein"
                     /protein_id="BAC68269.1"
                     /transl_table=11
                     /translation="MKLTKRISLAAASAAVAGGALLGAGGTASAAVPESAHIERPAVS
                     IKADDYREDRGVNYRHNSEEDYRRDGYRARQHSDHFSDSDRYDRRGHSYYWDDEDRCW
                     KHDSNYRYDWDRSDRRDSNRDDRDWNRYDHDWNRYDHDSNRSNHDRVLDNR"
     CDS             709185..710330
                     /codon_start=1
                     /gene="nicT1"
                     /locus_tag="SAVERM_560"
                     /old_locus_tag="SAV_560"
                     /product="putative high-affinity nickel-transport protein"
                     /protein_id="BAC68270.1"
                     /transl_table=11
                     /translation="MTAAPTATGGLRSRWRRTSGSMGRAEWGRAAGMAAFIIALHVIG
                     WFTLVAIVAPEHYSVGTKGFGIGIGVSAYTLGMRHAFDADHIAAIDNTTRKLMDEGQR
                     PVSVGFWFSLGHSSIVFVLALLLSLGVKSLAAPVREDNSELHHVTELIGTTVSGTFLY
                     LIAIINIVILAGIWKVFRQMRSGHFDEAALEQQLNNRGLINRLLGRVMKSITKPWQMY
                     PLGLLFGLGFDTATEVALLVLAGSGAASGLPWYTILCLPVLFAAGMSLLDTIDGSFMN
                     FAYGWAFSKPVRKVYYNLTITGLSVAVALIIGTAELLGLLADKAGLHGVFWDWISGLD
                     LNTIGFVIVGLFFATWAAALAVWKLGRIEEKWTAGLRPPEQQADRQR"
     CDS             complement(710518..711135)
                     /codon_start=1
                     /locus_tag="SAVERM_561"
                     /old_locus_tag="SAV_561"
                     /product="putative NADH dehydrogenase/NAD(P)H
                     nitroreductase"
                     /protein_id="BAC68271.1"
                     /transl_table=11
                     /translation="MTDREPQALDVLDDAGRKVLFTEARTANTFAEVAVADDELAMIW
                     ELARWSPSAANGQPLRVLFVRTPEGKERLGRHLDEGNRAKTLSAPAVAILAYDVDFHE
                     QMPTVFPARGEMLRAAFADQTEKRESLAAYNSALQTGVFLLAVRAAGLAAGPMAGFDR
                     AGVDEEFFAGTSWRSHLVVNIGHPGADPWFPRLPRVPVEDAVAYA"
     CDS             complement(711283..713301)
                     /codon_start=1
                     /gene="acsA3"
                     /locus_tag="SAVERM_562"
                     /old_locus_tag="SAV_562"
                     /product="putative acetoacetyl-CoA synthetase"
                     /protein_id="BAC68272.1"
                     /transl_table=11
                     /translation="MTTPHPAPYPEPFFTPDPKSAAHSRIADFARWAARHQGAEGIQD
                     PTDYRALYQWSVTDLEGFWAAVWEYFDIDATTEYEGVLAEETMPGARWFPGATLNYVH
                     HALRNLQPDAPAITALDETGAGYEITGRELRARVASVAASLRDLGVAQGDRVVGYLPN
                     TPHAVIAFLATASLGAVWSVCGQDYVPKAAADRFAQLEPTVLITADGYLFNGTTHDRR
                     AASLELAVALPTLKATVLVDHVGLAWPEGGDLGLTVPWEDAATRAEYLTIAPVPFDHP
                     LWVVFSSGTTGLPKGIVHGHGGVLLEHLKMLGLHTDLGIGDRLLWYTTTHWMMWNLVV
                     STLLTGATTCTYDGSPAPQARPDVLWELAARHKVTVFGTSPQYLLAMSKLGIAPSVYD
                     LSAIRVVGCTGSALPASAYPWVRDHVGAGVQLASTSGGTDIVSGFAGSAATTPVWAGE
                     LSAPGLGVALAAYDEEGLPVTDRVGELVVTRPMPSMPLYFWNDPDGSRYRDAYFGAYP
                     GVWRHGDWITLTSHGSVIVHGRSDATLNRNGVRLGSADIHDVVERLPEITEALVIGAE
                     EPDGGYWMPLFVVLADGVGLDDSLRAKIRDAIRAGASPRHVPDEILAVPALPHTKTGK
                     KLEVPVKRLLQGAPAEQVLNPSAVDNPDLIAYFARLGAERNKRSAHHT"
     CDS             complement(713315..714925)
                     /codon_start=1
                     /gene="mhpA"
                     /locus_tag="SAVERM_563"
                     /old_locus_tag="SAV_563"
                     /product="putative 3-(3-hydroxy-phenyl)propionate
                     hydroxylase"
                     /protein_id="BAC68273.1"
                     /transl_table=11
                     /translation="MKAASQRPVVIIGGGPVGVMAGLLLARYGVRSLLLERHRDIYPL
                     PRAVVVDDEIRRILQSVGVHEDFAALARPALGLRLLDARRRVITEFPRSMHGHHGFPE
                     TSMFDQPELERVLRSALARRPECELQGGVEVVSVTQDTDGPNDPTGPARVTFRRDGSD
                     EEEHVWADAVLGCDGAGSLTRDSIGAVWEDLHFQESWRVIDVRTTRQVRTWEGAEQIC
                     CPNRPATFMRVGEDRYRWEFRLPEDENLDGPDGWERLRELVAPWVDLPPDASAGDDFE
                     VVRQAQYTFRARLADRWRRGRVFLLGDAAHLTPPFVGQGLCAGLRDAYNLTWKLARVL
                     QQGAHDGLLDTYERERKPHARHVIRVAVAVGWAMTGGQDRGAAFRRAVVGTASRIPGV
                     TAAVSRDLSPALTAGPLVRRRPRLTGRVLAGTICPQPWVRHDGRRVRLDDVLGDSFAV
                     VTAVPPTAQMTAVATALGAPTVHVEDLRDDGTLAGWLARGRADAVLLRPDRVVMDTVQ
                     AGTGDFTDTVAWAPLLHTARHTADARPA"
     CDS             complement(714922..715860)
                     /codon_start=1
                     /locus_tag="SAVERM_564"
                     /old_locus_tag="SAV_564"
                     /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
                     isomerase"
                     /protein_id="BAC68274.1"
                     /transl_table=11
                     /translation="MSTNVLRTNDGWWVVRDERAVRVQTKAVTTGELLADRDAVREAA
                     ASAESGTPVADLVALPPVTTPCRVVAQMVNYRSHAKDSGFTGDIPATFFRKASGSVSG
                     PHDTIIRPAHVKFLDYEVELGLVMGATLPVGTVVEEQDLPRYVAGLVLTNDVSARDVQ
                     LTKTQFYESKSYPTFTPTGPYLALLEPEDFAHLLNLRLQLSVNGVSRQDRTLADMIVR
                     PAQALTLLARFQTLDPGDLLLTGTPGGTALKAPPKAAEKIAALLPPALKWKAFFKGQA
                     KNPKYLRNGDLITATIATPDGRIDLGEQRTPVTDAA"
     CDS             complement(715857..716894)
                     /codon_start=1
                     /gene="bphC"
                     /locus_tag="SAVERM_565"
                     /old_locus_tag="SAV_565"
                     /product="putative 2,3-dihydroxybiphenyl-1,2-dioxygenase"
                     /protein_id="BAC68275.1"
                     /transl_table=11
                     /translation="MIKVADLAWLEFEKPDLDQAEVFARDFGFAIAARTEGELWLRGT
                     FAGSPCMVIRRGRASRFIGPAFRAAERADLDRLAGTTGSTVRDIGVPGGGQSVALLDP
                     SGLPVRVVHCAEQLPALPEQEPLILNFGTDHRRTNATQRPPREPSRIQRLGHVVLETR
                     VFARTLDWYLDTLGMIVSDFLFLDGQRGRGPTMAFVRCDQGSVAVDHHTLALHLGPGT
                     GYVHSAYQVTDLDAIGAGGEYLAERGYQRSWGIGRHIQGSQLFDYWRDPDHFMLEHFA
                     DGDLFSCDLEPGWAPMSASGLAQWGPPVTRDFLGASPSPAKLREVMTALRGDNELDPA
                     RLLGLMKAMSS"
     CDS             717140..717775
                     /codon_start=1
                     /locus_tag="SAVERM_566"
                     /old_locus_tag="SAV_566"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68276.1"
                     /transl_table=11
                     /translation="MPTSAPPKNRFERRRAETRQALVRAARQILAETGDTSASIQAIA
                     ERADVGFGSFYNHFESKTELFDAAVTDALDEFGQVIDERVEGIDDPAELVAAGFRLTA
                     RMADSHPELMRILRDRGLAYIHSARGLAPRALRDLENGIASGRFTCRNATTALSALGG
                     TLMSLVALRLARPDLDGDEAASDLAEMVLRMLGVPPDDAHQVTRRPLPDLD"
     CDS             717968..719413
                     /codon_start=1
                     /locus_tag="SAVERM_567"
                     /old_locus_tag="SAV_567"
                     /product="hypothetical protein"
                     /protein_id="BAC68277.1"
                     /transl_table=11
                     /translation="MDLTADSLLSRAAHELSPRADEVIHDVEQCLRREIPELWDEPDI
                     AQMTRENVAEHVVALLFGIEHSIEPRRIDQPAADAERARRLAQRGKPVTAMLRAFPLA
                     HARVLDRLLEELPRLTSDAESINAAARKLIALSIAYMARTSETGVLAFQEERDRQLQW
                     RLSVVNEASVRVGTTLDIARTAQELVDLATEHFADAVTVDLLDMPSGDEPPAKGTLVV
                     RRIAQQSVMDGYPETTSLEAIYGELPVSPQQVHRYPDGSPPARALATGRPSRHHLGPS
                     ASMLLVPLCARGTTLGVVQFFRHHRPDAYGDEDLLLAQEVAARAAVAIDNARRYTHAR
                     ATALTLQRSLLPRRHPRSPPWRSPAATCLLPPSSAWAATGTTSSRCPVPGSHSWWATW
                     SATASTPPPPWAGCGPPCAPSPTSTCRPTNSSPTWTTSSSACPPKSLPKPLPKRTPNP
                     QGTSGPPACTPYTIPSPAAAPSPARATCCPS"
     CDS             719128..720147
                     /codon_start=1
                     /gene="prpI1"
                     /locus_tag="SAVERM_568"
                     /old_locus_tag="SAV_568"
                     /product="putative magnesium or manganese-dependent
                     protein phosphatase"
                     /protein_id="BAC68278.1"
                     /transl_table=11
                     /translation="MVGDVVGHGIHAAATMGRLRTAVRTLADIDLPPDELLTHLDDVV
                     IRLSAEVSSEASAQTDTESAGDIGATCLYAVYDPVAGRCTLARAGHVLPVVMARDGIA
                     DILELPAGPPLGLGGLPFEAAEIDLPEGSLIALYTDGLVEALDHDIEAGLTRLCHALA
                     QPSASLEATCDTALDALLPAGRPHDDVALLLARTHTLGERQVVTWDVDADPAEVARAR
                     AHVSEQLTTWGLEELDFTTELVVSELVTNAIRYGRPPIQLRLIHDRTLMCEVADAGST
                     TPHLRRARVFDEGGRGLFLVAQLAEHWGTRHARRGKTVWAECALGAPELFSTGLDLEG
                     IPGVV"
     CDS             720606..721364
                     /codon_start=1
                     /locus_tag="SAVERM_569"
                     /old_locus_tag="SAV_569"
                     /product="putative hydrolase"
                     /protein_id="BAC68279.1"
                     /transl_table=11
                     /translation="MCEAFTLRRSSSMPAVLIHGVPDTHRVWDGVRRHLIRSDVEAWD
                     LPGFGTPRPRGFGSSKEECVDWLVERLERVGEPVDLVGHDWGCILTARVASIRPDLVR
                     TWAGSSAPVSTQYDWHPLAKIWQDPVEGDRFMDELDPASFAKDLMENFDLPAEVAEEM
                     VRRVDGTMRDSILKLYRSAETVGAEWEPELTNVSAPSLVLWGTLDPACPIAFADELGQ
                     AVRASQVVELDCSHWTLIQKPAEVAAALEAHWNA"
     CDS             721705..722091
                     /codon_start=1
                     /gene="ssgY"
                     /locus_tag="SAVERM_570"
                     /old_locus_tag="SAV_570"
                     /product="putative SsgA homolog (the deletion was not
                     affected on the sporulation)"
                     /protein_id="BAC68280.1"
                     /transl_table=11
                     /translation="MQLVVPHEISAPVSMRLRYEPSDPYVVRAAFTAVDSDETVEWII
                     GRDLLIDGLEGPVGEGDISIWPADGPDRSDSYILLNPPAGTALLKARTHEIKTFLQGT
                     EDLVPRGAEPGHIDLDTSLAHFLAEG"
     CDS             722855..723661
                     /codon_start=1
                     /locus_tag="SAVERM_571"
                     /old_locus_tag="SAV_571"
                     /product="hypothetical protein"
                     /protein_id="BAC68281.1"
                     /transl_table=11
                     /translation="MERGQRRHGPVGRADGAELGQSAPCRRVGASTSPASTRAPTLPS
                     TSRTSTSPLDHEPACGQTAAHEVHGRARLRAGHRGRDGPLFAAAGSAVSVSLPHFRYH
                     PDPVASGSIGESAEVCACCNRSTGWIYTATFYTAHDVSGSFCPWCIADGTAAERFEGE
                     FTDPYGLDGISQETLVQVTRRTPGLHAWQDPHWLVHCNDAAAFIGEVGYTELAAHPEA
                     LDQLRLDLRMGGWNDATQLEHFLTHLGQGASAMLFRCTVCGTHLAYADAS"
     CDS             complement(723643..724497)
                     /codon_start=1
                     /locus_tag="SAVERM_572"
                     /old_locus_tag="SAV_572"
                     /product="hypothetical protein"
                     /protein_id="BAC68282.1"
                     /transl_table=11
                     /translation="MTSASERGRRPLRVGNCSGFYGDRASAMADMARAGGIDVLTGEY
                     LAEVTMLVLGKARAKDSTKGFAITFLQHLDAAREHLVANRIRLVVNAGGLHPAGLAAA
                     TRELIARHGHDLRVSHIEGDDVFGSLDGLGQAGHCLPHLTSGQPLSDWPHQPVQMVKE
                     DAGDLGEMVDLLCCERVDEQAPHYLGMALGAASSKAVRPSGVSAAYMARDGPLWRSTR
                     PRLHRRVSWWWRRLSPSPAQLIAELICTHGPARGFRQGDERRVIGVGCGSLEGNACAE
                     LGRHEASA"
     CDS             complement(724687..725370)
                     /codon_start=1
                     /locus_tag="SAVERM_573"
                     /old_locus_tag="SAV_573"
                     /product="hypothetical protein"
                     /protein_id="BAC68283.1"
                     /transl_table=11
                     /translation="MAGDERAQPLLPHAEGGGQVVVFGEQPGQQFGARDAYAKPCPEY
                     RGHAPGEVAEQDDPFATALCKATGPLDDMADTLLARARPTGMRADDTTCLLVSPLSRA
                     PAVAAPTGHHRRATAGPRGGSGVVEPVPGAENGDRLLEFAGVVVSINYQVGDTLPRLK
                     HTVTTFQLFRYSAVTWNPHRIHFDEPYAREEGHGGLVAHSHLRAALALCHRGSRPQVA
                     RDEGCLPPA"
     CDS             complement(725598..726644)
                     /codon_start=1
                     /locus_tag="SAVERM_574"
                     /old_locus_tag="SAV_574"
                     /product="putative dehydrogenase"
                     /protein_id="BAC68284.1"
                     /transl_table=11
                     /translation="MDTMLAGRFHLDSKKFAVEEVPVPVPGPGEVLIEVKAAGVCLSD
                     VHLIDGSLVPLFATSDTVTVGHEVSGVIHTLGPDLKRGLTVGTRVTLEAGKTCGQCAG
                     CVRSRPCTQMRTAGIDYDGGWAQYTVAREDTLIPIPDNLPFDQAAIIPDAVSTPYAAV
                     VTTAGVRPAQSVGVWGVGGVGAHNVRLARLAGAAPIIAVDPLPSARERALAFGADFAL
                     DPAADDFADQIRAATAGRGLDFAFDCAGVPAVREQAAAALGLGGVLILVGISPRPLTI
                     TEGLTFNYLGKQVRGHYGGSPESVTELVRLAEVGRLDLAPSITDHLPLAEAADAVNRL
                     ENKIGDPIRLILVP"
     CDS             complement(726776..729997)
                     /codon_start=1
                     /gene="cyp2"
                     /locus_tag="SAVERM_575"
                     /old_locus_tag="SAV_575"
                     /product="putative cytochrome P450 /
                     NADPH-ferrihemoprotein reductase"
                     /protein_id="BAC68285.1"
                     /transl_table=11
                     /translation="MTTQPETDLRPIRSPRGVPLFGHTPQIPSTNPVEYFGKLSKQFP
                     EGLYGMEIAGIEQVFVWDPDLVAEVCDETRFFKQIDKTPLAHVRDYAGAGLFTAHQHE
                     EEWGMAHRVLLPVFSQRAMKGYFGQMLEIAQNLVGKWERKEGQPVNITDDYTRLTLDT
                     IALSGFGYRFDSFAKEDLHPFLNALLQALVESLRRSQELPVMTKMRKADDKKYRENIR
                     LMRDLVENVIKERREGKGTGEDDLLGLMLEATDPETGKGLDDDNVRDQVVTFLIAGHE
                     TTSGLLSFATYSLMRNPHILAQAYAEVDRLLPGDTVPDYDTIMQMDVIPRILEETLRL
                     WAPIPMIGKSPLEDTVIGGCYGLKKGARVNILEGPLHTHPKAWERPEEFDINRWLPEN
                     RVNHHPHAYKPFGNGVRACIGRQFALTEARLALALVLQKFKFADTDDYKMDVKEALTR
                     KPGGFELNVRARQEHERTVFGAADLQTDDTQAQAAVSGVGVNLTVAYGSSLGSCEDLA
                     RTIADRGERSGFGTTLVGLDELGDNLPTEGLLVVVASSYNGKAPDNAQRFDDLLAAGL
                     PEGSLSNVRFALLGAGNTQWVATYQGFPKRIEAGLLAAGATRVIERGIADAAGDFDGM
                     ATRWMDTLWTTLAEEYAADTSETTGPRFEVQLLTEAEVRPAIVSEQAYPLTVVANEEL
                     VSDATGLWDFSIEPPRPAAKSITIELPDGVTYDTGNHLAVFAKNEPVLVNRALARLGV
                     DRDQVLRLDQPGGGRTHLPVGTPVTTGLLFTEFVELQDVATRSQIQELAEHTQCPWTR
                     PQLQAYTADTAEAEERYQKEILGKRVSVLNLLERFPAVELPLAVFLEMMGPIRPRFYS
                     ISSSPLANPRHVRLTVGLLEGPALSGDGRYRGTCSSYIAGLESGDVFYGYVRVPSPTF
                     APPADPATPLLLIGPGTGIAPLRGFLEERAHQHAHGTQVGLSQVFVGCRHPEHDYFYR
                     QEMQDWEQAGIAQVHTAFSAVTGHPARFVQDAIVGAADTVWQAIQDGAYVYVCGDGRR
                     MAPAVREALAAIYRKHTGSDDEAAQQWLAQLEADERYQQDVFA"
     CDS             730897..731553
                     /codon_start=1
                     /locus_tag="SAVERM_576"
                     /old_locus_tag="SAV_576"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68286.1"
                     /transl_table=11
                     /translation="MATERKPPRGTRKRDVPLTKDGICAMALQLIDADGVEALTMRKL
                     ATALDANPMSLYHHVPNKDAVLRGVAHRVGSQFSAGQREDVPWQDQLRELARDFRELS
                     HRHPKLMGYSFTRPDYVQPEDPFWQALIDILAAAKLPDEEIPRVAATLVGVFTGLLLG
                     ELNGALQRWATLPPAPSGPDGEDAPPPSKDVIDTMFNSALDAAVSGVENHVARVREGA
                     "
     CDS             complement(732025..732822)
                     /codon_start=1
                     /locus_tag="SAVERM_577"
                     /old_locus_tag="SAV_577"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68287.1"
                     /transl_table=11
                     /translation="MERAKRTPRGTRKRDVPLTEAGICTSALRLIDADGVEALTMRKL
                     AAALDANPMSLYHHVPNKEALLGGVARMVGARFRTVTLEDAPWQERVRLLATDFRTLA
                     HRHPNLMAYSFSQPDFIQPEDPFWVALTAVLAAAGVPQSEIPQLAALVCAVVIGVMIA
                     ELNGALHRWSNLQPATPASGEDGPTNEGFGEDRMFRLVLDTIISGLESRLTADHAGGR
                     EGQPPQNSGCASGRIPRQLRPPAAHCEGESPGNPVSGMAAGLDPEVQ"
     CDS             complement(733207..733389)
                     /codon_start=1
                     /locus_tag="SAVERM_578"
                     /old_locus_tag="SAV_578"
                     /product="hypothetical protein"
                     /protein_id="BAC68288.1"
                     /transl_table=11
                     /translation="MCTWRWPTEALPPTEVDWTAGLDADEHGRGLLIIDCLADAHGDW
                     QEAGHAVHWADITTLS"
     CDS             complement(734105..734434)
                     /codon_start=1
                     /locus_tag="SAVERM_579"
                     /old_locus_tag="SAV_579"
                     /product="hypothetical protein"
                     /protein_id="BAC68289.1"
                     /transl_table=11
                     /translation="MSQYQLRVYTLRSPEALVAYENIWSQHIPGMAKHRITTHGVWTV
                     PAAPGSEEPQLYALVSYRDADDVQERLEAYLSSPEFRADMEGFDISQIVGVAESVLTP
                     TADSPLR"
     CDS             complement(734503..734922)
                     /codon_start=1
                     /gene="ssgZ"
                     /locus_tag="SAVERM_580"
                     /old_locus_tag="SAV_580"
                     /product="putative SsgA homolog (the deletion was not
                     affected on the sporulation)"
                     /protein_id="BAC68290.1"
                     /transl_table=11
                     /translation="MESLKTVMQEVAVQLVVSRTYSLSMCMSLRYEPTDPYVVRATFF
                     THTDEPTEWVLGRDLLADGLRGSAGCGDIRVWPAVGRGDKAMYIVLGAPAGTALLEVP
                     VQDVKTFLESAEALVPRGTESGHIDWDREVANLFAKG"
     CDS             complement(734950..735294)
                     /codon_start=1
                     /locus_tag="SAVERM_581"
                     /old_locus_tag="SAV_581"
                     /product="putative secreted protein"
                     /protein_id="BAC68291.1"
                     /transl_table=11
                     /translation="MEGFAQAAPDAAHRLHAADGADRTHQEGKTMKRLTRRVAVTAFC
                     VAVAGVAALGAGGTASAATSASVHGQRPAVSVDAGDYRWDHGVGYLLELGYSWDEIRG
                     WHHDGRDEISGC"
     CDS             735716..735925
                     /codon_start=1
                     /gene="fdxA"
                     /locus_tag="SAVERM_582"
                     /old_locus_tag="SAV_582"
                     /product="putative ferredoxin"
                     /protein_id="BAC68292.1"
                     /transl_table=11
                     /translation="MQTVVDLTRCQGYAQCVFLAPEVFQLHGEEGLLYATAVPDDQVE
                     RVRQAAAACPVQAILLGEEVSAGAR"
     CDS             735915..737279
                     /codon_start=1
                     /gene="fprA"
                     /locus_tag="SAVERM_583"
                     /old_locus_tag="SAV_583"
                     /product="putative NAD(P)H-ferredoxin reductase"
                     /protein_id="BAC68293.1"
                     /transl_table=11
                     /translation="MPGDLKDGRIVIVGASLAGLRAAEALREEGFTGSLTVVGDEPHP
                     PYDRPPLSKQVLLGQATADSTGLPMRQDPNADWRLGVRATGVDLLAKQVLLEDGESLP
                     YDRLLIATGTRARPWPNPAEAALDGVFALRTREDAGGLAQRLTAGPERVLVIGGGFTG
                     SEIASACRERGLEVTVAERGPAPLVGALGGTLSKLAAAMQRNHGVDLRTGVTVTALNG
                     NGSFTGAELSDGSRVDADVCVVALGAVRNVEWLAESGLAAGPRGIACDAGCRAFNMYG
                     IVTDDVFVAGDVSRFPHPLFGYQMLSLEHWGNAVEQAEVAAHNMVNPGPLQRPHLAVP
                     SFWSTQFGLNIKSVGVPTYSDHVVIAQGSLEARRLAMVYGYQGRVTAAVTVDMAKALD
                     YYRHLIETAAPFPPPPGAQDRAVAADLAIPSDVPDPKGLSHGPTVALTGYLPDRRLTL
                     VQPG"
     CDS             737312..738511
                     /codon_start=1
                     /gene="cyp3"
                     /locus_tag="SAVERM_584"
                     /old_locus_tag="SAV_584"
                     /product="putative cytochrome P450"
                     /protein_id="BAC68294.1"
                     /transl_table=11
                     /translation="MASDTLLARITDYANRPDPYPLYAELREAGPVVRQADGSYLIGT
                     YHEIVALLHDPRMSADPRSRTAPAPYEVTRKPSFLRLDDPEHHRLRNSAMRPFGPPHS
                     PGRVDSMRGEIVQLTKELAEVFQEGRQIDVVDDFAYPLPVTVICRLLGIPDKDEQLFQ
                     DWTDTLVASADIGPEGDTAERDQAADQAQQEMGQYLVQLAEQRRGRPTGDMLSDLVNE
                     PDPAARLSEEDLAANTILLFIAGHETTVNLIANGVLTLLRRPDQLDRLREDPSLLPRA
                     VEELLRYEPPVHMRERVPLVDIDVAGTTIPGGTSVILALASGSRDPMRFSEPDRFDPT
                     RPDNQHVGFGSGIHLCFGAPLARIEAEAALGALLPHLGTARLVQDPPPYRQNAMLRGP
                     RHLPIQL"
     CDS             complement(738601..739236)
                     /codon_start=1
                     /locus_tag="SAVERM_585"
                     /old_locus_tag="SAV_585"
                     /product="putative TetR-family transcriptional regulator"
                     /protein_id="BAC68295.1"
                     /transl_table=11
                     /translation="MPMPAPRRNRFERRRAETRQALVRAARQVLAESGGASASIHAIA
                     ERADVGLGSFYNHFAGKPDLFDAAVADALEEYAQAVDERLHGVDDPAERVAGGVRLSA
                     RMAASYPEIMQILCHSQLGRIYAGDGLAPRAKRDVEQGMAAGRFTVADPVIALTLLNG
                     GLLALLELWCNQPEADSDQAAGAMAETILHMLGLSPDEARDLAWRPLPAAA"
     CDS             739502..741964
                     /codon_start=1
                     /gene="prpL1"
                     /locus_tag="SAVERM_586"
                     /old_locus_tag="SAV_586"
                     /product="putative magnesium or manganese-dependent
                     protein phosphatase"
                     /protein_id="BAC68296.1"
                     /transl_table=11
                     /translation="MTKTDHTPLAEPVSPRETPDAAIAMLDAEGTVVGWTHAAEQLVG
                     YSAGEVVGRSATHVLPPAEDVPSASVFAEQGRALDGWSGAVTVRHRDGHAIKMTLRIS
                     LLWGQDAGTRWLVSVTDIGTLSSGTSDEAVRESLLAHAPVGIAVYDPRLRCTWVNDVM
                     ERHDGTPRERRFGRRLRDSLPAVEAEALEVVMRQVLESGTTMVHEYRAWSSTDQRREH
                     AFSASFFCLQDADGTALAVCSMSVDVTGNRRARERLAILSEASTRIGSTLEVMRTGQE
                     LADLAVPLLADHAIVDLMESVPFGVDPSAGTGTAANDRPPVLRRAGVASVDPGILKLL
                     MRQEVIRPFPTSLFATVLRTGRSYLESVLDTYSGPWILHDPARTQMVRDSGVHSLMVV
                     PIRARRCALGLAVFCRSEEPTPFQEDDLLLAEELVTRAALSLDNALQYARQRTAALTL
                     QRDLLPHHVGGGAALDVASRYVPADIDHGVGGDWFDVIKLSGARVALVVGDVVGHGIN
                     AAVTMGRLRTAVRTLANMELPPHELLAHLDDTVKRLSEEDADAPDQLPPAVGATCLYA
                     VYDPVTRRCTMSRAGHPPPAIIDPQGRATFPDMPAGAPLGLGLGLVPFESVELELPEG
                     TLLALYTDGLVESRDDDIDVGLDRLGAALAESGSALEDLCSQVIETLPTQAPADDVTL
                     LLARTRGLEPAQVASWELPNEPAAVRIARQAAARQLSEWGLDHLVTTEQLIVSELVTN
                     AIRYSGGPIRLRLIQHQVLTCEVSDSNPSHPRPRQPHTIDENGRGLSLVAQLSHRWGS
                     RSATDGKIVWAEQDLPSKALAA"
     CDS             742052..744481
                     /codon_start=1
                     /gene="prpJ1"
                     /locus_tag="SAVERM_587"
                     /old_locus_tag="SAV_587"
                     /product="putative magnesium or manganese-dependent
                     protein phosphatase"
                     /protein_id="BAC68297.1"
                     /transl_table=11
                     /translation="MDKENAKNAYSAGASQGSTGVSGSGPGGRRCACDGPAAAVLDDR
                     GAVVGWTETAEDLTGFRAGEVCGRPVQELVADLPDHLRGATDMPESGRVRLRHQCGDT
                     IDVTFRTTRVQGSAQVLVLAAPTHHVADHKQGTALLRALSAQNRITIALYDTDLATVQ
                     TNAKPDTPDGLPVQPGTRLSDVLCADDAENLEAVLRQVLETGVPVVRRTQQVSWRHNS
                     ARRHTLSLSAFRLEDVRARPTGVAALYIDSDDLRARRHLDLAREVAERVGGSLDVVRT
                     AQDLADVLAPAFGDLAAVDLAYSVLDGEEPSKQLNGGNMGNAALAPATAVWPAGIKRG
                     ESIPPLPDHPLWRSFRHGEPAVFSLDDFIAMVGDPQLVKYLAPKDAHSMMVAPLHARG
                     LTLGAISVWRCGRSDPFTEDEADLMKQIASRGALAIDNARRYTREHRAAVALQQLLLP
                     PATTDTPAAETAGVHLPAGGEADISGDWYDAIALPSLRLALVAGDVVGHGMSASAAMG
                     SLRAAIRTLADLELEPDELLTRLADLVQRLAAEAPSGDCDIVGGTCLYAVYDPVTRRC
                     AMASAGHPPPVLVRPDGTAEAVGISPGPPLALSGMPYETTIIDVEPGSVLALYTDGLV
                     ERSDRDIGQGLRRLTEALAAYCRPDRALDETGRALLADLADQAPRDDGALLLARTRAV
                     PAADTAHWEIPADPAAVAKAREWTTRQLTLWGLDDLLFATELIVSELVTNAIRYGRPP
                     MDLRLIRHNALVCEVTDSSSTQPRLRRARTTDEGGRGLFLVAQLGGRWGCRHVQNGKT
                     IWSEQVIQDSS"
     CDS             complement(744841..745287)
                     /codon_start=1
                     /locus_tag="SAVERM_588"
                     /old_locus_tag="SAV_588"
                     /product="putative AsnC-family transcriptional regulator"
                     /protein_id="BAC68298.1"
                     /transl_table=11
                     /translation="MAVNLDDVDWAIIGQLQREARISLSELGRRVNLSSSATTERVRN
                     LESLGVITGYHAVVDLAKVGYPVLAVVRLKYPGNRHQPLRRLLAERGEILECLRTTGD
                     DCYTLKVAASSMEHLETLVDELAGFGSTTTSVVYSQTLPYRSPSRP"
     CDS             745381..746199
                     /codon_start=1
                     /locus_tag="SAVERM_589"
                     /old_locus_tag="SAV_589"
                     /product="putative F420-dependent dehydrogenase"
                     /protein_id="BAC68299.1"
                     /transl_table=11
                     /translation="MQLGVNVPNFGPGTDPGVLRDWARLAEGLGFDLLMVSDHVAVTP
                     DVAERYPEPFYEPFTTLSWLAGLTTRLRLGTTVLVLPYRHPLLVARMAANLNQLSSGR
                     FVLGVGVGWARQEFDALGVPFTARGRLADEYLGALRDAWRTETGDGTAPIPVWVGGHS
                     EAAIRRTVRFGDAWHPLRLPLPLMRSVLANHSLPAFAPRIALRMTGTPVDDRERPAGV
                     GTIEQILDDLDQLRLLGAATVVLDPYHGDPEETRRPHAAWQALTAVATHWRTPS"
     CDS             746196..746633
                     /codon_start=1
                     /gene="cdd1"
                     /locus_tag="SAVERM_590"
                     /old_locus_tag="SAV_590"
                     /product="putative cytidine/deoxycytidine deaminase"
                     /protein_id="BAC68300.1"
                     /transl_table=11
                     /translation="MITIEDETLLRRAIGIAAHAVTLGDAPYGSLLTGPDGAILAEAH
                     NTVRRDNDIAAHPELKLARWAARELAPAAAARTTMYTSCQPCTMCAGGIVRSGIGRVV
                     YALSTEQLVELNPQSGDWPTVPQDGPVLFEEARAPIDAYYRPT"
     CDS             complement(746752..747162)
                     /codon_start=1
                     /gene="gvpK1"
                     /locus_tag="SAVERM_591"
                     /old_locus_tag="SAV_591"
                     /product="putative gas vesicle synthesis protein"
                     /protein_id="BAC68301.1"
                     /transl_table=11
                     /translation="MTPDTPRHQGRSDEAADAAPGPFRLFPAAPQDVPASGNESPPHP
                     ASRINTDPDTVERDLIKLVLTLVELIRQLMERQALHRVDAGDLTEEEEERLGMTLMVL
                     HDRLNDLCGRYGLTMQDLNIDLGPLGTLLPPSDY"
     CDS             complement(747159..747446)
                     /codon_start=1
                     /gene="gvpS1"
                     /locus_tag="SAVERM_592"
                     /old_locus_tag="SAV_592"
                     /product="putative gas vesicle synthesis protein"
                     /protein_id="BAC68302.1"
                     /transl_table=11
                     /translation="MMTDPSDFGPAKPRPPDRGSLPDRQVALIDLLDRLLTGGIVITG
                     DVTLSIADIDLVRISLRALIASIGTTTPSPWSRGGPLPVTSPGHPDQLPSP"
     CDS             complement(747446..748261)
                     /codon_start=1
                     /gene="gvpL1"
                     /locus_tag="SAVERM_593"
                     /old_locus_tag="SAV_593"
                     /product="putative gas vesicle synthesis protein"
                     /protein_id="BAC68303.1"
                     /transl_table=11
                     /translation="MTATVSYLYGVSAVPGGSYDVVAALRGIADAPVRLVPDEDANLA
                     AIVSSVPADDFDEAPLAAHLEDLDWLEAVARAHHRVVDAMAARTTVLPLRLATIYRDD
                     DRVRAMIRAGHRAFAQRLAHLAGHMEWGVKVYFDPPSAPTASTAAAPAAELSPGRAYL
                     RSRHQERDSRQDAYRAAEQAARRVEAAARTQAVEHVRHRLQQGPLSHGSGENIVNNAY
                     LVADGQAEDFRDAVQLAAEQSETIRVEITGPWAPYSFVSRQNEPGEMSEEAIT"
     CDS             complement(748258..748707)
                     /codon_start=1
                     /gene="gvpJ1"
                     /locus_tag="SAVERM_594"
                     /old_locus_tag="SAV_594"
                     /product="putative gas vesicle synthesis protein"
                     /protein_id="BAC68304.1"
                     /transl_table=11
                     /translation="MTEPVPSNLGSFPSRASPSYGQGSSANLADILERVLDKGIVIAG
                     DIQINLLDIELLTIKLRLLVASVDKAKEMGIDWWEHDPALSSHADGGRELAEENRRLR
                     EEIAGLRDAQALPSAEGPAEKPERPKKRASTAKSTRAGNRRTPRTER"
     CDS             complement(748704..748928)
                     /codon_start=1
                     /locus_tag="SAVERM_595"
                     /old_locus_tag="SAV_595"
                     /product="putative secreted protein"
                     /protein_id="BAC68305.1"
                     /transl_table=11
                     /translation="MRFSAGGGCADQEVSGGAPTMMNAAAGAVLLFGCLYEEAEEGHD
                     AEPRTQRTSAPCRESALTDTADAESRSERP"
     CDS             complement(748925..749176)
                     /codon_start=1
                     /gene="gvpG1"
                     /locus_tag="SAVERM_596"
                     /old_locus_tag="SAV_596"
                     /product="putative gas vesicle synthesis protein"
                     /protein_id="BAC68306.1"
                     /transl_table=11
                     /translation="MGLLTHLLTLPLAPVRGVGWVMQQVAQVAEEQYYDPDPVLKELA
                     ELERALVSGQIDQETFDRREDELLDRLEEITRFREGTGA"
     CDS             complement(749194..749916)
                     /codon_start=1
                     /gene="gvpF1"
                     /locus_tag="SAVERM_597"
                     /old_locus_tag="SAV_597"
                     /product="putative gas vesicle synthesis protein"
                     /protein_id="BAC68307.1"
                     /transl_table=11
                     /translation="MAVYVYAITAASHPLRLDGVTGVGEPPEKLRTVNSRSLAAVVSD
                     APDGLRAKRRDVLAHEAVLERLMAEGSVLPLRFGAVTSDDQAVLQVLDERAASYQERL
                     TALDGCVEFHLKASCDEDALLREILLQSPEAHQLNEQIRSGRAGPDLQIALGERVAGE
                     VQLRHESFAAGAVEALRPLARDIRASDPKGGDFVSVSFLVDKARQEGFTAAEQDLANE
                     RGADFDFRLHGPLPPYSFVEAT"
     CDS             complement(749920..750369)