LOCUS       AY347877                2283 bp    mRNA    linear   PLN 31-MAY-2005
DEFINITION  Oryza sativa (japonica cultivar-group) clone OsKS-mutant clone 1
            ent-kaurene synthase 1B (OsKS1B) mRNA, complete cds.
ACCESSION   AY347877
VERSION     AY347877.1
KEYWORDS    .
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
REFERENCE   1  (bases 1 to 2283)
  AUTHORS   Margis-Pinheiro,M., Zhou,X.R., Zhu,Q.H., Dennis,E.S. and
            Upadhyaya,N.M.
  TITLE     Isolation and characterization of a Ds-tagged rice (Oryza sativa
            L.) GA-responsive dwarf mutant defective in an early step of the
            gibberellin biosynthesis pathway
  JOURNAL   Plant Cell Rep. 23 (12), 819-833 (2005)
   PUBMED   15668792
REFERENCE   2  (bases 1 to 2283)
  AUTHORS   Margis-Pinheiro,M., Zhou,X.-R., Zhu,Q.-H., Dennis,E.S. and
            Upadhyaya,N.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2003) Rice Functional Genomics Group, Genomics
            and Plant Development Program, CSIRO Plant Industry, Cnr. Barry
            Drive and Clunies Ross Street, GPO Box 1600, Canberra, ACT 2601,
            Australia
FEATURES             Location/Qualifiers
     source          1..2283
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /cultivar="Nipponbare"
                     /db_xref="taxon:39947"
                     /clone="OsKS-mutant clone 1"
     gene            1..2283
                     /gene="OsKS1B"
     CDS             1..2271
                     /gene="OsKS1B"
                     /note="ent-kaurene synthase 1-like protein OsKS1B; similar
                     to OsKS1A sequence in GenBank Accession Number AY347876;
                     similar clones obtained from wild type and dwarf mutant
                     TT14-1-3-3-1-1 plants"
                     /codon_start=1
                     /product="ent-kaurene synthase 1B"
                     /protein_id="AAQ72560.1"
                     /translation="MQHRKELQARTRDQLQTLELSTSLYDTAWVAMVPLRGSRQHPCF
                     PQCVEWILQNQQDDGSWGTRGFGVAVTRDVLSSTLACVLALKRWNVGQEHIRRGLDFI
                     GRNFSIAMDEQIAAPVGFNITFPGMLSLAMGMDLEFPVRQTDVDRLLHLREIELEREA
                     GDHSYGRKAYMAYVTEGLGNLLEWDEIMMFQRKNGSFFNCPSTTAATLVNHYNDKALQ
                     YLNCLVSKFGSAVPTVYPLNIYCQLSWVDALEKMGISQYFVSEIKSILDTTYVSWLER
                     DEEIMLDITTCAMAFRLLRMNGYHVSSVELSPVAEASSFRESLQGYLNDKKSLIELYK
                     ASKVSKSENESILDSIGSWSGSLLKESVSSNGVKKAPIFEEMKYALKFPFYTTLDRLD
                     HKRNIERFDAKDSQMLKTGYLLPHANQDILALAVEDFSSSQSIYQDELNYLECWVKDE
                     KLDQLPSARQKLTYCYLSAAATIFPRELSEARIAWAKNGVLTTVVDDFFDLGGSKEEL
                     ENLIALVEKWDGHQEEFYSEQVRIVFSAIYTTGTQLGAKASALQGRDVTNPLTEIWLC
                     LMRSMMAEAEWQRTKYVPTMEEYMANAVVSFALGPIVLPTLYFVGPKLQEDVVRDHEY
                     NELFRLMSTCGRLLNDSQGFERESLEGKLNSVSLLVHHSGGSISIDEAKMKAQKSIDT
                     SRRNLLRLVLGEQGAVPRPCKQLFWKMCKIVHMFYSRTDGFSSPKEMVSAVNAVVKEP
                     LKLKVSDPYGSILSGN"
BASE COUNT          641 a          438 c          574 g          630 t
ORIGIN      
        1 atgcagcaca ggaaggagct ccaggcaagg acaagggacc agctccagac attggagtta
       61 tctacgtctt tgtacgacac ggcgtgggtg gccatggtgc cactgcgggg ttcccgtcag
      121 catccgtgtt tcccacaatg cgtggagtgg atattacaaa accagcagga tgatggatct
      181 tggggtacaa gaggattcgg cgtggcggtc acaagagatg ttctgtcgtc tacgttggcg
      241 tgtgttcttg cactcaagag atggaatgtt gggcaggagc acatcaggag aggactagat
      301 tttattggaa ggaatttctc cattgccatg gatgagcaga ttgctgctcc tgttggtttc
      361 aacatcactt ttcctggtat gcttagcctt gccatgggga tggatttaga attccctgtc
      421 agacagacgg atgttgatag acttcttcac ctccgggaga tagaactgga aagagaggct
      481 ggagaccatt cttatggaag aaaggcatat atggcttatg tcacagaagg attaggaaac
      541 ctgttggagt gggatgagat tatgatgttc cagaggaaga atggatcatt tttcaactgt
      601 ccttccacaa ctgctgccac attagtcaac cactataacg ataaagccct ccagtactta
      661 aattgtctgg ttagtaaatt tggcagtgca gtaccaacag tgtatccact aaacatatat
      721 tgtcagcttt catgggtgga tgcacttgaa aagatgggaa tttctcagta ttttgtcagt
      781 gagataaaga gcatcctaga cacaacatac gtttcatggt tagaaagaga tgaggaaatt
      841 atgctggaca taacaacatg tgcaatggct tttcgcctgt taaggatgaa tgggtatcat
      901 gtttcctcag tcgagttatc tcctgttgct gaagcttcca gtttccgtga atcacttcaa
      961 ggatatttaa atgataagaa atctctaatc gaattataca aggcttcaaa agtcagtaaa
     1021 tcagaaaatg aatcaatctt agatagcata ggctcttggt caggtagctt attgaaggaa
     1081 agtgtgagct ctaatggggt gaaaaaagct ccaatctttg aagagatgaa gtatgctctt
     1141 aagtttccct tctacaccac actggaccgt ctagatcaca agaggaacat tgaacgtttt
     1201 gatgcaaagg attcccagat gttaaagacg ggatacttgc ttcctcatgc caatcaagat
     1261 attctagctt tggctgttga agatttcagt agttctcaat ctatatacca ggatgaactt
     1321 aattatcttg agtgttgggt gaaagatgaa aagctcgatc agctgccatc tgcacgccag
     1381 aagttgacat attgctacct ttctgctgct gctaccatat tcccccgtga attgtctgaa
     1441 gcccgcattg catgggctaa aaatggtgta ctgacaactg ttgttgatga cttctttgat
     1501 cttgggggat caaaagaaga actagaaaac ctcattgctt tagttgagaa gtgggatgga
     1561 catcaagagg agttctactc agaacaagta agaatagttt tttctgctat ttatactaca
     1621 gggacccagc ttggagcaaa ggcttctgca ttacaaggcc gggatgttac aaacccccta
     1681 acagaaatat ggttatgtct gatgaggtct atgatggccg aagctgaatg gcagaggaca
     1741 aaatatgtgc cgacaatgga agaatatatg gcaaatgctg ttgtctcatt tgcactggga
     1801 cctattgtgc tcccgactct gtatttcgta ggaccgaagc tccaagagga tgtcgtcagg
     1861 gatcatgagt acaatgaatt atttagactg atgagcactt gtgggcgtct cctgaatgac
     1921 agccaaggct ttgagaggga gagcctggag ggaaagctga acagtgtctc actgcttgtt
     1981 catcacagtg gtggttctat ctccatagac gaggctaaaa tgaaagccca gaaatccata
     2041 gacacttcca ggaggaactt gttaagattg gtccttggag aacagggtgc tgttcctagg
     2101 ccatgcaagc agctgttctg gaagatgtgc aagattgttc acatgttcta ctctcggact
     2161 gatgggttta gctcgccgaa ggaaatggtt agtgcagtga atgcagtcgt caaggagcca
     2221 cttaaactca aagtgagtga tccatatggc tctattttgt cgggcaattg agtgcttctc
     2281 cgt
//