LOCUS       AY395294                 712 bp    mRNA    linear   PLN 30-SEP-2009
DEFINITION  Oryza sativa (japonica cultivar-group) C2H2-type zinc finger
            transcription factor (ZFP39) mRNA, complete cds.
ACCESSION   AY395294
VERSION     AY395294.1
KEYWORDS    .
SOURCE      Oryza sativa (rice)
  ORGANISM  Oryza sativa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza.
REFERENCE   1  (bases 1 to 712)
  AUTHORS   Huang,J., Wang,J.F., Wang,Q.H. and Zhang,H.S.
  TITLE     Identification of a rice zinc finger protein whose expression is
            transiently induced by drought, cold but not by salinity and
            abscisic acid
  JOURNAL   DNA Seq. 16 (2), 130-136 (2005)
   PUBMED   16147864
REFERENCE   2  (bases 1 to 712)
  AUTHORS   Huang,J., Huang,F. and Zhang,H.-S.
  TITLE     A novel zinc finger protein cDNA, OsZFP39, from rice
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 712)
  AUTHORS   Huang,J., Huang,F. and Zhang,H.-S.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-SEP-2003) School of Agronomy, Rice Research
            Institute, Wei Gang 1, Nanjing Agricultural University, Nanjing,
            Jiangsu 210095, China
FEATURES             Location/Qualifiers
     source          1..712
                     /organism="Oryza sativa"
                     /mol_type="mRNA"
                     /isolate="7"
                     /db_xref="taxon:4530"
                     /clone="Z39"
                     /tissue_type="leaf; root; spike"
     gene            1..712
                     /gene="ZFP39"
                     /note="OsZFP39"
     CDS             18..698
                     /gene="ZFP39"
                     /note="QALGGH-conserved C2H2-type zinc finger protein"
                     /codon_start=1
                     /product="C2H2-type zinc finger transcription factor"
                     /protein_id="AAQ95583.1"
                     /translation="MGLNEKPLVPPLSPTPVDFRAHQVFPSKHHDFDTSKSRNISGSV
                     AIGSDSEEEYLATSLLMLAHGIRDETKDIRGMGDVKGVGVDTLELVKPSQRAYECSVC
                     GKVYWCYQALGGHMTCHRNLFAQVVAGDELSSDRTMVVKGHKCSICRLEFPSGQALGG
                     HMRVHYVGGVEGGSVKEKNVVKTKVTGALKLVLKDFDLNVPVVATMVGDEAESSHSEA
                     KARMMTLP"
BASE COUNT          164 a          162 c          224 g          162 t
ORIGIN      
        1 gtcgatttca taccactatg gggctaaacg agaagccatt ggtgcctccg ttgtctccaa
       61 cgccggtgga cttccgagcc catcaggtgt tcccatccaa gcaccacgat tttgacacta
      121 gcaagagtcg taacatctct ggtagtgtcg ccatcggcag tgattctgag gaggagtact
      181 tggcgacttc tctcttgatg ctcgcacatg gcattcggga cgagaccaag gacatccgag
      241 ggatgggaga cgtaaaaggt gtgggtgttg acactttgga gctggtgaaa ccaagccaac
      301 gggcttatga gtgctcggtg tgtggcaagg tgtactggtg ttaccaggcg ttgggtgggc
      361 acatgacgtg ccaccgcaac ctatttgcac aagtggtggc cggtgatgag ttgtcctccg
      421 ataggaccat ggtggttaag gggcacaagt gctctatctg tcgccttgag ttcccatctg
      481 ggcaggcgct aggaggacac atgcgggtgc actatgtggg tggtgttgaa ggaggctctg
      541 tcaaggagaa gaacgttgtg aagaccaagg ttacaggagc actgaagcta gtgttgaaag
      601 actttgacct gaacgtgcct gttgtggcaa cgatggtggg agacgaggct gagagctcac
      661 attcagaggc caaagcgcgg atgatgacac tcccctaacc agcgcaatac tt
//