LOCUS       AP028056             3211969 bp    DNA     circular BCT 12-MAY-2023
DEFINITION  Brooklawnia sp. SH051 DNA, complete genome.
ACCESSION   AP028056
VERSION     AP028056.1
DBLINK      BioProject:PRJDB15718
            BioSample:SAMD00598191
KEYWORDS    .
SOURCE      Brooklawnia sp. SH051
  ORGANISM  Brooklawnia sp. SH051
            Bacteria; Actinomycetota; Actinomycetes; Propionibacteriales;
            Propionibacteriaceae; Brooklawnia.
REFERENCE   1  (bases 1 to 3211969)
  AUTHORS   Ueki,A. and Tonouchi,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-APR-2023) to the DDBJ/EMBL/GenBank databases.
            Contact:Akio Tonouchi
            Hirosaki University, Faculty of Agriculture and Life Science; 3
            Bunkyo-cho, Hirosaki, Aomori 036-8561, Japan
REFERENCE   2
  AUTHORS   Ueki,A. and Tonouchi,A.
  TITLE     Complete genome sequencing of a Brooklawnia isolate
  JOURNAL   Unpublished (2023)
COMMENT     Annotated by DFAST https://dfast.ddbj.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Flye v. 2.9.1-b1780
            Genome Coverage       :: 58x
            Sequencing Technology :: PacBio Sequel IIe
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3211969
                     /collection_date="2007-03-31"
                     /country="Japan:Hokkaido, Betsukai-machi"
                     /db_xref="taxon:3041175"
                     /isolation_source="methanogenic reactor"
                     /lat_lon="43.4556 N 144.7444 E"
                     /mol_type="genomic DNA"
                     /organism="Brooklawnia sp. SH051"
                     /strain="SH051"
                     /type_material="type strain of Brooklawnia sp. SH051"
     CDS             complement(962..2407)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000451023.1"
                     /locus_tag="brsh051_00010"
                     /product="sodium:alanine symporter family protein"
                     /protein_id="BEH00720.1"
                     /transl_table=11
                     /translation="MLDEILNRLSSIIWGPFVLIPLLLGTGIWLTIRLGGVQFTKLIP
                     ALKLALLRRHDADGEPGDVSHYQALATALAATVGVGNIAGVATAIHLGGPGALFWMWV
                     SAIFGMAAKYSEAFMGVRFRTTDAKGEMSGGPQYYLKKAIPNRFGSFLSLFFAIAAVI
                     ASFGIGNMTQSNSVAAAMESTFGVEPFIVGIVLAVFTALVLIGGIKSISRITSGMVPF
                     MIIFYVVAGLVVLAINWQGILPALGIVFSDAFTGTAAVGGFAGSAMAQAVQFGVARGI
                     FSNESGMGSAAIVAAAAKTKHPVRQGLVSMTQTFIDTIIVVSMTGLVIITTGVWQDGS
                     TGSALTSEGFSTGLPGQWGGSIVAIALIFFAYSTVLGWAYYGERNVERLIGVKGVMPY
                     RLIFSVVVFVGATVELSTVWTFSDVANGLMALPNLIGLLICSGLIARETKAYLAVDPT
                     LENEPAVSTLLGTASLQHIDEPRDDEPAIQR"
     CDS             2487..3596
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00020"
                     /product="hypothetical protein"
                     /protein_id="BEH00721.1"
                     /transl_table=11
                     /translation="MGCNSAPILVDIETWLNRRVSPCLLTLTIDSFAAMLNCEFSDHP
                     DYDALELQWFDDERHGRGMLAFLSRRSDGRVDYYLQPGLRLDRDAYAIGGGVGAWVET
                     EFETARLIVADDGVFAEAHFVDVDGRAIEVRIDDRDGQQRERAGLLAPISAGIQHPNS
                     LMLVWLPSFDLLRATSNKPVIRIGGADARVGRLPGERLHRRILVKYAAPIVVATVAEA
                     YDGSIAGLETSHQLVSGAAGSVGAVVAAADGHIARLCFVPEIPDPEAMSVDSSATGRW
                     QIAIDGTGITGGSWAIHRTHDRLELGVDVTERWRPGPLPLLMRLVTTMVPVFRRWPTS
                     YRWRATAQLGADPTLTSRWERTGSGGRYLNQDTSR"
     CDS             complement(3612..4877)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003420440.1"
                     /locus_tag="brsh051_00030"
                     /product="wax ester/triacylglycerol synthase family
                     O-acyltransferase"
                     /protein_id="BEH00722.1"
                     /transl_table=11
                     /translation="MRQPRDEERLSAADASNVVIDAPDQVNVFLIAGILGVGGFVAAD
                     GTIDIELLRATLAARLADPELKELARLSQRVRRSSQWETCDPDLAWHIRLVDPVDGRD
                     GLADLGAALMTVPLPLDRPMWELLIVPGASPAAPGMILRIHHAVADGVAGVRVVQRLF
                     DSGPAPEDPESLRASATPPARGWCRAFVTGAMRVLAMFRAAVPSTVLLGTIGARRGVA
                     FVDVDLGALAAAARTAGATINDALLAASVAAAEAALQAAGHPVPAVLPASVPVALPHR
                     GSSGNAVGVMVVPLPAGQTPTGERLARIAAATRSAKAEARAQGTYELTRTRWGSRLFA
                     WLARRQRFIAVFVTNVRGPEERLTVAGAPLEHAWPITPLQGNVRFGISAMSYAGRFSV
                     TVHLDAGVLDARVAGRALGEELAHITARQ"
     CDS             complement(4962..5690)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973740.1"
                     /locus_tag="brsh051_00040"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BEH00723.1"
                     /transl_table=11
                     /translation="MPENPEPTAVRVPKYYLVKKEILALIAGLAPGTPVPTERELAAR
                     FATSRTTVRQAIAELVVDGRLARTQGSGTFVAQPKLMVVRPLTSFSQDLQSEGWHPGS
                     IVLDISEVPASAEAAERLQVSPGTLVHRVERLRTAVDEPIAHEVALLPGPLPDLAGQL
                     AAHSSLYRTLHEAYDITIATAEDTIETVLADPVTADLLGVETGLPLLLINRTGWDPDG
                     HTVEWSVGRFRGDRFRFVSRQRLD"
     CDS             5811..7895
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00050"
                     /product="hypothetical protein"
                     /protein_id="BEH00724.1"
                     /transl_table=11
                     /translation="MSTTTSGSAAKQKSGLRIPGFAQLQRLGKSLMLPIALLPAAGIL
                     LRLGQPDLLGQITTPVIGPFFEAMSAAGSAIFSSLPLLFAIGVAIGFAKRADGSTALS
                     AAAGYLVIDAVFKTMSPVVLRDVVNQAGDQAVINYSVFAGIAVGLVTAWLFDRYHNIQ
                     LPPYLGFFGGRRFVPIVTSLACLIMGFALSYFYPIFNTGLTGVGAFIGGTGVIGAFVY
                     GFINRLLIPIGLHHIVNTYIWFIYGDYTTAAGNVVTGELTRFAAGDPAAGLLTSGFYP
                     ILMFGLPAAALAMIHVAKPKQKKVAVGILSAAGLTAFITGVTEPLEFAFMFVAFPLYL
                     IHAVLTGLSLAIAYALDIHLGFSFSAGLIDLLLYGSAPAAKDIPLLLVMGVAFFAIYY
                     FLFRFAIVKWNMRTPGRQDDDDFEAEQAANQTDASGSSGGATSPASAKAEQLIAAFGG
                     RANLVNVDACITRLRMEVADKSKVDQARLKALGAAGVVEVGNNVQAIFGTQADALKSD
                     IQDALAANPTDPIETIAAIEEIAPATVVAAEASAPAITVMAPIAGRPVALKDVPDATF
                     AEGIVGYGLAIDPPRDLVDAVAPVAGKVMQLWPHAFVILTDDQVAVLVHLGLDTVQLK
                     GEGFTTHVSQGDRVEAGQLITTYDVPAVAASGRNPIVPVVVMERKADAVAFTDAVIGD
                     QVAALDALFTVR"
     CDS             7932..8717
                     /codon_start=1
                     /gene="nagB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728169.1"
                     /locus_tag="brsh051_00060"
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="BEH00725.1"
                     /transl_table=11
                     /translation="MEIVICPDATEAGRLGANAIVALLQRKPDAVLGLATGSSPMAIY
                     DELVRRRQSGEVSFAQARAFTLDEYVGLASDHRETYHNVIRRDFVDRVDFAPAAVHGP
                     DGLAADLPAVCHEYEEAIVTAGGVDLQILGIGTDGHIGFNEPSSSLASRTRIKTLATQ
                     TRIDNARFFGGDVDQVPTHCITQGLGTIMDARHVVLVASGHGKAEAVHQLAEGPVSAM
                     WPATILQHHPHVTVLLDEAAAGRVQLYSYYRETYAAKPQWQGL"
     CDS             8744..9907
                     /codon_start=1
                     /gene="nagA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728170.1"
                     /locus_tag="brsh051_00070"
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="BEH00726.1"
                     /transl_table=11
                     /translation="MLITAERILTGTDVLCPGWLEITDGTISALGQGTPPRPIDPTAG
                     DLELGPQIVVPGFVDMHTHGGGSGAFPDATEQSSRTAVALHRRHGTTTLIASLVSAHP
                     EELLREVSVLGEQVQEGLIAGIHLEGPWLSSRRCGAHEPSALRRPDPAEISRVFAAAK
                     GGIRMVTIAPELDGALPAIHQIVELGAVAAVGHTDATYDQARAAIAAGATVATHLFNA
                     MRPVHQREPGPVVALGEDPRVTVEMITDGVHLHPALYRAVSCEVGPDRVALVTDAMAA
                     AGMADGSYNLGELAVEVREGVARLAGTDTIAGSTATMDRLFRNAVVNSGLPRDEALAL
                     AVRQTSINPARAVGLPEAGLVVGRPADLVVLDADLRVQRVLHRGSWVDGVMKD"
     CDS             complement(9894..10259)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00080"
                     /product="hypothetical protein"
                     /protein_id="BEH00727.1"
                     /transl_table=11
                     /translation="MAHGDITHIDIPVSDLGRAAGFYSDLFGWDIAEIPGFEGYPMWQ
                     APNGISGGGLAPRDDRFTQPRSYVEVDSIDDAIEKATRAGGSVAAEKQNITDSSWWAV
                     IVDPDGNYIGLFEGVVNPS"
     CDS             10424..12175
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00090"
                     /product="hypothetical protein"
                     /protein_id="BEH00728.1"
                     /transl_table=11
                     /translation="MDRLRIANRGPAWRILIAACGIALVVGAAVLIVRPLTALTGLVI
                     TLSAALVLAGVKVVGSRPRQPWRWIWAVLLVGVAPVLLLLLPSVVRALPGAVAISLVA
                     NAGRLAFRGMRSDPLSLRLGQGAYVLANLLVAYLVVAWPDLAAVLLAVGFSAAIGGIG
                     ALLLFGAIGPQRSHPRSRPPASAMRRIAGGIVVLAMAIAATTGSILLTAGTARVDDFY
                     TWRGDISATPGHVLRVADYSGEVPAGAAAVRVLYTATYSDGSPALASAVVAYPTSPTD
                     EPRPVLAWQHGTTGVARSCAPSAGPEALTEYAIPGISRAMERGWVVVATDYPGQGTPG
                     RYPYLIGEGEGRATLDAIRAAQQIEDAHASLNAWIWGHSQGGHASLWAAQIVVDYAPE
                     VTIIGVAALSAASDPLMLSERITGGQSTALTRVVISLVLVPYADEYPDVSLASAVHPA
                     GQGIVETFASRCVIERSTLVSVLVASALAWDAPLYRINVVSGPMHERLSQNIADGIVA
                     APLFLGQGVDDEVIPITMQRALDAKLCASGRTVETHEYPGRSHMGVIAQDSPLIDDLF
                     AWADAVAAGAAPGNCGS"
     CDS             complement(12194..13816)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013222247.1"
                     /locus_tag="brsh051_00100"
                     /product="exporter of polyketide antibiotics"
                     /protein_id="BEH00729.1"
                     /transl_table=11
                     /translation="MNELLVLLRQRRRRDRFQLAVWIISIGLLTYASTASVAGTYGDE
                     AGRTQILQLAVATRTVLVFRGTPNGPSLGAFVFFELFSWLAVMVGLMSSFLAVRHSRA
                     DEELGRAELVASTPAGRILPTVATVVHGLLANVVVGVLVALALIANGLDAAGSFVFGA
                     AVTAVGATCLAFGLFVAQLFRTSRGANGAGVAFVIGAYIMRGIGDAAGTPSDDLLHVT
                     PAWPSWISPIGWGQATGAYVRNDLRPLLLAVVFSAVLVAVVFGLQSVRDQGASLIPGR
                     PGRANAGPLLSSSVGLAWRLNSTVIASWAVGGAVGGLLATSLSSLVDEVGSEAPDVAK
                     VLQGSLGGAASLEQALMATVFGIVGVLACCCVVQIGIRARQEEAHGTAETVLTTPVPR
                     IRWLADYWLVGVLATLIVLACAALAGLVGVGRAADPDALATELVETAIAQIPVALVFL
                     GLTLLVFAYLPRATIPLAWSLVGFLAMLGIFGPLFGAPKWLVNVSPFTHAPVPVGDSV
                     DWTGGLWMIGIGLVTAALAVASMRRRELVTGG"
     CDS             complement(13813..14748)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015775688.1"
                     /locus_tag="brsh051_00110"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH00730.1"
                     /transl_table=11
                     /translation="MIQTRDLVKTYGRVRALDGLDMSVSAGEVHGFLGPNGAGKSTTI
                     RILLGLARATGGEATVFGEDPWRRAHELHRRIAYVPGDVSLWPNFTGGEAIDLIARLR
                     GDGKDKEAYLERKQRLIAAFEFDPRKKGRTYSKGNRQKVALISAFATPAELYLLDEPT
                     SGLDPLMEQVFNREVARVAEQGATVLLSSHILSEVEQLCNRVTIIRAGRMAETGTLAD
                     LRHLTRTEVAFSTQGQDPGVLTGVPGANDVRIDNGRVSFTIDSDRVTAVLPELARLEV
                     TGLTIKPPSLEELFLRDYGDELAPAGTRGSREVRS"
     CDS             14901..15563
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228192.1"
                     /locus_tag="brsh051_00120"
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="BEH00731.1"
                     /transl_table=11
                     /translation="MYSQGMESRERLVTAMSELMWERGYAATSPREVRERSGVGQGSM
                     YHHFPSKRDLALAALQRNCDDLLPATTDLLTGPDDPMDKIAAYLTRPRPALKGCKVGR
                     MTQDPLVATDPGLLAPVADAFATVHHHLTVVLREAAERGELSTAVDPERLAYLLSATI
                     QGGYVLAIAAQDPRPYDDACAGALELLRASAPPAQRHDEPISTTNIPAAASASAASER
                     ND"
     CDS             15565..16569
                     /codon_start=1
                     /gene="gap_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805120.1"
                     /locus_tag="brsh051_00130"
                     /product="type I glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="BEH00732.1"
                     /transl_table=11
                     /translation="MTVRIGINGFGRIGRSYLRAALANKADVQVVAVNDLTDASTLAT
                     LLEWDSISGHLDGVSVDGDVITVGANQIKVLSTADPSAIAWGEYGADVVIESTGRFTD
                     GAKALAHLSGGAKKVIVSAPAKGDVPTFVLGVNDDRLDPTASDVFSNGSCTTNSLAPL
                     AKVLNDSFGIESGLMTTVHAYTGDQRLQDAPHSDLRRARAAAVSTIPTSSGAAKAIGK
                     VIPELDGRLTGFALRVPIPVGSITDLTAVLTKSADVAEINQAFADAAAAGPLKGYLQY
                     SEAPLVSADIVGNPHSSIFDAPLTQVVGHQVKVLGWYDNEWGFSNRLVEFSERIGKAL
                     "
     CDS             16591..17199
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002680661.1"
                     /locus_tag="brsh051_00140"
                     /product="hypothetical protein"
                     /protein_id="BEH00733.1"
                     /transl_table=11
                     /translation="MSSNSAGIPRVAVLGTASGLILMAFFTVLWGSWSLVGLSGPLAV
                     AVIVAFSSLGVVFVVEGVRLLLILRRFPTIDTASRRAQTKRIGLRFGIIFGIEGVLIG
                     AASGLLATAGLSDYLNPVIALIVGLHFIPLARVFARTIDYYIAGWVVIVAITGICLLA
                     FSGTPVYTVWTMVSLATACGTSAYGIYMRQLSRRLRGERAAS"
     CDS             17360..17839
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00150"
                     /product="hypothetical protein"
                     /protein_id="BEH00734.1"
                     /transl_table=11
                     /translation="MTPSAAFTKRVRYGAAVAGLAGILVFAGCSAETDASEETPAAAT
                     SESSSTSTARTTAASTGKYADGTYTASGSYQTPETVETISVTLTLDNDVITEVNVIGD
                     PQARETQQYQGQFIGGISDVVVGKNIDEISVSRVAGSSLTSKGFNSAVDKIKSEASS"
     CDS             17839..18696
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_017143615.1"
                     /locus_tag="brsh051_00160"
                     /product="FAD:protein FMN transferase"
                     /protein_id="BEH00735.1"
                     /transl_table=11
                     /translation="MPEQWRFEAIGTRWEIETVRPLQPGERARITRLIDQFDREWSRF
                     RSDSIVSRLAVSGGETAAPPDAAAMLDVFRELSAATRGAVNPLIGESLARRGYDASYS
                     FVDTGPIAAPPDWTTALTWDDGLLRLAQPAVIDVGALGKGRLVDLISAAVSSITDGPI
                     VVDASGDLAVRGGPVRIGLEDPRDPRRAVGIWDVTDAALCASAINRRTWGEGLHHVLD
                     ARTGRPVREVIATWALASDAMHADAAATALFFSGGAELAHDWGVDWVRMTHEGRLEWS
                     PSTTAELFT"
     CDS             18979..20274
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00170"
                     /product="hypothetical protein"
                     /protein_id="BEH00736.1"
                     /transl_table=11
                     /translation="MFVLRPTIEPIGLAGLVIAAAVACASKYLLVWRGRHIFNPAAVG
                     ATVVTIVATVLPLDAGIGSSAWWVGSPILLVPVLVLGIIVAWRTEKLAVVSLFLLVAL
                     VVTTIRVGVQYQQAGLELSLGDAAWQMLSASPFVFLATFMLTEPLTTAPRRWQQLVVA
                     GVVGLAAGWPIPVGYLTLGQERALLIGNLVAFILCVRGSLRLSLTDRGWLTPTIQELV
                     FTVDDRLRFEAGQYLELEVPHPHPDSRGTRRPFSIVSAPEDLPTLRIAYRDGAQPRSS
                     FKTALADVERGGLLHATGVWGDFLLPADARRPILLLAGGIGITPFISQLRHLAASGQT
                     RDIVLVYVVSDPAIAFRDEIAATGIATVVFAQQAPDELPAGWTLAPSARIDGESLLAA
                     VPDLSSRDAYVSGPPRLIADLTPSLRGARTLTTDAFAGY"
     CDS             20330..22168
                     /codon_start=1
                     /gene="recQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224869.1"
                     /locus_tag="brsh051_00180"
                     /product="DNA helicase RecQ"
                     /protein_id="BEH00737.1"
                     /transl_table=11
                     /translation="MPDLSPLDVLRTTFGYDEFRGDQAQVIDHVIAGGDAIVLMPTGG
                     GKSLCYQIPAMVRTGVGVVISPLIALMHDQVSALESLGVRAGFLNSTQSYDEQRATEQ
                     RALNGELDLLYLAPERLDLPRTREFFDRLAISLFAIDEAHCVSQWGHDFRPEYLKLSV
                     LGERWPGVPRIALTATATTATRHEIAERLGLQQARTFVASFDRPNISYRIETKQQPLK
                     QLISLIRAEHVGDAGIVYCLSRKSVEATAAALVREGIEALPYHAGLPGPVRSANQSRF
                     LRDDGVVMVATIAFGMGIDKPDVRFVAHLDLPRSIEGYYQETGRAGRDGLPATAWMAY
                     GMADIVQQRQLIEGSDGDSAHKRLLGQHLDAMLGLCETLRCRRQLMLEYFGEASEPCG
                     NCDTCLDPPTPWDGTVATQKLLSTVVRLKRERNQRFGAGQLIDILLGRRTPRVEQWHH
                     DQLSTFGIGTELTDLQWRAMVRQLLAAGLLGVSADGHQTLEPTQASWAVLRGQRSVAL
                     RHDAITRAGAAKKRKDSTRTGSRASAVDDLVAGDRELFEQLRAWRAETARAASVPAYV
                     VFPDATLAAIAQRRPDSLDGLFAISGVGAKKLESYGEAVLQVISAG"
     CDS             22219..23085
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011727285.1"
                     /locus_tag="brsh051_00190"
                     /product="polyphosphate kinase 2 family protein"
                     /protein_id="BEH00738.1"
                     /transl_table=11
                     /translation="MTTNKPKLLAPLLRCPNGPVDARDFNPDAKPGYPNGKDKDGDDL
                     RTELEPLLDDLQERLFAAGTRSPQAPRVLLILQGLDTAGKGGTIRHVIGMMDPQGVHI
                     HSFKRPTAEELAHDFLWRIERELPRSGQVGIFDRSHYEDVLIQRVDHLAPPEEIERRY
                     GAINDFEAKLIASGTVIVKCFLTISRGEQKQRLAERLTNPEKYYKYNPGDLDVALKWE
                     SYMDAYSIALTRCNTDAAPWFVVPANRKWYRNWAITNLIIEALGSLNLGWPAANFDVK
                     AERQRLEALPSK"
     CDS             23200..24171
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011016957.1"
                     /locus_tag="brsh051_00200"
                     /product="L-lactate dehydrogenase"
                     /protein_id="BEH00739.1"
                     /transl_table=11
                     /translation="MTYDVVKIGIVGMGHVGPHAASALINWGVADVIYVSDIDEKKAQ
                     AEQLDLMDSTAFLPRPTRVISVGADYEVLARADVIINAAGDITKVATNRDGELYGTTD
                     IARTFVGRIAAAGFEGFWINVSNPCDVVTRLVHELSGLPSNHVLGTGTSLDSARLRRA
                     ISQRTGLSIQSIDAYMLGEHGASEVAAFSQVSIAGKPLAELAVERPGRFGFSGDDVER
                     DGLNGGYDIYNTKHCTEYGIGAAAARLAAAIVRGERTVLPASVYLCGQYGQSGFYIST
                     PAVIGADGVEDIYELRLTDTERERFLASCDKVKHNYELVRDHAARAS"
     CDS             complement(24199..25428)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011029150.1"
                     /locus_tag="brsh051_00210"
                     /product="pyridoxal phosphate-dependent aminotransferase"
                     /protein_id="BEH00740.1"
                     /transl_table=11
                     /translation="MSSPLSSSLSVQPDLAGPWQRTAAYAGLLGTDGRLSTTIFTEMT
                     MLARQLGAINLGQGFPDEDGPQQVLDAAKAAIDAGINQYSPGRGEPDLRAAIGEHQQR
                     FYGLEADPGTEILVTAGATEAIAATVLALVEPGDEVVTFEPFYDAYAAVIGLAGGRHV
                     TVALRAPDFQPDLDEFDTVVTDKTRLIIVNDPNNPTGAVFPAETLQHIVDLAHRHNAF
                     IVTDEVYEHLVFDGARHIPVATFPGATERTITISSAGKTFSTTGWKIGWVVAPADVIT
                     AILTVKQYLTFVNGAPFQPAIATGLRLGDDFYASIASNLQRKRTILIDGLQQAGFQVF
                     SPAGAYYVLVDTAAVGFEDATQLARRLPELVGVVGVPVSAFVQPEHVAQYRSLLRFAF
                     CKREDVLREAASRLAGL"
     CDS             25587..25940
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00220"
                     /product="hypothetical protein"
                     /protein_id="BEH00741.1"
                     /transl_table=11
                     /translation="MTVVPVDANQTAVQLRSLDGAVINNNFAADANLDPTSAIYSDLQ
                     DLKAAEPYINVWVVRREDVDDATLNRLVEIYHDPSVIGALLDENKGTAVAVDKTPQEL
                     QDILTGLEDLIRSQG"
     CDS             25985..27055
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005082323.1"
                     /locus_tag="brsh051_00230"
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="BEH00742.1"
                     /transl_table=11
                     /translation="MGATVSLRGVTKDFDTPGGSIRAVDNVSLDIGSGEVFGIIGYSG
                     AGKSTLVRLINGLETPTSGSVAIDGQVITGLPERRLRPVRAGIGFVFQQFNLLSSRTV
                     AGNVGFPLRVAGVDKRARERRVAELLDFVGLADKAQQYPDQLSGGQKQRVGIARALAT
                     KPSLLLADEATSALDPETTRDVLDLLRRANDRLGVTIAVITHEMSVVSYLCSRVAVME
                     MGHVVETGPVYDVFADPQRPVTRRFVGTALHDRPRADVVARLRQRHSGRIVTVAVTDQ
                     NGSSTLLTERLRHYGVDGAVIHGGITEIDSRPLGALTVELVGLDSAIEELLSDLRRHT
                     DVVDHGTAQNPIDSTDEDGDPR"
     CDS             27052..27714
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005057738.1"
                     /locus_tag="brsh051_00240"
                     /product="ABC transporter permease"
                     /protein_id="BEH00743.1"
                     /transl_table=11
                     /translation="MTSGSQSLWPVLFEALGQTLQMVFVTLGIGGLAGLLLGLGLYTT
                     RQGNLLSNRPVYFVLNLIVNIIRPIPFIIFISAMLPLTIKVTGTSFGPTAAIFPMSIM
                     ATVATSRIVEQNIVALDPGLIEAARAMGASPLRIIATVIIPEALGPLILGYTFLFVGI
                     TDMSAMAGAVAGGGLGDFAIVYGYQRYNFVVTWIAVGVIIVVVQLAQLVGNILARRVL
                     RR"
     CDS             complement(27750..29114)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003975885.1"
                     /locus_tag="brsh051_00250"
                     /product="FAD-linked oxidase C-terminal domain-containing
                     protein"
                     /protein_id="BEH00744.1"
                     /transl_table=11
                     /translation="MLTQLRESLGEQAVVTDPAVLAERSHDRSGSPAVGAPLAVVRPR
                     STDQVSLVMRLAHAHDVPVVPQGALTGLAGGANAVPGAILLDLTAMDQILRIDPIDLA
                     AVVQPGVITADLAAAAAEQDLFYAPDPASAAESTLGGNVATNAGGMRCVKYGVTRDAV
                     RSLEVVLANGDVIRTSPPTVKAVGGLDLTSLLVGSEGTLGVITEITVGLLPAPGPVRG
                     ITAGFSSSKAALDAANQIMAGPHRPSTLEFMDEVVIGATLAYDPDAGLPTDAKAWLLV
                     LTDARTAAADDIASYVDVVRRHGAMRVDVADDPDRVAELLRARRVLNPAMHALRGDSL
                     NEDVAVPRGRLFDLLVRLAELSDQVGLPIGTAGHVGDGNLHPVICFDPDDPDQVRTAH
                     RTHELVLGLANELGGTVTGEHGIGLEKLSAVDAELGPRLRGLQRGIKDVLDPTGVLNP
                     GKKL"
     CDS             complement(29146..29532)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00260"
                     /product="hypothetical protein"
                     /protein_id="BEH00745.1"
                     /transl_table=11
                     /translation="MNELSSAGPRTEPADVRLRSLRAEAETARAVARAKLSEIRSERA
                     AAVTDDEHDPEGSTLTYEWSLAQAELVAAESSLDQLDAALARVAAGTYGVCVECGRRI
                     TQDRLDARPAADTCIDCARKHARRTR"
     CDS             29656..32355
                     /codon_start=1
                     /gene="mgtA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002210890.1"
                     /locus_tag="brsh051_00270"
                     /product="magnesium-translocating P-type ATPase"
                     /protein_id="BEH00746.1"
                     /transl_table=11
                     /translation="MVQASQHDADTVVAGLNSGTDGLKDAQVNSARETYGLNVVSESH
                     APSLPATILGSFRNPFVLLLIVLAAIMVATNDHIGASTITVMVLISVGLNTTQEYKAT
                     RAAQALRAMVVATTTVIRQGKASEIPVAQVVPGDIIELKAGDLIPADLRVVRAKDLTV
                     SQSSLTGESRPQDKTAEPQDSTDENLLHARNVCFMGTSVLSGSGLGVVVTTGRNTYFG
                     AMARAVADVQPRSAYDLAIRRITLLLIRIMLIMAPTVFLLNWWHTGDWLQALLFAVAI
                     GVGLTPSMLPTIISANLARGTSFMAARKVIVKVPDSIENLGSMDVLCTDKTGTLTEDR
                     IVLQRHLDIEGKPSQLVLIIGYLNSMHSTGVRNTMDDAVIGAMNKSTGTALPAYRVVD
                     EIPFDFERRRLSVILDRVTDLDQLTPPDEVKDVGPQELHLAPGEDLLLTKGAVREVMS
                     VCSRVMHDGSITALDDAARATAVATAESLNSDGMRVLAVSTRIIGADAARAHFVHDNW
                     GYTPADEADMVLIGFLAFLDPPKESASAAIQDLHRAAVDVKVVSGDSGLVCAHVVDAL
                     NLWDDTPADARAQRSMTGAQVDQLDDEALAQRVNDVLVFSEMSPLQKARVVGALQARG
                     HVVGHMGDGINDTPALRKADVGISVTDGVDIAKDTADIILLEQDLRVLRDGILEGRRT
                     FGNIQKYLKITVASNFGNVFSVLIASVFIPFLPMLAVQLLVQNMLYDISQTSLPWDRV
                     DGSVLARPRRWTDGHITRFMVILGPVSTIFDVVAFLLMWFVFHATGTTASGAVDPTSQ
                     HLFQTGWFLVGICTQVMVVHMIRTEKIPFIQSTAARPVLWASAAAIAVALVLPVVPFT
                     AAAFSFVAPPATFYPWLLATVLAYCLLTQWVKTRYIRRWHEWL"
     CDS             complement(32360..32641)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_064243572.1"
                     /locus_tag="brsh051_00280"
                     /product="DUF3175 domain-containing protein"
                     /protein_id="BEH00747.1"
                     /transl_table=11
                     /translation="MAEHKWSQDVTAHSDALDLEEGVFTWSDPERIARSLLRSAQNST
                     RRKASSPYRSAMSMLTFYINRAGSGLSDERREVLERAKDELRRLHADEE"
     CDS             complement(32657..33952)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011015500.1"
                     /locus_tag="brsh051_00290"
                     /product="MFS transporter"
                     /protein_id="BEH00748.1"
                     /transl_table=11
                     /translation="MTTTYSALQIDTIPDRPRSVEIARRPEIRRAASPEGLRRGEPGY
                     LRASLALLAAGLASFNALYCTQALMPTLTASLHASPAQAALTVSAATGVLAVSILPAS
                     VLSERFGRGRVIVASALAATLLGLLLPLAPGLGWLVAGRALQGLLVAGVPATAMAWLA
                     QEIHPRDLPRAMGLYVAGNTVGGLLGRLIPSGVLQFAGWRLALGIDMAFALACAILIA
                     TVIPAERRFTPKRLRLSSELRTMAAQWRDRRLAGLFGVGFIFMGVFVSLYDFLGYRLN
                     STFGLPMSAIGLVFLLYLFGTLASAQAGRMVGHFGRDKALLVGAAMAIVGMPVIAAGQ
                     LWLMLPGVALFTYGFFTVHSVASGWVGALAPASRGEASGMYLACYYLGSSIIGYLSGH
                     VMHAFGWWGLVGWLVALIGIGCLFAGSVSRASHRLQRLS"
     CDS             34038..34928
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011015499.1"
                     /locus_tag="brsh051_00300"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BEH00749.1"
                     /transl_table=11
                     /translation="MLSDDLSWFLVLAETEHVGDAAAELRIPQPTLSRRLARLEQRMG
                     TTLFDRHGRSLSLNVRGKALRSRIRAAVTQLDLAESEVRRLLDPETGLVRFDFLHSLG
                     TWLAPQLIRAFATSHPRAEIRLHQGTGTELVDRVLDDEADIALSSPRPDRDDMAWLEM
                     WRQPLALCVPADHWLAGRSTVSLSDAAGEPFISTPKSFHSRDLLDAVAADEGIEAKVA
                     YESDELSTVAGLVVAGIGVALLPADDPYLPLAGATFIPLRTERTREIGLIWRADHDPE
                     STTGLFLEAARGLTAHSSAQ"
     CDS             complement(34917..36287)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005115126.1"
                     /locus_tag="brsh051_00310"
                     /product="DUF2252 domain-containing protein"
                     /protein_id="BEH00750.1"
                     /transl_table=11
                     /translation="MPADHTALYGPRPSVNELAQQGKQLRKQCPRSDLGTGCNFDRDP
                     IALLEAQNAGRVQSLVPIRWGRMSQSAFAFYRGAAALMAHDLAPTPVSGVRVQACGDA
                     HLSNFGFYASPERELVFDLNDFDETLPAPWEWDVERLVASLVVAARSSGFGDQVATTV
                     AIGCARAYRTAMRWLAARGALQNFHTLVKASELLSRSEQMDMGAAGKEIARATRKAEG
                     RTSETALQKLTTVCENGELRLVEQPPLMVRPQQWPDDIASVPKVYGASVGPDIRALLK
                     RFQPVDGMLRVVGVGSVGTRCFIELLVDATESPLILQIKEATTSVLEPYAGASELSQA
                     GERVVSGQRIMQAVSDPFLGWTCSDGHEYYVRQFRDMKGAFQIERLSADLLNKYGQLC
                     GLVLARAHAQTAEPALISGYLGKGTAFDEAMAAFALGYAEQNDADYQALLAAIAEGRI
                     TADSLG"
     CDS             complement(36400..37074)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00320"
                     /product="hypothetical protein"
                     /protein_id="BEH00751.1"
                     /transl_table=11
                     /translation="MALYLSEMAALGVVGFDPLGAIIMLTFIAGGARFGHTLTFTAVN
                     WIMIVVLGVAAGSALDAVLGPLRHWLQSVPRWAWVTVETASAVGLLVWAIVRVRTGLG
                     PDKQGGARSAPLWMLVAIAVGLAVAAFADPGYSGAVLAGSGHPASWRVVGLTLWYLIA
                     MSPLVLVCIADGLGATARVSAWLHRWLSRSRRPVWIITTALIVVVAVLLAIDALLLAA
                     TGKFLP"
     CDS             complement(37117..38055)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804147.1"
                     /locus_tag="brsh051_00330"
                     /product="universal stress protein"
                     /protein_id="BEH00752.1"
                     /transl_table=11
                     /translation="MSEQTQGAGRIRLDTAGRIVVGTDGSERARKAVDWAADRALARG
                     LPLLIVMVIPGPQIGRTFTAVTDEYQTQFKRRCQQRLNAELERLRAAHPTLDVKAELV
                     EGYASYVLAQASKNAAQVVVGARGRRAPISVKLLGGVSDAVASHAHGPVAVITDEAQE
                     NPGGPVVVGIDDSNEARAAAKLAFEAADLRGVPLVVIHAWDYAMLGTPWEYDIWDESM
                     SEILDTLTKNIEGVFADIKAQYPEVQVELRIVDSSASQALIDASIDAGLVVVGSRGRG
                     GFTGLLLGSTSKRVLREAHCPVVVTRAEGSKNGKQS"
     CDS             38297..39682
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804657.1"
                     /locus_tag="brsh051_00340"
                     /product="L,D-transpeptidase family protein"
                     /protein_id="BEH00753.1"
                     /transl_table=11
                     /translation="MALGIGAAVYTAYFSTHGLPGASVAGVSVTGQTKSQLAAELGER
                     ADQVSVTLQIDDHSRELSLADLGISVDAQATADQVFAANENLGQRYSAVFTKQTSPVV
                     ATVDESKIDALTAELVSEYGDPAKDAIVKLGDDNASFVIEPAQAGTGVDASDLTAAAD
                     RAVQTLSSQTVRLTTSQVDPHTSTDQAQTVADKANKLVALDVNLTGRESDSYPATATQ
                     KAQWITIPTAENGSLGEPVISQEKVAAWVQQTADTAGVEVVNGIRNVNQAGTVVSTLQ
                     EARDGWQVNNATQLADNLVNALGSGQPYAGSFSFDKVDPTYQDKVIADGAQNLSYAAA
                     PGERWLDVNLGNNTVTAYEGATVARGPIYVVPGMPGLETPTGKFNVYLKYQSQTMRGT
                     NLDGTTYVAENIPWVTYFTGSIAFHGAPWRDSFGWSGPGGSHGCLNMPVADAQFIYGW
                     APMGAVVVSHY"
     CDS             39730..41040
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_193485269.1"
                     /locus_tag="brsh051_00350"
                     /product="MATE family efflux transporter"
                     /protein_id="BEH00754.1"
                     /transl_table=11
                     /translation="MDRRLGSLAIPALGALIAEPLFVLTDTAMVGHLGETVLAGMSIG
                     STVMQTVIGLCIFLSYTTTPMVARRLGANDKPGAIRAGIDGIWLGLGLGVILLLVGLP
                     LTGTITSAFTPDPAVARQAYHYIAICLWGLPGMLTVLAATGLLRGLQDTRTPLAVAAG
                     GAVVNVILNWLFIYPFGLGIAGSALGTAITQTLMALVYAAVAVRAARANEVSLRPGIG
                     SPGHAFMVSSLMLLRTATLRIVLIVLVWAAARLGTSELAALQVTMAVYMLLVNTMDAL
                     AIAAQAMIGHDLGAGDSVGVRQQLNRIAGWGILVGVVLGIAVAVVSPVVGAVFTPDAS
                     VRALLPVSFIMMAVFLPMCGVLFVLDGVLIGAGDVRYLALAGLWPLVSFAAAIGAMMW
                     IRPVGIAAMVWLWLCYYGAFMTARLLVLLLRARTSAWLVTGHDR"
     CDS             41078..42514
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005813466.1"
                     /locus_tag="brsh051_00360"
                     /product="MFS transporter"
                     /protein_id="BEH00755.1"
                     /transl_table=11
                     /translation="MTEMSGGAGEQPVQRVSEAAVMTVRTGSNSRPKRSPCYALVTIG
                     AVCAQISAGIVLSGLSMFIDRIRADLWPDGQTSRAQVQSVYTVLLLVAIAMMPIAGRL
                     IGRWGGRRLLLIGGTISSLGLAAMSTAQGMGGLYAFAIITGLGFGMSVNYVPVILVNS
                     WFHKHKGVIMGVTVAGTGLGGILSSLVFTNTNQPVSEGGLGWRASMLIGAGLYAFFCL
                     VPAWLLVVNKPSDVGLPIYGKAAVGVDVATVRVGEVPVEQVPGLRLGQALRSGWFWLL
                     YAMVTLLGVFCAMGQITQPFFINQQTYPGSGMTPGLAGTLMTTQMVGLIMAKPVLGWL
                     IEAIGMVKAMIILMAIHGVAGYLLGTIVYPASGWIFLVIGLVGAGFAVGSLTPPLACG
                     LAFGQRDYASIYGVLGSAYALGLAIGSVLWSIAGTIAADPDQPWQLYREAMKWCWLLS
                     IVIITGYLFAIRGGRRAQCRLQSELTLN"
     CDS             42599..44131
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011031209.1"
                     /locus_tag="brsh051_00370"
                     /product="MFS transporter"
                     /protein_id="BEH00756.1"
                     /transl_table=11
                     /translation="MPATVVRETSRTHRLRWSALAVLALGLFIASLDNTILNVALPTL
                     ARELHASTDQLQWTVDAYQITYAGLLLVAGGLVDRWGRSRTFLVGTAVFGSFSLMAGL
                     VGTTGLLISARALMGVGAALLAPSTLALVSSLFSDPKERTVAFALWSGANGAGGAVGP
                     LLSGVLLEHFSWGSIFLINVPLAVGIVVFGFFVLPHSRPRPVAGGVDYLGAVLSTVAL
                     ALICWAVISAPGLGAGNVLVIGAAIGGLSLLAAFIYWESRVPAPLLRLSLFKIRTFSV
                     AVGVSGLVTAAGAGALFVLTQYLQFILDYTPMQTGIRVLPIAVAMLVGAVSAPRFIDL
                     VQLKVTVLIGLLCVGIGYGWLATTSDSSAFGHLLPGVVLFGLGAGLLVPAATQAVMDA
                     LPPDATGAGSATNTALMQVGSALGVAVIGSLLTARYRGVMMSSSIWDQLGDLQSVALE
                     SVAGAARVAEQLTAELGAQLNQLAGHAFVAGMQISLLVCTIAVFAALIAVFVLYPRDR
                     RF"
     CDS             complement(44146..44403)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00380"
                     /product="hypothetical protein"
                     /protein_id="BEH00757.1"
                     /transl_table=11
                     /translation="MPRLNPSPVIMPGVDARQPLRIERPKDAGRACQARRAPPIRTLT
                     VGTGIPPVQPPAIHVDDLRVADYHRRFGLSPTPGTFNIAQS"
     CDS             44402..45217
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256708.1"
                     /locus_tag="brsh051_00390"
                     /product="ABC transporter permease"
                     /protein_id="BEH00758.1"
                     /transl_table=11
                     /translation="MDIRLRHTPLPLRIAAPIVAGLIFLLAWWLVTSFGSIPATLLPS
                     PGTVVGRLGRELASGRLWAPIGVTITEAAAGCLLASVIALPTAYLIAHVRLAEATLAP
                     YLAASQAIPAVALAPLLVIWVGYGMRPVVLLCSVMVFFPMVLSTVLGLRSIDREVLDA
                     ARVDGAAGAQMARWIEWPLALPATLTGVRNGFTLSITGAVVGELVMGGNGLGQRLAVQ
                     SQSSDTTGLFTTLIVLCVLAIAIYLGMTFIEWLVNPFASSPRWYRLTHPHHEK"
     CDS             45230..46243
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010886913.1"
                     /locus_tag="brsh051_00400"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BEH00759.1"
                     /transl_table=11
                     /translation="MQSMTRRTLLGSALLAGLAACARPSDGSSPATTGSDGGSAAAAL
                     TLGLTYVPDIQFAPAYVADKLGWFTEEGVSVTLRHHGANESLLGALQTGDEQVVFAGG
                     GEMLQGRSEGVTVRNFATAYQTYPATIIVPADSPIQSFADLRGHSVGLPGEYGENWFY
                     LLAVLAQSGLSRDDIDVASIGYTQFAALSGGKVDAVVGFLNNEVVRFNEAGFAVRTIS
                     LDDPPLVSAGLGATDATIAERPADLVGLLTALTRGAELCASDPEQAVQLSVDYVPTLA
                     EPDQQAHALAVLKATTELYGGQFGVQNPGRWEAMAGFFADSGLVSSPVPAGDAYTTQI
                     VAR"
     CDS             46293..47594
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114564.1"
                     /locus_tag="brsh051_00410"
                     /product="bifunctional O-acetylhomoserine
                     aminocarboxypropyltransferase/cysteine synthase"
                     /protein_id="BEH00760.1"
                     /transl_table=11
                     /translation="MTDHPAYQLETLAVHAGQEESDSATNARAVPIYQTVAYTFDDSQ
                     HAADLFALAVPGNIYSRLMNPTTGVYEARIAAMEGGIGALATATGAAAVTYAVLNVTG
                     AGDNIVALSTLYGGTFALFMHTLKQFGIECRLIDPDRPEDLPGLVDERTRLVFGETIC
                     NPKLNVVDIDAWAEASHALGLPFIIDSTVATPYLCRPIEHGADVVVHSTTKYMGGHGT
                     SMGGAIVDAGNFDWAAHADRFPMMATPDASYHDVVWTDAAGPAAYITRARTVLMRNTG
                     ATLSPMNAWIILQGIESLHVRMDRHCQNAAQVADYLRAHPLVAWVNYPGFDDNPYHEI
                     ADRVLTGKGYGGLVSFGLRAGREAGSAFVEALQLFSHLANIGDAKSLVIHNASTTHSQ
                     LNDEELAAAGVAPEMVRLSVGIENVDDIIADLEQALDKTAE"
     CDS             47591..48751
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010918413.1"
                     /locus_tag="brsh051_00420"
                     /product="homoserine O-acetyltransferase"
                     /protein_id="BEH00761.1"
                     /transl_table=11
                     /translation="MMPTSNDSLGIVETKQVTLFDAGNPLTLVCGDQLNEVVIAYETY
                     GTLNADASNAIYICHALTGDAHAAGWHEGDKHPGWWDTMIGPGKAIDTNRWFVISSNL
                     LGGCQGSTGPGSINPATGKPWGLDFPLLDMSDFVTVHRALIARLGVRRLHAVVGGSMG
                     GMQALQWSLSYPGDLDNSVIIAASSRLTAQNIAFSAVGREAIIRDENFQGGRFAENGA
                     NPDVGLSIARMMAHITYTSEEGFQSKFGRKPQFDESEPGFGVDFAVEGYLEHQGETFL
                     TRFDALSYLYLTRVMDYFDPFAARSALDAVRADPVRYLVMSFDTDWRFSTAHSQQIVR
                     QLAAAELPVTFRDIRSPWGHDSFLLKIDPYLATVKAFLEAHTDYEGTAWGRA"
     CDS             48736..49377
                     /codon_start=1
                     /gene="metW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003084530.1"
                     /locus_tag="brsh051_00430"
                     /product="methionine biosynthesis protein MetW"
                     /protein_id="BEH00762.1"
                     /transl_table=11
                     /translation="MGASMSQSMQLRDDLAVIARNIPAGSRVLDLGCGDGELLSWLIR
                     RRACTGTGVERGPDEVLGAIKRGVPLIELDIDSQLGMFAPDSYDVVVLSRTLQAVLRP
                     DLVLAAMRKIAPRQIVTMPNFGYWRHRLRLLNGHMPRSRDLPYSWYATPNLHHATLVD
                     LEPLFQEVDLKLERRITLSPHGRPRALGQLGANLMAGSAIYVLVRADQDPAEL"
     CDS             complement(49374..50306)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027889.1"
                     /locus_tag="brsh051_00440"
                     /product="5'-3' exonuclease"
                     /protein_id="BEH00763.1"
                     /transl_table=11
                     /translation="MTDALSLIVDTATLYFRAYYGVPTTLRDQQGRPVNALHGMLDML
                     ARLIDQYQPAAVVCCRDDDWRPSWRVDLVPSYKTHRVSTAEPADAEQIDDELARQVPW
                     ILDCLDAAGICQAGASGYEADDICGTLARRAAARGRRAVVVSGDRDLFQLVADRIQVA
                     YIARGVAKHELVDDAWLQNRYGLRGDQYADLATLRGDPSDGLPGIAGIGEKTAAALLN
                     SYGDLDAIIAAAADPSSRMSAKLRLSIGQADDYLQRARRVVATADVDLPELDDQLYPG
                     RADQERCRRLAEDHNSRGPMNRLLAALGSQPVGG"
     CDS             50362..50811
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_019983923.1"
                     /locus_tag="brsh051_00450"
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="BEH00764.1"
                     /transl_table=11
                     /translation="MLSRDGRMSFTELGRKVGLSTSATQQRVRRLEQRGIITGYRADV
                     DAAKVGRPLTAFIEIQPLSAAVADSAPGYLASLPQITSCYSVAGNASYLCLAQVGSAE
                     ELDGLLNLIRRELSVRTVTTIVLRTAFRHRPLVEETPHGQQPPGADG"
     CDS             50804..51619
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027779.1"
                     /locus_tag="brsh051_00460"
                     /product="polyprenol monophosphomannose synthase"
                     /protein_id="BEH00765.1"
                     /transl_table=11
                     /translation="MARLRSMAQRSESLDHVLVITPTYNEAENIESIIGRLRAAVPNA
                     YCLIADDNSPDGTGAIADRMAAQDKHIHVLHRAGKEGLAAAYLAGFKWGLERGFDVIA
                     EMDADGSHQPELLPAMLQALRDKNADMVKGSRWMRGGSTDQGRSREMLSRLANIWIQV
                     AMDLPVHDATGGFNVFRASILRKIDLDDVASKGYTFQIDMTRRVIEAGGTVAEVPIYF
                     PDREHGLSKMSGSIITEALISTGRWGIEKRTQQLKNVGHKLADEFESFNSRDH"
     CDS             complement(51712..52050)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003081521.1"
                     /locus_tag="brsh051_00470"
                     /product="RNA polymerase-binding protein RbpA"
                     /protein_id="BEH00766.1"
                     /transl_table=11
                     /translation="MADRALRGMGLGAKSFEDEEGIDFAGRRVLGFDCTNGHHFEVTF
                     SVEADLPAEWECPRCGAMGERSDGTPPEEKNEKPPRTHWDMLLERRSIPELEELLAER
                     LEEVRKTPHY"
     CDS             complement(52137..52925)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977406.1"
                     /locus_tag="brsh051_00480"
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="BEH00767.1"
                     /transl_table=11
                     /translation="MNRPAGSYPYFDEPFALMAHRGGYLDEKDAPRENSLYAFGRAVE
                     AGYRYLETDVHATSDGHLVAFHDQVLDRVTDASGTLAAMSFRQVREARIGGIDQIPTL
                     DEVLESFPVARLNIDIKAPGAIAPLVRTLQRHQAQDRVCVSSFSWLRLHRFRKLMPSV
                     ATGLTAPAVALSAFVPMLPRLISLGGQAFQIPVTQTIGGRSVRVLTPRLITAARAHGL
                     RIHIWTINEAAEMDDLIDLGIDGLISDRIGLLRDVAKRRGLWAD"
     CDS             complement(52949..53410)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00490"
                     /product="hypothetical protein"
                     /protein_id="BEH00768.1"
                     /transl_table=11
                     /translation="MVQPVDCPPRPARVGGATRVDYEVPDKLGWRVRLKSTPTGRYWF
                     RLAVAIFGFALIIAAPLTGWLPGPGGIPLFLAGLAVLSSEFLWAKSVNRWLLRYVRVY
                     VCWPVNQRRFFWVAVVGVAGLLWWASLAIIGIPAWMPDWAAGVLEYLPGVS"
     CDS             53487..54338
                     /codon_start=1
                     /gene="pdxY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_034349874.1"
                     /locus_tag="brsh051_00500"
                     /product="pyridoxal kinase"
                     /protein_id="BEH00769.1"
                     /transl_table=11
                     /translation="MSEVLSIQSAVSYGFAGNSVAVFALRRAGIDVWPVFTVNFSNHT
                     GYGAWRGSVMTTDQVAEVVTGVDDRGALANVDAVLSGYQGAPDMGRAILEAVALTRER
                     NPQAIYCCDPVMGDVGRGFYAAPGIPEFMRDQVVSQATIMTPNLFELEYLTERTTSTI
                     ADVVEATAALRARGPQTVLVTSVVGLDADSSGMRMIAQNATETWQVTTPLIDRTFTGS
                     GDLTTAVLLANVLQGADLGTALSNTASAVYGVLARTDELGRSELALVQAQDEIIAPRR
                     RFEATRI"
     CDS             complement(54355..55881)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_164929956.1"
                     /locus_tag="brsh051_00510"
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="BEH00770.1"
                     /transl_table=11
                     /translation="MTQLTTAASIGRLVRDARKQRGLTQHELASLLSTSQSAIHRIES
                     GNQNLSLEMINRIAQALESPLIVPGGRNAMNLSITGETALHGSITTRSSKNAAVALLC
                     ASLLNRGRTRLRGIAHIEEVNRLIEVLQSIGVQVTWSSDEADLTIVRPEVLDLANMDV
                     SAARRTRSIIMFLGPLMHLADSFRLPYAGGCQLGARTVEPHMQALHAFGLDVIATEGY
                     YNATALHSHPQHTIVLTERGDTVTENALMAAAMTPGETVLRNASPNYMVQDLCVFLMM
                     LGVEIEGIGTTTLRIKGQAELNKDVTYTISEDPIEAMSLITAAVVTHSELTITRAPIE
                     FLEIELAILHEMGLRFSIGQEYRSGNDFTRLVDITVKPSQLHAHEDKIHPMPFPGLNI
                     DNLPFFAVIAATADGQTLIHDWVYENRAIHLLELTKLGANVQLLDPHRLNVIGPTAWR
                     ARDMVSPPALRPAVCILLAMLAARGESVLRDVYVINRGYEDLPTRLNNLGAEITQFFG
                     "
     CDS             56064..57467
                     /codon_start=1
                     /gene="lpdA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_034283919.1"
                     /locus_tag="brsh051_00520"
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="BEH00771.1"
                     /transl_table=11
                     /translation="MSSHFDVVVLGAGPGGYVAAIRAAQLGLKTAVIEKQWWGGVCLN
                     VGCIPTKSLLRNAEIANIVLRDASTFGISGDNISFDYGKAFSRSRSVSDRMVKGVHFL
                     MKKNKITELNGWGSFVDAKTVAVTADDGSVDNVTFDNCIIAAGATAKLLPGTQKSANV
                     LTYQELILSEQLPSSIIIGGSGAIGTEFAYVLNAYGVDVTVVEYLDRMVPTEDAEVSA
                     ELAKAYRKLGIKVLTSTAVKSVVDTGSGVQVTIEPAKGGEQQVLTADKMLQAMGFAPR
                     IEGYGLDKTGVQLTQRGAIEIDDYCRTNVAGIYAIGDVTAKMMLAHTAEAQGVVAAET
                     IAGAETMPVNYAMIPRATYCQPQIGTFGLSEQQAKDAGYEIKVSKFPFSANGKAWGLG
                     HAVGFVKLITEAQYNEILGLTMIGPDVTELLPELQLAQQWDLTADEVARVVHAHPTLS
                     EALKEVVEGAAGHMINL"
     CDS             57666..58826
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011393979.1"
                     /locus_tag="brsh051_00530"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BEH00772.1"
                     /transl_table=11
                     /translation="MKRSLAAIAAATLSLSLLAGCGGGSSSSDSDVIKVGINYELSGA
                     VATYGDASVKGIEMAFDEINAAGGINGKQVETIKYDTKSEPAEATTLATKLMTQDKVV
                     TVIGPATSGSFKATIPVANQNKIPVVSGSATAEDVTVSNGKVQEYAFRTCFSDSFQGT
                     AMASFATDNLGAKSAVIIKDTSSDYAKGLAENFSSKFESEGGTIVGEEGYVAGDTDFQ
                     AILTRIKSQSFDAIYLPGYYNEVGLIIKQARDLGITAPILGGDGYESPTLLQLAGASA
                     LNNVYYTNHYSSLDTDNAKVGEFIANFKAKYNEDPSAFSALGYDTAYFVADAIGRASD
                     LTGEAVKDAMASTTDFSGVTGTFSIDANHDPDKAALVIGLTDGVPTSAVDAA"
     CDS             58902..59786
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000941400.1"
                     /locus_tag="brsh051_00540"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BEH00773.1"
                     /transl_table=11
                     /translation="MDQILQQLINGLSLGSIYALIALGYTMVYGIIQLINFAHGDVYM
                     VGAYVGYVCMAHFHLGFFTSLIVAMAVCAVLGMVIERVAYKPLRNSTRIAVLITAIGV
                     SLLLEYTMMYFAGAEVRTYPPMPGFMSGSYHLGGVTVTALQLMIIAISVLLMVALQFI
                     VKRTRLGRAMRAVSQDADAARLMGISVDNTISFTFALGSALAGAAGVLVGVYYNSINP
                     LMGILPGLKAFVAAVLGGIGLIPGALIGGYLIGTMEVVVSGLGFSTYRDAAVFAILIL
                     VLIVKPSGLLGKNVREKV"
     CDS             59786..60766
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_153018191.1"
                     /locus_tag="brsh051_00550"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BEH00774.1"
                     /transl_table=11
                     /translation="MSPRLRTFVTRTAMLAATYLIVLVLIQAGVINAYLQATMVTICV
                     NIMLAVSLNLVTGFTGQFSLGHAGFMAIGAYSTGLITMAIPTVWGFVLGLATGAVLAA
                     MVGFLIGLPTLRLRGDYLAIATLGMAEIIRVLLLNMGFTNGAAGLSGIPQFVNWSWLF
                     VLTVGTVVLITNFLNSRHGRDCIAVREDEIAAESIGVRSTRVKTLAFMTGAFFGAVAG
                     GVYASYFYFLKPDLFGFMQSINILVIVVLGGLGSVSGSIIAAVLLAIVSTLLQPFPEI
                     RMILYSLVLVVLMVFRPQGIMGSRELSLKVFSRLLPKRSKDAAATEGATA"
     CDS             60763..61551
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_025773590.1"
                     /locus_tag="brsh051_00560"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH00775.1"
                     /transl_table=11
                     /translation="MSPILEVKDLTRNFGGLAAVSNVNITLEEGELIGLIGPNGAGKT
                     TVFNLLTGVYPPSSGEIDFSPDGEPASIAGKKPYDICRAGVGRTFQNIRLFKDLTVLD
                     NVVIALEQNQTYSLLSSFLHLPSWAASREEVLKSARDLLRLMRLDHKSFDLARNLSYG
                     EQRHLEIARALATNPRLLLLDEPAAGMNPAETAGLTKLISWIRENYHLTILLIEHDMS
                     LVMSICERIYVLDHGIVISSGTPDVVRHDPRVITAYLGQEASDV"
     CDS             61544..62248
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_081214215.1"
                     /locus_tag="brsh051_00570"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH00776.1"
                     /transl_table=11
                     /translation="MFEIKDLQVSFGGIHALKGISLRVEEGEIVTLIGANGAGKTTTL
                     RTASGLERPDSGSVWLNGQDITRVSAQDRVKRGLIQVPEGRRVFPMMSVLENLELGAF
                     LRRDRAQTAKDMDEVFGRFPVLADRRQQPAGTLSGGEQQMLAMGRALMASPKVLLMDE
                     PSMGLAPLFVQEIFNIIANINATGTTILLVEQNANMALQVASRAYVMETGKIVLSGDS
                     AKLLATDEVRQAYLGG"
     CDS             62252..62893
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257688.1"
                     /locus_tag="brsh051_00580"
                     /product="CBS and ACT domain-containing protein"
                     /protein_id="BEH00777.1"
                     /transl_table=11
                     /translation="MFVRWRMTAHPFTVSPSTTVPEAVEMMQTHNVRKLPVVSEGRLV
                     GIISQSDIDRASPSMATSFSAGELVYLFSKLKVSKVMTRDPITIGPDALLEQAAIVMR
                     DRKIEILPVLEDGELVGVITESDLLDAFIDLNGARMNGTRLVIEADDQPGVMARLASI
                     TGAVRTNITHIAVYRGGLERSLVVLGVNTLNTVDLERQIADAGFTLKYRLRNE"
     CDS             62918..64090
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012870170.1"
                     /locus_tag="brsh051_00590"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BEH00778.1"
                     /transl_table=11
                     /translation="MRRPMLLVTGLLTGLALLTGCDSTVGTQQHLGDTVRLGVNVEQS
                     GDLASYGDSMTKGIQVAVDQANSSGGVRGRQIQLITMDNQGNSGKAVATATTLMSQQR
                     ALSVIGPVSDGLFALTLPVADHQQIPVISGSACDANRLNDENGKVYQFGFRTCLGLDQ
                     QGAAMATFAHSNLAASTAAVFRTADTGFANEFADAFTDAFTADGGTVGVQDAFPAGET
                     DYSRFVDIMRSSPTDVVYVAAQAPEAASLIRTLREAGIDNPILASGDMNAPAANEIAG
                     PDALNRVYFVSQFSALDTDNAVAQNFLNAYRQAYGADPDTHAAMAYDAILLAIYGIDR
                     ADELTGINVQRALATARNIDGAGGKFSIGQGHQVVKDALVVELADGAPVSVTHVAP"
     CDS             complement(64096..64764)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011014898.1"
                     /locus_tag="brsh051_00600"
                     /product="YigZ family protein"
                     /protein_id="BEH00779.1"
                     /transl_table=11
                     /translation="MSLSHYVVLRQGSRPTSQIEIKKSRFLGYASRTADEDQARDFLA
                     EVRRAHREARHVCHAFVVEPDRRIQRSSDDGEPAGTAGTPILKAITARQTSPGRTELS
                     DVTVAVVRYFGGIKLGAGGLVQAYSEAAAAVLDNARLVGRQRMRLIGLALPIAEAART
                     ESRLRAQGCRVESVDYQADKVQLRIAVADESEDLRAAMTSLAAITAGGAKPAIGEQIW
                     RDLD"
     CDS             complement(64761..65546)
                     /codon_start=1
                     /gene="yaaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003092094.1"
                     /locus_tag="brsh051_00610"
                     /product="peroxide stress protein YaaA"
                     /protein_id="BEH00780.1"
                     /transl_table=11
                     /translation="MLVLLSPAKSLDFTSRPVTRKHTMPRLLDRSEELIEVLRTKSPD
                     ELARLMKISDDLAVLNAARYRDFETPFTPGNARAAILAFNGDVYRGMAAASRFGERDF
                     TEAQKTIRILSGLYGVLRPLDLIQPYRLEMGTALTTGRGRDLYEYWGDLPSELLRADL
                     MDAPGSDAVINLASQEYFGVINPRVIGAPIISPRFEEITPSGERRMVSFYAKYARGAM
                     AGWLVINRVRSLRKIREFDAEGYHYDPQVSTPTQPVFVRPQAA"
     CDS             65741..68113
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224401.1"
                     /locus_tag="brsh051_00620"
                     /product="excinuclease ABC subunit UvrA"
                     /protein_id="BEH00781.1"
                     /transl_table=11
                     /translation="MTGTDAPRTHPADQHDLIRVRGARENNLKGIDADIVKRRLTMFT
                     GLSGSGKSSLVFDTIAAESQRMINETYSAFVQGFMPTLDRPEVDQLDGLTTAIIVDQE
                     RLGANVRSTLGTATDANALLRVLFSRIAQPHIGGPQAYSFNTPSVSGSGAITVQRGAG
                     SRAEKRTYTLVGGMCPRCEGMGSVSDLDLTELYDDSKSLNDNPFKIPGYSMDGWYGRI
                     FKGSGYFDPDKPIRSYTKRELRDLLYREPTKIKVEGINVTYEGLIPKITKSMLSKDPE
                     SMQPHVRAFVERAVTFQTCPECGGTRLAEPARSSKIKGNSIGDVCAMQITDLADWVRS
                     IDEPSVQPLLANLRHLLDSFVEIGLGYLSLDRPSGTLSGGEAQRTKMVRHLGSSLTDV
                     TYVFDEPTVGLHPHDIQRANDLLLRLRDKGNTVLVVEHKPEVIAIADQIIDLGPGAGA
                     GGGEIVFQGTFDELRTSGTLTGRHVDDRARLKPQVRQGSGALEIRGASTHNLKNVDVD
                     IPLGVLTVVTGVAGSGKSSLIHGSFHGRDGVVEIDQSQIKGSRRSNPATYTGALDAIR
                     KTFAKVNGVKPALFSANSEGACPACNGAGVVYTDLGFMATVASRCQECDGRRYQAAVL
                     EYRVAGRNIAEVLEMPMAQALEYFAQGEAKTPAANKILQHLVDVGLGYLTLGQPLTTL
                     SGGERQRLKLASRMGESGGVYVLDEPTSGLHLADVEQLLGLLDKLVDSGKSVIVIEHH
                     QAVMAHADWIIDLGPGAGYDGGRVVFAGTPAQLVADAKTLTGQYLARYVA"
     CDS             68150..68770
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00630"
                     /product="hypothetical protein"
                     /protein_id="BEH00782.1"
                     /transl_table=11
                     /translation="MNDIAFGVLAIAVGLLFCFFGATMLRLTITIWGAFAGFSLGAGV
                     IAGWFGQGFLATTAGWVVGLIMAIVFAWLAYAYYAVAVLIATASLGFAAGAALMAALG
                     VTWNWLIILVAIVVAVGIGVAALTVNMPAVLLIVLSTLGGASVAVSGLMLVLGVLTIA
                     DLTDPAVTANPAHGWWWTVVYIVLAVLGVTVQTRKSRRWQRDAWAH"
     CDS             complement(68828..69922)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00640"
                     /product="hypothetical protein"
                     /protein_id="BEH00783.1"
                     /transl_table=11
                     /translation="MVTEYQPRSAGELWQRIDREDLVRLGVVGGLAVVVLVASWLQAP
                     WWISAPLAAVGLVIGCWPIVVEVWAALRARRMSMELSMFIALVAAAAIGEWVTALVIT
                     VFVLAAEILEDLSMDRGRDALGELMNFLPDSVQVRRDGQLRSVHRDELAVGDVVMVLP
                     GGRIPVDGVVLEGNSSVDESRITGEPLPVDVSQGSQVYAGSINHSGAVALRAERVGAE
                     SSYGQIVAAISAAQNSQAPIQRLADRLAGWLVYLALGGAALTYLITRDLTATISVIIV
                     AGACGVAAGTPLALLGAIGQTARAGTFIKDGSHLEELSAVRVVVFDKTGTLTRGEPAV
                     TAVTASEGVDGDHLLAAVASAESYRPTNAI"
     CDS             70097..70408
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010868054.1"
                     /locus_tag="brsh051_00650"
                     /product="metalloregulator ArsR/SmtB family transcription
                     factor"
                     /protein_id="BEH00784.1"
                     /transl_table=11
                     /translation="MPQTDEIARVAALFKLMSDPTRTRLLYALLEAGELYVSDLAATT
                     GTSESTVSQALRMLRASGIVTGRRDGRKIWYRLSDEHVRELLNVTLEHTHHHPGDEDP
                     A"
     CDS             70405..71304
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804603.1"
                     /locus_tag="brsh051_00660"
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="BEH00785.1"
                     /transl_table=11
                     /translation="MSGHHHSSSHAVSAAGKHRSRLAITFALVAGFFAVELIAALRSG
                     SLALLGDAGHMAADVTTLGAALLALHLAPLRDKRGRRTFGNYRVEVFASGLAVLIMLG
                     VAIFITVEAIGRFGSAVEPASGIMLAVGILGLVINVVSMLLLRRGSSESLNVKGAYLE
                     VLADALGSIGVIAAAVLVSVTGSPWWDTVIALGIAAFIAVRAVMLGLEVLRVLAECAP
                     PGIEPAEIQVALEDIPGMLEVHDLHVWQLTSGMNVASAHIVTSAPDTMLAAQHLLRDD
                     FGIAHVTLQTESANRRECDHTDW"
     CDS             71399..72379
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00670"
                     /product="hypothetical protein"
                     /protein_id="BEH00786.1"
                     /transl_table=11
                     /translation="MRTIPRLTRAYRNAKVVEIDSSSKIIIFSDSHRGDGSLADEFHK
                     DRDIFEAALQHYLDEGYTLIEAGDNDELWEYPKFHHIIKANPEVFALLRKFHTKGRYM
                     RIYGNHDMQLRDPEYVRHHLYLRLNHVTGRAEPLFDGLKVEEAVLLRHKASGQEILTV
                     HGHQGDFSNDQAWRGSMFTFRIFWRHLHALGIHSPSSPTRNSFQRHKVERNYVRWILQ
                     HGTALICGHTHRERFPLGEDAPYFNSGACVFPDYITGLEIANDSISLVGWQVVPDANG
                     YLHVAPKVLAGPRPLDDFHLRPDPKPHRRPNRSMDQSRKVEQASSHPSLL"
     CDS             complement(72386..73639)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776532.1"
                     /locus_tag="brsh051_00680"
                     /product="MFS transporter"
                     /protein_id="BEH00787.1"
                     /transl_table=11
                     /translation="MTQAQVGGWRAWSVWAAGTLAFIAAMFSRTSFGVAAIPAAEQFS
                     APVGAMSMFVIVQAGVYAAMQIPAGAVLDRLGSRNVLAIGLGVMTAGQVVLAFATSFP
                     LGLVARVFIGGGDALIFSSAIRLILLWFPPRKIPVLTQVTAAAGQAGQWLSAVPLVMI
                     LSNWGWTTAFLTVAASCFVGLLIAVLVVRDAPPGLVVTSRGSGGLFAGVGEVLAMPAA
                     QLAFFIHMLAASAPIAFTFLWGFPYLTQAQGLTDAQAGSLFTVFVIASMIVGPLTGML
                     TRRFAARRTFLALGIVGLSAVVWTSALVWPGYAPHWLLVLLLITIGADAPASNIAFDI
                     NRSHVPAHRIGTATGVTLVGGFSAGLVVVAAIGVLLSILGGPNPSADDFRVAMSAQLV
                     VWVYAGIMVIRKRRQLLRSLPSADE"
     CDS             complement(73662..75152)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011015555.1"
                     /locus_tag="brsh051_00690"
                     /product="DUF1846 domain-containing protein"
                     /protein_id="BEH00788.1"
                     /transl_table=11
                     /translation="MHAVGFDRDKYIALQTEQIVARRNEFGGKLYLEFGGKLFDDLHA
                     SRVLPGFSPDNKIVMLEALADELEVVVVVSALDLARNKVRADLGISYEADVLRLIDAF
                     RSYGLYVSSVVISHVTESNPQARRFKRKLERGGLKVYKHYPIKGYPNDVSLIVSDDGY
                     GRNEYITTTRDLVVVTAPGPGSGKMATCLSQLYHDYKRGITSGYAKFETFPIWNLPLD
                     HPVNMAYEAATADLDDVNVIDPFHLAAYGEQVVNYNRDVEVFPVLSRLFEQILGRSPY
                     KSPTDMGVNMAGLCISDDQVCREASKQEIIRRYYKALVTERRDELEPTQSDSIALLMS
                     GLGLTKHDRPVVTPALDVEKRTKNPAAAIELPDGRIITGKTSPLLGACSAMLLDALKA
                     LAGIDPEVKLLAPQTIEPIQTLKTRHLGSRNPRLHTDEVLIALSVSANSDENARRTLA
                     ELSQLRGCDVHSTVILGSVDEGILRNLGVQVTCEPIYQSKSLYKKR"
     CDS             75383..76021
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011013577.1"
                     /locus_tag="brsh051_00700"
                     /product="hypothetical protein"
                     /protein_id="BEH00789.1"
                     /transl_table=11
                     /translation="MKAPAMAKKISFRSMVIVLVVGLILGVGLTLWVTKPFSATAAFD
                     HQPKSRTSEVVNAVTREQQVVLLSLGIQGISQKSDSSTFFGVHVPGSSRATFLMYSFD
                     AKLGIDGKQVKVEEIGQDEYEVKIPEFIFIGHSNEEFTLAAENNGALSWVTPEIDPVE
                     LINGVLSDDSEAQYIASNEEILRSQTQAFYSSIVTAIDPDLTLHFDFAGDQG"
     CDS             complement(75984..76373)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00710"
                     /note="frameshifted, insertion/deletion at around
                     76112,76425"
                     /product="hypothetical protein"
                     /protein_id="BEH00790.1"
                     /transl_table=11
                     /translation="MERLARFRELGKVQSRVSPGVLDELRLMSAATIDRYLKPHKDAA
                     HPVALSGTRPSLILRSSIPTRTSMDDPLTVLGFLELDTVTHSSSNLHQQERSAPAPPR
                     ALSGHLDVRQPPQQELNLGRPRSRNAG"
     CDS             complement(76303..76671)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00720"
                     /product="hypothetical protein"
                     /protein_id="BEH00791.1"
                     /transl_table=11
                     /translation="MMSRRKITKKFAREYAKAGKVEKGRLLDELVHATGWTRDHARRA
                     ILAANARKGTARQQTRKPRPRKYSYDALVVLQEVWRLAPVRAAVGEASRRGHGRYFGT
                     ARPVPGAGQGAIPSESRSAR"
     CDS             76826..78187
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00730"
                     /product="hypothetical protein"
                     /protein_id="BEH00792.1"
                     /transl_table=11
                     /translation="MLIAASVQPVLSGTVVEDESNHEILDAIDHAHQQLIAAEIAELV
                     GILRAADRWKIDQDAVGAGIERLIQPGHDGTPRIAEFLALEIGALLGISQTSALCRIG
                     DALDLRHRHPKLWQAVLTGKVRVWQATKICLECAHLSRSAAHNVDAAMAASIGMLPWT
                     RIMKALPGQIIAADPDTARQREQARRESRRIRISPIEDGHVSIYGVVNPVDGIKFDHV
                     LNEVAKTFPTEPDTPLCRDLDRRRSLAFGMITQDAYTKLHREKPLLDLSETPSNRLPQ
                     RSTPTTQQPIGCTLIVHISADDPALDPSPTSTTGVARIEGWGPLLTEQLPHFLNGANI
                     TVRPIIDPAGIRPVDSYETPARMRLALEQRNPVDVFPYGTTQASRCDSDHTIPYIDGR
                     SSQTHLGNLGPLSRKAHRAKTHGKWKLEQPTPGTFHWTSPHGYQYQVTPTGTIRIRVP
                     EQT"
     CDS             complement(78206..79114)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257625.1"
                     /locus_tag="brsh051_00740"
                     /product="AEC family transporter"
                     /protein_id="BEH00793.1"
                     /transl_table=11
                     /translation="MIAMLTALLEVMLPVFVIAGVGFLLARRFTIDQLSLNKIQLYAL
                     TPALAFSSIMDTSVSASDVGDLARGYLGATLVLGLVSAVAVRMLAKPVRNGVIASVLL
                     GNNGNFGLPIALLALGQSGLDRAIVIFMIAIVLIWTVGPVLFGAAPSVRSALVNIARL
                     PVIWAILLATVFRLVGIELPGGLSTAVHMVGNASVPMILIALGIQLGYGKRVRFGKTV
                     ITAMLLKLIVAPLLGWGVCWLLGLRGQDLQSVVLALSMPTAVNVFLLALEYDKDAETI
                     ASIVAATTLVSLVTISIVVSQLGALV"
     CDS             79163..79888
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003978056.1"
                     /locus_tag="brsh051_00750"
                     /product="PIG-L family deacetylase"
                     /protein_id="BEH00794.1"
                     /transl_table=11
                     /translation="MTDLRPVAEDFSSALAIVAHPDDLEYGAASAIARWTAQGKQISY
                     LLVTHGEAGIDAIPPQVCGPLRMQEEITGAALVGVHTVDFLDYPDGVVCYDLNLRRDI
                     AAAVRKACPDVVITINHHDQFGPGRYNQADHIAVGRAVLDGTRDAANRWVFPELVSDQ
                     GLAPWKAQRILVSGSPQSNAFVDVTASFDAGVASLAAHQQYLAGLGDHAMGDPRIFLE
                     QIARSTGERVGVQLAVSFEVVEL"
     CDS             79885..80526
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00760"
                     /product="hypothetical protein"
                     /protein_id="BEH00795.1"
                     /transl_table=11
                     /translation="MSNDILQVPIPDEQLVLHRFAIKPHHLDDYLPLWRREVEIARWH
                     GFTTHRAFLETNAEPKLTWLYSHPDPEAGNRAVRADPETVRVEALKAPHVFRNVKIRP
                     VRGEYLTHLDTTVTPHPLAVMRRYSIVGSWSEFLDVWQRIRVVREIYGFGCLFAVVDE
                     PENMFTWAFEYDGEWRDFATAQLEYYHDPDRIALRGVFDYMADYSINPAQQLM"
     CDS             80529..81200
                     /codon_start=1
                     /gene="tsaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011459538.1"
                     /locus_tag="brsh051_00770"
                     /product="tRNA (N6-threonylcarbamoyladenosine(37)-N6)-
                     methyltransferase TrmO"
                     /protein_id="BEH00796.1"
                     /transl_table=11
                     /translation="MEPIAHIRSAFPAKFGIPRQAGLVPDLVASVVFEPHYRNPDAIR
                     GIEDFSHIWLIWQFSAAIRDDWRPTVRPPRLGGEQRLGVFATRSPFRPNPIALSSVRL
                     LEVRSEPDLGPVLVVGGADLMDGTPIFDIKPYIAADLHTDATFGFTTRNTDYRVQVDI
                     SDELIARVPEKLRDGLLGVLAEDPRPAYQDDPERNYGLGFAGLNVRFRVAAGVLTVVE
                     IEPLV"
     CDS             complement(81221..81847)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00780"
                     /product="hypothetical protein"
                     /protein_id="BEH00797.1"
                     /transl_table=11
                     /translation="MEFFGNLAHQITLLAINEQTGRVRNRGQLKLAAAGATLAELAMQ
                     ERVSLVDKKVQVHDARPIGDPLLDAMLRVLGTHPAHRPARIIQAGGGFYLDQSMDDMT
                     RSGWLVKKPARGLGGDRYRILNAQELTAARELAATAIRDPAGVTSRAACLGGLALELQ
                     FGKWLAPEAGWRQRWRSQRVLQQRDWVVKAVHDIIASQQSATTAAISS"
     CDS             81945..82394
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00790"
                     /product="hypothetical protein"
                     /protein_id="BEH00798.1"
                     /transl_table=11
                     /translation="MDGGEAGLSRVPPNAVLGVVAALVVVLAVVTALLTTQRERPELD
                     PGTPEGTVQIFILAFVEGDDDQAVALLDPALGCSAPLRDVYRPSRVSLSVVSSKITGE
                     EGVVVLDVTEYSGGLFDSWSHREDFYLIRADGSWLITGNPWPVYSCK"
     CDS             82407..84098
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00800"
                     /product="hypothetical protein"
                     /protein_id="BEH00799.1"
                     /transl_table=11
                     /translation="MTFLGVAILALLAGLITVVVNAGRHRESLDARNVRRVFQYAVLY
                     ALVVVSAIGATELLGRLLGAEAPAWQDDSYALAQALTFVLVGVPLAALLAWWTWRSHR
                     ASPAETSSPLFTAYLTIAALTGLVVAAAGLQVAVFEAIDHAEFDAQATARFVVWAAVW
                     LGHWIVARRSLDVAAATPHLLLGSLVGLVLAATGLIQLLGTSLDLLLRPGAVVPPLTG
                     LARGAGLLTAGGLVWIRYWVLSASRLPRQVLWLAYVLLIGVAGGLIMAIAAVSMLLWT
                     ILVWIVGDRLDQTFAQHFDSTAMQTATAVIGVVIWWYHRAAVGQSAAEHREIRRTYDY
                     LVGGIALIAAASGVGTIIVALIEAATPGLDIGMPTINTLLAALTLLVVGTPVWWFHWR
                     RLKAAVGADPAAEVAALSRRIYLVLLFGVAGVAAVVALLVAAYAFFRDLVDAQLGTAT
                     LRAMRYGLGVLVASAAVSAYHGAVFRQDRQIDVPDRPSRPRSVVLIGAHDPDLVRRIR
                     QATDSPAELWVRTDAAAEQWDEESVLAALDGYSGKDLLVIADETGLRVLEVDRRR"
     CDS             complement(84104..84706)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00810"
                     /product="hypothetical protein"
                     /protein_id="BEH00800.1"
                     /transl_table=11
                     /translation="METMENLAHQVAMLAISPFSGEVRKTSRLGAATAAAVLAELVLQ
                     ERVRWASGKVHVSDSRPTEDHLVDVMLHDLTGRAGREPAKIIGDARQTYSGQALGELV
                     SNGWAKLIPASRLSAQRYELIGEERINAARELARSGLTDPHAAPARAAYLGGFVALLG
                     LDSEVAGLGFRGRRRVRSALLKRSWLLRALQTQFSVTTPL"
     CDS             84747..85724
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00820"
                     /product="hypothetical protein"
                     /protein_id="BEH00801.1"
                     /transl_table=11
                     /translation="MPHTFVSPWNGETHDHQTRTFLAAAHGQQTDRPPVGAWIHYGSS
                     FWTPEQVAEAHLRFYHQYDWDYIKVMDDFRLQVPDGLDEITDPAQLDEVVPDPKATLT
                     NLVKQAEVLRIIRAEAPEAAIIDTIFSPVQTLVRALGETVIDYLAADTELAHRTISRV
                     ATALADYAAQLPDLDVDGLFLAINGASTDSTSFGLSPEQFTEWISPYDIQVLQAAEGL
                     VRIGHLHGEGADPDLLTDYPFEVLNWSDKVSAPRIPEARQRYGWIPMVGLDEITSLYW
                     TPSKAREEILQARRAAGDQIIVAPNCTLHSDGSPLVLRELRESVDLPLG"
     CDS             complement(85728..87047)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804006.1"
                     /locus_tag="brsh051_00830"
                     /product="M20/M25/M40 family metallo-hydrolase"
                     /protein_id="BEH00802.1"
                     /transl_table=11
                     /translation="MSDWTELEDEAVRITRELIRIDTSNYGDGTGPTERPAAEYVLGL
                     LHEVGLDPVSLESQPGRASVIVRIAGADPSRGGLVVHGHLDVVPANAADWSVDPFSAE
                     ERDGMIWGRGAVDMKSMVGMVLANLRRIAREGIVPPRDLVFVFFADEEQGGTWGSQWM
                     VREHPELFAGCTEAISEVGGYSVTLPVAGGGTRRAYLLQTAEKGFAWVHLRASGRAGH
                     GSLPNDENAIVRLAEAITRINQHEWPLEYVASVRALFDGVTEITGVSPDDGLEAFLDL
                     LGGGRAFVAGTLRDSANFTRLDAGYKNNVIPSEATAHIDCRFLPGHQDELLDTIRELA
                     GEHVDLIIDQLGISVDAPRDSAFVASMQAAIQAEDPDAALLPYCLSAGTDNKALEALG
                     IHGYGFVPLKLPADLNFAMLFHGVDERVPVDAVRFGARVLRRLLDDC"
     CDS             complement(87071..88507)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776542.1"
                     /locus_tag="brsh051_00840"
                     /product="FtsX-like permease family protein"
                     /protein_id="BEH00803.1"
                     /transl_table=11
                     /translation="MSISSAPARVSGLFSFTAHLTKARFASRQGESLLYLAAIMAFII
                     SSALALTVAGGTWMFYNRWQHPHGLLLEVLTEDSTFDIVPQSYFILAVFACALLIPAT
                     YSLASGAAVLGARGRERRLAALRLLGLSSGDVTRMALIDTLVQATIGVGIGAVIYLVT
                     LPLWSRLTMLGMPLSAEEMLLPWPLTAAICVAVIGLGVASAWWGLRQVRISPLGVARL
                     GTRPRLKAWRIVLAGLVLIAGSVAMSVLPLGSGVAGFLLMAGIIVIMIQGFNIAGPWL
                     LQQISKLIARAPRLSVIWAARRIEAHPKQTWQRVVGISLLALIGGYMALMPIEINGGD
                     DTAGQTFVQATQWDFTKGVIITLAVGFTLTAASIFITQASAVFERAEQTIAMYKMGAP
                     LAFSTKVMWLETLGPLVFSVVLGAGLGAAMAYPMYRYATSVGVVSDGGPIVMAIVLIA
                     GIVLAMVALWACRPLQRRVLATQHRAND"
     CDS             complement(88504..89235)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776543.1"
                     /locus_tag="brsh051_00850"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH00804.1"
                     /transl_table=11
                     /translation="MISIPTSPHSSPLLATHDITKSFGAVRALAGISVRVEQGESVAI
                     MGPSGSGKSTLLHCLSGVLVPDDGVVDFDGGPLSALNDRQRSHLRLSEFGFVFQDGQL
                     LPELPARENVALPLMLTGTSRRLALAAADDMLGRIGLGELRGRRPGDMSGGQAQRVAI
                     ARAMVGHPRVVFADEPSGALDQASGHEVMQLLTTTCRIAGAALVVVTHDINVARWCSR
                     LIEIRDGIVHADRRLSAATTSGELR"
     CDS             89338..90045
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_00860"
                     /product="hypothetical protein"
                     /protein_id="BEH00805.1"
                     /transl_table=11
                     /translation="MRRHSQQVSHEDQAAQTIAALTASRRAIVDAYEVERHRIERDLH
                     DGTQQYLVAAAMMIGEARLSATVASDPELAERLSEAQAAIQRGLDALRVTVRGIHPQI
                     LTEQGLAAALADVAEAAATQVRIVCPNPLPAIPEGVLATAYFFACEAIANAAKHAPRA
                     EVSVLLTADELLRVSVVDSGPGGARFAAGHGLAGMRERLAAVGGELTISSPMGGPTQV
                     LASIPLLLQRGEPGVTL"
     CDS             90042..90725
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003974351.1"
                     /locus_tag="brsh051_00870"
                     /product="response regulator transcription factor"
                     /protein_id="BEH00806.1"
                     /transl_table=11
                     /translation="MTTVAIADDSALLREGLAGLLERQGFEIVAQESRADALRQTVQQ
                     LAEQGRLPQLLITDVRMPPTMANDGLQAALDMKTAYPALSVLVVSQYVAPVYAQQLFA
                     LPAAPDSGGSGYLLKDRVSQVADFIGTLRVVCAGGMVIDPEVARAMMRASRSGLGELS
                     PREFEVLELMARGLSNGQIAAELVLSNAAVAKHVSNIFMKLGLTPDEENRRVRAILAF
                     LADDHGPLI"
     CDS             90848..93031
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002361277.1"
                     /locus_tag="brsh051_00880"
                     /product="amino acid ABC transporter substrate-binding
                     protein/permease"
                     /protein_id="BEH00807.1"
                     /transl_table=11
                     /translation="MHISHRSRASAARTGALITLLLGFIGMTFGVSALQAHAEGPVEG
                     QTFVIATDTTFAPFEFRDASGDMTGIDMDLIREIAQRKGFNVDIQALGFDAALQAVTS
                     GQADGVIAGMSITDARKEVFDFSAPYFSSGVQMAVRADDSSITSYEDLRGKTVVAKTG
                     AEGLSFAQSIADQYGFTVKALGSADTMYAEVASGNAAAVFDDYPVLAYGIAQGNGLKV
                     VTPKEQGSSYGFAVLKGSNAELLQAFNEGLSEMKADGSYHALLTKYLGSNAPADDAQV
                     EGVQGKTFVIATDTTFAPFEYRNESGEMTGIDIDLINEIARRQGFSVDIRALGFDAAL
                     QAVTSGQADGVIAGMSITDARKEVFDFSAPYFDSGVQMAVRADDDTITSYEDLSGKTV
                     VAKTGAEGLTFAQSIADQYGFTVKALDKADTMYSEVATGNAAAVFDDYPVLAYGINQG
                     NGLKIVTPKEQGSSYGFAVLKGSNPELLQAFNAGLSGMQTDGTYQAIIDKYLKAPDAG
                     GSSQSFWGLLVQSMPALLKGLLLTLAATALSLVFASVLGVVFGFLKVSGNKILQSIAS
                     VYVDIFRGTPLLVQAFFFYFGLPTALGIKLDVLTAGVITLSLNAGAYMTEIVRGGIQS
                     VDTGQMEAARSLGLNWMQSMRKIIVPQAVKIMTPSFINQFVITLKDTSLLAVLGFAEL
                     TYQGQQIIARNFRSFEVWLIVGAMYFIVISALTKLSNRIDRRINK"
     CDS             93028..93771
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003724779.1"
                     /locus_tag="brsh051_00890"
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="BEH00808.1"
                     /transl_table=11
                     /translation="MSESAKTMIEVTDLHKSFGSNEVLKGISTTINQGEVVAVIGPSG
                     SGKSTFLRCLNLLEEVTSGKVIVEGRDLTDKNTDINQVRQKIGMVFQHFNLFPHQTVA
                     ENIMLAPSMLKKLSKTEARSRAESLLAQVKLSEKIDARPAQLSGGQKQRVAIARALAM
                     DPDIMLFDEPTSALDPEMVGEVLDVMKALAAAGMTMVVVTHEMGFAREVSDRLLFMAD
                     GRVVEEGDPREVLANPQNDRTKDFLAKVL"
     CDS             93877..97368
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728760.1"
                     /locus_tag="brsh051_00900"
                     /product="transglutaminase family protein"
                     /protein_id="BEH00809.1"
                     /transl_table=11
                     /translation="MAGRVSYPEPVTIRIALKHQTTYRFDRPTTVNPHTVRLRPAPHT
                     RTPIEAYSLSVVPGDHFINWQQDPFGNYLARLVFPEPVNELQFTVDLIADMTVINPFD
                     FFVEEYAAEMGWSYPDELATDLQPYLHQVPAELDSPADGDLVDQWIASRLPESQWRDC
                     GLRTVDFLVRLNEAVRDDVAYTTRMEPGVQTPGYTLSRAIGSCRDSAWLLVSILRRFG
                     LAARFVSGYLVQLAADMEPVDGPAGVKHDFTDLHAWAEVYIPGAGWVGLDATSGLFAG
                     EGHIPLSCTPHPSTAAPITGSTGIAEVEFSFSNEVTRIHEDVRVTKPLSDDQWDAIDT
                     LGQVVDAGLANEDIALTMGGEPTFVSAAETASPQWNSAADGPEKRQLAAKLTDKLRQR
                     WADGGLVHHGQGKWYPDEPLPRWQMTLAWRTDGEPIWHHPALLVNPWTKPSATAGTDA
                     LAHQIAARLGIADEFVLPVYEDTVQAAVSAAQLPWGPRPDIDPDPSDELLANEHARQQ
                     LVDRLDDAATEPAGWVIPVFVDPDDPDGGSWATTRWRPRRRAIFLTAGSSPIGLRLPL
                     NALAWGAAPDIVRNADGDATRPLPDGHQTSVKPARELPIESAPRTALAIEERDGHLFC
                     FLPPIDRLDDALRLIATIEDACAALQTPIVLEGYPLPGDDRLQTLSVTPDPGVIEVNV
                     QPTSSWGDLVQLTTTLFEDARQVGLTTEKFDLDGTHTGTGGGNHITLGGPTPQDSPLL
                     RRPDLLRSMVTYWQHHPGLSYIFTGRFIGPTSQAPRVDEGLPGTLYELDIAFTELDEM
                     LTDPTVEHDIAKAISADWRTDETLEERLERQRHSQPWLTDRLLRHLLTDLTGNTHRAE
                     FCIDKLYNPDRRGGHAGLLEMRGFEMPPHERMSLLQALLVRGLLWRFAREPYRAPLVR
                     WGTRLHDRYLLPAFAAADLWNVLDELNAALPISERFDLAWFESFLEFRFPILGEVQLG
                     DVDLELRQGIEPWQVLGEEVTLSGTARYVDSSVERVQVASTGLIPERHLLMVNGVPLP
                     LTPVIGHGWGVGSVGRSDALAAGVRYKAWSPPSSLHPTIGVHAPLRFDLVDKISGQSL
                     GGFRYHVVHPGGRSFDTYPVNAVEAESRRAARFEPYQTSGHLEIPGVSDWGSAEYPVT
                     LDLRRFERWHDVLEESI"
     CDS             97371..99929
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_049769952.1"
                     /locus_tag="brsh051_00910"
                     /product="circularly permuted type 2 ATP-grasp protein"
                     /protein_id="BEH00810.1"
                     /transl_table=11
                     /translation="MAGVSQAVDQRISPVLRDYVQRAGGHDELAHVLADRDILGFTPS
                     LSEVEYPGWQRRQRALTRLVRSEAITYGGSRPGELANSWSVDVLPFIMSSAEWAGLQA
                     GLRQRAELLNAMLADFYGPRTLLHSGVVPSELVLGHRGFLPAVDGLTLTGDHQLTIVA
                     TDLVRAASGCWTVLSDRTQSPSGMGYAMANRRLVARVLDRDYRHVSIHRLRGFFDQIR
                     VALENTLPPGADSPRVAILSSGTISETAYDQALVAMLVGYPIAQSGDLQIADGYLWLR
                     TIGRSQPVNILHRRLDAEYADSLDLRSDSLLGIPGLLQAARRHRVSVANHLGSGILEN
                     NGLLAYMDRIAESLLGESLKLPTVPAWWCGDPEGLAYVKSHLDSLIIKPISRVRGARA
                     IPARLLDEQARSQLLARIDAEPWRWSAQQYLEPSTVPVVEARSIEPRPMVLRTFGAAD
                     GASYSFMPGGLARVASSPDQWNITNATGAFSKDVWVLEDSHREAPSAGISPRRPAHLP
                     AEAADLGLPPSAAENLFWLGRYAERTEMTSRVLKVSEQLIADNLDRPGTPGHSAMRTM
                     LEALSMVTGVQPGFVGQGAAERLDEPLPQIRRLLLDEITQGCVAYNVGRMAACAANVR
                     ELLSGDTFSIFNALNATLRQAREGEDLLAVQPVINEALRSLLAFAGVANESLVRDATW
                     AFVEAGRRIERAELTVQLLRHTVSSVTGPVTEAVLSESVLSAGDSVITYHRRVAASFG
                     AVIPAEATLDLLLLDASNPRSVRYQLDRLIHVLSVAPNPRIEQAAAALVASLASTNPR
                     RLGGNERQRARLLLDELDAGLRDLSDQIQQAHFVTQLPAFSFAVPERSEDAYGH"
     CDS             99919..100821
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804381.1"
                     /locus_tag="brsh051_00920"
                     /product="transglutaminase family protein"
                     /protein_id="BEH00811.1"
                     /transl_table=11
                     /translation="MATEHNDPRRYQVVHRTRYRYDAEVTASFARAFLVPRVTPHQQV
                     LDHDVEISPAPDLYEVHTDFFGNHSHYVEIHTPHTQLQVRKSATLAVQWPAADLPSMT
                     IPVDRTVELVHLDPRIDPVKRASYLLPSPLIELSTPVREFASGLLDPRMPVGEAIGTV
                     YHAIYEGFSYTQGATTVATTLPEVINARAGVCQDFAHLAVASFRAVGLPARYVSGYIE
                     TYPPPGEEKLAGSDATHAWASVYIPERGWIDLDPTNDQLADSRYLVTAWGRDFRDVSP
                     LKGVIFSESRDSVLDVAVDVTRLD"
     CDS             complement(100829..101590)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005093147.1"
                     /locus_tag="brsh051_00930"
                     /product="transglutaminase family protein"
                     /protein_id="BEH00812.1"
                     /transl_table=11
                     /translation="MRLKLVHTVIVESDEPIHAWHGEARMTPCYLPNQSLLHPVVSIT
                     PSAWRHEYFDYWGTAVVMFNVPETHLRMRVTAATELDYSAPAAPNGRGVGWEALKDPS
                     VDERFCDHLRLPEGLEVPDQWRSWRAEAASPAEFVQELGHRGLIDADDGGVVPATMTA
                     LHWAGIPSRYVAGYSIPTELVRGVKRPAQVYNWLQYWDGRWVAWDPRLGCAPDSRHVA
                     VGYGATREDVPVLFGVHDSSGEVQMTSEVTVERLN"
     CDS             complement(101581..102525)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003895947.1"
                     /locus_tag="brsh051_00940"
                     /product="alpha-E domain-containing protein"
                     /protein_id="BEH00813.1"
                     /transl_table=11
                     /translation="MLSRIAGSLFWIGRYLERAENISRILEVKLQQFLEDPTVDERAA
                     SSSLLGAMGLDMPEHTDELIDAGAVLRYLWYDPDSPSSVRAIVAAVRQSARRIRETIS
                     PELWEAINTTYNEVFSASFTAIRPTASLQLVRLRCVQIAGLASQTMVHDEAYHFFLLG
                     QSLERVDMTSRLISTVAVEGNTLVAWTRALRAVGGHHAFNRTYFGEGDYLDAARFLIV
                     DRRFPHSLVYGLQAVQDSLGELDPINVKARQDPTARLVGRTRSRMEYLDASELIEGLE
                     DRMEQVQVACAQVSGELTDRYFAGIEVSVWHREVLVCD"
     CDS             complement(102525..104057)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013230917.1"
                     /locus_tag="brsh051_00950"
                     /product="circularly permuted type 2 ATP-grasp protein"
                     /protein_id="BEH00814.1"
                     /transl_table=11
                     /translation="MESLVNRYHPPEGVYDEMFDGEEVRSSYGLSYELMSDMPNTEFI
                     DRADYVRSTYLDQGVTFDVGGVESPFPLDVVPRIITAADWAQIEAGVQQRVTALEAFL
                     ADVYGSGKVFGDGVIPRRIVATSTHYHRVAHGIRPPNGVRIHVSGTDLVRDASGVFRV
                     LEDNVRIPSGVSYVMTNRRAMSTAFPEWMGRYQVRPVHGYPQLLLEALRAAAPEGISE
                     PTVVVLTPGVHNSAYFEHALLARMMGVELVEGSDLFCESGQVKARTTKGAQPVHVIYR
                     RVDDDFLDPMYFRPDSVLGVAGVLAVAAAGGVTIANAVGNGVADDKLICTYVPDLIRY
                     YLDAEPILAGVDTWRLENPKDRVEVLDRLEEMVVKPVDGSGGKGVVICPKASPKELDI
                     LRAAILEEPRNWIAQPVVQLSTVPTMIDGELGARHVDLRPFAVNDGESVKVLPGGLTR
                     VALGEGQLIVNSSQGGGSKDTWVLMDEGVGSQPRAQFWGPPDMTDERDMFGVVATQSQ
                     ES"
     CDS             104231..105157
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805160.1"
                     /locus_tag="brsh051_00960"
                     /product="PAC2 family protein"
                     /protein_id="BEH00815.1"
                     /transl_table=11
                     /translation="MLDPAELFNPEPHLESDEYPQPDGERPTLLITLGGYGDAGEAQE
                     LIGRQLSERLANHKLGTFDIDQLYDYAGQRPQIIFDRDHFTDYQKPEIALHKVTDDAG
                     AGFFWLSGPEPALQWERMIASIEHVMDGFDIGRVLILQAVPAPTPHTRPIHVSGFASD
                     PVLLGDRDGLPGTFQMSSPFIGLLTLRLGEHGKDVIGLAAHVPYYVAESGYPDAAIAL
                     LQQASSVSGLALPSDGSLAQSSETVNQTIEQQVAASAEAQQVVARLEQQYEQYMSHRQ
                     ITPRANVPTAEEIGAEVEEFLKGLDDGDQPTD"
     CDS             complement(105183..105926)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015775698.1"
                     /locus_tag="brsh051_00970"
                     /product="ROK family protein"
                     /protein_id="BEH00816.1"
                     /transl_table=11
                     /translation="MQITTLTVDCGGSGLKASVLDAAGTMKAPVIRIPTPYPLPPARL
                     IECFRELAAQLPPAQRITIGMPGMLRHGVVISTPHYITERGPRTRVLPQLVTEWEGLD
                     FQSVVSDSLGMPAKVLNDAEVHGAGVITGTGIEVVLTLGTGLGSAHFDGGHLAPHLEI
                     SRGPIRMSTYDEYIGEPERRRLGNAMWSRRVRRVVDSLRPVFVWDRVYLGGGNSRRIT
                     PGALIALGDDVVVVPNAAGIAGGVRAWTL"
     CDS             106000..107127
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388935.1"
                     /locus_tag="brsh051_00980"
                     /product="MFS transporter"
                     /protein_id="BEH00817.1"
                     /transl_table=11
                     /translation="MNFFTNGLMLTLVPRLPEIKQAFELSDDFYGIVVAAMGAGALVV
                     GPLPARFIARHGALKVALVSTIGAALMLALASGAASPLAFAVAFFLMGVLDAHIDAAQ
                     NTQGVAVQIWAGRTIMSSLHATWSVGATVATLAGSLAAGLRVPLAVHGGVMAATIIVL
                     ALACYRMGVIPPDVRLAQLHSKQKADQQAPANWRRLLPVLPLALLGVVGVVPEDATNN
                     WAALYLVDHFGLGYSPAGMAVTVMLVAQVIGRLLSDPLADRYGQETVASVGGGLVAAG
                     ALVVIATPVAPLVYVGLVLIGVGCAPIVPTAFSAAGRLPGLASGTGISLVGFALRLGL
                     TLNSPLMGAVAERSSVRAAFGIVVIAGLAACLLAWRYRPRH"
     CDS             107182..108384
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_037393649.1"
                     /locus_tag="brsh051_00990"
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="BEH00818.1"
                     /transl_table=11
                     /translation="MKVLVLGGDGFCGWPASLHLSARGDEVIIVDNFSRRRIDEELGV
                     QSLTPIRTMVERRAAWQEVSGRAISVVELDVAHDYHGLLALLREECPDAIIHYAEQRA
                     APYSMKSGKHKRYTIDNNVNATHNVLCAIVESGHDIHLVHLGTMGVYGYGTAGMAIPE
                     GYLGIQVPTDDGLVETEILYPTNPGSVYHMTKVLDQTMFAYYAKNDELRITDLHQGII
                     WGTNTIQTKLDERLINRFDYDGDYGTVLNRFLMQAAVGYPLTVHGTGGQTRAFIHIQD
                     MVRCIEIALNNPPAAGDKVKIFNQMTETHRVRDLAALVAELTGAEVEMVPDPRKEAAE
                     NELIVHNDNFLALGLDPITLSEGLLMEINETAGRYADRADLSRIPATSLWTRHQQAGV
                     PASRASAE"
     CDS             108399..109538
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011056273.1"
                     /locus_tag="brsh051_01000"
                     /product="glycosyltransferase family 1 protein"
                     /protein_id="BEH00819.1"
                     /transl_table=11
                     /translation="MRIAMFTEVFLPKIDGVVTRVLRTLDELSAMGHDVLVFAPGSPP
                     PVYAGFDIVKVRSVGFRPWYPEIKVGLPTPKIAEQMIAFRPEVVHAVNPAWLAAYGVL
                     SAKRRDIPLLASYHTQLASYTKDLHLSWLAGTADRWTTTLHNRAEVNLCTSPQMVAAA
                     IAGGVNDVDLWPKAVDTVTYHPGARTKRMRRRLTDSHPDMPLVIYVGRLSNEKNLDDL
                     LPVVHQMPDVRFAFVGSGPARESLESAFSGTNTVFTGYLRGHELAEAYASADVFCFPS
                     TTETLGLAGLEAMASGVPVIGADAGGIPHLFDDRIQGFLVPPHDPFEFATKLRMLVDD
                     PQLRRRMAQAARAEAERLSWRSATEALVGYYELAIERHALRHEKS"
     CDS             109806..111320
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259273.1"
                     /locus_tag="brsh051_01010"
                     /product="acyl-CoA carboxylase subunit beta"
                     /protein_id="BEH00820.1"
                     /transl_table=11
                     /translation="MRDKALQGGGQKRIEAQHAKGKMTARERLSILLDEGSFQELGAL
                     ATHNLSDFGMADKRYPGDGVITGFGKINGRRVAVYAQDFTVLGGSFSQVQAQKINKIQ
                     DLALESGIPIVGLNDSGGARVQEGVRSLAAYGEVFQRNVAASGVIPQISLIMGPCAGG
                     AVYSPALTDFTIMVDQTSNMFLTGPEIVASVTGEQVTAEELGGAAVHAGRSGVAQFEA
                     KSELDALEMTKLLLSYLPANTSEDAPILISDDDPDRMNESLNTIVSEDERKGYDMRQV
                     LDQIFDTDSILEVHESFAPNAICAFARLDGRPVGIVANQPMVMSGVLDIDSSDKISRF
                     IRVCDVYSIPVITFVDCPGYLPGVEQEYNGVIRHGAKIIYAYCQATVPKISIVTRKAI
                     GGSYVALSSKQMGSDVAFAWPTAQIAVMGPEGAARLLHGRQIRDSEDPAATEMQFIAE
                     YRERFFNPYRAADLGQIDEVIEPKETRPRLVRALEVLQTKVAPTVAKKHGLFPV"
     CDS             111327..111713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259272.1"
                     /locus_tag="brsh051_01020"
                     /product="OadG family protein"
                     /protein_id="BEH00821.1"
                     /transl_table=11
                     /translation="MADIGWGLWMMLLGMGSVFLMLIALMVVLMLLGRPGKQPAPAAI
                     EEAPSEPELESVEPADENAWMTIADDSGLTPEQIAAVSVAVAVHADVRRKQGAPANRV
                     YAPGSRLWASRWVAMGRSSQMTNQRR"
     CDS             111716..112222
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259271.1"
                     /locus_tag="brsh051_01030"
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit"
                     /protein_id="BEH00822.1"
                     /transl_table=11
                     /translation="MRRYQLTVNNNQYDIDVEELSATDFSVSIDGQTVAVTLNSQADT
                     AQAAITPQIEARSAAAAASAASGVPVAPKVPATMRAAKPRTPSPAVAGGADLAYSMSA
                     PMPGVIIEINVTPGSSVSKGDVVMVLEAMKMKNDLHASQDGVVESVDVSQGDQVKYGQ
                     VLLRFVKD"
     CDS             112224..113357
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259270.1"
                     /locus_tag="brsh051_01040"
                     /product="sodium ion-translocating decarboxylase subunit
                     beta"
                     /protein_id="BEH00823.1"
                     /transl_table=11
                     /translation="MDASTIQNLLTGFYNLSWQGLVMIAVGILLIYLAIAKEYEPLLL
                     LPIGAGCLLANMPISMMLGTAEEPGMLQFLYDIGVGNELFPLLIFIGIGAMTDFGPLL
                     ENPKMVLLGAAGQFGIFLTLILALLLGFTRPEAASIGIIGAIDGPTSIYVSAQLAPHL
                     LGPITVAAYSYMSLVPIIMPPVMRLLTTQKERSIRMPYSSREISQRTRIMFPIVVTII
                     VGILVPFALPLIGTLMLGNLMRESKVVERLSGAAQNELNNIVTLFLGLAIGSTMVGQN
                     FIKPQTLFILVLGLLAFCLDTAAGVLFGKLMNLFSGGKFNPLIGAAGISAFPMAARVV
                     QKEVSREDNTNFVLMHAMGANAAGQVASAMAGGVVLALMAGAI"
     CDS             113458..114984
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011015077.1"
                     /locus_tag="brsh051_01050"
                     /product="Hsp70 family protein"
                     /protein_id="BEH00824.1"
                     /transl_table=11
                     /translation="MQLGIDFGTTRTVVAYADRGNYPVVGFTDSHGDAHEFLPSLVAS
                     ADQGLVYGFAAAQARAAGRPVLRSMKRELASAMASTSSRVHVGHEQYQLLDVMVGYLN
                     HVRTQLETSSTIAPLLKSDPIAGVVVAVPAHANSGQRFLTLEAFRQAGFPVTAMLNEP
                     SAAGFEYTHRLAGSPSARRSRLVVYDLGGGTFDASLVAIHDRSHAVLGSVGVNRLGGD
                     DFDAVLADLACELAGIRPDDLGVDGYFQLLGDAQAAKEQLAPQSRRIVLEVQDQTVIV
                     PVADYYQACAPLTEQSIKAMGVLVDGLDAGTPDLSAIAGLYLVGGASSLPLVPRMLRE
                     RFGRRVYRSPYPAASTAIGLAIASDPESGYTLSDRVSRGFGVFREADAGERMQFDSIF
                     DRDQTMSVGGDLTIQRRYRAAHNIGWYRFIEYAGLANGQPEGDIVPYADVLFPFEDAL
                     QAEPPAVDEVEVRRTGEGHLIEETYHLDQHGIVSVSITDLDTGYRQSHQLGLAGSARL
                     "
     CDS             114994..115893
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01060"
                     /product="hypothetical protein"
                     /protein_id="BEH00825.1"
                     /transl_table=11
                     /translation="MAADQPSSNPEWPDFVPPEFEQSIPQAPKEPVVPSTPPPANWSS
                     GSGAWTPGPAPRQSSDRWFNRPPDNNGASFLPGAAARTPVTNALMAICVVVWILQNLS
                     PAFNDLVMLIPSVAATEPWRFLTSAFAHAPRSFTHIGFNMLTLWLMGRYLEPILRARR
                     FLAVYLISALGGGTLFVLLAFPAGQGPGGTGSNWNTAVLGASGAIFGLFGAYLVLAWA
                     MKRSLTPMLILLGLNLVVMVLFPTIAWSAHIGGFLAGAAATGVIFWDLRRVANGRRSH
                     LRGGLLAVTAALIVALIIKYLSV"
     CDS             complement(116071..116316)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01070"
                     /product="hypothetical protein"
                     /protein_id="BEH00826.1"
                     /transl_table=11
                     /translation="MHEIADVIGHHQARHGGSHAACVGVLAPGSRQRGIGADHLIADL
                     TGIRLDEGFQPRYQGFDNQGGREVACRGTTDTISDQQ"
     CDS             116200..116775
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01080"
                     /product="hypothetical protein"
                     /protein_id="BEH00827.1"
                     /transl_table=11
                     /translation="MIRANAALARAGREDSDARGMATTVTGLVMTDDIGYLVHVGDSR
                     AYRCRDGVFEQLTVDQSWVQMLLDEGMLDPADASTHPMRNMLMHSLSGALRDPEAVHI
                     TPIDLQIGDRWLLATDGLTSYLPRDVISSQVTSVSAPQELANILVDLCWPHSLDNITV
                     LIGDVIDSEAKQQSQFVGAVQGYELRRSRVS"
     CDS             complement(116791..117330)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_016328048.1"
                     /locus_tag="brsh051_01090"
                     /product="L-threonylcarbamoyladenylate synthase"
                     /protein_id="BEH00828.1"
                     /transl_table=11
                     /translation="MIAYATDSGFALGALLGNHAGADRIREIRHLDDRHHLTVVVSEF
                     AQLGRYVQMDNWVFRAIKAATPGPYTFILPASREVPRTMQHPKKRTIGVRVPAHTAAL
                     ALLDRIGEPLVSSTLILPGAEEPMADGWQINEEIGHLIDAVYDSGDAGRTPTTVVDLT
                     GAEPEILRQGGGDPELFVP"
     CDS             complement(117431..117850)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01100"
                     /product="hypothetical protein"
                     /protein_id="BEH00829.1"
                     /transl_table=11
                     /translation="MPAKNPGRGQRGFSVSVLVCLLIPILLVCIGLAVDGAAKAAADR
                     RAEAVAAQAARAGLDAAAPALVSGMTSEAGAGQIAVRAAEQVIASHPDMEGMAVVGGE
                     VTLQVTTSTTVRTTFLSLAGIDELPGRGSAIVELRMR"
     CDS             117977..119191
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015775974.1"
                     /locus_tag="brsh051_01110"
                     /product="pyrophosphate--fructose-6-phosphate
                     1-phosphotransferase"
                     /protein_id="BEH00830.1"
                     /transl_table=11
                     /translation="MVNKVGLLTAGGFAPCLSSAVAGLITRYTELAPEIEIIAYRHGY
                     EGLLKGDSVVVTPEVRAHADRLYKFGGSPIGNSRVKLTNVADLVKRGLVAEGENPLEV
                     AAKQLVADGVDVLHTIGGDDTNTTAADLAAYLADNDFDLTVVGLPKTIDNDIVPIRQS
                     LGAWTAADEAADYAKNIIAEHNAAPRELIIHEIMGRNCGYLAAETTKRYQAWLDEQEW
                     LPEIGLSREAWAVHAVYLPEVAVDLDAEAERLSKIMDEVGNVNIFLSEGAGVAEIVEQ
                     MEKNGEKVPKDAFGHVQIDKINPGAWFGKQFSKRIGAQKTMVQKSGYFSRSAPSNDED
                     LALIGRTCVMAVDAALAGTPGVIGLDEENNDQLSVIDFPRIAGHKPFDITQPWFVELS
                     ESIGMPKPEHAK"
     CDS             complement(119193..120311)
                     /codon_start=1
                     /gene="yhjD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005157374.1"
                     /locus_tag="brsh051_01120"
                     /product="inner membrane protein YhjD"
                     /protein_id="BEH00831.1"
                     /transl_table=11
                     /translation="MSSVHSLLEWLQASPAGSHLLRAYVRYMNRLGNQLSAAMAFFTI
                     LAIVPVLMFAFAAVGFTLTVLRPDLLGVVQIFLVDNLSAGPLQDQILILLSQYLLNWR
                     NVGILAIGIALVVGTSWVANLKGVIRGMGRPSFDMVQRHKPWQEPLINMGLLLVILVL
                     VATTFTATVIGTQLAGTIVDWLHVSSLAVGISSALVRVASLAFSLAGATLLFWLMYRF
                     LPDERPPASALKRGSVGAGVCFVILQTAVSWLTGLLSAARATQLFGPVILAMLFINFF
                     ANLILLWAAWIATSNQPAVARRHSLGDEILRGQELTVTVEDHWAHADAEVEQRLQADR
                     SASQLGTTQSPADGRRPARLRLRIRRGAGPAGRRIHKR"
     CDS             complement(120334..123153)
                     /codon_start=1
                     /gene="gcvP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_034284375.1"
                     /locus_tag="brsh051_01130"
                     /product="aminomethyl-transferring glycine dehydrogenase"
                     /protein_id="BEH00832.1"
                     /transl_table=11
                     /translation="MSSFLHRHIGPDAIQQTRMLDRLGLSSLDELVDKAMPAAIRVDD
                     GLSLPAGIDEAAALERLRSLAARNNPGRAMIGLGYHGTITPAVIRRNILENPAWYTAY
                     TPYQPEISQGRLEMLLNFQTMVADLTGLPLAGASLLDEATAVAEGVAMARRAVRSGQV
                     VLVDPGLLPASLAVLRTRMDAAGIEIVIGGDDLAADDNLARAFCVVVQTPTADGRLQS
                     TAELAALAEAAHAVGAQLVAAADLLALTLVTPPGEWGADIAVGSTQRFGVPLFYGGPH
                     AGYIAARAGAERRLPGRLVGVSTDADGAPALRLALQTREQHIRREKATSNICTAQVLL
                     AVTAAAYALYHGPEGLREIATGIHLSARQLAGALRAAGAQVVHESFFDTLLVGVPDAD
                     QVVRRARAAGIHLRRVDAGHVGVSIGEDATDDDLVAVAQAFGAEIAGDQFWGGLAADA
                     RTSEYLTHPVFGSHHSETSLMRYLRSLADRDFALDRGMIPLGSCTMKLNSAAELEPIS
                     YPGFAGLHPFVPDSDAQGMHELIDELSGWLAEISGYDKVSLQPNSGAQGEFAGLMAIR
                     RYYRARGEDGRTVCLIPSSAHGTNAASATMAGLKVVVVKATEDGSIDLDDLRAKVAAH
                     AGRLAAIMITYPSTHGVFEDTISTACELVHSAGGQVYVDGANMNALVGLARPGKFGAD
                     VSHLNLHKTFAIPHGGGGPGVGPIAVRAHLAPYLPDAEHPVSESAFGSAGVLPITYAY
                     IAMMGADGLRQASQVALLNANYIAKVLNEAFPVLYTGQGGLVAHECIIDPRAVCKHAG
                     LTIDDIAKRLIDYGFHAPTMSFPVPGTLMIEPTESEDQRELDRFCDAMIAIRAEIDLL
                     IAGEWPHDDNPLVNAPHTLGRCTADEWTHPYSRRLAAYPAGRSTGQLGPADSQKYWPW
                     SARIDNAYGDRHLMCTCPPVADYVQ"
     CDS             complement(123213..123779)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805153.1"
                     /locus_tag="brsh051_01140"
                     /product="MerR family transcriptional regulator"
                     /protein_id="BEH00833.1"
                     /transl_table=11
                     /translation="MSSPQESLSVVSAQDALFEGDFGPLPDDLAFRGPVACNVAGISY
                     RQLDYWARTGLVTPEIRDAGGSGTQRLYSFRDILMLKVVKRLLDAGISLQQIRTAIDH
                     LRERGVQDLSQVTLMSDGISVYECTTDHEVIDLLRGGQGMFAIALGGVWRDIEGTLLA
                     LPGERTAAVAAEPMDDELSRRRQQRAAN"
     CDS             complement(123966..124427)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977444.1"
                     /locus_tag="brsh051_01150"
                     /product="bifunctional nuclease family protein"
                     /protein_id="BEH00834.1"
                     /transl_table=11
                     /translation="MIELDIMGVRVEVPSNAPMLLLKESGGQRYLPIWIGAAEASAIV
                     NALEGIVPPRPMTHDLMADVLSQLGHVDLEGRITTVADGTFYAELWVDGHAITARPSD
                     VVALALRSGFKVKCPDELLDQVGVELFEPAEDEVEKFREFLDQISPDDFEN"
     CDS             complement(124455..125165)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027756.1"
                     /locus_tag="brsh051_01160"
                     /product="MerR family transcriptional regulator"
                     /protein_id="BEH00835.1"
                     /transl_table=11
                     /translation="MPPPAKRSIGQVLPLLKNEFPDISISKIRFLESEGLVSPERAPS
                     GYRRYAEADIDRLRYILRMQRDHYLPLKVIRQNLEMMDRGIEPPTIESPASSNSAASA
                     APETDPQDPATAPRPAQKRPMKLTRRELLQVSGLSEATLIELERQQMVVPKRGSIYYG
                     REALTVCVVARRLQEYGMDSRHMRAIKQAAEREAGLVEQAVRPYLAISAKPAQTLHEV
                     SQLVVHAHAAMIYTLLEG"
     CDS             complement(125165..125656)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01170"
                     /product="hypothetical protein"
                     /protein_id="BEH00836.1"
                     /transl_table=11
                     /translation="MIDCSKCGHSNPVGSNFCSKCGNALPASVSETTRVIIVPEEDPR
                     TLEISAEDADALSTLPAGNALLIVTRGPDVGARYLLDKDIVTAGRSPKSDIFLDDITV
                     SRDHAEFVMRDGQISLVDKGSLNGTYVNRTLVDQAAVLRPGDEVQIGKFRMLFFVSEH
                     GLR"
     CDS             complement(125751..126137)
                     /codon_start=1
                     /gene="gcvH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226819.1"
                     /locus_tag="brsh051_01180"
                     /product="glycine cleavage system protein GcvH"
                     /protein_id="BEH00837.1"
                     /transl_table=11
                     /translation="MIELPEDVLFTAEHEWVRIDSSTVARIGVTAYATGELGDIVYVS
                     LPTVGSSVVAGDSCGELESTKSVADIFAPVSGVVVRINETVADEPELIGQDPFGEGWL
                     FDVELADTSELDDLLDEDAYAEHIGE"
     CDS             complement(126187..126927)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01190"
                     /product="hypothetical protein"
                     /protein_id="BEH00838.1"
                     /transl_table=11
                     /translation="MPESAAPKPRDLGGAIAGWLRPNRKQLVWAVALCVVAAAIVIQV
                     QSSAKDDQYAALRRDDLVQLLDGLTTETDQLTAEVAELERTRDALASGADAEAVAAQE
                     AQKRADTLGILAGTVAAVGPGVRITISAPPGALTTDIMLEAIQELRDAGAEVIEINDS
                     IRLVAQSWVGQTQEGLVIDDQAVSLPITIDAIGDSHALTEGAKFRGGLVSQVESDRIG
                     GSVDIEQLDEVEITSLATPRTPRYARPA"
     CDS             complement(126920..127252)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813185.1"
                     /locus_tag="brsh051_01200"
                     /product="small basic family protein"
                     /protein_id="BEH00839.1"
                     /transl_table=11
                     /translation="MLAILGLIAGVVLAIIWRPDMPIWLQPYLPIMIVAALDALVGAA
                     RAGLEHTFSDKVFAVSFISNVAIAALIVWIGDLIGVGSQLSTAVLVVLGIRIFTNAAV
                     IRRKVLHA"
     CDS             complement(127308..128102)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977439.1"
                     /locus_tag="brsh051_01210"
                     /product="DUF881 domain-containing protein"
                     /protein_id="BEH00840.1"
                     /transl_table=11
                     /translation="MSTTQAPPKRRPPDASMELLTAIQRDTIDPEYGSHYGEDRHDRR
                     RHRWLAVLVSFLAGLMFVTSSMGAGRGNDNVASERADLIAQVNQAELRNKELRSEADE
                     LAEQVQELEEAQLGRQVDLDKSSLVWSGMGAVTGPGLALTITENPLDDAGILIDQDIR
                     QVVNGLWLAGAEAVSVNGYRLSSRTAIRQAGSAITVDYRSLTAPYRIEAIGDPDSLAS
                     RFESGPGGAWLNFLKRNHGVGWTMESRGALELDADGGLGVDKAGVR"
     CDS             complement(128106..128705)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_221514425.1"
                     /locus_tag="brsh051_01220"
                     /product="CDP-alcohol phosphatidyltransferase family
                     protein"
                     /protein_id="BEH00841.1"
                     /transl_table=11
                     /translation="MAADRPLVSNRVWTIPNVLSFLRLLGVPFFLALILLEHDVAAVV
                     LLALASLTDLLDGRIARRFNQVSKLGEMLDPAADRLYIFATVLGLAVRGIIPWWLLVV
                     LVGRDVTMAALLPALKSRGFASLPVNFIGKAATFCLLYALPLILLGAGPWVISPAASI
                     IGWAFAIWGAFLYWWAGLMYIWQTQQILRSVPPVKTRAS"
     CDS             complement(128751..129902)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027828.1"
                     /locus_tag="brsh051_01230"
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="BEH00842.1"
                     /transl_table=11
                     /translation="MKVGLVCPYSFHRPGGVQNHVLGLAGWLKSVGHQIAILAPGFPP
                     DGMLADYGLSDAEFTTGGKAVPLKVNESVARINFGFGPARKAKAWLDAGDFDVVHLHE
                     PIAPNLSLLTLWLTDRPVTATFHSNSPTIKSWKRINEMLPGAVRRLDAAIAVSSVAAK
                     VAKENTGVVPVVIGNGLAIDDYELKPVSGRWRGGDHPRVTFLGRYNEPRKGFHVLTAA
                     LPLVRERFPDLEVIVIGHGPAMSIDGVTFVGGVSDAERNRWLSVSDVYVAPQTGRESF
                     GIVLIEAMACGAPVVASNLSAFVEVLSDHDGVIGHIFKTGNSHALAEAIIDSLNEPRD
                     LRLLRGRAQAASFDWSVIGPQIVAMYEIAAENRYLAVDEAKGRARRHIT"
     CDS             complement(129899..130771)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027829.1"
                     /locus_tag="brsh051_01240"
                     /product="phosphatidylinositol mannoside acyltransferase"
                     /protein_id="BEH00843.1"
                     /transl_table=11
                     /translation="MSTPRSGRATLTAFRAAAHIPRAIWQPCAQLASLALAARPPKPL
                     RQWAINARVVTGAQPGFKDRYRAQLSWFRNTVGSLQLGRLTLDQIAGKVDVDPGQLEA
                     LLTSHAERGLVIAIPHMGSWDLAGAYGQVVGLPVTSVAERLPAGQYQYFSALRAKLGM
                     QIYPYDQHGLVETLADDVHSGRVACLVADRDFGRHGLAVSWPAPGGARELTVPPGPVL
                     IAQRTGADLVPIAAWFVGNRTHLEIGEPIEHRPGVDGAGVMAQQMVDFFATQIAGHVT
                     DWHMMQRFFPGEMA"
     CDS             complement(130768..131391)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027830.1"
                     /locus_tag="brsh051_01250"
                     /product="CDP-alcohol phosphatidyltransferase family
                     protein"
                     /protein_id="BEH00844.1"
                     /transl_table=11
                     /translation="MLEKIRAQWTKVIHPFALGLLKLGVTPDMVTWTGTIATIIVALV
                     FFPQGWLWQGVAVLALFIFSDSLDGTMARESGSSSKWGAFLDSTLDRLADGAIFGGIA
                     IYYAAQPDGLLWCAVAIGALVFALVTSYSKARGESVGIEVHAGFAGRADRLLVGLLGV
                     LLTGIGLTWALPVALSYLCLAGAFTVGQRMWIVRRAILAEQGAEEAA"
     CDS             complement(131384..131977)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804993.1"
                     /locus_tag="brsh051_01260"
                     /product="HIT domain-containing protein"
                     /protein_id="BEH00845.1"
                     /transl_table=11
                     /translation="MNDEQPCEVIQPGELPGEPDALQRLWTPYRMVYIQGSSKPADGS
                     AGQCPFCRAPERSDEESLIVHRGRTAYVICNLYPYNPGHLLVCTYRHVSSYIDLDPQE
                     TVEVAELTQQAIRMILHVSGPAGFNLGMNQGQIAGAGIAAHLHQHIVPRWQGDANFLP
                     VIGRTKALPQFLADTRQLFADGWAELFGTTESEGQHA"
     CDS             complement(131970..133976)
                     /codon_start=1
                     /gene="thrS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977296.1"
                     /locus_tag="brsh051_01270"
                     /product="threonine--tRNA ligase"
                     /protein_id="BEH00846.1"
                     /transl_table=11
                     /translation="MSVNISITRDQSPEAQVVEQGTTGLDLFGNDRSIVAMAVNGTTV
                     DLATLVHDGDQISPILMTSDEGLAIVRHSAAHVTAQALQQIFPEAKLGIGPPIVDGFY
                     YDFQTSPLSPDDLKAIEKKMQAIIKERQRFVRRAVSDQEALDEEAGEPFKLELIHDKG
                     SASSDDGSSVEVGKGELTMYDNVRRNGEVAWTDLCRGPHVPHTGYINAVALTKTSSAY
                     WRGDQRNQQLQRVYGTAWATRDDLKAYQHRMEEAAKRDHRKLGAELDLFSFHEQVGSG
                     LPLFHPKGGVIKRVMEDYVRTRHIDEGFLYVGTPHIAKEELFYTSGHLPYYADVMFPP
                     LDDDGQAYRLKAMNCPMHNLIYSSRGRSYRELPLRLFEFGTVYRNEKSGVVQGLTRVR
                     SITQDDSHSYCTPDQAPDEVRHLLRFVLSLLHDFGLTDVALELSTRDEVGKKKDKFIG
                     SDEQWEAATKILAEIAAESGLTVVDDPGGAAYYGPKISIQAKDAIGRTWQMSTIQYDF
                     NQPERFGLEYVAPDGSHRQPVMIHSAKFGSIERFMGVLIEHYAGAFPVWLAPVQVVGI
                     PVAASFNDYLAEVLDKLKAAGVRTELDASDDRMQKKIRNAQKQKIPFMLIAGETDAEA
                     GSVSFRFRNGSQRNGVPIDEAVAFVRDWAQSRRNDDPKAEADGE"
     CDS             complement(134159..135175)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_086845576.1"
                     /locus_tag="brsh051_01280"
                     /product="magnesium transporter CorA family protein"
                     /protein_id="BEH00847.1"
                     /transl_table=11
                     /translation="MGAMSTDSVIRSIVWRDDKIAETDIDFSTISARLADPEQLLWVG
                     LQQPTADDLARLGKELDIDPAAIEDALNHVERPKALRYAHYSFVTVYAAKWAGGELSP
                     ASPGELTLTKLSAFTFPHGLVTVWYDPDFSFDEIIDRWSEDSYLSAHGSAMLVHGMLD
                     YVVDGYFEITQDFDDVIEDLEDEVLEQTAGSRDLQRRIYRLRASLVHLRRAVVPMREV
                     VASIMRHRREVSADATLDPWFDDLYDHALRAADWADSLRDLVTTIFETNMSLQDTQLN
                     VVMRQLAAWAAIIAVPTAITGWFGQNVPYFGFNQPYGLWLSVSLIVVISVTLFISFKR
                     RDWL"
     CDS             135270..136247
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011015422.1"
                     /locus_tag="brsh051_01290"
                     /product="SPFH domain-containing protein"
                     /protein_id="BEH00848.1"
                     /transl_table=11
                     /translation="MPDETRDVVEEASVGGEAAGKPVGHEGTRVMVDERPAWTMSGAL
                     ALLLALALLGLSTWGIIATAISDDAGLGVNGLLIFGCIVGYLLAFLMFTSLTIVAPGD
                     TKVVQFFGRYIGSIRKQGLLLTIPLSSKKRVSVKVRNFETNELKVNDADGNPINIAAI
                     VVWQVADTAKSVFAVEAYEDFVKVQAESALRHIATSHPYDFAEPGEESLRGSTDLVSG
                     ELAEEVAARIAIAGLEVVETRISSLAYAAEIAQAMLQRQQASAVLAARSKIVEGAVGM
                     VEQALERLETDDIVSLDDERKAAMVSNLLVVLCSDSRSTPVINTGTLYG"
     CDS             136244..136522
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01300"
                     /product="hypothetical protein"
                     /protein_id="BEH00849.1"
                     /transl_table=11
                     /translation="MSTGKDEVARGNEPRVTEPGRPRGNPSRKSILLRLDPAVHEALA
                     KWASDDLRSVNSLIEMLLRDDLRRAGRAVKAEPIRRPGRPRGNSADGS"
     CDS             complement(136551..138524)
                     /codon_start=1
                     /gene="yagF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013095374.1"
                     /locus_tag="brsh051_01310"
                     /product="xylonate dehydratase YagF"
                     /protein_id="BEH00850.1"
                     /transl_table=11
                     /translation="MALRDLFTGTDPSIYEVRTQAPGPAGRLPLTPELLADAPSGDLF
                     GMTMNVGMGWNPDDVNRDAVMIVSTAGGATDADGNPIALGLHTGHYQLAELVNEAARE
                     VAAQGALPYATYVSDPCDGRSQGTVGMFDSLPYRNDAAIVMRRLIRSLPTRRAVMGIA
                     SCDKGLPAMMIALASMHNDPAILVPGGTTLRASDGEDNGAVQTIGVRYAAGEMSFEDA
                     AEAGCRACASPGGGCQFLGTAGTSQVVGEALGLALTHSALAPSGEAIWRDLARASADA
                     LLDLKHRKIFTRDILTDHAIENAMVLHAAFGGSTNLLLHLPAIAFAAGLQVPGVDDWA
                     RINSAVPRLVSVLPVGPVDYPTPMVYLAGGVPEVMLHLRRLGLLHTDVLTVTGETLDA
                     NLDWWEASERRQLLRGRLHDVDGVDPDDVILSPQAAKAKGMASTVTFPLGNIAPEGSV
                     VKSAAIDPSVIGDDGVFRHTGPAKVFTSEKAAIKAIKQSTIAAGDIMIVLGAGPLGTG
                     MEETYQLTSALKKVPYGKHVSLITDARFSGVSTGACFGHVGPEALAGGPIGKLRDGDL
                     IEIVVDTVGLTGSLNFIGSPDEPLTPPAGAEVLAARQTYPGLAPDRDLPDDTRLWAAL
                     QDVSGGTWGGCVYDVDRIIEVLEAGKKALAAQQ"
     CDS             complement(138680..139390)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391259.1"
                     /locus_tag="brsh051_01320"
                     /product="glutamine amidotransferase"
                     /protein_id="BEH00851.1"
                     /transl_table=11
                     /translation="MNHDRTALAIRHVAFEDLGLIEPLLVARGYQVSYLDIGVDSLDP
                     QILTQPDLVVVLGAPIGVYETDAYPFLVTELEAISVRLQAGLPTLGICLGAQLIAAAL
                     GAPVTPTGRKEIGYAPLQLTDAGRASVLAGLEGVAVLHWHGDEFAIPDGAQRLAQTPG
                     FPNQAFCLGDRVLGLQFHVEADHTRIERWLIGHALELAAAGIDPRQIRADATTCGPML
                     ADVAVTTITSWLDRAERG"
     CDS             complement(139424..140185)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01330"
                     /product="hypothetical protein"
                     /protein_id="BEH00852.1"
                     /transl_table=11
                     /translation="MAKRGVSGAIMRGLGAKDHALTVVDKKVLAPHFVQVRMTSPTLL
                     HDLDTGPAAWLRFWFPGEGSHEYQRGYTITHPDRSTGEFNVNFVLHEPAGPGSAWAKR
                     ARPGDTVQAMIYGSTTFEVPDQPATGYLLIGDSASIPAIASIIEALPSEAHIECYLEE
                     HDPADHEIPLPEHPGATVYWVPRQGPGSLTAAIPARDYGGWYAWVAPESGSLKALRPR
                     LRNEFGFTKATSYIQAYWVEGKTMGTRRGLGESSD"
     CDS             complement(140282..140722)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01340"
                     /product="hypothetical protein"
                     /protein_id="BEH00853.1"
                     /transl_table=11
                     /translation="MAFENAEIYGYLSEYAAALESFDAERAAALWGTPSTVLTDEAVS
                     VAHNHEDLVRELQKNYPQYQKLGLASVGNELIEVNPLTERLVRVRVRWVLHDRSGAIL
                     TAISYIYVLRRDDDGVLRAYVAVPIEEDEKLARLAKRRGVALDD"
     CDS             140886..142634
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776516.1"
                     /locus_tag="brsh051_01350"
                     /product="ABC-F family ATP-binding cassette
                     domain-containing protein"
                     /protein_id="BEH00854.1"
                     /transl_table=11
                     /translation="MNSLISSPLLPGAHLRVDGVSLAFADRRVLTDVSFVVSAGERVG
                     IIGENGSGKSTLLRIIAGLLPPDSGAVTVNATAGLTPSIGLLHQDAPFTPGDSIAQAL
                     ESAVAPARDVLAAMDRHAAQMAADPDDHDAAARYAQTLDDAERLEAWDVDARIAAMLA
                     GLGLDDLPTDRLTSEISGGQRARLSLAWLLLSAPDVLLLDEPTNHLDDHATAYLRSIL
                     LAWRGPVLFASHDRAFLDETVTSLIDLDPAPVPHAVAGPLTVDGPGSGIGITRFTGSY
                     SDYLAARNQARIRWETQYRDEQAELKRLRASVRDNHVVGHENWKPRTEVRGAAKFYSD
                     RNAAVVSRRVNDARSRLDDLEQRQIRRPPAGLRFGGLTAGLELRNRREFSGPVLAASE
                     VAVSGRLESVSLTVSATEKWLVTGPNGSGKSTLLEVLAGQLDPTGGSVNAPAGLRIGM
                     LSQDVDLPDPFERGDQRSVRQAYQDLLGAELAEQAPLSRFGLIAGRDENRPLLALSLG
                     QQRRLALAVLLADPPDVLLLDEPTNHLSLLLVTELEAAIPGYPGTVVVASHDRWLRRN
                     WTGQRFEMAADGDSPV"
     CDS             complement(142646..143308)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004521496.1"
                     /locus_tag="brsh051_01360"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BEH00855.1"
                     /transl_table=11
                     /translation="MTDTEGDGLDLAERIAGVLRERLITGAAVPGEQLSEAALASDLE
                     VSRNTLREAFRILIHEGTLERIPNRGVFVRVPSVSSILDVFRVRRVIEVAAVREALPK
                     HPAIADARDAVERAKQAQEIPEWTIVGTANMEFHSALVSLADSPRLNIFFQNVLAELR
                     IAFVSLHSAEHLHAPFVEQNEELTVLLEQGRMTEAAAELETYLARSERLVLASFGRMG
                     QS"
     CDS             143525..144802
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011266439.1"
                     /locus_tag="brsh051_01370"
                     /product="divalent metal cation transporter"
                     /protein_id="BEH00856.1"
                     /transl_table=11
                     /translation="MTAESTTRPASPSDSEGTDLKTFAKKRRSSLIGAIFLMATSAIG
                     PGFITQTATFTSRMGAAFAFGILASVLIDFAIQTNVWRMITLSGKRASDLANAALPGS
                     GYLLTVLIVFGGLVFNIGNIAGAGLGLNSLLGVDAKIGGLISAFLAIAIFLYKRAGVI
                     VDRVVVFLGLLMIGLTLYVAIVSSPPVGEALRQTIWPDAINFATITTIVGGSVGGYIT
                     YSGAHKLLDSGNAGPEHIKQVTRSALAGIAATGVMRYVLFLAILGVVSSGVVLDTSSN
                     AANPAAQAFHYAAGELGLRAFGLVFWAAAITSVIGAAFTSVSFITVFSKTGMTERTRN
                     WWTVGFILVSLAVYVTLGTAPAALLVFAGGFNGLVLPIGLTLFMYIGWFHAKQLLGGP
                     YSRFLLVVGTLATALSWYMAVVSIVPIFQFLGR"
     CDS             144811..145614
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973421.1"
                     /locus_tag="brsh051_01380"
                     /product="putative hydro-lyase"
                     /protein_id="BEH00857.1"
                     /transl_table=11
                     /translation="MNGLTTALSASSPPEQARQAFRSGLVRPTAGLSQGYAQANLITL
                     PRADAADFQEFARLNPKPCPLLDVLDGTTEPAIAPGADLRVDLPLYRVWRDGELVDEV
                     SDATDAWGDPAALVSFVIGCSFTFEWALLDEGIPVRHITADRNVPMYRTNVSCVGAGA
                     FSSPLVVSMRGIPAEMVDAAVEVSGRYPLVHGAPVQVGDPEKLGITDLQHPDYGDAPI
                     LEAGDVPVFWACGVTPQAAVVASRPRFAITHAPGHMFISDVPNDRYLVV"
     CDS             145680..146453
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105454.1"
                     /locus_tag="brsh051_01390"
                     /product="5-oxoprolinase subunit PxpA"
                     /protein_id="BEH00858.1"
                     /transl_table=11
                     /translation="MTESSARVDLNSDVGESFGRWTIDDAAMLTTVSSANIACGFHAG
                     DPSSIRRSLTVAAANGVTVGAHVGYRDLVGFGRRDLDVDTPDLIADIIYQIGALQALA
                     IGAGTRVSYVKPHGALYNRIVHDERQAGAVVTAITEVDPSMVLLGLPGSAVLGLAERA
                     GVPTATEAFADRAYTPQGELVSRRIEGSVLRDPELIANRIVRLVEAGTITAIDGTEVR
                     LHADSICVHGDSDGAVEAARALRARLTAAGVQIASFAGV"
     CDS             146455..148089
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105456.1"
                     /locus_tag="brsh051_01400"
                     /product="5-oxoprolinase/urea amidolyase family protein"
                     /protein_id="BEH00859.1"
                     /transl_table=11
                     /translation="MTELRSTPRILPVGEQALLVELADLATTLGFFDSLRAAELDGIV
                     EAVPAARTVLVKYAPGTVSYGELADRLATLDVSDGTSSSGQLVEIPVHYDGADLSEVA
                     DLLGITTAELIRRHCESDYRVAFGGFAPGFAYLAGGDPLLDVPRRATPRTRIPAGAVG
                     LAGTFSGVYPRESPGGWQLIGRTDVVMWDLDRTPPATLQPGDRVRFVDAGPARVNGVP
                     VSTSTVIRANSGCAERAVEVLRPGAQAVLQDEGRVGVAGLGVTGSGALDRPALHTSNG
                     LVGNSPGEAAIEFAQGGEIEAHGEIVLAVAGACGELRITRRSGRVDSAAGLSPIALGS
                     GERLAIVPARGGLRNYLAVRGGFDVPLVLGSRATDTLSGIGTPPLTAGSMLDVRTIGA
                     VPFPPVRAPEPWPSEHVFADVVELPVVLGPRDDWFTQQALGTLFTQLWGVTRQSNRVG
                     LRLHGDLPLERSITDELPSEGVVPGALQVPASGQPVLFLADHPVTGGYPVIAVLTTRA
                     LAVAAQLTPGISVRFTAADSSLTPLAVHTPTSLELP"
     CDS             148086..149816
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973423.1"
                     /locus_tag="brsh051_01410"
                     /product="acetyl/propionyl/methylcrotonyl-CoA carboxylase
                     subunit alpha"
                     /protein_id="BEH00860.1"
                     /transl_table=11
                     /translation="MNRILIANRGEIAVRIVRACHDSGRVAIAVYADSDADAEFVRLA
                     DEAWALEGSTAAQTYLDIAKLIGIARRAGADAVHPGYGFLAENADFARAVLDAGLIWI
                     GPPPEVIDLLGDKVAARALAQQVGAPLVPGTPGPIPGPHEAAAFAARNGLPIAIKAAH
                     GGGGRGLRVVWRAEDVVEQYEAAVREATQAFGSGECYVERYLDRPRHVEVQILGDSAG
                     TVVPVGTRDCSLQRRSQKLVEEAPAPFLTADQHALITGAARDICAAAGYVGAGTVEFL
                     LAADGTISFLEVNTRLQVEHPVTEETTGIDLVLEQFRLAEGGRLDPAPPPVHGHAIEF
                     RINAEDPSRGFLPVAGALTDFRPPAGPGVRLDSGVSSGSVVPAAFDSLLAKLVVWGPT
                     RDAALARARRALDEFDIGGLPTVLPFDRDVVVDPAFTGEPFGVHTRWIETDYVTRAEP
                     EPLPEPPLGLDVVRTWVELDGRRVQLGIPAGILAVGSLAASGVTENADVTPTAPAIPE
                     GAVVSPITGSVVRWLASDGSTVAEGEATVVVEAMKMETTVVAPRPGTLTVTAAEGDAV
                     DAGAVLGLVG"
     CDS             complement(149992..153366)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_156997904.1"
                     /locus_tag="brsh051_01420"
                     /product="error-prone DNA polymerase"
                     /protein_id="BEH00861.1"
                     /transl_table=11
                     /translation="MGYHNPPIPWRQLEGTLTGRKPPAEQEAPFSWKRAPYQAPPIVR
                     PAHVVPYAELHAHSSFSFLDGASGPVELVEEAERLGLHGLALTDHDGLYGIVRFAEAA
                     EATSVKTVFGAELSLDLPAPQKGVPDPVGSHLLVLARGEAGYHRLAGALTAAQLAGQE
                     KGRPVYDLDGLSDQAGGDWVILTGCRKGTIRQALRAGGHREASRELADLVERFGRDRV
                     YVELTDHGGPLDSTHNDALATLAAQAELPVIATGNVHYAAPVRHLLAQAVAAVRANRS
                     LDELDGWLPAAGTAFLRSGAEMQALFARYPGAVERTVELADDLAFPLRRAKPALPKQE
                     VPDGHTPMSWLRRLVWQAVPRKYPDLDESGRSRIEHELDVIEAKDFPGYFLIVHDIVA
                     EARRRGILCQGRGSAANSAVCYLLDITAVDAIFYRLPFERFLSSLREEEPDIDVDFDS
                     DRREEIIQWVFERYGRERAAQVCNVIQYRPKNAVRDIAKALGYSPGQQDAFSRDIERW
                     GGPIGADGSNDIPPQVAELANQLLKAPRHLGIHSGGMVLTERPVGEVVPIEHARMPGR
                     TVIQWDKDDAAWMGLVKFDLLGLGMLAALQHCFDLIRASTGETWELATLPKEEKAVYD
                     MLCRADSIGVFQVESRAQMGLLPRLQPRKFYDLAIQIALIRPGPIQGGAVHPFVRRKL
                     GAEPVSYLHPKLEPVLARTLGVPVFQEQLMQMAMAVGECSGEDADLLRRAMGSKRGLE
                     RIESVRERLYAGMERNGLVGEKADIIYRQIQAFANFGFAESHSLSFALLVYASSWIKL
                     HYPAAFLAGLLRAQPMGFYSAETLTADARRHGVEVRRPDLQHSGVDAGVELLDPGSGG
                     PTGMDACCERYQPSVGEFDPAAPDEGARHRRDGRFVVRLGLAGVHGIGKDVAARIVAE
                     RETGGQYRSMEDLVRRTGVTETQLSALATAGAFDCLGLTRRQALWRAGTAALDQAETL
                     PGTIVALQPPLFAEQTGLERLADDLSSTGVSVDDHAIAHIRGSLAARGVLTSAELRTF
                     EAGRRVSAAGLVTHRQRPSTASGITFVNLEDEFGLINVVCSAGLWKRYRRVARSSAAL
                     IVRGKLERSPEGIVNLLADRLEPLTIDVAHHSRDFR"
     CDS             complement(153388..154926)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_034285994.1"
                     /locus_tag="brsh051_01430"
                     /product="DNA polymerase Y family protein"
                     /protein_id="BEH00862.1"
                     /transl_table=11
                     /translation="MTTTLAPVRCLAAWFPDWPVNAWWLAEDQPQTGPVAVIEANRIT
                     ACSPAARAEGVRCGQRRREAQARCPQLTVVPADPRRDEQMFTPLVVTIEQIVPKIQVV
                     RPGLVAMRTRGPARYYGGEAAAAEAILAQISELGVAGSRAGIADGLFTAEQAAVHADP
                     ILVVPPGAAAGYLAPLPVNRLGDAELSELLPRLGMHTLGDFAAMSVGDVRDRFGDRGV
                     RLHALACGRDPREVVPRRLPPEFDRQIDFDPPLALAEQVAFSVQATAEDFVAGLAAQQ
                     LVCTELRVILRAEQGEHVERVWLHPGCFDAAAVVDRVRWQLQAAAGNAIGSGLVRVRL
                     EPVATDAIAHHAPGLFGSGTDEKVHHVLSRVQSMLGHEAVVTPAIGGGRGLAERQLMV
                     PWGDRAVLRHPADRPWPGRLPDPLPATVFPQRRRVEVTDADGVRVGVDDRLLLTGIPA
                     QLSVGAAHLQLASWAGPWPVSERGWDAAQATKGCRFQVADVTGGAWLLMLDDQGWWAE
                     GRYD"
     CDS             complement(154926..155627)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013222725.1"
                     /locus_tag="brsh051_01440"
                     /product="hypothetical protein"
                     /protein_id="BEH00863.1"
                     /transl_table=11
                     /translation="MLVNTAAATATPHGDLLQRLRSQADAGPRVRHLVPVHPALAGLL
                     DGGLQPGAAYSVSGGALLLALLAEPSQAGSWCGVVGIPELGAEAAGSAGVVLERLVLV
                     SQPGERWLSVVAALAEALPLVAVRPPAQVRDADAARLAARLRERSSVLLVCGDWPRVT
                     AKLGIAEAHWSGLGSGHGYLDSREVLVNATNRHSGISRTARLMLPDSTGRLSADAGET
                     MAEQTQPRSTLRAVG"
     CDS             complement(155693..157879)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014878409.1"
                     /locus_tag="brsh051_01450"
                     /product="YhgE/Pip domain-containing protein"
                     /protein_id="BEH00864.1"
                     /transl_table=11
                     /translation="MSVQPASRLLQYEFRRFKGKSRLALIFVLLIPFLYGCIYLHANW
                     NLYANIDEVQVAVVNHDKPVEFQGRTIAAGQMFEDGLREEPTFDWQFLGGDDAKAQQG
                     LSDGDYYMIIEVPEDFSSNLVSAGSYDAVRASLTLYRDDANGFIIGTLTSKADDALSR
                     TLDSTVSEAYFKALFVSIEQIREQLTTASTGAAQLDSGLAQAATGVSQLNDAVTSIDT
                     SGMQAQLDALNSGLDDVDASMQTMAGAVGTMRDGAGDLAGVSNTVINGASNVESSLAP
                     INDFFQNQLPNMQGDAVELGDINAALVAGENGGLVTELSGDLSGATVAAQRLLVSHPE
                     LATDPNYQDLVSQLASATILHAEIHSKATAQATLIAGLKANLDPTLLQAAANAAQSAS
                     DTLNNATAQLQTGVSKIETGMTQADGATAQLYAGVSALRATASDVMAQAPKLISGVVQ
                     LTNALGQLNTAMPQLSSGAHELAEGLSAGVSQIPSLSENQQETLSSVMASPVDIEQVV
                     YHDAKYYGRGLAPMFFSIALWMATVSMFLVIRTISGRALTGRASFLRTTLFGCGPVAV
                     VAVASAMILGFGVWVLLGLDPVHPWLYLLLLVVASLCFTSLAYALRVLLGSPQTAVFL
                     VALIVQLPACGGTFPVSMLNAFYQGLAVISPMRYSVDAFRVAISGGNPAVYWGSVGVL
                     AGILACATVAIGWLIRRRMIFEMRDIHPPMVTSTSTADYAFSVRPR"
     CDS             complement(157881..158726)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01460"
                     /product="hypothetical protein"
                     /protein_id="BEH00865.1"
                     /transl_table=11
                     /translation="MRWHLGGSVDNSGKVRVPAIPDGEPVLSARSLMASGPEGTVFGP
                     VDLDLYPGELCIVTGDEGSGKSAFLLTLSGRFRGATGDLTICGIDALARPYEAIQNTA
                     VARLGNYVLPEDRLTVTESISERAYLDGISLAEAERRAAQMEEILGFRIERGAEIEQL
                     DPVTRIVGATALVALRPARVIVVDDVDAAVPHADQVAMYQYLIKLAQFNGAAIVCTAI
                     NGDTVPKGVLRVRLASRRRSYVHAYTDHEPAEMTVVDTDPVISADPLLDTDTGTVIVT
                     RTGEN"
     CDS             159054..159794
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01470"
                     /product="hypothetical protein"
                     /protein_id="BEH00866.1"
                     /transl_table=11
                     /translation="MDQVQRMTADYSEATGLASVIVEARGVPVAAPCAFTEFCQAMRS
                     DPVRAKLCESCDAHGGLQSLIEQSPRIYRCHAGLIDFSVPMMEGDKYLGAIASGQVRQ
                     TDDADQPQYLTTGSTWQDDPRLVELYNQVPVYSRRRIIAASETLLGLSKSAGLVNKCP
                     IFNLPTRSGSRAAETVHPERTQPQFQLLTQIVSADDESGSRTVSEHHAALRDALTAEN
                     LDEAFIQGMRPAVSAIVSASVYRGAQNL"
     CDS             160028..160810
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003893817.1"
                     /locus_tag="brsh051_01480"
                     /product="HAD-IIA family hydrolase"
                     /protein_id="BEH00867.1"
                     /transl_table=11
                     /translation="MKRTPRDIECWLTDKDGVLLQGDVPLPGASDLINCWVDTSRRFL
                     MLTNDSSYTARDLSARLEQAGLIVPEENLWTSALATADFLAGQHPGARLYVVGEVGLT
                     TALHDAGFVMVEEDPDYVVVGETRTYSFEAITMAINHIIGGARFIATNPDTLGTSPTG
                     VLPATGSVIALITAATNRRPYVVGKPNPMMFRSAMNRIKAHSETTAMIGDRMDTDIVA
                     GIEAGLFTVLVLTGITGRKDLERFPYRPNLVVESAAALRKML"
     CDS             complement(160844..162013)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01490"
                     /product="hypothetical protein"
                     /protein_id="BEH00868.1"
                     /transl_table=11
                     /translation="MLQTYMDSGDKDWVSATVTMDGTVFENVGIKLKGNSSLRGVTTE
                     SAPQDLPWRIKLDKYVSGANLDGYTDFTVRANSTETSLNEAVALDLLGTAGLASEQAV
                     ESSFSVNGSDAQLRLVVQNLDESWVADNFPDAGSDSVLYKAEADGSWSWLGSDADYSD
                     SFDIEAGPDDYAPLVQLLDLVNNGTEEEIAAQLPNLLDIDSFATYLAFEELVNNSDDI
                     DGPGNNSYLFWDSTTQKFTVVAWDHNLAFGGSPGGMGGTSSGMPSGMPSGMRPSDMPS
                     DWQSGGMPGGQGNGMPAGQMPSGMPSDMQSSGGAWGGGMPGGMGGNNPLVTAFEANEE
                     WTALKTQAASDLQSALIDSGALTSSLDRWVEVVKSSGLIDEATITSEADQIRSYA"
     CDS             complement(162288..165116)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01500"
                     /product="hypothetical protein"
                     /protein_id="BEH00869.1"
                     /transl_table=11
                     /translation="MTTTSHDDLTRYLSASQALAQTATEVEELARSEAVETYRRQIDL
                     LGRRLQTNPRAFRDMFISDGMGAIAAEFRQPELSEEFTTALWQKLLLGNDASLVLMRF
                     VWNLPLGAKRKFIRALDSYLSERYPVFKGLSVNWPAGSSIPPYIRTPEQRSEDFELVN
                     QGYLGYMNIGYTQREVDLLVWLEALRDKQCADKPCQLGELLAGRKEPRGGCPVQVHIP
                     DMMQLLGTGHFREALDLIESINPLPNVTGRVCPQELQCQSVCAHSGRPIEIGQLEWFL
                     PQRDRVVDPDGNIARYANVPDPWQVATKPPVAVVGSGPSGLINAFLLAAEGHPVTIFE
                     SFHRLGGVLRYGIPEFRLPNSLIDDVVEKITALGGRFVTNFVVGKTATLAELKEAGFS
                     HIFVGSGAGLPRFMNVPGEHLLNVMSANEFLTRVNLMQGHRPDHETPLPECRGKKIMI
                     IGGGNTAMDAARTARRLGGKVTIVYRRTRQEMPARVEELAHALEEGIELATLRSPSEF
                     RGDDRTGFVNSAVLEVMELGAPDASGRRRPMATGTSETVDVDLVIMALGNSANPIIRD
                     SEPELTVTTAGALELTEGSQATSIGGVYSGGDAARGGSTAVKAAGDGQAAAREIREAS
                     LLPAAQIIEMVAGAKRFTDLASAPNTIIERRELQPNIIELTVNAPVIAKNAQAGQFVR
                     VLAEPQGELVPLTLADWDAEAGTIVLVVQGMGTTSKMINAMKVGDRLEGIAGPLGQPS
                     ELHKIADDQTVVFTAGGVGLPPVYPIARANLQLGNHVTLIAGFRSADLLFWVGEGERV
                     DELQAEFGDQLEVIYTSNDGSFGIEGFVTVPLKDLLDANQRGEGRPIAEVTTIGPPMM
                     MRSVSDLTKPYGAKTVASLNSIMVDATGMCGACMVPVLIDGKLIRKHACIDGPELDSH
                     AIDWDKFLPRFNLFKSQEQQSKIKHGWV"
     CDS             complement(165127..170163)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01510"
                     /product="hypothetical protein"
                     /protein_id="BEH00870.1"
                     /transl_table=11
                     /translation="MTDSATQDVALESHADKPGEAKYPGKPVVINGNGAVAHVMKHVC
                     GGVIGYPITPSTEISEIYEAARAEGQLNVWGKHPFFFEPEGEHSAQSGALGAALTGGQ
                     YVSNASSSQGILYAMESHFVTVGKKVGGFVLQVAARVVSKHSLNVMAGHDDIYALLPS
                     GYTVFFGANPQEAADLAAISYRTSALTLIPVANAMDGFATSHMLSEARLPEPALLKEY
                     LGDPQGRIACPSVAQEIVYGAKGRVWQLGRWVDRKAAEFGLRELDEIRHWLAGHADAV
                     EADNEGHLVEETLRFVPDDLASQWRRQWLGAWQKGTRQAVPALVDPTNPGLTGPVQNQ
                     PDFQAGIADHRTHFAAEVPRLARQAMDEYSELTGRQYSPVITYDVDDADYVFVGLGSV
                     CDDIRAVMPYLRSRGIKVGLVAVKLLQPFPEAEVVAALRGKKAVTVMERSDQMALTQF
                     VNQAIFRGAANAAHPGRFPGIEPVAEIPAMTSAIFGLGGHDLQPRDLIATAENMAGEN
                     ASPLVYLGSTFFSDASDRTYSELEAKLAAAYPETTLMALPVGENPKLLPDTALRIRFH
                     SVGGYGTIATGKLMTDILAGALGLNSKSAPKYGSEKSGAPTNYYITLSPEPVLITNAE
                     LEDVEVVLSPDHKVFQHTDPLKGLVPGGTLILQSNLSPEQAWRALPAKARRTIRDKHI
                     KFLIIDAFSVAAEHAPTPELQTRMMGIAFIGAVVGGVDRIVQDTSLDALREKVYLQIS
                     KKFGRKGTAIVSSNMAVIEDGLTAVIPVPYDEPAYLTIDAESAPVNSRGLALSSAMCP
                     SPCAASNLFDADYYERIMGKPFRDGTVGRAPVFPGSGLFVPSGTAAGKDKGMFRRTVP
                     IFDASLCTGCMECTLACPDAAIPNAVHEIHTLIAAAVEMIEVNQPQRAAMRDHIYGIA
                     SRVREYYRADKDAGPLADLVAKAADELVPATSGSYLRRNFGACVEVLRGFPVARTRPF
                     FDAIERETPGNGGLYSVTIDPWKCTGCLECVDVCGPGALTAFDQTPEIEEKLESGFEF
                     LSRTPNTPARFTAGAVDPGGDTKRLFLDRANYYAVTGGHGGCRGCGEVTSTRMVMATS
                     HALGAKRQSEQRILLTALVDAVSATLDDAVDITPERKARLEATIAELEKGLYLLEGGP
                     IGKAPATTVVANSTGCSSVYASTMPYNAFTDPWVNSLFQDAQALAKGIYEGLAAKAAD
                     LVKAVRVARLELEDAYDPAVHDRELATLDWSEFTDEELAYLPTVLTIGGDGANYDIGF
                     GALSRILTSSTPIKMMVLDTGGYSNTGGQASTASFIGQDADLARVGATATGKTEDRKE
                     LAILAAFHPNTYVAATATAMQGHFLRAAMDMLNFSDGAALIDVYTPCQGENGIADNMA
                     NERGRMAVASRMAPVFVHDPRKGDNLRDWFDLDGNPDPGKLWTTHTIEFVDETGELRL
                     KEFPLTPAQFAMGEVRFKKQFSKLQIDQDAIAVPVEDYIDLPEADRATHVPFIWSTDG
                     ADRLVKIKVSQTIVAMVEGRRRNWQLLQYLAGVDIERLKALHKSDLDDLQSRYDGAMA
                     ARESSMDEIARAMSELAASTAAQPVTTFGGGFGGFGGPAPAAAAAPAETGLPIVRLDA
                     DDIAKCTDCKNCWQELPELFERTKVIVDGQTRDAARLIAGAVDKVEPTDDLRRRIAKV
                     VANCDAEIIH"
     CDS             170378..170932
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005088529.1"
                     /locus_tag="brsh051_01520"
                     /product="DUF1697 domain-containing protein"
                     /protein_id="BEH00871.1"
                     /transl_table=11
                     /translation="METAPSTLVTMAEWVALLRGVNVGGITVRSVDLKALFTDLGFTE
                     VRTVLASGNVVFSAEGDRARLKSGIETALRERFGYDAWIVLVSREEVAAAVAGFPFDA
                     SDPGRQPWVIFCSEEAVRRELLDGASDFDPLTDPVAEGDKVIYWNPVTGATTSTTFAK
                     LLAKPRYKATTTNRNLRTLQKIIG"
     CDS             171000..172001
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225858.1"
                     /locus_tag="brsh051_01530"
                     /product="ketoacyl-ACP synthase III"
                     /protein_id="BEH00872.1"
                     /transl_table=11
                     /translation="MPTTRISGVATHLPERTQDTADTEVELRQRNGHLRLATGLISRL
                     TGVQRVHVRPEGWQASDLAVAAARKLIDEQPGDIDLLMFASASQDLIEPATSHIVSAK
                     LGLSAPVFDVKNACNSVINALQIADALIRAGSHRRILVVSGEAPTSAVRWQLRDRAQF
                     VRSFPGYSMSDGGAAVLLEADESCQRGIQAATFHALSRHWNIGTLPGGGTVAAHDPDM
                     TYFDMDGSSLQRAFLELGPEPITTFLRQQRRRPTDFDFVAIHQVSVPFLPPILERLGV
                     PADRTIVTVADHGNLASVTLPLQLELARRRGMIGPGSLVLLIGLAGGISLGLMAVRL"
     CDS             171998..173950
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01540"
                     /product="hypothetical protein"
                     /protein_id="BEH00873.1"
                     /transl_table=11
                     /translation="MSRRLAVVVPVYNEASGIAATLEALAGQDDADFDAVFVDNASTD
                     DSVQLMETFIRRHGLTRWRIVHEPLKGTGAAADTGMREAIAGGAQLLARTDADCLPRH
                     DWTAAVRRALTPSHEGGLGLALVGGELVPRRDEGLGWPTRAALRGAVHLAEAFGRIRP
                     GNRDPAYRGPYMMAAGCNVGITSRLYEQAGGFPRTRIEQLHEDRALVNAVRRLTRDYQ
                     RRSDVVVYASSRRAQAWGLANTLLWYKDHAYCPPEVDIRDPALAQRPARTSIALAARH
                     ERRLLLAAHPLAFPFIDAIGGPVRRVPGLGVVVKDADLMRAVLMDSDSFGKSGPGSPG
                     DLWTPVLGPRVLMNMDGADHLELRRKLAPLFSPGSVRDLVADSLGPATQRLSERLRRG
                     EEVDLVSHAQHAASAVISRLVGLPPGVIDAGFFARSSTVTGFVSLARPSLTPRQITRA
                     RKVMHELDEHAAAAYAGDESTVPGRMRALGLTQAEALGAVGAFVLTGTETLVSFIPRL
                     AAILVDTGWHARLSAEPKLVDAAVAEALRVTTPSPVMLRSVERPTRIGTVEVTPGERI
                     ILGTYWANRALGEFDPETNPAAQLRQLWFGAGVHFCLGAPLAMAQINLVLGAVLAARN
                     LRIVERQASRGVLIPSYRRLVLRGSS"
     CDS             173947..175521
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225861.1"
                     /locus_tag="brsh051_01550"
                     /product="class I adenylate-forming enzyme family protein"
                     /protein_id="BEH00874.1"
                     /transl_table=11
                     /translation="MTDLVTAVLASADSRAEQPALTSGRTTLGYAELARRIRSTASGL
                     RAEGLQPGDRVLFSVRPGPQAVILALGIVLAGGVVVFADPGAGEALFRSRARLAAPRW
                     VAAESLLYLASSAPLRRFARRRGLELAPYARLVPQARHLRAGGWLPGTPRRAVPVSRL
                     AGHRHEPDGRPVSVDLDDEALIVFTSGTTSTPRGVVHSRGSLGAGLTDFADGVGMRPG
                     QRVLTDQLMVGVPALIAGAHWTIPPPGANAGARPEHYLRLLRDTELIFVVPAVMDSML
                     RALDDSARLRPAGLETIVMGGAPVLGPLLERVHARFPDAAIRAVYGMTEILPVAIADG
                     VAKLRAGTDPAGGDRLGRLVPSVTARIDDGELVLSGPGLARGYLADLPENPLGELHTG
                     DLARIDGDQLVSLGRKKDMFIRGRQNIYPGLYEPLVAGLAGVAEAALIGLPDEIGDDR
                     IVLVVVPEHAAGVGLATDHRLAREVTRRLPGLLDAGAVPDLVLTIDDLPRSGRGRKLD
                     RKALAGQVAAYLRDAR"
     CDS             175518..176432
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225862.1"
                     /locus_tag="brsh051_01560"
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="BEH00875.1"
                     /transl_table=11
                     /translation="MRIAVTGASGFVGGALATALADDGHQVTGFGRRPHGWQHPRGNY
                     VIWDLDSAAPDEAHHIDAVVHCAALADDWAPRDAAMRSNLGGTRRVLETFAGCRFVHM
                     STSSVYDAFRPSVMARENEPAPHRHLSSYPESKAAAERLLAGTDAVILRPHAVYGPGD
                     TTLLPRLLQSVRHGRLVLPAGAQVRHSLTHIDNLTQAVRCALDPDGPSGVFNIADAEP
                     VYLAEVITEFLARADLPARIIAIPFSAAWQAARFAELRAALRHTRPRLTRYAVSQLGV
                     ERTFDIAAARRQLGYRPFTTTLSGAEAW"
     CDS             176547..176927
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804331.1"
                     /locus_tag="brsh051_01570"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BEH00876.1"
                     /transl_table=11
                     /translation="MIEEGRPLFVQIAEDIENSIIDGSLAEDAQAPSTNELAAFYRIN
                     PATAAKGITMLTDKGVLYKRRGIGMFIAPGARDLLLGERRAAFATRYLDPLIAEARTL
                     GLGPDDIARLLQERAATTMEGTSR"
     CDS             176924..177817
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804332.1"
                     /locus_tag="brsh051_01580"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH00877.1"
                     /transl_table=11
                     /translation="MTTVIEVKNLTKRYKETLAVDNVSFTIEKDAIYGLLGRNGAGKT
                     TIMSILTAQNFATSGDVRIFGEDPYENPRVLGRMCFVREGQKYPDEATAMHAFRIAGL
                     FYPNWDQAFADDLVADFQLPTKTRIKKLSRGQLSAVGVILGLASRAEITFFDEPYLGL
                     DAVARQIFYDRLLEDYVEHPRTIILSSHLIDEVSNLLEHVIVIDKGRIVMDEETDAVR
                     DRAATIVGDSAAVEAFVTGRQVIHRQSLGRVTSVTVLGRLTDADRAQLAAAGLDATPV
                     SLQQLIVRTSQSTASKEGALL"
     CDS             177814..178509
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01590"
                     /product="hypothetical protein"
                     /protein_id="BEH00878.1"
                     /transl_table=11
                     /translation="MNRVINVVRMQLVNRQAYVWVPVIVLTGSLGLTLAIYSIIAGSG
                     VQGPFYGGGAQAPLWCLLAVGVQALTLSFPFSQALSVTRKEFYLGTLLSAALTAMILA
                     AIFVVGGLIERITDGWGLNGYFFYLPWVWEHGPAAAALVFFALAFGFFVLGFWAATVY
                     KRWGTVVLTAALVIPGLMLVAALWFIGRANAWVQVGRWFASQTAPGWALWGLLATAVL
                     AGISYLILRRLVP"
     CDS             complement(178414..179103)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01600"
                     /product="hypothetical protein"
                     /protein_id="BEH00879.1"
                     /transl_table=11
                     /translation="MVSRSTRVLAAITLACAGLDLVVLAGFHLIQPEIDPLTSATSEY
                     VHGKAGAMSSVTSAAVGLGAVSLAVAVWRITVTVSARVGAGLLAVFGLAKLAQSFFPI
                     DAGGATTTGLMHNLLGNLAFLVLPVAAILITPAAARACGRGQPGWWPRLAAWLIVLTS
                     VLVLVGDGVGLFGLAQRIYLVSAALWTALVASWLWSARSRDQAAQNQVGDAGQNSGGQ
                     QAPQGPSGSGL"
     CDS             179363..180613
                     /codon_start=1
                     /gene="urtA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003860043.1"
                     /locus_tag="brsh051_01610"
                     /product="urea ABC transporter substrate-binding protein"
                     /protein_id="BEH00880.1"
                     /transl_table=11
                     /translation="MMSRKLTAVAFIAAGTMALASCGAPVEQTADSPSGTGSSSGTCV
                     DTSGSSIKIGFVNSLSGTMAISEKTVSDALHMAADEINAAGGVNGKTLDVVQEDGASE
                     PTIFAEKAEKLISQDCVAAVFGGWTSASRKAMLPVFEEKDSLLFYPVQYEGLEASPNI
                     FYTGATTNQQIIPAMDYLKSEGVKKLFLVGSDYVFPRTANKIINAYAAANDIEIVGEE
                     YAPLGHTDFSTIVNKLKGSGAEAVFNTLNGDSNVAFFKEYKNAGLAPETTPVISVSIA
                     EEEVAGIGLENVEGQFAAWNYFQTIDSPENHTFVEAFKAKYGQDRVTSDPMESAYTSL
                     YLWKEMAEKAGGFSTEAIVAAADGVTFAAPEGQVTVDGENHHLFKAALIGQIASDGLL
                     HTVWSSGSPIEPDPFLKNYSWWQG"
     CDS             180720..181604
                     /codon_start=1
                     /gene="urtB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003894361.1"
                     /locus_tag="brsh051_01620"
                     /product="urea ABC transporter permease subunit UrtB"
                     /protein_id="BEH00881.1"
                     /transl_table=11
                     /translation="MDFVISQLLAGISLGSVLLLASLGLSLTFGQLGVINNAHGEFMM
                     AGAYAAFVVARLIPYSGISLMVALPVGFLVGGLLGAFLQVTLISRMRLRPLDTLLATF
                     GVGLVLQQLARDIFGAQPVYAATPPWLSGPIRILGVDVPATRVFIFAVAVVCVVGLYL
                     LQQFTSLGREIRATVENRDLAETSGISTNFVDVLTFFIGSGIAGLAGVALSLMDAISF
                     DFGVGYIVDAFLVVVAGGVGQLKGAVIAAFGLGIIQAFLEYWTDASAAKVIVLLLVVL
                     LLQFRPQGLVAVQTRSLA"
     CDS             181601..182728
                     /codon_start=1
                     /gene="urtC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728737.1"
                     /locus_tag="brsh051_01630"
                     /product="urea ABC transporter permease subunit UrtC"
                     /protein_id="BEH00882.1"
                     /transl_table=11
                     /translation="MKTMLSAYQKSSLWIWLAIAVAAVAIAPLLLSDFRLSLLAKYMC
                     LAMVAVGIGLAWGQGGMLTLGQGLFFGLGGYMMAMHLKLTDVSPGGVPDFMMLYGNGE
                     VPGWWEPFRSPVLTVILILVVPAATAFLLGWAVFARRVRGAYFAILSQALVAAFSLWL
                     VNQGTSTGGFNGLTDFKGFFGYSLKDPANKRMLYFIAATVLIGMVLLTRQIMRSRFGE
                     LLVAVRDQENRVRFLGYNPAIIKTVAYTIAGIFAAIGGALFVPIVGIISPKDVGVTPS
                     ILFLAGVVIGGRTTLLGPVLGTIALRFVETGLSETYPAFWTYFQGALFILVITFLPQG
                     VATLGPWLKRMAERYRYRRTKKPAPARAAETIETPQLVGRT"
     CDS             182731..183534
                     /codon_start=1
                     /gene="urtD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003894359.1"
                     /locus_tag="brsh051_01640"
                     /product="urea ABC transporter ATP-binding protein UrtD"
                     /protein_id="BEH00883.1"
                     /transl_table=11
                     /translation="MTPKPDLQALEKAIAAPRGEFHRDYLQVKDLRVSFDGFVAVDGV
                     DLVVTSGDLRFLIGPNGAGKTTLIDAITGLAKATGSATFGGVELLGMPSHKIVRAAVG
                     RTFQTASVIEELSVLQNLDIAAGMGRKSRELLRRRKTVPTEVELALETIGLTGLVNAP
                     AGVLAHGQKQWLEIGMLLVQDARCLLLDEPVAGMSAIEREQTGELLKRIGEQRTVVVV
                     EHDMEFLRNFANSVTVLHQGKVLAEGTVAEVQADPKVIEVYLGETHAAA"
     CDS             183521..184216
                     /codon_start=1
                     /gene="urtE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003894358.1"
                     /locus_tag="brsh051_01650"
                     /product="urea ABC transporter ATP-binding subunit UrtE"
                     /protein_id="BEH00884.1"
                     /transl_table=11
                     /translation="MLQLDSVTCGYGRVSVVFDVSLQVPDAQMVAVLGNNGAGKTTLL
                     RAVMGLLPVRTGTITFDGTNITKMPTNKRVRRGIAYVPQGQQSFGQLTARENLKLIAD
                     HHGAAGARRMAEALDLFPALRDLLGRRAGLLSGGQRQQLAIARALITGPQLIVLDEPT
                     EGIQPNVVAEIQAAISTMMTESGISVLMVEQHVGYALEMASEFIVLASGRVVSTGQGG
                     ADAVEQARAAMAL"
     CDS             complement(184228..184935)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013389990.1"
                     /locus_tag="brsh051_01660"
                     /product="SOS response-associated peptidase"
                     /protein_id="BEH00885.1"
                     /transl_table=11
                     /translation="MCGRYVTADTATIVDVFQVDEVGELPAPTFNARPVFEDLGSDEP
                     RVPVVVDSVRDGVSKRRCWPARWPFTPSWSKSLVMKGPTFNAVAETVAEKPMWRDAIA
                     THRSIFPAVGYYETQGGGRKRKRFYFHPDGDEVLALGGLYSWWRANRESPWIMTAAIL
                     TIRAPGQAGTIHSRAPMVLPADLWDDWLDPGITAGQEFIDAASQEASSVVQSLQFYEV
                     GLLDENSPAMLRPVDSA"
     CDS             complement(184970..185470)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01670"
                     /product="hypothetical protein"
                     /protein_id="BEH00886.1"
                     /transl_table=11
                     /translation="MTKLTGRLDDDRRTLVLTRQFDVPAEQLWTDFTDPDRLERWFGA
                     WTGDPASGQVMLTMNAEAESVPAVPCRILHCDRPRRLSVTVTDSFGTWQLAIGFDEDE
                     GSTRLTLRHEEVDLQTVPEVGPGWEWYLDRLTAAVAGEAPPTLEDFVDTYAPMGQDYA
                     VMISGS"
     CDS             complement(185549..186655)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005057610.1"
                     /locus_tag="brsh051_01680"
                     /product="putative zinc-binding metallopeptidase"
                     /protein_id="BEH00887.1"
                     /transl_table=11
                     /translation="MPGMKLLICPTPDCSGLLYLEDLRCDTCGAEVAYHTLSETMVAV
                     TGPDIEVANRLWHPCVNRDRDCNWLAADDSSTDQCFSCRLTRVRPNDNDPDALERLAE
                     AEKSKRRVLVQLNSLGLPIDPYFESDGGLGFDLLSSEYEKVTIGQANGIVTIDLAETL
                     DAHRERLRVALGEPYRTMLGHFRHEIGHYYEWVLVEQTDKIEQCRQIFGDERASYTDA
                     IDQHYSNGAPPNWRDSYISEYATMHPWEDFAECFAHYLHITDTLDTAASAGMELVPGR
                     SVVPALPLAVGPRDSYGADDFDALMDDWHWISLFFNRVNRSMGKADLYPFSISDPVVD
                     KLRFIHGVLTDLPRTRVSELDGFGRSIDSQDTAG"
     CDS             186837..188483
                     /codon_start=1
                     /gene="glpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259132.1"
                     /locus_tag="brsh051_01690"
                     /product="anaerobic glycerol-3-phosphate dehydrogenase
                     subunit GlpA"
                     /protein_id="BEH00888.1"
                     /transl_table=11
                     /translation="MRTYDCDVVVVGGGSTGAGVVRDVAMRGYSAILVDRADLGQGTT
                     GRYHGLLHSGGRYVVSDPHSATECAEENAIVTRIHASAVEATGGLFVSTPEDDLAFSD
                     DFLAGCHKTGVPVEEISVATALKREPRVNPGIRRAFLVEDGTVDGWQMVWGAARSAQE
                     YGAQILTYHAVVGIEMTGSSVSAVRCIDRRSGEDVTISCRFVINAAGAWSHHIAEMAG
                     CHDVEVVPGRGIMIAMNHRLVNTVINRCTYPADGDILVPVHTVAIIGTTDVRAEDPDE
                     LPIPADEVQQMLDCGEILIPGFRQARALHAWSGARPLVKDSRVSAQDTRHMSRGMSIL
                     DHQSRDGVSGILTIAGGKLTTYRLMAKNIVDRMCEQLGEERECRTADEAVPGSTPGET
                     YQVTHRLHDREADRRDDQIICECELMSRTMLTDALHADPQASMDDLRRHLRLGMGPCQ
                     GGFCSLRATGIACAEGVIDAELANARLHEFLAHRWIGLWPILYGDQVRQTALNEWIFQ
                     GLLDVEHLPEPKVVLEPVPLGVAAQSLQSTTEPETTEAVR"
     CDS             188480..189709
                     /codon_start=1
                     /gene="glpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259131.1"
                     /locus_tag="brsh051_01700"
                     /product="glycerol-3-phosphate dehydrogenase subunit GlpB"
                     /protein_id="BEH00889.1"
                     /transl_table=11
                     /translation="MNDVVVVGGGIAGLLSAARLVTQGAKVTLVTFGVGGLQLSHGGF
                     DVLGYAPERVDRPFDVLDDFIAANPEHPYAVLGADAVRLGTDFASEFFGDRLVGNDGR
                     NWLLPTAVGALRPTYLASPTMVNAEARAGHDPVVVVGLQQLKDFQAELIAGNLVKQQI
                     PARAIVLDLPARTHEADASGLTYARAMDRADYRADFAKALGKQLLSGEKALIPAIAGH
                     HEAAAFTDLQTRLGAPLAEIPLPPPGVPGMRLNEYASRRLQDQRVRWILGARVVALHS
                     EGGRAVSVDVATSGHLTKVRADAVVYAPGGFESGSLSLDSHGKVLETHLGLPVRVPPG
                     RLIGPDRRSEQPLFRSGLAVDDQMRVLDDADRPVYPNLFAAGGVLAGAMRWSEKSGEG
                     IAAASAVRAADAIGDLA"
     CDS             189706..191052
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259130.1"
                     /locus_tag="brsh051_01710"
                     /product="anaerobic glycerol-3-phosphate dehydrogenase
                     subunit C"
                     /protein_id="BEH00890.1"
                     /transl_table=11
                     /translation="MSAKKDPKKLTEAERQERDADRRERLVTSQQGPKVLTLNLKEPD
                     IFAAQRLNRESLDHCVKCTICETQCPVAAVTPLFSGPKYVGPQAERFRHGESVDHSLD
                     YCSSCGICTLSCPQGVQIAELNSMARAVMKADHMPIRDFLIGETVLMGKAMTPIAPIA
                     NAALNNKPIRIVMEKMIGVHRNAPMPTAQSQSFVSWAKRHQPAKPATRGPVVFFHGCA
                     GGYFEVQTSIHTVEVLEHLGYEVIIPTQGCCGLAQQSNGLFTQARKTVRKLCDQLRAA
                     GKDLTIISSSGSCTGMLKHEAHEIMGVDDPALIDVGSRIRETSEFLMELEDEGTLPHT
                     FQRVDMTVPYHAPCQLKGQGMGMPAIRLLELIPGLKVVESGQACCGIAGTYGLKKEKY
                     DVAQAVGQALFDMVVDTNPDLAVCDTETCRWQISKSTGVPTVHPISLVHRAYGLDK"
     CDS             191375..192115
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776957.1"
                     /locus_tag="brsh051_01720"
                     /product="MIP/aquaporin family protein"
                     /protein_id="BEH00891.1"
                     /transl_table=11
                     /translation="MLLLLGVGVVANNLLGKTKGNGSGFLFVNFGWGIAVMTGVYFAS
                     ATGGHLNPAVTLGVVVRELLLGNTIDWALVGVYVVAQFLGALLGAFLAWLAYKNHYDE
                     DVDPALKLGTFATGPEIRKPFWNFLTEVIATFVLVGWVIVAGLQDPNGIAWAPLGVTL
                     LIVGIGASLGGPTGYAINPVRDLGPRIIHALVPIKGKGGSDWGYAWIPVAGPLTGGLI
                     AGLVVAPIYIAVGTLPSQAAPFFQLAGA"
     CDS             192169..193698
                     /codon_start=1
                     /gene="glpK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776956.1"
                     /locus_tag="brsh051_01730"
                     /product="glycerol kinase GlpK"
                     /protein_id="BEH00892.1"
                     /transl_table=11
                     /translation="MAEMFIMAIDQGTTSSRAIIFNHAGQIVSSGQLEHEQIFPRAGW
                     VEHNPDEIRNSVNEVMGQAFARARINRHQIAAVGITNQRETTLVWDRETGEPVYNAIV
                     WQDTRTQKICDELAGDEGPDRFKEICGLPLATYFAGPKIKWILDNVEGAREKADAGKL
                     AFGTMDSWVLWNLTGGQHGGVHVTDVTNASRTMLMNVRTLEWDPGMCEVMGIPMSMLP
                     EIRSCSEVYGHGDKESLIIDTPIAGILGDQQAATFGQACFQKGMAKNTYGTGCFMLMN
                     TGEEAVFSKNGLLTTVCYKIGDAKQVYALEGSIAVTGSLVQWLRDNLKIVSSAPEIED
                     LAATVENNGGAYFVPAFSGLFAPYWRPDARGALVGLTRYVNRGHIARAVLEATAYQTR
                     DVLEAMNADAGVPLAELRVDGGMTANNVLMQFQADQLGVAVVRPKVAETTALGAAYAA
                     GIAVGFWDGEADVVANWAEDKRWVPDTSSQAQVERERLYRNWKKAVTKTLEWVDEDVV
                     E"
     CDS             complement(193788..194405)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_143485785.1"
                     /locus_tag="brsh051_01740"
                     /product="TMEM175 family protein"
                     /protein_id="BEH00893.1"
                     /transl_table=11
                     /translation="MSRPLIESGRMDALIDGIFAIASTLLVLELTSHAIGNVTTSGEF
                     LAGLLGMGDQFISFLVSFLLLCLLWMAHVRLFTYIAYIDGNLMRINVLQLLFIVLIPF
                     STVVDTDYADIWLGRLVMPSTVFPAILLSWLGWCYVLRHRSLLVPDVAEADIADMSRA
                     SLIAVLLSALTVALAPFIGSWAFLAFALRPVFDAIRERRRATTTA"
     CDS             194584..195801
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003900009.1"
                     /locus_tag="brsh051_01750"
                     /product="M20 family metallopeptidase"
                     /protein_id="BEH00894.1"
                     /transl_table=11
                     /translation="MARLDLAVAKQSIKAELERRTDDLLALNHAIHADPELSGEEFRA
                     AERIAFVLDDAGFEVEVGAYGMPTAIEALYGDGDLTVVICCEYDALPGIGHGCGHNVI
                     AAAGLGAALALAPLAADAGLRIKLLGTPAEEHGGGKIELLREGAWEDADFSLMVHGMS
                     GTDISASLELYTAVDRFDIIFTGKGAHAASAPWAGINALSAATLALNAIGFLRQHMMQ
                     GVSMNAIISQGGTATNIISEQAVVQVEVRAFEIAIWRDVKKRVLACFEGAAIATGCSW
                     EYRRTEYAYAPVDPDPQLAKLWDDNLIAGGRTVDHTGAGGGASTDMGNVTQVLPAIHP
                     TIAFLGETAIPHTAEFATAAITAAADQAMLDGAQGLAATVLDVALNPALRKHYQDLKA
                     ARPAGATQVSLES"
     CDS             complement(195810..197183)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728048.1"
                     /locus_tag="brsh051_01760"
                     /product="FAD-binding oxidoreductase"
                     /protein_id="BEH00895.1"
                     /transl_table=11
                     /translation="MTVQDTTVDSRADDLRHALGDRIILAADPGYDAARMPWNLAADQ
                     RPYAVARPVTAEDVVDVVRAAAAAGLRIAPQSTGHAASALAETDLSDTVLVVLAGLRG
                     VTVDPVGRTARVLGGSVWNDVIAATAPYGLTALHGSAGNVSVAGYALRGGVSFYARAH
                     GLAVGAVREVQLVTADGALLRASADEHPDLFWALRGGSGAFGIVVSLVIDLLPYADVF
                     AGFMIWDASHAAEVTRAWAQWTKTVPNSVTTTLRVLHIPPLPELPPFLSGRSVVTVDG
                     AILETDAEAAALLGPLRALQPEVDMFARIPAAGLLEVHMDPPDPTPAASAHSVLAELP
                     DEAVDAFLAVAGDQGLFVAELRHLGGELTRRPHNAGAVGSLQGEYLLHTIAMVMDPAA
                     VIATRQLVHGHLRALDQWRADALALTFVDGGVNDYSPGYGEALEGLRVIKHQYDPTGV
                     FASGLPI"
     CDS             197340..198455
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013227111.1"
                     /locus_tag="brsh051_01770"
                     /product="LuxR C-terminal-related transcriptional
                     regulator"
                     /protein_id="BEH00896.1"
                     /transl_table=11
                     /translation="MASIRALGRARSDIDVVSRAGLPLHAFMTEASASLGSVVPFVAG
                     CVSTLDPQTAMVSGTVKLEALSGRNDADVAWARIEYGEDDPTAMQALLLSGRTAIGVS
                     QETEGLVERSVRMAQLLIPYFGFYDEARVVFTDRAGAWGCLAIFRGSDDRAFSHDELD
                     FLASVAPAFTRGIRTGLLAQPSPRTQPVDMGPAVVIVDANDRIVQSSERARQLYERMA
                     ALPGWADPLHMVQALVSGARRQARGETDQQPRIRMRTIDGVWVVLHAALLSGDADRAG
                     EVIVTIDEARPQEIADIVAGAFALTSRESEVMALVLRGADTKQMADALHVSAYTVQDH
                     LKSIFDKSGVTSRRELVARVYFDHHLPRLESGLDIRA"
     tRNA            complement(198585..198659)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00010"
                     /product="tRNA-Val"
     tRNA            complement(198679..198750)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00020"
                     /product="tRNA-Cys"
     tRNA            complement(198801..198874)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00030"
                     /product="tRNA-Gly"
     tRNA            199152..199225
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00040"
                     /product="tRNA-Val"
     CDS             199694..200494
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005084991.1"
                     /locus_tag="brsh051_01780"
                     /product="sirohydrochlorin chelatase"
                     /protein_id="BEH00897.1"
                     /transl_table=11
                     /translation="MSAPALVLLAQGTTDSRVEQVYHTLRHELQSQRPTISIHLAFAD
                     SCPPTGPQVIGALANRGVDEVVLVPLDLSRVCGPTDTMAGVLTAVRHHRPDVKSAMAR
                     PIGPAIELLNVLDLRLRNALSTVHATELDGLVLLTPTWGDTRGAGLIARRARQWATHH
                     KLPVLVAHSDGSGPDVAAAIASLRHIGRRNIAVGSLFISPTELYRQQAELALASGALA
                     VSAPLGADPLLGELAMARYSFAAMELLDDVTISQTDEADLEASASQAL"
     CDS             200711..201205
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01790"
                     /product="hypothetical protein"
                     /protein_id="BEH00898.1"
                     /transl_table=11
                     /translation="MNSVIATQAVETHQPPVPVSSWATRITDWETRNAGKLWQCRLIG
                     EHHGAEVVQYVQAHWFGHWVWHYSTLFVTRRGPSCPAWCSEHANTIPDSEELQDECIQ
                     HAHHVTVGPATVDLDAVEDPTTGQFSEVSITTPDRLGPVTAATARQVAEALMQAADLL
                     DGRR"
     CDS             201202..201621
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01800"
                     /product="hypothetical protein"
                     /protein_id="BEH00899.1"
                     /transl_table=11
                     /translation="MIVAADKKQAAVEVLMDVNSTPDYYMKCVVSETLELAGFTVQTY
                     PYKAYRAAVEDGRPRIIVHFHSDQRQKAVGVFLAVVVAEQLPGDYISVNFSRSTWRVL
                     DEAEWRFAAEERPEMTIRNKVRDLADKWAAAQRAEVA"
     CDS             201621..201833
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01810"
                     /product="hypothetical protein"
                     /protein_id="BEH00900.1"
                     /transl_table=11
                     /translation="MSDLFRIVDPENWDVFVTDSEPVEYVNLKGLAQLVKGSPLGIDQ
                     AMQALQDQGMDGALAARVWLELAELS"
     CDS             complement(201931..202092)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01820"
                     /product="hypothetical protein"
                     /protein_id="BEH00901.1"
                     /transl_table=11
                     /translation="MTQLRTVNVPYLGEDGRLSEQHTPAVVEQRLAALESAVADLAAR
                     VAALESPAG"
     CDS             complement(202254..202505)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01830"
                     /product="hypothetical protein"
                     /protein_id="BEH00902.1"
                     /transl_table=11
                     /translation="MTTPDSFERQVRRRAEAIGLKLKKSRKNIRRPWSFTLAESWPSK
                     PAKRLWCGKVIWSQLFATLEDASDRLTEFEAEVEAEAGA"
     CDS             complement(202768..203604)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01840"
                     /product="hypothetical protein"
                     /protein_id="BEH00903.1"
                     /transl_table=11
                     /translation="MLTTDANTAFLPEQIGDLIVKPTLATSVAAQAAHVVNTGDVAAY
                     RVPIVAADPSAAWTAEGEQITTSAPVLDEIASPFYKLAGLTSLSRELADDTTPEAAEL
                     VGEGLARDIARQLDAAFFGTRGASTIQPAGLKDLTGVGTISAGSAWKDTDPFVSAIFA
                     AANIGATITAFVANPADAELMAKVKKAAGSNEPLLGNDPTQPTRRQIAGVPLLTSPAV
                     DAGTVWSIPQDRVILAVREGTTLEVDRSVYFGSDRIAVRAIMRVTFLFPHPSAIQKIE
                     LA"
     CDS             complement(203786..204235)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01850"
                     /product="hypothetical protein"
                     /protein_id="BEH00904.1"
                     /transl_table=11
                     /translation="MSEQPAETPAVATTPDDGGQLAKARKEAAGYRERLRAAEAERDQ
                     IVQERDQIAGRLAGFQRAQIDQLAVEARLKPAALWATGVTLADLLTDDGTVDTTAVTQ
                     AIDETRTTFGITQGAQATNPTGVAGNNGTPIRGEDTETSWSAALKHR"
     CDS             complement(204228..204443)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01860"
                     /product="hypothetical protein"
                     /protein_id="BEH00905.1"
                     /transl_table=11
                     /translation="MCTTDISMTIWHLTNNLQRLSGRLCEFNDAELSAIHHSLQQLDH
                     GVNELANIGARRIVADVEAKSKETAHE"
     CDS             complement(204457..204930)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01870"
                     /product="hypothetical protein"
                     /protein_id="BEH00906.1"
                     /transl_table=11
                     /translation="MPENLQLKTPGMTYMKCLAHLMGVSNSRAMGWFHARDEIRGFQQ
                     KLAGTGGVFRTTMDAETVTRAGLQLFVRAQNPQSEKYRSMPGLSLLDRVCAESYVDEF
                     AFIRPDALNPIEAIELWDDRGRLTPVDRRTKLYKSAAKTLATPTKTTATSPARDK"
     CDS             205274..206410
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_043791004.1"
                     /locus_tag="brsh051_01880"
                     /product="ISAs1 family transposase"
                     /protein_id="BEH00907.1"
                     /transl_table=11
                     /translation="MPSSPTVGASRIERAGDLMTALNHVPDPRDPRGVRYPLAGMLAV
                     AVCAVLAGARSFAAIGDWALDLDAGHLDRLDLERAPVESTLRKLFARIDAAALDAALA
                     VFAWCRVRHIAGRRVVAIDGKTVRGARSKAGSAPHLIAALDHATGVVLGQHAVEAKSN
                     EIPAVRDLLAGFDPADLAGCVITADAMHTQDDTAKAIIAAGADYVFTVKANRPTLLAA
                     LKALPWNKVPVGSTSTQHGHGRRATRTIKVIETPTLPGWPEFTGAAQVAQLRRTVTKN
                     GKKTVEVVYLITSADHHDAPPATLAAWVQGHWSIENALHWVRDVTYDEDRSHVRTGHA
                     AHVMASLRNTAISILRLTGWDNIATALRHHARNPERAITCALTS"
     CDS             complement(206528..206806)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01890"
                     /product="hypothetical protein"
                     /protein_id="BEH00908.1"
                     /transl_table=11
                     /translation="MKINPQLPMLDSPAHLALTAALATAADHGQFIACASWGDENNPW
                     LSDSADDRDWAADRCRHCPVQSECADAGASESFGVWGAIDQATRRGQK"
     CDS             complement(206803..208296)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01900"
                     /product="hypothetical protein"
                     /protein_id="BEH00909.1"
                     /transl_table=11
                     /translation="MSEWLKTPALDDAVVWLKRYVITTAVEDIWVMALWAQHTWLLGY
                     VPVTPRLLIDSIMPGSGKTTALEHLQRICLDPAQMSQVTSSALLVRLVAERPRTLLLD
                     EVDRSLDPKKETTSDLLSILNSGYKRGATRPVLTPTKGGDWIPKEMATYCAVAMAGNS
                     PRIPDDTRSRALRIFLLPDVNDQAEETDWLDEDFELQALTVGDGLRQWAETHAGQVKE
                     ARPTFPDGCKGRLKERWVAFVRVAAVVGGPWPQRVSALIERDMEEERRDREDGMRSIP
                     PTMQAILDVAEIVKDRQFVPTSEIVAKMIADRPDQWSKESPYGRDLTAHRLAKMLVGA
                     GVRPRQEPDGERRRGYAEVDIAAVASRLHTNSVNGSNDTNDSNGRYPNSSEGSQSNRS
                     NRSTRSDRSDEPDHPGEGADHSRASHDVHLSESGPIGPTGYDKPIQRGPTGEQSQSGH
                     AQTDSRTTGPIGEATDPCPDCGMSLTLRAGTQKCTWRHKLAQKGGLS"
     CDS             complement(208293..208700)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01910"
                     /product="hypothetical protein"
                     /protein_id="BEH00910.1"
                     /transl_table=11
                     /translation="MIAKKENRPREENPGTATTHSIRESSISGPSLFSPQAQVRRALA
                     GLDLGAHRDDLVADAISSVLPAQWEQRGRIFEDCRPRPGDYLGTDPTAAQRIDRRCAV
                     SAAQCRLHAAVLRGDDILDPEHAADLALIGAIV"
     CDS             complement(208697..208990)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01920"
                     /product="hypothetical protein"
                     /protein_id="BEH00911.1"
                     /transl_table=11
                     /translation="MSTPDSERRLLASIAANESWAQTTDRTARTAKARAALQAKFLAQ
                     ADGDPIRAEHLRRAYYQRLALKSAQSRRKAREAIADAKAAESELAALGGDDAA"
     CDS             complement(209060..209464)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_01930"
                     /product="hypothetical protein"
                     /protein_id="BEH00912.1"
                     /transl_table=11
                     /translation="MSEAVLRAFCPICGGFVGAVEREDDGALLWRATVWTTSEYELAV
                     NGRRVHRRVDFPPNYLGRPGVDYYPDDEVFATCREEHKMVADLNELYLQVQAGKKKTT
                     LPLLYHGEDPVAAAVQKLGEQRKDEVAFPTES"
     CDS             complement(209461..210363)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003547143.1"
                     /locus_tag="brsh051_01940"
                     /product="tyrosine recombinase XerC"
                     /protein_id="BEH00913.1"
                     /transl_table=11
                     /translation="MAARLEDLRKSFDRALRAADKSPQTVRLYDQAVIFFGRWLAEQG
                     RPETLDELTRPAIREWLASLRDAGLSANTRKMRYRGLHRFCQWLADEDELATNPMAKL
                     EAPAVTDEPAVPIVSDADLTKLLSTCRGKSFADRRDQAIFRVLLDTGIRVGELAGMTT
                     DPSRLDLDTAIALVTGKTGTRFVYFGDRTVQAVDRYLRVRSDHRWAHLPKLWLGERGG
                     LTEDGIRARFEVRCDEAGLPRIHPHQLRHTWANDFLANGGQERDAMRLAGWKSDAMLG
                     RYGSVAADERAKAAAQRLRRGDRI"
     CDS             complement(210432..211478)
                     /codon_start=1
                     /gene="ligD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003972287.1"
                     /locus_tag="brsh051_01950"
                     /product="non-homologous end-joining DNA ligase"
                     /protein_id="BEH00914.1"
                     /transl_table=11
                     /translation="MATPAMQLDVQGIEVRLSSPDKIYFEDLGISKLDLANYAMSVGD
                     GFLAGLRRRPTTLERWPGGVREGMKLTTRADGKGDAFYQKRAPEKRPDWVDVAEITFP
                     SGRTATAITPSNLATIVWAVNLGTLRFHPWPVTAPRVDLVDQLRIDLDPQPGTDFGDA
                     VGAALELRQVMGELGLESYPKTSGGRGVHVFCMIEPVPFVVARHAVIAIGRELAHRMP
                     EKVTVEWWKELRGQRIFVDFNQMARDRLMASPYSVRPVPQARVSAPLTWDELPDVRPD
                     DFTVVTMPQRYREHGDVWAPLYASKPQSIDPALRLYELGLEQGLTDMPYPPEYPKMPG
                     EPPRVQPSRQRKID"
     CDS             211561..212016
                     /codon_start=1
                     /gene="msrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003857328.1"
                     /locus_tag="brsh051_01960"
                     /product="peptide-methionine (R)-S-oxide reductase MsrB"
                     /protein_id="BEH00915.1"
                     /transl_table=11
                     /translation="MNRSLPGDGVFRLTDDQWRVKLNPKEFHVLREAGTEAPFIGEYT
                     NLEAEGTYRCRACGAELFRSTTKFGSHCGWPSFFSPLAEDRVRYIEDRSMPGRPRVEV
                     RCANCDSHLGHVFEGEGYDTPTDLRYCINSISLTFEPADDPEPGARTGA"
     CDS             212097..212669
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030605.1"
                     /locus_tag="brsh051_01970"
                     /product="DUF3000 domain-containing protein"
                     /protein_id="BEH00916.1"
                     /transl_table=11
                     /translation="MSGDSSFGRITDAIEAFGWHPRVQVEQIPAPQRIAPHAYAVEAS
                     VLTTADDEVGTGRLIVLHDPNGNQAWNGNYRCVSYARADVDLEMVTDPLLAEVGWTWL
                     TEALEANNASYHDASGTVTAVSSRSFGELAGEADRAEIEIRASWTPELGELPDIVPHL
                     AAWQSLLCTTAGLPPLADGIIQLTTRLEQQ"
     CDS             212666..213928
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224510.1"
                     /locus_tag="brsh051_01980"
                     /product="ribonuclease D"
                     /protein_id="BEH00917.1"
                     /transl_table=11
                     /translation="MSEPPELDLAELPVLAEPASGVPSVVDDSPSRSAALEALRAGHG
                     PIAIDVERAQSFRYSSKAYLLQLKRPGSGIILIDPTAFQTDEAEVAQLAALQQLIGDQ
                     EWIIHAATQDLPNLVQLGLRPVQLFDTELAARLLGLPKVGLAALVGRYCGVRLLKEHS
                     AADWSRRPIPDDWLAYAALDVELLHELREQLSAELAATDKQEWAAQEFEWLCRWAVHP
                     AAEHPDRWRRTSGSHLVRTPRGQAVVRELWTVRDDIAHQNDKTPSKILPDKAISELAA
                     LITRSHPGVPTVQELRSIDGFKRRQARAYQAEWLAALDRVANLPTSELPPVRTATNGI
                     PAPRNWERVNPQAWRRWEAVRPVVVKRAEELNLPVENLISPDALKHLLWEIELPLSVE
                     SVSDQLAARDARRWQQDLIAPLVVERLS"
     CDS             complement(213974..215884)
                     /codon_start=1
                     /gene="dxs"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005081956.1"
                     /locus_tag="brsh051_01990"
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="BEH00918.1"
                     /transl_table=11
                     /translation="MSLLESIHQPSDLRALQRPQLDELAAEIRQFLISNVSRTGGHLG
                     PNLGVVELTLALHLTFDSPHDPIIFDTGHQSYVHKMLTGRGGEFASLRQKDGLSGYPC
                     VAESEHDWVENSHASTALSWAEGLAHGFQLRGETDRTVVAVIGDGALTGGMAWEALNN
                     IAIADDLPLVIVVNDNGRSYAPTVGGLSRQLGAIRTDPRYEQTLETIKTQMRRARFGR
                     TAYDVLHGMKSGLKDILAPQEMFSDLGLKYLGPIDGHDLDALTEALELAKGFGGPVIV
                     HAITKKGHGFRAAELNKADHFHTVGRIDATTGEPLSAAVQATWTDAFAQQMMEIADDH
                     PDVVALTAAMLHPVGLTRFAAAYPERTFDVGIAEQHAMTMAAGLARAGLHPVFAVYST
                     FLNRAFDQLLLDVGLHKLGVTVVLDRAGITGPDGASHNGIWDVSLAGIVPGLMLASPR
                     DQPRLAEVLTQAVETSDAPTLIRYSKEKLPDPMPAVVRRDGLDVLSADEDADVLLVAW
                     GAMCARALKVADLLRAQGITVSVVDPVWGLPISPALVEMTRHHRLIVTIEDNLIVGGL
                     GSHLELEMDAAGIEVPTRQFGVPQRYLQPATRNEIFAEIGLTPQAIAREVTETMTAFI
                     EAPTVDAERFRQ"
     CDS             complement(215991..216359)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02000"
                     /product="hypothetical protein"
                     /protein_id="BEH00919.1"
                     /transl_table=11
                     /translation="MTTIAHRLADELSVQNFVPRGWPETVLPPGVPDWEQSAADWLLG
                     CCPPDYRGYAVLRRHPSVLARFAGDFIEGRIRANREMRLDDQPSLLDDEAEELHLLAT
                     RRAIALVEEALRGKIFLRTA"
     CDS             216527..216943
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005090019.1"
                     /locus_tag="brsh051_02010"
                     /product="HIT family protein"
                     /protein_id="BEH00920.1"
                     /transl_table=11
                     /translation="MDVFDQIIAGQLPAEVIWRTERLIAFLDARPLFAGHTLVCPVEH
                     YETLYELPEDYYTEILAAARTIALAQKAALGAQGTFIAANNVISQSVPHFHLHVVPRS
                     KGDGLKGFFWPRSRPSADQLHAVAEQLRAELAGAKP"
     CDS             216940..217236
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02020"
                     /product="hypothetical protein"
                     /protein_id="BEH00921.1"
                     /transl_table=11
                     /translation="MSELANIFMPGARHWDEVKRAEKSLYVDSKQGGSGPGKLDLDSG
                     FMVLRDQTGNATETSTTIGNPFRTAPEEAVEDEHRSAADDITQMSPTADPVVND"
     CDS             complement(217240..219909)
                     /codon_start=1
                     /gene="acnA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003972923.1"
                     /locus_tag="brsh051_02030"
                     /product="aconitate hydratase AcnA"
                     /protein_id="BEH00922.1"
                     /transl_table=11
                     /translation="MSIDSFGAKDSLEVNGTTYAYYRLDKVPGQERLPYSLKVLLENL
                     LRTEDGANITHDDIAFLGEWDADSEPDHEIQFTPARVIMQDFTGVPCIVDLATMREAM
                     ADLGGDPSKINPLSPAEMVIDHSVIADVFGSPQALRVNTDLEYERNRERYQFLRWGQT
                     AFDDFKVVPPGTGIVHQVNIEHLARVVFPREVNGELVAYPDTCVGTDSHTTMVNGLGV
                     VGWGVGGIEAEAAMLGQPVSMLIPRVVGFKLTGKLPEGATATDLVLTITDRLRKHGVV
                     GKFVEFYGPGVAQVPLANRATIGNMSPEYGSTIAIFPIDQITLEYLRLTGRSEDQIAL
                     VEAYAKAQGLWFDPEVTAEYSEYLELDLSTVVPSIAGPKRPQDRIALADARQAFATAL
                     PNYASDLTKSVDAAIGEQPVTLSNGLVGIAAITSCTNTSNPSVMVAAGLVAKKAAEKG
                     LQRKPWVKTTLAPGSQVVTSYLERAGLTPYLDQLGFDVVGYGCTTCIGNSGPLIPAVS
                     KAVNSDDVVVVSVLSGNRNFEGRINPDVKMNYLASPPLVVAYALAGSMDLDLTTEPIG
                     QDDQGNSVFLRDIWPTPTEIEDVIASAIDPQMYTTSYADVFAGDERWQTLPTPEGKVF
                     EWDATSTYVRKPPYFDDMPAKPAPVRDICGARVLLKLGDSVTTDHISPAGAIKVDSPA
                     GQYLTSHGVERKDFNSYGSRRGNHEVMIRGTFANIRLRNQIAPGTEGGFTRDFTQPDG
                     PVTTVYDASVNYQARGIPLVVLAGKEYGSGSSRDWAAKGTMLLGVRAVIAESYERIHR
                     SNLIGMGVLPLQFPAGTSAASLGLTGEEAFSISGVTDLNAGITPKTVEVTATAPDGKT
                     TRFDAIVRIDTPGERHYYLHGGIMQYVLRALKG"
     CDS             220174..220458
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02040"
                     /product="hypothetical protein"
                     /protein_id="BEH00923.1"
                     /transl_table=11
                     /translation="MTQDKFNADSNDNFEVAGNQLTDAIKKLWKDTTVRSIIIRHPDG
                     RKLMTVPLAVGVAGGAIALVMAPVLSIIAAIGAGLAKVRVEVVRTDDPQR"
     CDS             complement(220487..220687)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02050"
                     /product="hypothetical protein"
                     /protein_id="BEH00924.1"
                     /transl_table=11
                     /translation="MTTSRISTPRCPLRPDDPCSLCQPGANGPQDCGLVYLVMDDPEL
                     REVYAAQLKQRRAARQQSSIRH"
     CDS             220665..222662
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02060"
                     /product="hypothetical protein"
                     /protein_id="BEH00925.1"
                     /transl_table=11
                     /translation="MLIREVVIDSTVRPNAAILNSAWQPRSLFATSLYPIGWGSAVRN
                     EDYVSSSLRPIDVFPITTRVLDVLRVSDVTPGMRRVTLGGPGLAAHTADTGYPVQAFR
                     SDGFDDEFKIILKHPDADVVVAPTQADGVLNWPMDNPLLVARTYTVRRWDPAAGEIDV
                     DVVRHDSGPAGRWAQTVEPGEQVQIAGPKASSGQPEGADWILAAGDETALPAIGRWLE
                     NWPHGVPGQIFIEVAEQSHRQQLTQPDGVQLTWLVRDGAPAGTTSLLHDAVRAAPWWE
                     GRVFVWLAGESLTLAPIRRWLRHEKQLPKAQLDVTGYWRRQPHAEDTGGLDVLGSTAT
                     HTLKLQKLADIVPGFAIRTAITMGLAAALESGPRTSGQIAAQTAAPETGIAKLLRYLA
                     SLGLVSRTADGRYGLTDFGAELNNDHLAGELDFAADHALRELAGLLCLTDAVESGRHG
                     GSAWFSDAAPETVLTEPAVVAERIADEATKAGYLAGPLAHSPELRGLGSLAVMGLGAA
                     VIASVLVREHDRLQVTVLATPAEIEVLRASAPAHERVRCAPADAGDAPEPTDAVLLVN
                     VLNGSSDADAARHLRAIADGLNPGGRILVLTEVFDAQRAYPHDYAEDLIDFGLFGGGS
                     RDHGEYASLFAAAGLGGMRGETLGWGFTLVSLAPRRPQDEG"
     CDS             complement(222659..223426)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010865121.1"
                     /locus_tag="brsh051_02070"
                     /product="SDR family oxidoreductase"
                     /protein_id="BEH00926.1"
                     /transl_table=11
                     /translation="MAESVLDLFKLDGRRAIVTGGGRGIGQAIAQALGEAGAQVALVS
                     RTAQQLKAATEKVPNSVAVAADVMTVNAAALLDDCEDGLDGPIDIIVHAAGFQHREAA
                     VDFPREQWERLLQVHLTAPFVISQELGRRQLEAGRPGSHIFIGSLNNYQSVVPDIVAY
                     AAAKSGVGGVMRALSKEWSGKGIRCNGIAPGWVHTELTETLFSDWSRAKSIIARIPMG
                     RLAEPSELGSVALFLASDASSYITGQMLVVDGGWTTS"
     CDS             complement(223474..223950)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02080"
                     /product="hypothetical protein"
                     /protein_id="BEH00927.1"
                     /transl_table=11
                     /translation="MRIGIVVESYWGNTAQVAEAIAAGARQTGAQTVVWSAAQAPAQI
                     ADVDLLLVGAPTHNLKLPSSSSRRIAARRGIDVDSSGVREWIASADLSGVPTVFTFDT
                     RVSLHSGSAAKDAAKKLKRRGAHVEQGEGFFITGDTPVLQAGEIERAKEWGSRLAC"
     CDS             224006..224851
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02090"
                     /product="hypothetical protein"
                     /protein_id="BEH00928.1"
                     /transl_table=11
                     /translation="MSSASQQGGVTPRERVLNTALSQITEHGMTVSLEHLSLEEIIRA
                     SGVSRASAYRIWPNKQRFLADVLVSAVRATRLEVDSQAEVAQLTALLDANPSFATDAQ
                     VRRDVIVEGLRISIQADFERIASSPQWATYLSLNATCRGLADSSLREEVATALAEMQE
                     VFIDHRSAVYARLPPLLGYRLVPPLSGANGFRSMSEAAGALMTGFLVQLGARPQLLTA
                     TFRLAAYGVDERDWTVPAFALTGLVLSYLEPDPDLVWDQAQLARAEATLADITALLKA
                     SWVTN"
     CDS             complement(224855..225538)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_038967141.1"
                     /locus_tag="brsh051_02100"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BEH00929.1"
                     /transl_table=11
                     /translation="MTELAKARTVQASRIVDELREQILHGDREPGSRLGQELLAAEFG
                     ASRMPVREALRALEAEGLVKIKAHSGAWVSGLDQEEFEQCYKLREVVEPMVIGESVPL
                     LNTVQLDRIAELADLIDATGGARGLRSFLQLDREFHLLSYAGAAYPFLTELVTRLWNT
                     TQPYRRELVRYMPDESFHSTCAEHHLIVDAVRSRDTEAAQSLVRLHIRRTRMTLRNYG
                     EVLWTKDDD"
     CDS             complement(225546..226070)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013527976.1"
                     /locus_tag="brsh051_02110"
                     /product="VOC family protein"
                     /protein_id="BEH00930.1"
                     /transl_table=11
                     /translation="MAIPGIRGLDHVGFTVPDLEQAHEFFVDVLGCEFFFELGPFESK
                     GGTWLSEHVNVDDRARFRNRHYRLGNGSNFEIFEYELDGRNEQQPLNSDVGGFHLAFY
                     VDDLDEAVDYLKSRGVKVLGEPTVSGGANEGQRWVYFLAPWGLQFEMVSYPDGKAYEA
                     GRERLLWSPVHPQD"
     CDS             complement(226070..227071)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003643576.1"
                     /locus_tag="brsh051_02120"
                     /product="zinc-binding dehydrogenase"
                     /protein_id="BEH00931.1"
                     /transl_table=11
                     /translation="MKAVVKYAAGAEHVELREVPEPMPGPGQALLEVIYTGVCGTDLH
                     VMRDEYKVHPPVVMGHEVLGRVVGVGSGADADAWMGKRVVTETFFRCCERCEMCRAGR
                     RNMCEQRESIGSFRDGGFAERLVVPVLNLHEVPAGIPDEIAALAEPLACTCHALLLRS
                     TIKAGHKVLVTGPGPMGFLAAQVARASGAQVTLAGIPSDAEKLTRLASKGITTTTQTP
                     AELSFDVGIDCSGVAAGASNAMRAVKRGGAYIQVGIFGHEVTVPLDVLILHELTMTAG
                     FSHSPRAWDLALDLMGQDVVDLAPCVGPIFPIEQWADALAAISDGKTMKVLIDSRSR"
     CDS             complement(227085..228365)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011337521.1"
                     /locus_tag="brsh051_02130"
                     /product="pyruvate dehydrogenase complex dihydrolipoamide
                     acetyltransferase"
                     /protein_id="BEH00932.1"
                     /transl_table=11
                     /translation="MATVVLMPAVVADAEDAVLTAWLVAEGDQVTKGQELAEIETDKA
                     NVEVEAETAGSVGRLLGSPGERIAVGAPIAVLLAAGEDASAIAEALGEEAPSAPPSGN
                     DSAQPPVRRPGERVFASPLARRIAAEHGLDIAQISGRGPRGRVVRADVEAVIAAQAPA
                     PTPTTDAITAATPVVQPAPAAVAPHHAEAAPSEAAPEAGGAYEDIPLTGMRRAIARRL
                     TESKTTVPHWYVTVDARLDALLAYRKQLNQISPVKISVNDLLIKAIAAALQAVPAANA
                     VWNGESIRRYSTVDISVAVSTPVGLVTPVVRGVEKLGMSALATTTKELIERARDGKLK
                     QKEIEGGSFSISNLGMYGVRDFCAIINPPQSAILAVGAAEQRPVVTDDGALDVATVMT
                     MTLSSDHRVIDGSLAAEFMQALKTRLENPVLLAL"
     CDS             complement(228383..230593)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528128.1"
                     /locus_tag="brsh051_02140"
                     /product="alpha-ketoacid dehydrogenase subunit alpha/beta"
                     /protein_id="BEH00933.1"
                     /transl_table=11
                     /translation="MTHEEVLVPSAPWKQVSTTQADWDAADPQLLRAMLVQMQIIRSF
                     EEIALKLAGEGALHGPAHSSIGQEGGAVGSIIGLRPTDGINGTHRGHHQFLAKGLNYL
                     RGTDFDPAHPIDDEIHAFVKKTLAEILGLDQGFSHGRGGSMHLQWREAGNLGTNAIVG
                     GGVPLANGSAFCQKYAQADAPQEGGSDVTVTFFGDGASNIGSTLETMNLASAWHLPLC
                     FFIENNMYAVSTTVFEATNEPRLSARASGFGMPAWRVDGMDPLAVYLTMQQATEHLRQ
                     GKGAVVVEAEVYRYFHQNGPFPGSAFGYRSKEEEKQWRERDAIQRVARELIARGNLTQ
                     DVFDQMVATIDGVMAGLMDEFTEADPESKRPAKRIRPELWPDPSFVDYGIRGDASELE
                     AWQVLEDDQVTAWREVKFADAAADVMERRMHTDPRYVTMGEDVHKLKGGTNGVTRGLK
                     AEFGDRIMGTPISENGFAGLAGGIAMDGRYRPVIEFMYSDFMWVAADQVFNQIGKARH
                     MFGGDHGVPLVLRSKCAMGAGYGSQHSMDPAGVYAAHPGWRIAAPSNAFDYVGLMNAA
                     LALEDPVMVIEHVDLYEKMDRVPEGDLDYIIPPGVAKIRRPGEELTILAYLNMVDLSL
                     KAVEATGIDAEVIDLRWLDTASMDWETIGESIKKTNNVLLVEQGSPGPGYTSRIATEI
                     TERFFDYLDQPVQRVYGSQSTPTISKVLERAALAYEPEIEAGIARVRRNLGQQA"
     CDS             230758..231507
                     /codon_start=1
                     /gene="fabG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004082240.1"
                     /locus_tag="brsh051_02150"
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="BEH00934.1"
                     /transl_table=11
                     /translation="MKWDLEHRRAVITGAANGIARATAHLLASDGARLVLVDLDADKL
                     AITAEQCRKSGAEQVETFAADLTDGDAVHRLGEFVTSTMDGLDLLIPAAGIIGREPIV
                     EMPDEHWDRIMNINVRAVFQLNRELLPLMADGGSVVLFSSDAGRRGSPGKAAYATSKA
                     AIIGLARSIVGEVGRRQIRVNIVAPGFIDTRMNAETFAVKGDVLAEETPLGRNGRPEE
                     VASVIAFLCSDAASFVNGAVVPINGGHYMAG"
     CDS             231562..233028
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005086406.1"
                     /locus_tag="brsh051_02160"
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="BEH00935.1"
                     /transl_table=11
                     /translation="MSDRIAQLEQQVLEALPKGLFIGGEWIETSSTIPVENPAKGAPF
                     AEIADATPEQAVLALDAACDAAASWAATKPRERAELLRRVFDLINERKDIFAALMTME
                     MGKTFNEALGEVAYGNEYVRWFSEQTCRIAGYNSIAPASGKRILTEKVPVGPVLAITP
                     WNFPLAMATRKIAPALAAGCTVVVKPAKLTPLTTLLFGKILQEAGLPAGVVNIITTNR
                     SGATTGPLISDPRMRKITFTGSTEVGVGLLRQAAGRVLRTSMELGGNAPVVVLADADL
                     DVAVQGAMDAKMRNLGEACTAGNRFIVHESIADEFTKRFTERMAAQTVGYGLDPATNV
                     GPLIDNDQRSKVLELIQDAVDKGGKITTGGNRLDRPGYFMQPTVVSDIQPGARVLTEE
                     IFGPFAPIITFSTEQEAIDIANGTDFGLAAYVFSNDLRTAMRVGDGIETGMVGINTGV
                     VSDAAAPFGGVKMSGLGREGSELGIEEYLETKYYALPL"
     CDS             complement(233114..235018)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003817018.1"
                     /locus_tag="brsh051_02170"
                     /product="phosphoenolpyruvate carboxykinase (GTP)"
                     /protein_id="BEH00936.1"
                     /transl_table=11
                     /translation="MSPLKSRPERLSPPELIATADDRWATSAPPNAPEEVVTWVAAVA
                     DLTQPDEIHWCDGSQTERDMLYDEMVASGELVRLNPQLRPGSYLARSTPSDVARVERR
                     TFICSERESDAGPTNNWAEPAAMRRTLAEVFDGSMRGRTMYVIPFSMGPIGGDISRLG
                     VEITDSPYVVTSMRIMTYMGTEALDAIASGADWVPAVHSVGYPLVDADGRRIPDVAWP
                     CNEQKYICHFPETREIWSYGSGYGGNALLGKKCYALRIASVLARDEGWMAEHMLILKI
                     TSPQGQVFHLAAAFPSACGKTNLAMLRPTIPGWKVETVGDDIAWMRPGPDGRLYAINP
                     ECGFFGVAPGTSERTNPTCLHALSRNVIFTNVALTDDGDVWWEGMTPEPPAHLIDWQG
                     NDWTPGSGRTAAHPNGRFTVHASQAESISDDWDDPAGVPIDVILFGGRRAHTVPLISE
                     SYDWAHGVLMGAMVSSEQTAAAEGKVGFLRHDPFAMLPFCGYNMADYWAHWLRMGEVL
                     GDKAPRIFQVNWFRKDATGRWLWPGFGENSRPIEWALQRVMGNAQGAEAISGRIPAPG
                     ELNLDGLDISEQQVEALFELDPAEWSAEADSAEEYFAQFGAKVPSELERQLSSLRARI
                     DQVRESSAQS"
     CDS             complement(235482..236624)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224485.1"
                     /locus_tag="brsh051_02180"
                     /product="TRAM domain-containing protein"
                     /protein_id="BEH00937.1"
                     /transl_table=11
                     /translation="MADYPCVELGPIAHGGHCVARLDGRVVFVRYGIPGERVRVRITD
                     DSKPRMWWGEVAEVIEASPDRVIPPCPVAGRCGGCDFQHVAVPRQRELKAQVLAEQLR
                     RLAGLDIDVTVEPVPGDADGLGWRTRMRYLVRDHRVGLRAWRSDELVELPVGGCRIAH
                     PGGPADLGRFAGHDGELQVVISDDGCTVLGPGGELLTGSQIVTQHVGGRAYRVRADGF
                     WQVHPGAAETLTAAVLDGLNPKAGEQVADLYCGCGLFAGALVDAGCRVTGIEASRSAI
                     ELAKLNVPQARFHAMRVDKAGSRLAKKTDLIVLDPPRTGAGAGVVRQLAGLEPTGIAY
                     VACDPAALARDLATFATCGYRLESLRAFDLFPMTHHMECVAVLRPH"
     CDS             complement(236723..237538)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02190"
                     /product="hypothetical protein"
                     /protein_id="BEH00938.1"
                     /transl_table=11
                     /translation="MIFGRKKRNDADQDDESAVDEETLDELEDDAEAHDDAAAEESEA
                     GASAADGDESDDAEEEIDEWAALDASRDWREDGPFDLTEVDLDADDIERLDFGCVVLT
                     PFEGMQMQLQVDQRTKKVQAALVMAGASAIEVALFAAPAHTSMVGDIRNEMIAATEKA
                     GGKATLAEGPFGTEVRRVIPMTDPKGNRVVHISRTWFAEGPRWMLRGVVMGEAGRASG
                     IEGVSELVYEFFSNAVVRRDSEPRVPGDLIPMTLPSSVATKDAGAEKASRAEG"
     CDS             complement(237570..238028)
                     /codon_start=1
                     /gene="dut"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224478.1"
                     /locus_tag="brsh051_02200"
                     /product="dUTP diphosphatase"
                     /protein_id="BEH00939.1"
                     /transl_table=11
                     /translation="MIDDGLPLPAYARAGDAGADLATAVDVVIEPGQRVLVPTGVSIA
                     LPDGYAGFVHPRSGLAARSGLTIVNAPGTVDAGYRGEIKVCLLNTDQRTPIELHRGDL
                     IAQLVVQQVLRVHFEPVDELPTSERGADGHGSTGGVTAWRDDSGSAPAAG"
     CDS             238116..238391
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02210"
                     /product="hypothetical protein"
                     /protein_id="BEH00940.1"
                     /transl_table=11
                     /translation="MSDAADKSNPTSGIEFKIIAGALGAVATFAVQKLIRSGWKQITG
                     QEPPDPNDPDASAVAAIAWVAASAVGVSVAQVVTRRFAAKRYRSLGH"
     CDS             complement(238525..238821)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005057245.1"
                     /locus_tag="brsh051_02220"
                     /product="DUF4193 domain-containing protein"
                     /protein_id="BEH00941.1"
                     /transl_table=11
                     /translation="MATDYDAPRKSDEEMSEDSLEELKSRRNDKQSGQVDEDEVEAAE
                     AFELPGADLSHEELTVRVLPRQADEFTCASCFLVKHRSQLAETRGGLDYCVDCV"
     CDS             239054..240292
                     /codon_start=1
                     /gene="sepH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805049.1"
                     /locus_tag="brsh051_02230"
                     /product="septation protein SepH"
                     /protein_id="BEH00942.1"
                     /transl_table=11
                     /translation="MESALTPREIQARIRGGESLEEVAQAAGVSVEQIDAYAGPVLAE
                     REHAATLARTSQVRRHRESGVQRLLGEVVADALAAEGVAPEEIRWDSWRDENRRWTVQ
                     VSWPSNGEQQHADFDFDQRGRYSTAKDAGAKKLIGERPPQAKRPGTPNPDAEPTVDLH
                     DELAIVRVVQDNAEPPAVLPDVPAARIIKLPGRDQDNIDDEPDDYVDPELEQFDGVYD
                     IVSNPRSDMDVLYDMLSGFNEDSVRIYTGLTQPVSPPPDPEPEAQPRSAQRPRPSDPR
                     SRRRGRTASVAGEPIEVAPAADQPAEPDKQPTDAETAQSAATPPESAAAPDSRAGAHP
                     KAATPRAKATHKPATPRPKPAQAAAHAEQASAEPEQDALVSGPEEQTTPKPRKRRKRA
                     SVPTWDEIMFGAPPPSDPSN"
     CDS             complement(240340..241494)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030493.1"
                     /locus_tag="brsh051_02240"
                     /product="alkaline phosphatase family protein"
                     /protein_id="BEH00943.1"
                     /transl_table=11
                     /translation="MARIQLPDYGRSTLTEVLPAVASHLLAGLPGLPGNAEDCRDVLG
                     IPQARRYVMVMVDGLGHDLLIRQRFRAPYLGSLLEGAIGLTSGVPSTTATSLSSIGTG
                     TVPGRHGIVGYSFRALGEIINALTWDDRLDPLTFQPQPTWFEKLEAHPQIAVSTVSLA
                     KFEDSGLTQAALRGSRFIGLIDENDTSLRIEQIVAASRVGERSFVYAYERRLDHAGHG
                     MGCLSEAWNQTLDEIDAWIEQLRSALDPQTCLIVTGDHGMVDVPSNHQIVIEDTPVLT
                     NGLDLIGGEGRLRQLYCDRPDEVATRWRRWLGERAIVRTRDEAIDEGWFGTVDDRMRD
                     RIGDVLVALLGDWAIMTLTRPGELTLVGQHGSLTPEEMRVPLLIDQLTAD"
     CDS             complement(241497..242084)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030492.1"
                     /locus_tag="brsh051_02250"
                     /product="DUF5998 family protein"
                     /protein_id="BEH00944.1"
                     /transl_table=11
                     /translation="MRREVKTSPGQLPEPLQTQINDCGFFPQLVADSVALALGREPVD
                     VFLVHHEATFAPEGIGRHLSVLVLTATRLIVCHTDEHTDDPANATAISSTESVPLRLL
                     GAVALTRVISQPEHFGSAGAQTVETWLTLSWSTVRRIDLEPATCGDPSCTADHGFQGS
                     DVAEDMVIRMSPVSDGAENVQRLVEFGTALQQRVH"
     CDS             242142..243215
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_164930149.1"
                     /locus_tag="brsh051_02260"
                     /product="DUF2183 domain-containing protein"
                     /protein_id="BEH00945.1"
                     /transl_table=11
                     /translation="MVATLEPMESQQFVGTRIDDFITDRVARFLRKRGWREAIIPFTG
                     YGSADHVRVLGRLVLRPVRARSYFGMYAEAFLHQRGWRNFISAPVPRRPVTVKVGDED
                     LELVTDRSGYIDVTVKGSALEGGWQEVTLSTAEAPDATAPVQVVDSAQQFGLISDIDD
                     TILSTWLPRALLAAWNSFVLTEGNRQAVPGMARMYQKLLAEHPGAPIVYVSTGAWNTM
                     PFLSRFMKRHGFPDGPMLLTDFGPTQTGWFRNGANHKRRALAELARDFPHIKWVLVGD
                     DGQHDPAIYREFAELRPEHVELIAIRRLSSTEQILAHGTATVLRDSADLEWEPSAVTQ
                     VSGVDGDDLAPQVWRAIESDQSD"
     CDS             243263..245713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_164929932.1"
                     /locus_tag="brsh051_02270"
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="BEH00946.1"
                     /transl_table=11
                     /translation="MATKTPDDVEEFEERIIDIDVSSEMETSYLEYAYSVIYARALPD
                     ARDGLKPVQRRILYTMYDMGLRPDKPHVKCARVVGQVMGLLHPHGDTAIYDALVRLGQ
                     DWSMRLPTIDGHGNFGSLDAGPAAYRYTECRLAPAAMAMVSDIESDTVDFRPNYDGKE
                     LEPSVLPAAFPNLLVNGASGIAVGMATNLAPHNLIEVVGALKHLLAHPDADLDALMRY
                     IPGPDFPTGGTIIGLDGVRDAYASGRGSFKLRAACRIDQVSPRRKGIVVTSLPYGVGP
                     EKIMEQIKDLVTRKKLSGIADVKDLTDLKHGTRLVIEIKNGINPDALLAQLYKLTKLE
                     DTFAINAVALVDGQPRTMSLIEMLQVYLDHRIEVVLRRTRHRLGKATDRLHLVEGMLL
                     ALLDIDDVIAIIRSSEDVAEARTRLMEAFELTEVQANYILDLQLRRLTKLSRIELESE
                     RDELTAEIARLNEILDNESVLHGLVSGELDDVVKKFGTPRRTVLLADSGVAASSAAAP
                     LEIPDDPCWVMLSSAGLVARLDVAEAPARPEGPRTRHDCVVAAIQATTHAEYGVLTSH
                     GRLIKAKAIELPSVPPTATSPNLQGGTRISDLVHLDKDERVLGLTSLSDSSLGLALGT
                     RSGVVKRVNPEILASKDDWTVINLADGDEVVGALELHSADDELVFITSDAQLLHFAAS
                     LVRPQGRAGSGMTGIKLGADAQAIWFGAVRAGAAVVVTVSGSSSSLPGTETGSVKVTP
                     FAEYPPKGRATGGVRCHRFLKGEDTLLLGWAGAAPAIAAAGSGSPVDLPPATGRRDGS
                     GTPASQPIAAVASRVLGS"
     CDS             245730..246218
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000119799.1"
                     /locus_tag="brsh051_02280"
                     /product="carbonic anhydrase"
                     /protein_id="BEH00947.1"
                     /transl_table=11
                     /translation="MPFADLLTANAAYAEGFEHRDLDGRPRAGLCLLTCMDCRLDPLP
                     MVGLQVGDAKVLRSPGGHLGPEMLAGCVLAVHALGVNRIMIIAHTRCAMAGSESDLRD
                     RISASSGIKDIDIVFGADADRLGRLAEDVETLRNHELIGRFAEVGGFDYDVDSGRLTQ
                     LY"
     CDS             complement(246297..247529)
                     /codon_start=1
                     /gene="coaBC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_071831608.1"
                     /locus_tag="brsh051_02290"
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase CoaBC"
                     /protein_id="BEH00948.1"
                     /transl_table=11
                     /translation="MNIVLGVSGGIAAYKAVMVARLLVEAGHDVQVVPTEDALHFVGK
                     PTWEAISRHPVTASVHENVAEVRHVALGQHADLIIVAPATANTLARMAAGIADNLLGT
                     TLLATEAPVLVAPAMHTQMWLHPATQANIATLRTRGIEFVGPNDGRLTGTDSGPGRMS
                     EPDEIVTRAFEILARTSLTSGDLAGVKLLVSAGGTREPIDPVRFIGNRSSGRQGVALA
                     AAAAARGADVVLLAANIEDAILSEVSDCANVRIDRTGTATEMDAAANREADDADVIVM
                     AAAVSDYRVAGVRDTKMRKEDTGTQVTLTLTENPDILAGLVHRRRPGQLVVGFAAETA
                     ENQQALLALGRQKLARKGADLLAVNAVGWSEGFETTENTLYVLAVGGELVATASGSKR
                     EAADGLLDAIVAARQARS"
     CDS             247625..248308
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02300"
                     /product="hypothetical protein"
                     /protein_id="BEH00949.1"
                     /transl_table=11
                     /translation="MLAVRDEDPTRPWDAPGPWWPDEYPEVIGVRDRRANGAWLAEDS
                     PAGRLAVILNRDVLSVPDGSLESRGGIVLASVSGESLPQRPRTAGFNLVEVAGPRAWV
                     TIWDGLRLRRQQLEPGVHMISHDEVDDPRTARIVRWLPDYREITQRQGPEMAFEQWAH
                     QWVAVLSASSALGPFDDRAIIRDNHPHGYPTMSLLVCVAEIRAERVQLASAVLPEPGV
                     WAEAPFVLA"
     CDS             248363..249322
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002289459.1"
                     /locus_tag="brsh051_02310"
                     /product="DUF368 domain-containing protein"
                     /protein_id="BEH00950.1"
                     /transl_table=11
                     /translation="MSEPISSNPTSVQKPPADGYLNEPESISAWLIRLVKGILVGIGF
                     ILPGLSGGVLAVIFRVYDPIIRFLAKPFHRFGKNVLYFIPIGIGAVIGIVLFSVVVDA
                     AFGRFAAQFICLFIGFVVGTFPSLYRTAGRQGRTTTHWIILAVAAVVIFAIMLIGGQS
                     MINVTPNWLVWLGSGALIGLGVIVPGMSPSNFLIYFGLYDKMAAGIKDFDFAVIVPLT
                     LGLIVCVLVFAKAAAWAFDHYYAGMYHFILGMVIGSSLAIFPTVVFPTFTASGLAEAN
                     LSLPVALIFAIVMFIVGTIASWLFSKLEDKVAIQREAIEAAAS"
     tRNA            249697..249773
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00050"
                     /product="tRNA-Met"
     CDS             complement(249885..250376)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02320"
                     /note="frameshifted, insertion/deletion at around
                     250356,250389"
                     /product="hypothetical protein"
                     /protein_id="BEH00951.1"
                     /transl_table=11
                     /translation="MGPRRPEAGLITVERSATQFGQQIVTTDTKNHENRTVALDPKTA
                     AALKAWRQQQASERLEWGPAYEDTDGLVFAWENGARVFPDYFAKAFLAAQKGTSLPRM
                     TLHGTRHTHATTLLREGIPVHIVSKRQGHKDPSVTLNVYADAIPKDDDRAVEVFAKAV
                     WGA"
     CDS             complement(250691..251329)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02330"
                     /product="hypothetical protein"
                     /protein_id="BEH00952.1"
                     /transl_table=11
                     /translation="MNGAELCTVREGLGLSKAWLARRWQVPSEAIDRWEQISTTEVPL
                     EYVADLSFIEALADARASDLLGQFSRDLGVDDLKDVILDAADPSTWPSTTVPGTDDEC
                     EMSGLPAGFFRACAYRARQALAGRLTIEYAQAEQDEYILAAAASGIVTLSSNANGGRL
                     IARLGPISDALDMKSMDVKHLVTKILDIDQCQISARRIRSSGTYVLWVIRIR"
     CDS             251623..251892
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02340"
                     /product="hypothetical protein"
                     /protein_id="BEH00953.1"
                     /transl_table=11
                     /translation="MPKLVTGTVESWDSDRGCGVIMMDGNIPVWSHYSTIRGVTGFAN
                     LTPGEQVAMTLISRDPLAKNTEAPGFAWITADVYPIDRTKDDSYD"
     CDS             252011..253378
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011727513.1"
                     /locus_tag="brsh051_02350"
                     /note="frameshifted, insertion/deletion at around 253321"
                     /product="IS1634-like element ISMsm6 family transposase"
                     /protein_id="BEH00954.1"
                     /transl_table=11
                     /translation="MSPYLRKVKTRSGATAVQIVETKHGQRVIVEHLGSAHTDAELAA
                     LMRAGHDKLHAGQPALELGIDPHGAPVGAVAVVAGTRSKLLMDAIRASWGRLGFTVID
                     DEAFFQLVAARLVEPTSKRDSIRVINQLGMHAFHENTYYAALRRCMAGDYREQIAKAC
                     FTHVWTDAGGDISLLLYDVTTLYFEAENEDDLRKVGFSKERRVDPQIVVGLLVDRSGF
                     PLEIACYEGNKAETATIIPIVKAFQDRHQITDMVVVADAGMLSATNLQALDDAGLRFI
                     VGSRVTKAPHDLAKHFCWHGDHFTDAQIIDTITMRRTKPDPARLDTCDEPVWNPQDHP
                     LAWRAVWQYSRKRAVRDQHTLTAQQNRAQAIIDGLHPPRKARFLKTSGATLTLDHTSL
                     DRARRLTGLKGYVTNITVDTMPADQVISAYHELWHVEQSFRMSKTTSLPDRSSTTPAT
                     RSKPT"
     CDS             253285..253581
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02360"
                     /note="frameshifted, insertion/deletion at around 253321"
                     /product="hypothetical protein"
                     /protein_id="BEH00955.1"
                     /transl_table=11
                     /translation="MARRAILPDVQNDLAARPIFHHTRDAIEAHLTIVFTALAIARDL
                     QARTGWSIKRIIQTLQPLRHVTITITINGHPIEAQPAISDNTREILNTLGIPEH"
     CDS             253681..254352
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02370"
                     /product="hypothetical protein"
                     /protein_id="BEH00956.1"
                     /transl_table=11
                     /translation="MIRHLPKALASLITLVIVLCAGITQASAAPPTPTPAPQGTWVFT
                     ASKPEMNATHAMGKFGASVDVGSSSNTLRWYFQLSSAMSAMAVSPMDCKATLNGRLGS
                     PYSDYHPNIPASYLWHSSIPALSYNTEYKLEGNCRYNAYTGTSYGNMVVAWAFRFKID
                     QNAKAASMDPQDSTLDINSTQIEFIEVSDASSEDSETSQVFEVVPTANPYIPGYDIVG
                     VLTLY"
     CDS             complement(254980..255453)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02380"
                     /product="hypothetical protein"
                     /protein_id="BEH00957.1"
                     /transl_table=11
                     /translation="MAPNIDRHPNNCELLEPTLQQLKWLAAQSVEILAVVAPESPTRS
                     EKPRRLRRRFSSEEVKEMAQQYRDGVSTPQLCAEHGISKTGILRLLREEGVEVRRQTA
                     TDGVVAEAAQLYEAGMPVTRIAEQLSVSGSALRRSMLKAGVDMRPRGGYRRAPLA"
     CDS             256006..256248
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02390"
                     /product="hypothetical protein"
                     /protein_id="BEH00958.1"
                     /transl_table=11
                     /translation="MIIEDVPWNENDVQPLLGMWGHLANASEGPLLISTSHPGDGQPA
                     QHRAWLDDAVAGLTGLGIPVLGTFTAARDGVYRHSC"
     CDS             complement(256372..257016)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011674335.1"
                     /locus_tag="brsh051_02400"
                     /product="Ltp family lipoprotein"
                     /protein_id="BEH00959.1"
                     /transl_table=11
                     /translation="MSQFPPNQPPQQPYYQGQPPQQPAGQQPPPYGQPAFQPASAPKK
                     PWYKRAWAIVGFVILGFFILSRLVGGGSADDQTQDAAAQPSVTIAAETTAAPAPEPTT
                     AAPPAETEPAVPTEYKSALKKAQSYIKTMNFSQARLYDQLTSEYGEKFSPEAAQYAID
                     NVDADWNAEALAAAISYQNTMAMSPSAIWDQLVSEYGEKFTPEQADYAIANLPP"
     CDS             257243..257770
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010941194.1"
                     /locus_tag="brsh051_02410"
                     /product="O-acetyl-ADP-ribose deacetylase"
                     /protein_id="BEH00960.1"
                     /transl_table=11
                     /translation="MNAQITLHKGDITTDAEADAIVNAANTSLLGGGGVDGAIHRAAG
                     PELLAECRTLHGCRTGDAKITKGYRLPAAHVIHTVGPIYRDGRHGEPALLASAYRRSI
                     EVAAENGCARVAFPAISAGVYGYPADEAARIAVSTVAKAMAEHPQVIEVRFWLFNEHL
                     YRAFEQALRELHTMS"
     CDS             257855..258490
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02420"
                     /product="hypothetical protein"
                     /protein_id="BEH00961.1"
                     /transl_table=11
                     /translation="MSEPVAITEYVVRTIAETAIDNEKYFCDLDSVVGDGDFGYSLAR
                     GFEKVLEQWDEFDRSSVATFLQKVAMVVTSRVGGTSGPIWGTAFLRASMVARKAETFD
                     GATVVAMLRSAAEGIMARGGASLGEKTLLDALVPMTDTLERELNDGAPLGDVLDATAA
                     SAVEAAEATSKLEAKRGRAAYTGERSIGSVDAGATAVGVLATAVAKNWPGR"
     CDS             258533..259528
                     /codon_start=1
                     /gene="dhaK_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259135.1"
                     /locus_tag="brsh051_02430"
                     /product="dihydroxyacetone kinase subunit DhaK"
                     /protein_id="BEH00962.1"
                     /transl_table=11
                     /translation="MKKFVNDPKQYVPEMLTGIALANPGTLKYVPEYNLIMRADAPNN
                     DKVTIIQGSGSGHEPAHVMVVGPGMLDGACPGDVFAAPPMDYVYESGKLLASDKGILL
                     LVNNYTGDKMAFEMAAEMLESEGYKVATLFINDDVAVKDSTFTVGRRGVAGNFFVMKA
                     CGAKAEQGADLEEVVRVGEKVNSVTRSMGIALTPCTPPAKGEPLFHLADDEMEVGVGI
                     HGEPGRRRDKLGSADEIVDELLEAIVPDLPYNEGDEVALMVNGLGGTPISELYLLYGI
                     AHRKLAERGIKVWRSYVGEYCTSLEMAGASITLVKLDDEIKELLSAPAEIAIRVF"
     CDS             259556..260368
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010902971.1"
                     /locus_tag="brsh051_02440"
                     /product="N-acyl homoserine lactonase family protein"
                     /protein_id="BEH00963.1"
                     /transl_table=11
                     /translation="MTEMKVHVLSTGVMETDLTWLLLKGGKTIRDRYHKNDPVVWGDC
                     PTHAVLIEHPEGRVLWDTGVPRDWETRWEPTGFQDFFPVREPVDGPGYLDTALADLDL
                     GFDDIDILVLSHLHFDHAANAKLFNPAKTKILASTAELEGVKSITGYSQGAHIVSDYD
                     GLAIDGIAGDDEILPGISVIQTPGHTWGTMSLKLDLENDGTKIFTSDAVYLSDSWGPP
                     AVGAAIVWNNLAWLESVDKLRGIADATGAEMIFGHDAEQKKTLRFAPAGYYS"
     CDS             260376..260795
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02450"
                     /product="hypothetical protein"
                     /protein_id="BEH00964.1"
                     /transl_table=11
                     /translation="MILYDFVCTDGHDFEALIASMSDDAPSCPVCQAPSRRRLARLNI
                     GGRADTGVSRDQMPRSWTQTGAGDRETIRHWHEVAAKREKLEERHPELAGDRRPILAH
                     EGIFARKPLRAGDDIAAAVRDASSPTQSDTHKDKQQQ"
     CDS             260792..261901
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011726685.1"
                     /locus_tag="brsh051_02460"
                     /product="alcohol dehydrogenase catalytic
                     domain-containing protein"
                     /protein_id="BEH00965.1"
                     /transl_table=11
                     /translation="MKITGAVLEEIGRPRPYAESKPITVCELELDPPGPGEVLVRMEA
                     AGICHSDLSVVNGNRPRPVPMLLGHEAAGIVEQLGDGVDDIEVGQRVVMAFLPRCGKC
                     KNCLTDGKLPCIPGTAANTAGRLLTGGERLHRNGQKVFHHLGVSGFATHAVVDRRSIV
                     PVGSDIPPQVAAVLGCAVLTGGGAVINAGAPADGDTVAVVGLGGVGMAALITALSLGK
                     GDVIGVDALPDKLKRATELGASAVYTPQEAIDAGVKAPVVVEAAGHPRAFETAVKLTD
                     VGGITVTVGLPAPGADATISPLGLTAEARTIMGSYLGSAVPARDIPTYAQLWREGKLP
                     VDALISSIITLDEINSAMDALADGKAVRQVILFDA"
     CDS             262182..263750
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02470"
                     /product="hypothetical protein"
                     /protein_id="BEH00966.1"
                     /transl_table=11
                     /translation="MPDVEAGQYLATSGHREFLSNGPQTTIIETSHLPGAIAFSDPPL
                     IMQQVLDTISYEQASAGYWIREIWQTRSAITSRLLMLSDDAGLVLYAIDGTDRLAFDS
                     GLVELPADAVPGASWTSQATATDTDGVSTSWSRTGSIGSAAEQGCLEITTTDRYRDTE
                     TTSVTTRCPQRGIVAVDQAAAGEPPAVDTSGLRLRPHPDLMPASDPITTTILTGEVAM
                     AVGMTTPPVAVGDGLVFANRTNGQLDFVSPGANGQWTLSTVRRPGLDMTASLDAGEMV
                     VAATTDRALVAYDRHGRWVWQADLPDIASDLFWVDDEAAAALTLDGQLTIFAVSDGRT
                     IRTTDMPAGSTVGPAVVQGDSGALIATASERQIAILNAEDRVTTLEVRDDVRSLAMTH
                     QAVVVSDVTADLTAFTLAGDRLWRVGMPDSCRQLVATDELVVCRLPNAIAAIDPASGR
                     VIWRAELSALAIYVADGQILSMGRQTTTLLSTSGDELGSWQIERTASNTWAVPMTGGL
                     LVTSDIGEFEWWPA"
     CDS             263735..265441
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02480"
                     /product="hypothetical protein"
                     /protein_id="BEH00967.1"
                     /transl_table=11
                     /translation="MVASMKTQARVVVDALDKIFVDPIRSGRPRPKDWQPGLAPVMAL
                     AAAGYLIGVVLVLGAPWLRSADRPVVIERAEVIGSASMTVLLWLVTLTLAVGLTAALH
                     VHPLLKLISIIVFLLPLTPQLALGTGSLAVVASVGGTIIFFLIRRRGSFAGWEFPVIW
                     ILVSTGVMMPLISTGNFGYDIRTSTVLLILAFMNSLAVPALMMTGYAAAQVGISFSQW
                     MGLRLSQLMPRYLSLVAISVLGLGNLGYAIWSTHQRRLGWELENWMGSVLLVALAAGI
                     IAVLWSGLPDRGTSPRDPADPDALVDSWTSQAFGLASVTLAFMLLTSLGAVAGGLADV
                     FLGSQPDWLANLSSSTTLVFLVRLGQAALALWWGWHRARRGDRVTPVVLGAYAAIMAI
                     SALSVLTAWAWFAWEIEPAGVLLLMIGALIWCTGRGDAGVHQALILALLVTLFRFREP
                     LSEPGMIFGAVSASAVLLISLLWRVMTDGDLMAGDSKALPQSSRVLAFATMTLLAVLI
                     LAVTAQMRIETTAIDQSGMVGLGDMTLGGALFMAAGIASLVALWTYRRGDALTAGPVP
                     RS"
     CDS             complement(265481..266914)
                     /codon_start=1
                     /gene="aldA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002225842.1"
                     /locus_tag="brsh051_02490"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BEH00968.1"
                     /transl_table=11
                     /translation="MAELTTYRNYVAGEFRATDQTIPVENPATGEVLAYAPRATPADV
                     DDALQAAFDAKKSWALTPAPERASYLTKLAQAIRAHEAMFTDILVKEQSKTPELANVE
                     VLFTADYLDYMAGFALRIEGSVMNSARPKESIFVLRKPLGVAVGILPWNFPFFLIARK
                     LAPALVTGNTCVIKPASVTPINALEFAKVAAEVGLPRGVFSMLAGSGAIGEQMSADPR
                     VDIVSFTGSVPVGSAIMAAASKNVTKVNLELGGKAPAIVLDDADLDLAVASIKASRVI
                     NTGQVCNCAERVYVTRGVADEFISKMTEAIASTTYGDPSVDKGLDMGALIDANAASRI
                     GAMVDASVAQGATVLTGGKVADRGQGHHFQPTVLTDVTQDMPVIRDEIFGPVLPIMVV
                     DDFDEAIQKANDSEYGLTSSLYTASLANAMKGMREIDFGETYINRENFEAMQGFHAGT
                     RKSGVGGADGPLGVEEFTRTQMIYVEA"
     CDS             complement(266982..267845)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02500"
                     /product="hypothetical protein"
                     /protein_id="BEH00969.1"
                     /transl_table=11
                     /translation="MSKTASSVEGYWIEQIGLMRELPAAVTANEPESIHDLRAAGRRL
                     KATIRVYRPLLRPQLAEALLAELDWYNSELGRARDAEVIHEHMAELFADRADAKPLLD
                     ELAGEQESLRQEAITILGGDRAAALVDLAGVMVAQPWRRSKARKGKGPTREQIMRRVG
                     WAEQRVGKAWQEVDAHPEGRWAGLHLLRRRAKAARYAYESVAAARSGAAATARYYAEL
                     ADLLGMVQDAVIVERVLAGRPGELTEYALDEQRRRSQAAEKRVADARKSATASTADSG
                     RLATAPAQPPV"
     tRNA            complement(268036..268110)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00060"
                     /product="tRNA-Asn"
     CDS             complement(268251..269345)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103575.1"
                     /locus_tag="brsh051_02510"
                     /product="NADH:flavin oxidoreductase/NADH oxidase"
                     /protein_id="BEH00970.1"
                     /transl_table=11
                     /translation="MSEVSRALFEPIKLRGLEVRNRIWVPPMCQYVVDKQDGVPVAWH
                     LMHYGSLARGGAGGVVVEATGVVPEGRISPQDLGLWNDHQRDAFAPIVELVHAQGAKL
                     GIQLAHAGRKGSVYREWGTEAPGTSVPVSEGGWQTVAPSAVAFPGLAEPAALDQAGID
                     RVAAAFAAAARRAVDAGFDFVQVHGAHGYLLHEFLSPLSNHRTDSYGGTLENRARLLL
                     QVVDAIRAEVGQAMPIAVRLSATEWVAGGFDIDETVTVVRWLGQHGADFVDISTGGNV
                     KQAPIPVGPGYQVPYATAVKKATGVTTSTVGMIDSAFQAEQIVATGLADIVMVGREFL
                     RDPSFALRAAETLQVAVGYIPAPYRRAYRR"
     CDS             complement(269492..269995)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02520"
                     /product="hypothetical protein"
                     /protein_id="BEH00971.1"
                     /transl_table=11
                     /translation="MADRSAYKLTKDEIAELAKVLGRRPDVLVAARGPEGFVALLRDR
                     MVVRRPQGWQLVAWTDIQRGGWDSDNRRLYWQMTDGTRSEIELNEQSALPHAFAERVR
                     ASIVAWRQIELDDDLGTVQLVGRRRPGSDEPISWQVEGLGRCDLGDPKVQSIVLGLVE
                     EMRAEYE"
     CDS             complement(270026..270856)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02530"
                     /product="hypothetical protein"
                     /protein_id="BEH00972.1"
                     /transl_table=11
                     /translation="MFFDIVDTALLTAADEIRLAVAIEAGVTAERALMDGSLCCDVAA
                     ADLELIAELGRAARDEFFMGNLRMVANLALTWADRAGVSAEELFQEGCVGLGRAIQRW
                     DWRRGYRFSSLAWPMVEAEISHAAMRRCGAIEASVFRLRSAFELRRAREQLETLLGHE
                     VTVTELAGYLGRDVRTVAATVELSAPDRLSDDLMALLPDPAGECPPDELHAEVLRGLD
                     ELPPQEAALLRCSFGIGQPAMTRAATADRLGLSVSTTRRLELKALSRLRRLLLSAEAA
                     "
     CDS             complement(270953..272827)
                     /codon_start=1
                     /gene="dnaG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005085036.1"
                     /locus_tag="brsh051_02540"
                     /product="DNA primase"
                     /protein_id="BEH00973.1"
                     /transl_table=11
                     /translation="MASRINDEDIALVRERARIDEVVGAYVQLRNAGGGSLKGLCPFH
                     DEKTPSFQVTPSRGFYYCFGCGEGGDVITFLQKIDNLSFTEAVQALADKTGVQLRISD
                     DGRPATQPGLRQRVLAANQAASEFYQSQITSAEAVIFRQFVDGRGFDREAAQHFSMGY
                     APKDGKALHDHLHRAGFSDEELVRAGLIRESGWDYFQGRVVWPIKDSAKSVLGFGARR
                     VFDDDRMPAKYLNTPETVVYKKSHVLYGLDLARQPIGKKAQAVVVEGYTDVMACHLSG
                     IDTAVASCGTAFGADHARMLQRLMGNNDAFNGEVVFTFDGDAAGQAAALKVFSLDQTF
                     VAQTYVAVEPNGLDPCDLRLKSGEPAVRELVGRRVPLYRFVMRNVVAQYDLDRVDGRL
                     QAVRAAAPLLSSIRDGSLVRGYLHDLAQLVGMDVEEVRQIVSQQVRRAMPAAHEPPKQ
                     RTRRPAEEPDGPVLDGLSLPWPDPRDRNLAVERDTLKLMLQYPTLFDTTWNGVSADDF
                     THPAYRAVFEVILATPFQAQGWTEQLQAVTVDDVARQLQVALLVEGIHHDPDEAYASA
                     YTAKLQLLTTLRRLAELKSRLQRINPVEHSSAHKQAFTELIALETRRRTLEQISAGAD
                     "
     CDS             complement(272865..273995)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011392159.1"
                     /locus_tag="brsh051_02550"
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="BEH00974.1"
                     /transl_table=11
                     /translation="MTSDALQPNARAISWASTMTGHGDDLVTAHRDSHVHIATGAPIG
                     REAREAREAQWLRPGAALASGAGNRAREEQPDSERTCFERDRDRIVHSTAFRRLAGKT
                     QVVVYPTDHQRTRLTHALEVAQVATSVARAVGANVPLTEAIALGHDCGHGPGGHASEE
                     AFDAFLPHGFDHGPWGADVALAELNLCAETLDGIRNHSWSRPAPATIEGEIVSWADRI
                     AYCAHDLEDAAAAGIVQLDELPSSVTERLGTGRREQLSVLIRSISHSIVEAGRVGMDA
                     ETAEALAQLRRFNYQQIYTRPESLEQSQAVIAVLQELVAYYIEHPASLPDGFRQDDRV
                     LAAVTYVAGMTDRFAFDQAEKRLGWARWRLPRSMGHGVGPMA"
     CDS             complement(274032..275237)
                     /codon_start=1
                     /gene="dusB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015775729.1"
                     /locus_tag="brsh051_02560"
                     /product="tRNA dihydrouridine synthase DusB"
                     /protein_id="BEH00975.1"
                     /transl_table=11
                     /translation="MQGPSSLESMSATQTTPTRLLPELRLSSPSHPDALVIDTPVVLA
                     PMAGVTNAAYRQLCREQGAGLYVCEMITSRGLVVGDPKTADMLAFWPEEDVRSVQTYG
                     VDPVSLEVAVDILCDGFGVDHIDLNFGCPVPKVTRKGGGGVLPWKLDLVRQIIASTVR
                     TADRYGVPVTVKTRIGIDDRHLTFLDMGRLAEDCGAAAICLHARTVAQAYSGHADWNA
                     ISELVQVVDIPVLGNGDIWEAADAVAMIEQTGCAGVEIGRGCLGRPWLFRDLAAAITG
                     EQETVLPSLGEVCAIVRRHAELLARLWGEEHGMKDLRKHMAWYFKGFPVGGDTRHALG
                     MVSSLAELDALLAQLDGAVPYPTAELGRPRGRQGSPRSKVTMPWGWLDDRCGLELDLS
                     EAELETSGG"
     CDS             complement(275242..276681)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_166233908.1"
                     /locus_tag="brsh051_02570"
                     /product="MFS transporter"
                     /protein_id="BEH00976.1"
                     /transl_table=11
                     /translation="MTGQDVYLAWRGQIAGTPTLEDAMNDPQPEVLNQLPSRAQRLDR
                     LKFGREHGKLLVGSGVGWALDAMDVGLISYVMTALAVHWNLSNTQLSWIGSIGFVGMM
                     IGASVGGLLADRLGRRNVFALTLLIYGIATGMAAFSVGIAMLMALRFVVGLGLGAELP
                     VASTLVSEFAPQRIRGRMVVWLESFWALGWIMAALLGYFLVPQEIAGWPGWRWALLVG
                     LAPAAYALVVRHGLPESVRFLESKGRLIEAEKSVREFEINSGVQPEVDIETAVKHTPV
                     SVEVSTQQRARLFSPGMRRRTIALWAVWFFVNLSYYGAFTWMPTLLFRQGHSLIRSFE
                     YTLIITLAQLPGYAMAAWLIEKWGRRPTLASFLLGSGVAAVLFGIQTSPVGIIVAGCA
                     LSFFNLGAWGALYAIGPEIYPTAMRGTGTGAASAAGRVAAIIAPLCVPLLLNSGGNPL
                     VFGVFGVSFLIAAGSALLLPERRQKEMVE"
     CDS             276783..277523
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391734.1"
                     /locus_tag="brsh051_02580"
                     /product="hypothetical protein"
                     /protein_id="BEH00977.1"
                     /transl_table=11
                     /translation="MQRFRDLLVFESASRLVLACDSIGGIGPKPADSVSVDARTVAHF
                     GVRVPLLEVLCSGARPIALVNALCVERDPTGQEMIDEIEILAAQAGIPADAVTGSTEE
                     NAPTSATGLGITVIGALSQDLPKAQPGDVVICAGLPIAAPDFTLYIGHPDQVTVAEVR
                     RILESGLVHDALPAGSHGVGFETDEMARIAGLQARWTGGRIVDPKRSAGPASCVLFAC
                     APEATDEVIALLDDGRPAQPVARLTPPD"
     CDS             complement(277701..278468)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02590"
                     /product="hypothetical protein"
                     /protein_id="BEH00978.1"
                     /transl_table=11
                     /translation="MRLGLPARLAVLVATTLAVMSFTHPLWNFGVLCVVLGLAVWQRL
                     PVAAVWPLIRASLAVFVLVGFCAAFATSDRVLHDPAHLQVLAQWGPLRFTVGGVLMGG
                     TFVLRMLAMIVATWTAIYQISVDDVLDLAARWRLPSWLSILIGSAMAALPNLARRHEQ
                     IRQAQQARGQRLDSGGPVERWKANAAIVVPLITSSLLTAESLGVALSVRGYGAHRTMT
                     VMHDVVRRPQEVALSILVLALGVCAVAGRLAWGWGRL"
     CDS             complement(278465..280162)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011460552.1"
                     /locus_tag="brsh051_02600"
                     /product="energy-coupling factor transporter ATPase"
                     /protein_id="BEH00979.1"
                     /transl_table=11
                     /translation="MPQDLTVDSVSYRYPSGSRDALHDVSAEFAAGSCTAIMGATEAG
                     KSTLLQALTGVIGELDGGVLSGRIRYGAADLADYRVQTLTQYIGLVLQDPASQIIGRT
                     VGEDVAFGPRNHLVPRAEISRRVAQMLELVGLSGFEARSTAELSGGELQRLAIAGVLA
                     MGPEVLCLDEATAELDPVGAGRLREVVASLRQRGMTVVTAEHDPAAVLDQASGIVVLD
                     AGQVAWQGAPADFFADPDRVERLGIRPLPMSVVARGMLRERPELALTLPVGRRLPLTV
                     AEMSGWLRDLLPAEPRPHPPAPSAQGTGRPVIEIDDLHFGYSPRAEVLHGIHLTIRAG
                     EFVALTGPNGAGKTTVAKHLNGLLRPTAGRVLICGRDVSGRPTWQLAGQVGYVFQNPD
                     HQIFCRSVADEVGFALRVAGRPQAEISARTTAVLQFTGLTDLCEANPLTLTRGQRQLV
                     AMASTLIAEPEILVIDEPTTGQDWRGVQAIMDLVDRLNQQGTTIVMISHDRELIAHHA
                     RRVVTIDGGRVVADGPVQTQVTTQLGELWQQCFGGRPDSCDEITAGRRLVQSCGART"
     CDS             complement(280165..280707)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011460553.1"
                     /locus_tag="brsh051_02610"
                     /product="ECF transporter S component"
                     /protein_id="BEH00980.1"
                     /transl_table=11
                     /translation="MSNVQTGPKLEDRLPDQANRGLSARKLAIMAIFIALSAVGALIK
                     IPSPVGTVALDAAPGFFVAIGFGGWLGAVVAAIGHLLTAGITGFPLTLPVHLAIAVGM
                     AACAWVYGWFGRKGPVGLVIGFVLAVIINAPVLGLIMVPIGGWALYVAALPSLAIGAV
                     VNLAIATLAYQALRKTRLLS"
     CDS             complement(280713..281447)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064405.1"
                     /locus_tag="brsh051_02620"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BEH00981.1"
                     /transl_table=11
                     /translation="MEGAAVGSEPLYLRVERDLASRISDGAWQPGDYLPSEQALQQRY
                     QVSRTTIRKAVGDLVIDGLLEIDRGNGTRVTRGRDHQPDANIMSFSASMRAMGRRPGV
                     RNTHACLCEAEAAEQASSEVVDSSRRLVHISRVHTADDDPVSASESWLPASAFAGVDV
                     EGIAARESLYTELSALDVGITRVSDRYGIAEASQTEAALLDVAPGTPLLCVDRIGYTA
                     NNRPIETSRIVVRTDLYRPTITTRSR"
     CDS             complement(281630..282661)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_148043383.1"
                     /locus_tag="brsh051_02630"
                     /product="hypothetical protein"
                     /protein_id="BEH00982.1"
                     /transl_table=11
                     /translation="MPSDPPAQAGWAAALCWGGGEICLWISERFAFDLPILLGMSTTY
                     RFADLVEQGHDEYSIRTQVRSGELSSVRHGGYALDLDPDSPEARHRALIRTTVPLLND
                     DAVLSHCSAALLWGLPVPRRLLTKVHVTHDRPGGGHVRTWTHTHSSALPSLEIAEVEG
                     LRITSLARTAVDTARLCSNQEALQIVDAAWRMLDTPTDLAAACEMAGRCHGIRAARWA
                     LAHADPRSESPGESLSRYWMIMGKIPTPTLQLEILDPGGNFVARADFAWEEYRVLGEF
                     DGRIKYASSLNGQPLAEVVMREKERENRLRALGWWVYRWTWDDLRHGQRFAADLRRFL
                     DESPFRRTR"
     CDS             complement(282846..284231)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228379.1"
                     /locus_tag="brsh051_02640"
                     /product="glycine--tRNA ligase"
                     /protein_id="BEH00983.1"
                     /transl_table=11
                     /translation="MAESTLDKVINLCKRRGFVFPCGEIYGGTRAAWDYGPLGVELKE
                     NIKRQWWRYMVTGRDDVVGLDSSVILPREVWVASGHVSVFSDPLIECLSCHKRWRADQ
                     IVEEYAHRHGLDEDAVALNEVPCPNCGNRGQYTEPRDFNMMLKTYLGPIEDESGLHYL
                     RPETAQGIFVNFKNVLNATRQKPPFGVAQVGKSFRNEITPGNFIFRTREFEQMEMEFF
                     VEPGTDEQWHQYWIDARKDWYVGLGIAEENLRFYEHPKAKLSHYSKRTVDIEYKFGFA
                     GSDWGELEGIANRTDFDLTTHSKHSGTALEYFDQAKGQHYTPYVIEPAAGLTRSLMAF
                     MVEAYTEDEAPNTKGGVDTRVVLKLDSRLAPVKAAVLPLSRNEALSPKARDVAAELRQ
                     YWNVDFDDAQAIGKRYRRQDEIGTPFCVTVDFDSLDDDAVTIRHRDTMAQERVAISQV
                     RPYLAERLPRC"
     CDS             284467..285405
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976297.1"
                     /locus_tag="brsh051_02650"
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="BEH00984.1"
                     /transl_table=11
                     /translation="MIIMIASRTKRPVRRLAAVLLGAAVLITTACTPSGESGAGDGTS
                     IVVGAYPFQFAAERVAGDLAVVTNLLSPGSDGHDLELSPKQVTAVTNADLVVHQSGYQ
                     AALDETITQQQPARVLDTADFLQLLPATQTEDGHDHGAYDPHVWLNPMNLAEIGGQIA
                     AVLAEIDPDNAASYAANAARLTDDLTGLDDQFSAGLTNCRTDTFITNHAAFGYLADRY
                     HLHQVGISGLSTEAEPSPARIAEVQQIAREHDLTTIFYETAVSPKLAQTIASDLGLKT
                     DVLDPLETLSSESRGDDYIQVMTANLTSLRDANGCQ"
     CDS             285402..286172
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028392.1"
                     /locus_tag="brsh051_02660"
                     /product="metal ABC transporter ATP-binding protein"
                     /protein_id="BEH00985.1"
                     /transl_table=11
                     /translation="MNQPVISARGVDTWLGDQQILFGVDLNVATGEVVALLGGNGSGK
                     TTLLRTLLGLIPHQSGQIELFGQPAARFRDWSRIGYVPQRGRLQVANATVDEVVMLGR
                     LARRRLFRLPGSTDRAACDEAVERVGLTGLGPRPMSQLSGGQQQRALIARALAGRADL
                     LVLDEPFAALDVRTQTSLARLLGRLHQQGLTILVVLHELGAMEPLLERSVVLQLGRVI
                     HDGPLASGPPLDGCHTPDCTDVGRTLEPQLTQVTGGTN"
     CDS             286174..287151
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028393.1"
                     /locus_tag="brsh051_02670"
                     /product="metal ABC transporter permease"
                     /protein_id="BEH00986.1"
                     /transl_table=11
                     /translation="MGMLALDFMVRALIAGALTGVMAPAVGTYIVQRRLSLLGDGLGH
                     VAIAGVGLALLTGRAPVPIAIAVTVVGAVAIELLRQSGRASGDVGLAILFYGGLASGV
                     LMAGLAGQGAGTLSQYLFGSLTSVSNPDLAAVAVMAVVVLITALGLSPQLFAVCADED
                     YARAQGLPTRALNLIIVIMAAVTVAISMRTVGLLLVSALMVVPVATSQNLVLGFRRGL
                     ATAMGLGLILALAGVVASYYLDTATGATIVVLGVIVFVGTLPVNSVLERHRRANRLEA
                     DEERIFERAEPHDSLSDAHLHPAVLHGDHVDYLHDGHRHAPHGDHFDEH"
     CDS             287141..287539
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007449657.1"
                     /locus_tag="brsh051_02680"
                     /product="transcriptional repressor"
                     /protein_id="BEH00987.1"
                     /transl_table=11
                     /translation="MSTEAHPPLPRLTRQRQLILDRLAEADEFLSAQQVYGLLRADGE
                     SIGLATVYRGLQWLVDVGLVDSIRNSEGETTYRRCSPVHHHHLICRRCGRAVEVAGEP
                     LEAWSRQVAAEHGFREPEHFVEVYGICSSC"
     CDS             287914..288102
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02690"
                     /product="hypothetical protein"
                     /protein_id="BEH00988.1"
                     /transl_table=11
                     /translation="MLVGPSTPFAPEVYGGRVDEIGGAWVADAAMAGQLARMGASMRS
                     MKQVFTRFNASFDHGGRE"
     CDS             288099..288461
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02700"
                     /product="hypothetical protein"
                     /protein_id="BEH00989.1"
                     /transl_table=11
                     /translation="MTIPVDVDQLAKVLGRFGPGYLLTLKPPQADGPAVKVHCVDPVF
                     DDGRLLVPCEHRSAIDNAGQDPRVTIVWPPLVHHGHSLIVDGSAAVHRDRLVVDIVGA
                     ILHRPDAHSDGPDWVFGD"
     CDS             288552..289955
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02710"
                     /note="frameshifted, insertion/deletion at around
                     288490,288605,288717"
                     /product="hypothetical protein"
                     /protein_id="BEH00990.1"
                     /transl_table=11
                     /translation="MSNEPTPNPWSRPATPAWDASAPGLDGSGATGTPYPSAPGTPYP
                     SAPSTPYPSAPGTPYPSAPGTPYPNPSGGQYPPGAGASAPAAFTTTSTVAPELPGQAE
                     KSAKAGRGKIAGLMLVALLAGAVGGGAAGYTVTQLGSPAQVTQTEVVQADPSNPDWTT
                     VADSATQAVVAIQVVGSDGTAGQGSGVVIDGAGHIVTNNHVVASSSARSAITVVLGNV
                     AYSATIVGTDPTTDLAVIQLNELPADLEVMGFADLSSVQVGDPVMAIGNPLGLNDTVT
                     TGIVSALNRPVSTRAVTDTPTTQQGEVVVTAAIQTNAAINPGNSGGALVNTSGELVGV
                     TSSIATLSSSSDSQSGNIGLGFAIGADQVQYVAEQLISQGYADHPQVGLSATDESGSG
                     QLGARVVRITQGSPAEQSGVQVGDLITAVDGVPVPSTESLVALVRAGRVGEPIELTLI
                     RGGQTQTVTVTPVAAPR"
     CDS             complement(289979..290719)
                     /codon_start=1
                     /gene="recO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228390.1"
                     /locus_tag="brsh051_02720"
                     /product="DNA repair protein RecO"
                     /protein_id="BEH00991.1"
                     /transl_table=11
                     /translation="MPTYRDHAVVLRTHKLGEADRIITLLSRSHGKVRAVARGVRRTS
                     SKFGGRLEPFSHVDVQFANGRSLDVVTQVETLHAYDGPLRLDYGAFTAGQAMLEAADR
                     LVAEEREPALRQYRLLLGALRTLGEGTPVGPRPATMVLDSYLLRALSVAGYAPALTSC
                     ARCGAEGPHAGFAPETGGMVCVECRPPRTVLPAPPTWQLLSALISGDWQATADVPEAV
                     CQQASGLVAAFASWHLDRGLRSLRLVER"
     CDS             290817..291620
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228389.1"
                     /locus_tag="brsh051_02730"
                     /product="isoprenyl transferase"
                     /protein_id="BEH00992.1"
                     /transl_table=11
                     /translation="MAARVRPAKRAPIPHPSGARPPAIPQSALPKHVAIVMDGNGRWA
                     KQRGLPRTKGHEAGEAVLFEVIEGAIELGIKYLSAYAFSTENWKRSPEEVSFLMGFNR
                     DVIHRRRDDLDALGVKVRWAGRRPKLWASVIRELQDAEEQTEDNDVLTMQFCVNYGGR
                     AEIIDAVRAIARDATAGRINPDRITEKSFRRYLDEPEIPDVDLFVRSSGEQRISNFLI
                     WQSAYAELVFVNKFWPDWDRRDLWAAVERYASRDRRFGGAVPNEWPPGA"
     CDS             291889..294822
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226436.1"
                     /locus_tag="brsh051_02740"
                     /product="glycoside hydrolase family 2 TIM barrel-domain
                     containing protein"
                     /protein_id="BEH00993.1"
                     /transl_table=11
                     /translation="MCWSLDGTWRFHFSPTTSAAPADAAEVDLDDSGWEPIQVPSHFV
                     LTDDSRWGRPIYTNVKFPIPLDPPHVPDANLTGDYRLEFELPGAETTTEGIRPGEPWQ
                     GWRDFQRVLLRFDGVESIGLVHLNGKRVGVVRGSRLRTELDVTDLLRPGRNLLHVRVH
                     QWSAMTYVEDQDQWWLPGIFRSVCLIGRPAGGIDDFWLDAGYDHRTGRGRIVPEITAA
                     DDAWPITLRIDDLHFEQTFASADELLPLDLGEVVAWDCDTPRLYTATLASNGETIEAK
                     IGFRTVRVVGRELLVNGRPLRMRGVNRHEFDPDKGRIVSEERLRADLMMMKQHGMNTV
                     RTSHYPPHPRFLDSCDELGLFVVLENDLETHGFELAGWVGNPTDDPTWTDHLVDRMRR
                     TVERDKNHPSVIIWSLGNESGTGANLAAMSAWTHRRDPGRPVHYEGDHAGRYTDILSR
                     MYPPLEGLEDLSDGLGSALTDIPGQAARQTDRPIMLCEFVHAMGNGPGGVAGYEHLFD
                     TLPGVIGGLVWEWRDHGLRTTINGQPDFGYGGDFGEVFHDATFVIDGLTTPDGHPSPA
                     MAEVAAQFTPIRLEMDQEVVFIRNLRHSADTSDLVFTVVVDGPDGEVGREEMDVPVIE
                     SGDEIAVVLPSVAPSAHERWLSVVASLGDDSAWAPAGHVVARAQVIIEPTHGPAATPR
                     PRPAHLDGWQVGPVTLDPVTGRPSSWAGVPVSESDTTLWRAPTSNDSLRTFGSYELAD
                     VVATRGLGVDAPSSAERWRDAGLDRLVSRLVELRHDGDRITVRRRQAPAQGTWGVEVI
                     EQWTELEGQAALGIDIVPFGRFDCTWPRVGWHLLLPGGYSEASWVGTGPGEAYPDSDA
                     GVWLGSFSADIDDLCFGYIVPQETGHRPNLRRLAISGAGLPTLQVSSSGPHHPGFTLA
                     RHDAHELDAASHCSELGTSRGVHLYLDAAQHGLGSRSCGPDVRPEFQLWAKAVRIDLQ
                     LGVMR"
     CDS             294819..295850
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976006.1"
                     /locus_tag="brsh051_02750"
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="BEH00994.1"
                     /transl_table=11
                     /translation="MSRTTINDIAALAGVSKGTVSRVLNGHPRVSERSQEAVWQAVTQ
                     TGYRANVHARSLATGRNNAIALLIAAASEQLFNDPTFAELIEGVRDGLLDSDLSLVIL
                     MGGSEIEDHRTVSYIKAGHVDGLIHLNPFIDDPITAGLADSALPLVLCGPRPPIPLPR
                     RNWLVTMDDVGGVRQALDHLASRGARTIAMIGGDPRGVSAGIRFQAYRDWLGPNFDPD
                     LFEPGDYGTGSGNVAFGRLPDRRPGIDALFCASDRMAIGALETAYRRGRHVPGDLLVM
                     GFDDHQIAAQADPPLSTIHQPIREIGRTAASTLLAAMAGETPSDKIFPTQLVVRGSTW
                     PQSTPTDSH"
     tRNA            295406..295496
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00070"
                     /product="tRNA-Gly"
     CDS             295885..297195
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010968184.1"
                     /locus_tag="brsh051_02760"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BEH00995.1"
                     /transl_table=11
                     /translation="MSHLKPTGSLPSFSRRTLIRGALAAGLASTGAGSLVACGGGGGS
                     SSGGGTVGGEVTLGVYQGDEVPRKAMQAMIDGYAHGSNVKINFVDHETFKNNINNYLQ
                     GNPDDVFTWFAGYRARFFAQNGLVSDLSDIWKNFDGMPESMKNASSTTDGKQILVPST
                     YYPWGVFYRPSVWQARGYTEPNSKAEWLTLCEKMKADGIIPLAFANKGGWESMGTFDM
                     MNLRVNGYDFHVSLMAGQEAWDGEKVKNVFKTWSEFTPFEQPDANGRTWQEGAQALIN
                     EQAGMMTLGMFIGQQFETTQYADDLDFFIFPEFDPAIGADVVEAPIDGFMMAAKPKNE
                     AGAKDLLTYLASPEAVNITLQFDPSVIGANSNADQTAYSALQKKAVQIIGEAKNISQF
                     LDRDTRPDFASTVVGPALQSFIQNPADIDKILANVEQQKKSIFG"
     CDS             297228..298169
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003722709.1"
                     /locus_tag="brsh051_02770"
                     /product="sugar ABC transporter permease"
                     /protein_id="BEH00996.1"
                     /transl_table=11
                     /translation="MSTAQPATQAGTGAPAGGGKVKLRHQRMNSQDRTTVVLMAAIPT
                     VLVLGLVWFPAISSVILSFTDWNGIGPLSDINFIGFKNYVDIFTIYPPFWPALQHNLM
                     WLISLFLIFTPLGMLLAVLVDREIRASRFYQTSFYLPVVLAGALIGFIWQLLFSRDQG
                     LINAVLGTTIDWYGNPEVNIYAAMIANGWRHTGYIMLLYLAGLKGVDPAIHEAASIDG
                     ASQMQTFFRVTFPVMRPTNIIVMVITFIDALRAFDLVWIINQGRNGLELIATLVTANV
                     IGEASRIGFGSALAALMLLLSSIFIIIQLRIMVKGDD"
     CDS             298171..299091
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004524829.1"
                     /locus_tag="brsh051_02780"
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="BEH00997.1"
                     /transl_table=11
                     /translation="MATTTTAPVNATGWDGDIELRKRKVSPGRVALYVFLTIMALMWL
                     FPMLWAVYNSLRDYGYTLEHGYVSFGGFTLENFPNAWRRGGFATSFGNSAVITIAAVV
                     FTLAASSCMAFVLARVKFRFNFAMLAVFVAANLLPPQSLLIPVYRMFRWVQLPAWLSD
                     SGSLLNTHAGVILINVAFQTGFCTFVLRNYMIGLPKAMYEAAEIDGASLWRQFYGITL
                     PLIRPALAALATLQVAWIYNEFFWATVLLQSGDKMPVTSSLNNLKGTFFTDFNLLSAG
                     SIIAALPVLVIFFVLQKQFVSGLTLGSDKG"
     CDS             299102..299272
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02790"
                     /product="hypothetical protein"
                     /protein_id="BEH00998.1"
                     /transl_table=11
                     /translation="MGRRAAVGGPASCALVALFGTELMPADLVAAGAQPVSGRVLVRA
                     LIDSGLRVRKAG"
     CDS             complement(299280..300098)
                     /codon_start=1
                     /gene="folP_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012296421.1"
                     /locus_tag="brsh051_02800"
                     /product="dihydropteroate synthase"
                     /protein_id="BEH00999.1"
                     /transl_table=11
                     /translation="MGIINRTPDSFYPPARHLELDDALSRAASMISEGVDIIDVGGVR
                     AGQEGDWVTEAVEIDRVRPFLVALRLAHPELLISLDTWRAEVADACAGLVDLVNDTWA
                     GADAGLVAVAAEQGAGYVVSHTGGLAPRTDPTGVYYGPGDGVVEHVLSGLAEGAKRAV
                     SAGVASEAVLVDPTLDFGKRTVDSLRLVAATGRFLALGHPVLMAISRKDFVGETLDLP
                     ADERLEGTLAATAVAAWQGATVFRAHDVRATRRVVDMVASIRGDRAPLRSERGS"
     CDS             complement(300263..302044)
                     /codon_start=1
                     /gene="leuA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976275.1"
                     /locus_tag="brsh051_02810"
                     /product="2-isopropylmalate synthase"
                     /protein_id="BEH01000.1"
                     /transl_table=11
                     /translation="MTTEIRSTPKPRTKPQPRPVQQPSPMPFQRYQPFQPIVLSDRTW
                     PAKSVTKAPRWLSTDLRDGNQALIDPMTPGRKRKLFDLLVQMGYKEIEVGFPSASQTD
                     FDFVRSLIESDAIPDDVTISVLTQARPDLIDRTAQSLIGAKRGTIHLYNAVAELFRRV
                     VFHMDEQECKQLAKNGTRWVIDAAEKYLRDVEFGYEYSPEIFTQTPTEFAVEVCNGVI
                     DVWQPDADREIILNLPATVEMSTPNTYADQIEYFCRNIDSRDSVCVSLHTHNDRGTAV
                     AATEFGLMAGADRVEGCLFGHGERTGNVDLVTLGMNLYTQGIDPKIDFSRLDEVRRTV
                     EYCTGMPVPARQPYSGDLVYTAFSGSHQDAIKKGLEDLETKAERERVGIHEVAWQAPY
                     LPVDPHDVGRTYEAVIRVNSQSGKGGMAYLMKADHSLVLPRRLQMEFSRVVQQHSDSE
                     GGEVTSEQLWQIFSDEYLNRTEPLKGKGFTLETTEDGRATIKARISSHGVEKVITGEG
                     NGPVSAFVDALGNVGVRLRVLDYNEHALTAGGDATAAAYVECEIENGDIEVHWGVGID
                     PDITTASLKAVMSAVNRHRREAYAVAM"
     CDS             302376..303857
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011969872.1"
                     /locus_tag="brsh051_02820"
                     /product="mannitol dehydrogenase family protein"
                     /protein_id="BEH01001.1"
                     /transl_table=11
                     /translation="MYMANLNRSNFPVERRIGASAPDATGIVHLGIGQFHRAHAAVNT
                     ALAMAEAGGDWGIVGVANRSRRIIDPMLNQDFIYSILQLSPEGTDVQLVDVHRRLFVA
                     AEQPAEVLAAIADPNHKIVTLTITEKGYNKDGVTGHLMTDSAEIAPGLAGPDGAKAPL
                     AQLAWGLVKRSQESKAPVTVLSCDNMQSAGNTTKAMVTEFLQAAGVDDNTMSWIAENV
                     SFPNAMVDRIVPGTTEQTKAQVEQILGLRDEAPVPAEAFTMWVLEDHFKAGRPAWQAA
                     PGVTFSDEVEQYELVKLRLLNGSHSLISYLGGLSNSPTIPSARDKEFVAKSVHAAIYN
                     EFLPSIELPHGFDADAYVAQLFHRWQNHALGDKTARVGSDGSAKLLQRIPEPALRLLN
                     MGQMPNEMALTAASWIACVAPPAGFDPGEIAAEMEEPQRENLAKATAGAKNTHEHVEK
                     IMTGGFFPTELGEHAEFTDRVAELLDIIVTDGVEAAANNALGE"
     CDS             complement(303992..304933)
                     /codon_start=1
                     /gene="era"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_016326176.1"
                     /locus_tag="brsh051_02830"
                     /product="GTPase Era"
                     /protein_id="BEH01002.1"
                     /transl_table=11
                     /translation="MTEQVATPEGFKSGFVCFVGRPNAGKSTLTNALVGSKVAITSSK
                     PQTTRHAVRGIISRPDAQLVIIDTPGLSKPRSLLQERLNDLVYATWSEVDVIAIIFPA
                     NQHVGPGDEYLVREVASLPHPPRLAAICSKTDLVSPERVAKQLLEIAALQEKAGLTFD
                     EIVPCSALSGGQVDEVADVLISMLDEGPAYYPDGEVTDEPTETLVGELIREAALEGVR
                     DELPHSIAVEIDEMGLRAGRPDDRPLLDIYASLVVERDSQKPIMIGRGGEHIKQVGTD
                     ARRQISALLGTPVHLDLKVKVLKEWQRDPRHLNRLGF"
     CDS             complement(304926..306227)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003895866.1"
                     /locus_tag="brsh051_02840"
                     /product="hemolysin family protein"
                     /protein_id="BEH01003.1"
                     /transl_table=11
                     /translation="MATIEGWTVTGLDWVMVGCAVLAAVLAGVGSAVETALVSITPTR
                     AEQMVADGKRGAAAVKQITDDPAPETTTAAFLRVACEVTSVVLVCLVLVDNFHGLGAR
                     LWLTVLIMTLVAFVVWGVAPRTLGRQNAEGIAGASARILSVLSVILWPISQLLIWVGN
                     AITPGHGYADGPFIAEAEKIAGASEGEREMIRSVFELGDTIVREVMVPRTDVVYLNRD
                     KTLRQGLSLALRSGFSRIPVIGEDLDDVVGVLYVKDLMRRVYDNPDADKRETVGSLMR
                     PASFTPDSKPIDDLMREMQTSRHHMVIVIDEFGGTAGVATIEDIVEEIVGEITDEYDA
                     EPDMAEEVEPGVWRISARMPVDDMGDLFGLQLEDEDVETVGGLLAKELNMVPIFGSQI
                     IWNGLEITAEKSTGRRHQIDTVLVRRAAVEDDDESGDNDDD"
     CDS             complement(306200..306658)
                     /codon_start=1
                     /gene="ybeY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976270.1"
                     /locus_tag="brsh051_02850"
                     /product="rRNA maturation RNase YbeY"
                     /protein_id="BEH01004.1"
                     /transl_table=11
                     /translation="MIEVNNESGAEVDELALVQLAEFALARLRIHPQAELSILLIDPD
                     AMAELHQRFMDLPGPTDVMSFPMDELRAPEPGQEPPRGMLGDIVICPQFTSAQAPENG
                     REPAEEIQYLLIHGLLHLLGHDHGEPAEKAVMFGLNDTIIAEWRRSRAGQ"
     CDS             complement(306655..307644)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976271.1"
                     /locus_tag="brsh051_02860"
                     /product="PhoH family protein"
                     /protein_id="BEH01005.1"
                     /transl_table=11
                     /translation="MPGSRTFVVPASIDMVNVLGPRDEFLRIMERELAADIHVRGNEF
                     TLTGTTSDIAAATEALTEVITILRTGQGLSTETVERVIAMGADGVRPAEILTQDILSS
                     RGRTIRPKTLNQKRYVDAIDKHTITFGIGPAGTGKTYLAMAKAVQALQSKQVTRIILT
                     RPAIEAGERLGFLPGTLNDKIDPYLRPLYDALHDMLDPESLPKLLTGGVIEVAPLAYM
                     RGRTLNDAFIVLDEAQNTSMEQMKMFLTRLGFGSKIVVTGDTTQVDLPGGVRSGLRAV
                     QGILDGVRDIAFCQLTKRDVVRHKLVGDIVAAYDRYDSTLAEAFTSRGQRGTR"
     CDS             complement(307794..308264)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027611.1"
                     /locus_tag="brsh051_02870"
                     /product="DUF5709 domain-containing protein"
                     /protein_id="BEH01006.1"
                     /transl_table=11
                     /translation="MTENMAHSEDAPEPSVQMEQLSQSDSLINRGVDDVLDEGYTAPD
                     NWSPAQGFGNTPAEMRQGETLEQRIAQEEPEENPKKLRGPWNPNRENRQVGSARAGRL
                     ISAGGGIDAEDTEAQSVAADVGISGGAASAEEAAVHIISEEDLENPGDDEDDES"
     CDS             complement(308334..309338)
                     /codon_start=1
                     /gene="hemH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004527679.1"
                     /locus_tag="brsh051_02880"
                     /product="ferrochelatase"
                     /protein_id="BEH01007.1"
                     /transl_table=11
                     /translation="MPGTVTLLVNTGTPDSPDKTAVKEYLSEFLNDPYMMGMPDAVRR
                     VLVDKIIVPGRVGGSAARYRDLFAQAGGRSPLAVHSEALAVRLSTELGHPVVPFMRYG
                     HPGIDDVVDQLAGADQIVVAPMFPHETYSSYTSAAEYAIEQVSARCPQARLRLLRPYY
                     DHPGYIDSLATSVRPYFTDDYDLMVISFHSIPVSHQVRGARTGMDYEQQCRSTAHLLA
                     KAVGVPDDKLRVTFQSAIKPMKWLEPALETECVAWARDGAQRVLVVCPGFAVDCLETV
                     YDIGSKLAKTFTSAGGAEFTLVPALNAQEHWAQALAGILRSDLVQPVGNSSDGSTARV
                     "
     CDS             complement(309323..310621)
                     /codon_start=1
                     /gene="tgt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005112950.1"
                     /locus_tag="brsh051_02890"
                     /product="tRNA guanosine(34) transglycosylase Tgt"
                     /protein_id="BEH01008.1"
                     /transl_table=11
                     /translation="MTSEPPSPDDFGFRVDARLPNGLGRAGVIRTPHGQIETPAFIVV
                     GTKANVKAVLPEQIAQLGGQAVLANAFHLYLQPGSDIVDEAGGVGAFMNWPGPTFTDS
                     GGFQVMSLGAGFKKVLAMDVTGLQNDEVIAEGKQRQAHVDDDGVWFNSPINGDRHRFT
                     PEISMTVQHQLGADIIFAFDELTTLLNTRGYQETSVQRTQAWAQRCLVAQRELTAQRA
                     HRPYQALFGVVQGAQYEDLRRQACRGLLATEADGQHFDGYGIGGALEKQRLGEIVSWC
                     TSELPEDKPRHLLGISEPDDFFAAIAAGIDTFDCVNPSRVARNAAIYTADGRYNVTTA
                     ANRRAFVPLEDGCDCYTCTHYTRAYLHHLFKAKEMLAATLATIHNERFTVRLVDTIRA
                     ALVSGDFEGCRTEVLGRFYGSVPSIKSDSHDLRRPTCPAL"
     CDS             complement(310611..311516)
                     /codon_start=1
                     /gene="tatC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977194.1"
                     /locus_tag="brsh051_02900"
                     /product="twin-arginine translocase subunit TatC"
                     /protein_id="BEH01009.1"
                     /transl_table=11
                     /translation="MSTDTSTSGKPGGRFAWLKPPQFDENGAMSIWDHLREIRYRLIV
                     SMVAIVVLFIVAFIFYAPIVELILRPYQIAADRVSAKNPDAMIQVVNSGVASPMLLAL
                     KAAGLAAIIAACPVWLYQLWAFIVPGLLNNEKRVAQLFLLSAIPLFLAGVVVGYLTLP
                     KAFEFMLGFTVAQAGVANLQDLNDFLSLEMRMLLVFGISFLLPVILVMLNMLGMLKSW
                     QLRKARTIAIFVCFVFGAVATPSGDPFSMLALSLPMVIMYVVSELICSRREKRSLKLR
                     IRSGEISPEEAEAAYLGKTIQTDDK"
     CDS             complement(311526..311912)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02910"
                     /product="hypothetical protein"
                     /protein_id="BEH01010.1"
                     /transl_table=11
                     /translation="MGSIGWPELIIILIVVLLLFGGTRLAGLGKASGKAIREFKEETR
                     DLKKEDSAAAQQPQITAAPQQPAPQVQQPYVQPAPQPPQAYDPAQPQPQFPQQAPQAQ
                     PYPSQSQPVYDPQQAPQNQQPPADQR"
     CDS             complement(312028..312948)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005080095.1"
                     /locus_tag="brsh051_02920"
                     /product="YafY family protein"
                     /protein_id="BEH01011.1"
                     /transl_table=11
                     /translation="MLAMVPYLQAHPGIGVAEVAADYGITRRQLLADLNVLWMCGLPG
                     GLPDDLIEIDMDAAESEGVIHLSNADYLSRPMRFTPDEAVALLVALQAVAEMTTGPVR
                     EAARSAARKLSEATGQQDLVWLSVSTGDERIRETLASAIDRRQRVRLTYDGAARGVTS
                     YPEVDPAEIQMRDSIAYLQAWSLERQDWRTYRLDRIADVALTGQSADKHGSAPELPEG
                     WFDQSNGEVTLELAASATWVVDYYPAREIQNHPDGSATVRFAVADPAWLDSLLLRLGD
                     QARVRSPEGVGSAAAAAAREAIERTETLFG"
     CDS             complement(312972..313955)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027895.1"
                     /locus_tag="brsh051_02930"
                     /product="WYL domain-containing protein"
                     /protein_id="BEH01012.1"
                     /transl_table=11
                     /translation="MAARKTERLVNLTILLLSSRRFVPREKIRETVEGYRGLGDESFN
                     RAFERDKDELRAMGIPVETGSDERFFDDEPGYRIVRTDFELPPIEFTGEEAMVLGLAA
                     TVWQQASVADQTSHALAKLRAAGVDPDPSRLRALAPRLSAREAAFDPLWQAMIDRQTA
                     QFDYKSGQRRTVQPWRLVLRNNSTYLLAFDCDRQAPRMFKLSRISGTVSTIGRPGAFV
                     PPDDAALSGHVDALIPKSDLEVVLAIRTERAPALRRRAEQVASSIELPAGFEAYRLQL
                     NAANAVAEIASHGADVIVLEPAGLRAGVLDQLREVVAAHADTPLRAVGEQP"
     CDS             314016..314930
                     /codon_start=1
                     /gene="gluQRS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012803860.1"
                     /locus_tag="brsh051_02940"
                     /product="tRNA glutamyl-Q(34) synthetase GluQRS"
                     /protein_id="BEH01013.1"
                     /transl_table=11
                     /translation="MTTGRFAPSPTSDLHLGNLRTAVLAWLLARDDAGAFLLRIEDLD
                     QQRVAAAPQVAQRQLTDLAALGIDWDGEVVRQSQRLDLYRDAAAGLETYECYCTRREI
                     AEASQAPHGSYRPYPGTCAHLTRSERAARRAVRPAAIRVRAHGAAMTVHDLHAGEVSG
                     EVDDFVLFRADGTPAYNLAVVVDDGLQGVTQVCRGADLLDSAPRQAWLARELGFVPPS
                     YAHVGLAVNRVGERLAKRDGAVTLSELESSGLSGRQVFETICRSAGLPAAGSAPELLD
                     AVRGRDWWTIEAIWRPWVVDARAIIDRR"
     CDS             complement(314944..315900)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02950"
                     /product="hypothetical protein"
                     /protein_id="BEH01014.1"
                     /transl_table=11
                     /translation="MTLAACGGSDTDDSPSPTPSDTPASATPSATPTVDPTVLTDLSS
                     IDVTGDWGTEPTVNAPYPFKVDETMTKVVIQGTGTEVPSATATVNMHYVGINARSGSV
                     FDSSWISGAPTTFQLSGVITGFAKGIVGQRVGSRLAIAITSSEAYDPNGQASIGVDPG
                     DTLLFVVDILDSELAGPVGSTVTPPDGLPVVTETADGVPQISIPAGLAEPTEVGVQPL
                     IQGSGAALQATDALTSHAVCVTWDGTEYYNDYGSASVTDAASAAVHQALFNALVGQQV
                     GSRVLVTLPGSVAYPTGNRTPSIAPNTSVACVVDLLFTQAYS"
     CDS             complement(316013..316756)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003408439.1"
                     /locus_tag="brsh051_02960"
                     /product="pseudouridine synthase"
                     /protein_id="BEH01015.1"
                     /transl_table=11
                     /translation="MTDDPTEGLRLQKALAQAGVASRRASEELIAEGRVEVNGRVITE
                     QGTRVDPERDVIRVDGSRIPPPRRHLYLVLNKPRGVISTMDDPQGRPSLQQYVPRHQR
                     LFHVGRLDTDTDGLLILTNDGEFANQLAHPSHEVPKTYLVEVEGLLDNKTLRRLEKGV
                     TLEDGPIKADKLKLVQRAASRSLVQITLHSGRNRIVRRMMDAVGHPVRQLSRIAIGPV
                     RLGQLQSGQTRELTQAELGALLDVIDHQG"
     CDS             complement(316737..317351)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02970"
                     /product="hypothetical protein"
                     /protein_id="BEH01016.1"
                     /transl_table=11
                     /translation="MSEITEAATGVQPELEALLLLATEPLPVVVLAETVRQPESVVTE
                     ALVDLKDFYDRTGRGFQLREVAGGWQYATRPEQADLISRWVVEGLQNRLSQASMETLA
                     VIAYSQPVARSRVSAVRGVNVDGVVRTLIARGLIAEQDRDESTGAGLLCTTDYFLERL
                     GLASLDDLPPIAPHLPEAADLAAELSALAIIPDNVEKTDDRRPN"
     CDS             complement(317344..318189)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_02980"
                     /product="hypothetical protein"
                     /protein_id="BEH01017.1"
                     /transl_table=11
                     /translation="MTSPQPASEPDGSFLLRLTNFEGPFDLLLQLIGRRQLDITEVAL
                     SQVTDEFIAHVKVGGEVWDLEQTSSFLVVAATLLDLKAARLLPSGEVEDQDDLAVLEA
                     RDLLFARLLQYRAYKQISAWFADRMAAEALVRSRPGGLEDQFRRLLPEVTIPGGPARL
                     AKLAERAFTREAEQQMPLSQLHLPQISVAAQAGIIAARMRAARTLTFRALTQDATRLE
                     CVARFLALLELFRQAQVSFEQLSPLGELTIRWTGQESGEIEISDEFDLPAVQDNQERT
                     PEPNE"
     CDS             complement(318186..318515)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013227803.1"
                     /locus_tag="brsh051_02990"
                     /product="hypothetical protein"
                     /protein_id="BEH01018.1"
                     /transl_table=11
                     /translation="MPRRVSLPGADELFRGQAETPMPDVPASASPPPMKVPAGPTGRI
                     RHDEKITVYVSTEELLNLEQIRLRLRAEYGINVDRGRLVRVAIGMLADELQTGGDDSA
                     ALQRLQQ"
     CDS             complement(318500..319426)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977053.1"
                     /locus_tag="brsh051_03000"
                     /product="ParA family protein"
                     /protein_id="BEH01019.1"
                     /transl_table=11
                     /translation="MNNRSTRADDGLFEVETSEDVEPVEPESELGPTGRPLPDLPEPT
                     PPEPGPKHAIIISMTNQKGGVGKTTSTINLGAALAETGRRVLLVDFDPQGSLSVGLGV
                     NPHNLDQSIYNLLLSREYSFDEIVLSTATEGMDLLPANIDLSAAEVQLVSEVAREQSL
                     KRVLDRIRDRYDFILIDCAPSLGLLTVNALTASDKVIIPLECEFFALRGVALLTDTIS
                     KVIDRLNPDLEMIGILATMYDSRTLHSREVLQRVLEAFGDSVFHTVIRRTVKFPETTV
                     AGEPITSYAPTSPGAEAYRMLAREVLVRCHAG"
     CDS             319747..321021
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011337850.1"
                     /locus_tag="brsh051_03010"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BEH01020.1"
                     /transl_table=11
                     /translation="MNIQRRRVSTRSAILRTTAVAGIAALALSACSGGETSGGSSPTG
                     AAGDLDLKVGTIFPQTGSLATLGPPEIAGVDLAVKDINDAAQGLSVQVTHTDSGDTTT
                     NIATQSATSLLSQGMSAIVGAASSGVSMTIIDQITGAGVVQISPANTSPDFTDYDDDG
                     YYWRTAPSDVLQGQILGNKILEDGKTKVGVLYMNDPYGIGLAQNLVKTLEAGGATVSS
                     NITYDPSASNFTSEVGQVLAQSPDAVAVIGFEESKIIFSNLATEGFDFANLYGTDGNY
                     GQLAPGDQPDIAGAQFTSPGVKATDDFQARLQELVASQGASPLNVFSYAAEAYDATVL
                     TALAALQGGATDGQTIRDNLQSVSEGGTKCTTFGDCAELLASGTDIDYDGLSGPITFD
                     ANGDVTEATISIYKYSAGNESAWVDQVSGTLS"
     CDS             complement(321278..322024)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011055908.1"
                     /locus_tag="brsh051_03020"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH01021.1"
                     /transl_table=11
                     /translation="MTTTPQPVLKVENLVAGYVPEVNILNGTNAYVGKGELVGIIGPN
                     GAGKSTLLKAIFGLVTIRSGFVTLNGKDITGLRANRLVSKGVGFVPQTENVFESLTIA
                     ENLQMGCYQNPSLYPSRLDFVVTLFPELKKRLGQRAGSLSGGERQMVAMSRALMMDPH
                     VLLLDEPSAGLSPVRQDETFLNVARINAAGVSVMMVEQNARRCLQICDRGYVLDMGRD
                     AYVNTGHELLNDPNVIQLYLGTLAADHKAG"
     CDS             complement(322021..322986)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_073601368.1"
                     /locus_tag="brsh051_03030"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH01022.1"
                     /transl_table=11
                     /translation="MADDIAAERASLDETAIEESAADAYPLPDPLWKGDIGPGCAKVD
                     PILIADSVRKTFGGLVAVDVEHVEIPRHAITALIGPNGAGKTTFFNLLTGFDKPDSGS
                     WEFDGTDLAGVPAWKIARRGEVRTFQLTKAFGGLSVIDSMKLGARDQLGESFWACLIP
                     PLWRAQERGIEERALELLKQFKLYEKRDDLALSMSGGQRKLLEMARALMSAPQLVMLD
                     EPMAGVNPALTQSLLGHIVRLKQQGMTVVFVEHDMHMVQAIADWVVVMAEGRVVAEGK
                     PTEVMKDPVVVDAYLGANMDRDLGEVVKEIRASYAASRPEGGSAQ"
     CDS             complement(322979..323959)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391162.1"
                     /locus_tag="brsh051_03040"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BEH01023.1"
                     /transl_table=11
                     /translation="MMNWNFLWVALSELITPQTAAYALAALGLAVHFGYTGLLNFGQA
                     GFMAVGGYAFAMCAVTFNQPFWVCILAAVLGSVLLALLLGVPTLRLRADYLSIVTIGT
                     AEIVRLVVRSPEMGTWTGGSTGINRSGASFFAMNPLPDDLSWTLGTIRYNSDAIWVRL
                     VAWTVVVLAGLFVWQIMRSPWGRVVTGIRENEDAVRALGKNVFAYKMQVLVIGGVLAG
                     VGAIFAIMPTSLQPDNYGTQTTFFLWAILLLGGAATVLGPIVGAMIFWALLALTDGIV
                     AAGVSTGVLPITTLQSGQIRYMMVGLAIMLLVIFRPQGIFGRKSEVLFNG"
     CDS             complement(323975..325351)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03050"
                     /product="hypothetical protein"
                     /protein_id="BEH01024.1"
                     /transl_table=11
                     /translation="MAPTVRNRIAFLSIISALVFAVCGLIAASPARAAADTIRVTVTY
                     EGQPVPGVDVVVSGTSGDSSGTTDAAGRIELEVSGTGLYTIAVDPATLPEGVPAPSAP
                     LEFNKISSGSSFVVLKLGEDATTGSSASSPSSSASSASASPTPGGTDTSGTGNGEATT
                     QDTGSFGHQLATKVVRGVIFGLILALAAIGVSLIYGTTGLNNFAHGELVSFGGFVAYV
                     AMTSSAGMNGWAAMLLALMAGAGFGWLQNATIWHPLRKKRVGLIQIMIVSIGLSLLLR
                     YIYAFIFGPNRLVMPQSFDAVATPFGVPVSYWGLWGSVLCLVLLAAVVLILERTRLGK
                     SIRAVADNKMLAATAGIAVERVILMVWMGGAALAAVSGVLVAFYQTLSFQGGAQILLL
                     IFAAVTLGGLGSAYGALVGALILSLFVELSTFIIPTSMKNVAAMIVMIAILLIRPSGI
                     LGKAQRVG"
     CDS             complement(325560..326285)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013230540.1"
                     /locus_tag="brsh051_03060"
                     /product="VIT family protein"
                     /protein_id="BEH01025.1"
                     /transl_table=11
                     /translation="MARPRARHPHSGEQHIGSVDQRLNWLRAGVLGANDGIVSTAGVV
                     IGVAGATSQPLAIATAGIAALVAGAFSMAGGEYVSVSTQRDTERALLAKEQQELNTMP
                     AAELQELTDIYIDRGVSPDVAALVAKDLTAHNALQAHADAELGIDPDDLTNPWAAAIS
                     SLTAFSLGAMIPLIAIVLPVSHAEWICVAAVVIALAVTGWVSARLGGAPAGPALLRNI
                     GMGLLTMAVTFGVGHLFGTAVGI"
     CDS             326578..327339
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03070"
                     /product="hypothetical protein"
                     /protein_id="BEH01026.1"
                     /transl_table=11
                     /translation="MARTSGTSSDSADNTDTSRPAVKEGGIRVSDILAGGLASAIAAV
                     VGGTLGAVGSVVSAFVVSIVAGITLPLLRRPLRTGEEKLHHLAANGHGTAAQSSKDAT
                     HAKGESNAKGQRTKADSATRRHRIHVAVVTTLIAFVLAFGVIFAIQAFFGHSLSTGTG
                     QLQQQVSRSDPTDDSTDDSLPTTSQLPSASSPAATQTSSPRPAGTATTRTTNPATTST
                     TTEASAPPTSAQAPASAQAEDTSRQQGPTSNTTGG"
     CDS             complement(327362..327988)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03080"
                     /product="hypothetical protein"
                     /protein_id="BEH01027.1"
                     /transl_table=11
                     /translation="MVAMDGFTGFKTATVEELPDAATVMDPFHVVRLAGDALDGCRRR
                     IQHTLHGHRGRASDPLYRARRTLHTGVELLTTKQHARLNALFTGDDHVELEATWGVYQ
                     EMIAAYREPEPATGRTRMDKLIATISARVPRALQEVITLGRTLKKRSADILAYFDRPH
                     TSNGPTEAINGRLEHLRGSALGFQNLTHYIARSLLETGGFRPRLHPRL"
     CDS             complement(328007..329503)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011726646.1"
                     /locus_tag="brsh051_03090"
                     /product="IS1634-like element IS1549 family transposase"
                     /protein_id="BEH01028.1"
                     /transl_table=11
                     /translation="MAYVRTVITGSGATAVQIVWKSVRGSRDIEHVGSAHSPAEVEML
                     KASAVQRIAAGQDPLPLDQPVDDGPRIQVVGMRMGLLLDAIAQVYRWLGLDKASGGDL
                     VFEHLVTARIIEPSSKQDAARVLAEAGVGSMSYRTVKRRLPTFAEPAFRRRLSGAVSA
                     RSDLGPAALVLYDVTTLWFETDTGDGFREPGFSKERRLEPQITVGLLTDATGAPLMIE
                     AFEGNRAETKTMIPLIRGFVEAHGIADVVVVADAGMMSEQNLKDIEDAGWSFIVGGKI
                     PEIPYAISQWRKHHPDAEPPDQLVVSQKLVHGVKADTRHRMVYFQYRAARARRTLHGV
                     DQQLAKAANAVAGKAPVKRNRFITLSGARPSINRELETKVRTLAGWKSYVTNLDKPAE
                     FVIGAYHQLWHVEHAFRMSKSDLKARPVYHHKKESIDAHLAVVFAALAVSHHIEQATG
                     WTIKRFVRTFRQYRDVTLSVAGQTITASQPIPADEADTLTKIKNSDAH"
     CDS             complement(329572..330201)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03100"
                     /product="hypothetical protein"
                     /protein_id="BEH01029.1"
                     /transl_table=11
                     /translation="MWRQDTTAAAEPRAKLSRAGLRWALEAIVCQHLSMARVAEGLQV
                     SWNTANDAVLAEGHRVLIADPHRFDGVTTVGVDEHVWRHTRRGDKYVTVIIDLTPVRQ
                     DTGSARLLDMIEGRSKQVFKTWLADRPKAWRDAVDVVAMDGFTGFKTATVEELPDAAT
                     VMDPFHVVRLAGDALDGCRRRIQHTLHGHRGRASDPLYPDLGHDSRFRC"
     rRNA            complement(330795..330906)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="brsh051_r00010"
                     /product="5S ribosomal RNA"
     rRNA            complement(331007..334091)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="brsh051_r00020"
                     /product="23S ribosomal RNA"
     rRNA            complement(334434..335948)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="brsh051_r00030"
                     /product="16S ribosomal RNA"
     CDS             complement(336688..337956)
                     /codon_start=1
                     /gene="tyrS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027993.1"
                     /locus_tag="brsh051_03110"
                     /product="tyrosine--tRNA ligase"
                     /protein_id="BEH01030.1"
                     /transl_table=11
                     /translation="MNALLDELTWRGFVAESTDVDALAAHLDSGPVTSYVGFDPTAAS
                     LHIGHLMQLLVARRFQEAGHRPILLVGGATGLIGDPKMTGERVMNETDVVHEWAERLR
                     AQVSRFVSFEGSNAAIVENNYSWTSQMSALDFLREVGKHFSVNRMLARDVVARRLTDG
                     ISYTEFSYVLLQSLDYRELYRRHGATLQTGAQDQWGNITAGIDYIRRTEGATVHGLVT
                     PLLTKADGTKFGKTESGAVWIDPELTSPFAFHQFWLNAEDAKVIDYLKIFSWRSRDEI
                     EELALETAQAPHKRAAQRALADDITDLVHGRPEREAAELAGRALFGRGDLAELPDSTL
                     TAVMSEVQAAEIAPIDGQLPLVADVLAASGVVSSKSAARRAIAEGGAYLNNQKVTDVE
                     ARLTNDDLLAGRWVLLRRGKRTVGSVKLVG"
     CDS             complement(337986..339338)
                     /codon_start=1
                     /gene="argH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011729312.1"
                     /locus_tag="brsh051_03120"
                     /product="argininosuccinate lyase"
                     /protein_id="BEH01031.1"
                     /transl_table=11
                     /translation="MFALSVSTHFDWRLALDDLDGSIAHAAALHRAGLLTDEDHEAMV
                     AALQQLRADVARGAVTADPGDEDVHGALERLLIERIGPQLGGRLRAGRSRNDQIATLI
                     RRWLRREIRLLTLDVLGVVEALRDQANAHLGAIMPGRTHMQTAQPVLLSHQLLAHAWP
                     LLRDIARLQDLDKRAAVSPYGSAALAGTSLGLDPELVATDLGFDSSVPNSIDGTAARD
                     VIVEASYVLAQVGVDLSRLSEDVIIWVTPEFGFAKLDDAWSTGSSIMPQKKNPDVAEL
                     ARGKAGRLIGNVSGLLATCKGLPLAYNRDLQEDKEPLFDSVDQLHVLLPAVAGMVGTL
                     RFDADRMAQAAPRGFSLATDMADWLVRRGVPFARAHDIAGAAVQFCEGAGIGLADLTP
                     EQLSEIAPELTPQVLDVLTIEGSVASRNGRGGTAPDRVREQIAELGATAAAAAAWAKA
                     "
     CDS             complement(339463..339996)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776177.1"
                     /locus_tag="brsh051_03130"
                     /product="arginine repressor"
                     /protein_id="BEH01032.1"
                     /transl_table=11
                     /translation="MSEEAQPRASTRVARQARIIELIQRREIGSQAELADLLAAGGIS
                     VSQGTLSKDLLEIGAVRVRNAAGALVYAPPATEIASDHSAHEARLARVCAELLISASG
                     SANLTILKTPPGAAQYFASVIDRVARDAILGTIAGDDSILVIARDADGGQELANWFSG
                     LASGESREGTGDDAARG"
     CDS             complement(339993..341189)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011729315.1"
                     /locus_tag="brsh051_03140"
                     /product="acetylornithine transaminase"
                     /protein_id="BEH01033.1"
                     /transl_table=11
                     /translation="MPTQTEWLKRYQNSMMHNFGLPKTVFVRGEGCSLWDADGNRYTD
                     MFSGIAVGGLGQAHPAVVRAVSEQMATLGHISNLFASVPQIELGERLAELATGGARDR
                     AARVYFANSGTEANEAAFKITRLTGRTKIIAMEGSFHGRTMGALALTSTAKYREPFEP
                     LPGDVVFVPYGDLDAAAAAIDDQTAAVVVETIQGESGVVCPPAGFLPGLRDLTRAHGA
                     LLWVDEVQTGVGRCGEWLTSVADGLDPDLITIAKGLGNGVPIGACIAIGPAGELLTPG
                     SHGSTFAGNPIAAAAGLAVLKTIEDDDLLVRARELGDRLAEAVMDLGLPQIETVRGRG
                     LLRGIVLSVDIAPRVADAMLDSGWIINAPRPSVLRLAPPLVVTDEIIDRFAQVLGVVI
                     AQESAP"
     CDS             complement(341189..342100)
                     /codon_start=1
                     /gene="argB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013227836.1"
                     /locus_tag="brsh051_03150"
                     /product="acetylglutamate kinase"
                     /protein_id="BEH01034.1"
                     /transl_table=11
                     /translation="MALHRTNDESTLISKAGVLIEALPWLMDYAGKIMVIKYGGNAMI
                     DDELKCAFAQDIVFLRQCGVKPVVVHGGGPQISSMLKRLDIRSEFRGGLRVTTPEAMD
                     VVRMVLVGQVGRELVNLINRYAPFAVGLSGEDAGLFTAEPKTIQLDGEDIDLGQVGDV
                     ATVNPDAVIDLIDAGRVPVVATVAPGPGDLVYNVNADTAAAALATALGADRLVVLTDV
                     AGLYADWPDSQSIIKEIDSTELRQLMPTLESGMRPKMEACLRAVESGVERATIIDGRI
                     KHALLLEIFTDEGMGTMVRAAEQIQEA"
     CDS             complement(342100..343251)
                     /codon_start=1
                     /gene="argJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027859.1"
                     /locus_tag="brsh051_03160"
                     /product="bifunctional glutamate
                     N-acetyltransferase/amino-acid acetyltransferase ArgJ"
                     /protein_id="BEH01035.1"
                     /transl_table=11
                     /translation="MSITAAQGFAAAGIAAGIKSTAKADLALVVNQGPRFDAAAVFTS
                     NRVVAAPVIWSRRAVADGVLHAVVLNSGGANACTGAPGLEDAAATAKAVAQSVDCEPD
                     DVAVCSTGLIGVRLPMAAVLSGIAAAADQLSADGGDAAAHAIMTTDTVPKQALAEGEG
                     YTIGGMAKGAGMLAPALATMLVVITTDAEISAPDLQTCLQKATALTFDRIDSDGCMST
                     NDTVLALASGASGTIPDLDDFTTNLARVCWSLARQLIGDAEGASHDIAVEVTGAASEQ
                     DALEVAREIARSNLFKCAIFGNDPNWGRVLSAIGVTSAAFEADELDVTMNGVQVCRAG
                     GVGDPRELVDLTGRECQVLVDLHAGEHKATIWTNDLTYGYVKENAEYSS"
     CDS             complement(343248..344258)
                     /codon_start=1
                     /gene="argC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977244.1"
                     /locus_tag="brsh051_03170"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="BEH01036.1"
                     /transl_table=11
                     /translation="MAGCTGYAGGEVLRLAAAHPELTIGNLTAHSNAGTKLGEHLPNL
                     PQLADREVLDTTPDNLAGHDVVFLALPHGASAPIAAELGADTLVIDCGADFRLIDPAQ
                     WTKFYGSEHAGTWPYGLPELPGQRAKLAATKQIAVPGCYPTNVTLSLLPALTHGLITG
                     QDITVAAASGTSGAGKAAKPHLLGSELFNSMSAYGVGGMHRHVPEILQNLSLLGATDP
                     TVSFTPMLAPMSRGILAVVTAPISGVGAADVRAAYADSYADEPFCRLLPPGQWPASKS
                     VLGSNGFQVQVTVDEAAGRLVAVGVLDNLTKGTAGGAIQSMNLALGLPETTGLSAIGV
                     AP"
     CDS             344332..345204
                     /codon_start=1
                     /gene="larE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015777075.1"
                     /locus_tag="brsh051_03180"
                     /product="ATP-dependent sacrificial sulfur transferase
                     LarE"
                     /protein_id="BEH01037.1"
                     /transl_table=11
                     /translation="MPALDSEAVRFDDLSTATRADAEAVADALSDVKRLGVAYSGGVD
                     SAVLLALSVRVLGRDRALGLLADSPSLARHELQIARSVAAQLGADVVEFATHEGDRPQ
                     YRANGADRCFYCKDELFTVISETLAEDLSLDAVAYGENADDAKRLDRPGAEAATRHRV
                     LRPLAQAGITKARVRALAHDLGLSVADKPAAPCLASRIPHGEQVTPEKLRQVETAEQV
                     LRDLGFSDSRVRHHGKIARIEVPLAEIGRFADDTVREQALRAIRASGFAYVTIDLAGM
                     QSGAFTMQIITRHD"
     CDS             complement(345225..345767)
                     /codon_start=1
                     /gene="bioQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728885.1"
                     /locus_tag="brsh051_03190"
                     /product="TetR family transcriptional regulator BioQ"
                     /protein_id="BEH01038.1"
                     /transl_table=11
                     /translation="MSKAGIVDAALGILDQYGLADLSMRRIADALGVQAAAIYWHFAN
                     KQTLLAAVSDAILAGQAPCDESMSIAGWARDLREVLLTHRDAAELVAASLAVGLCTRV
                     PDAGAVEVLEAEGWPPDDARRATRAIVHFVLGHVIQEQTRQNLLAVGVLTSPTPALDE
                     DGFELGLRMLVSGVQAVAAG"
     CDS             345910..347127
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003892107.1"
                     /locus_tag="brsh051_03200"
                     /product="pyridoxal phosphate-dependent aminotransferase"
                     /protein_id="BEH01039.1"
                     /transl_table=11
                     /translation="MSKYEQASRLQGVHYDVRGKNMVEAQRMEAEGQRVLHLNIGNLA
                     SFGFAPPETMVRTFITHLHESDGYSDARGIYSARTAVANYYQTRGLNVDVPQVLIGNG
                     VSELISMILQAMTNIGDEILIPAPDYPLWTAQTVLSGGHPVHYLCDESNGWQPDIEDI
                     KSKITRRTKAIVVINPNNPTGAVYSRELLQQIADIARENELVVLADEIYEKILYSGEH
                     LNMAGLTGSDVLCFTFSGLSKAYRACGWRAGWLVSTGPLDDATDLFEGLQLLANMRMC
                     ANVPAQHAIQTALGGYQSIDDMVKPGGRFHDQLQVAHKLLNDIPGISCEPARGALYLF
                     PHLNAEMFDIEDDEEWALGLLRRKKILISHGRGFNWPHPDHFRLVALPEESVLREAVG
                     RIAEYCEETRVID"
     CDS             complement(347270..349765)
                     /codon_start=1
                     /gene="pheT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027870.1"
                     /locus_tag="brsh051_03210"
                     /product="phenylalanine--tRNA ligase subunit beta"
                     /protein_id="BEH01040.1"
                     /transl_table=11
                     /translation="MRVPMSWLREMVALPAAVTTQQVADALTRVGLQVERIEVTGAEV
                     SGPVVVGRVLESVDEPQKNGKVIRWCQVDVGEAEPRGIVCGAHNFAAGDAVVVALPGA
                     VLPGGFAISARKTYGHISDGMICAVDELGIGEDHTGILVLPELVDGKPPTLGADAMDL
                     LQARDEVLEIDVTPDCGYCLSMRGMARETAQAFGVEFTDPYAEVVATQTDAGYPVRLD
                     SSNCSLFSALTITGVDPQAPTPLWMSHRLAAAGMRSISLNVDITNYVMLESGQPLHAY
                     DADALQGTIVVRQAVDGEHLVTLDDVDRTLSAEDLLITDDSGPIGLAGVMGGRTTELS
                     ASTRNIVLEAAHFDPASIGRTFRRHKLASEASVRFARGVDPALPLAAAQAAARLMAEL
                     GGGKLADDYTLTGEVPVMPTQRIRADLPARILGAQISAQQVVDVLRASCVEVTEQPDG
                     WLDLVPPTWRGDLVDPYDYVEEVGCKLGLELITAEVPRAAAGRGLSFEQRSRRAVLAA
                     IAQAGFAELITLPFISSEELDKLGLSPDDPRRALVQLANPLADTQPFMRTTLLPGLFT
                     AVARNTSRSQDDLALFECGSVFWANGSAPAPVPDVSHRPSDAEIKAVTGNLPDQPRML
                     AAVLTGNWLPAGWQHPAIRADWTHAVYFAETAASALGSTLVRRAVAHTPWHPGRCAEL
                     GVQVGDQLVVIGHAGELHPSVVKAYGLPERACAVELNLDVLIATAPRGGEIAPLSSYP
                     MTKQDVALIVDVDVPAAEVQRALIDGAGELLESIRLFDIYTGAQIGEGKKSLAFALGF
                     RAADRTLTEAEAAVAREAAVAKAAQDCGASQRA"
     CDS             complement(349762..350865)
                     /codon_start=1
                     /gene="pheS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977229.1"
                     /locus_tag="brsh051_03220"
                     /product="phenylalanine--tRNA ligase subunit alpha"
                     /protein_id="BEH01041.1"
                     /transl_table=11
                     /translation="MTTSESADQDPNPLDVGEIMRLVDAALAAVGAATTTAELKQVRI
                     DHAGDKSPLALANRAIGKLEPGQRKHAGQLVGQARGSVNAAVAARQNELNAAELEAAL
                     QTERVDVTLPVDMHPEGALHPITALINDMCDVFVAMGWEVAEGPELESEWLNFDSLNI
                     GPDHPARGLSDTLFVEPASDHKLLRTQTSPVQMRTLLSRDLPVYIVSPGKVYRADEYD
                     ATHLPVFHQLEGLVVDKGITMGHLKGTLDHLAQAMFGEVRTRLRPHYFPFTEPSAEMD
                     LECFVCHGDSVGNPDRPCRTCKSEGWIEWGGCGVVNPRVLKAAGIDTDVYSGFAFGMG
                     VDRTVMFRNNAADLRDFVEGDIRFPRSLQGGAR"
     CDS             complement(351083..351898)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027873.1"
                     /locus_tag="brsh051_03230"
                     /product="RNA methyltransferase"
                     /protein_id="BEH01042.1"
                     /transl_table=11
                     /translation="MTDIHGGPNALAPISQAQVRSARRLHQRKGRQAAGEFLVEGTQA
                     VREALADPEQIRLLIVDDPGRHREILALATGIPLVQAGQREIAQLADTVTSQGIFAIV
                     HDTAARLEDLPSGSRLVVICAQVRDPGNAGTVIRCADAFGADGVILTHGSVERTNPKT
                     VRASVGSIFHLPVVSGPSLDEAVSWARDQGMQVLAADAGGRGLDRIPHAELARPTAWV
                     MGNEAWGLPADVVDLVDEVVSIPMWGRAESLNLSTAAAVCLYATASAQHHAIA"
     CDS             complement(351903..352268)
                     /codon_start=1
                     /gene="rplT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977226.1"
                     /locus_tag="brsh051_03240"
                     /product="50S ribosomal protein L20"
                     /protein_id="BEH01043.1"
                     /transl_table=11
                     /translation="MARVKRAVNAQKKRREVLEQASGYRGQRSRLYRKAKEQTLHSGV
                     YSFRDRRAKKGDFRSLWIQRINAACRENGMTYNRFIAGLKATNVEVDRKMLAELAVND
                     PVAFAGLVKVAQSAQQPVA"
     CDS             complement(352308..352526)
                     /codon_start=1
                     /gene="rpmI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977225.1"
                     /locus_tag="brsh051_03250"
                     /product="50S ribosomal protein L35"
                     /protein_id="BEH01044.1"
                     /transl_table=11
                     /translation="MPKMKTHSGAKKRFKVTGSGQLKHKRAGKGHLNEHKPSKRTRRL
                     NVDGILETQDAKKIRKLIGSYKPKSKRG"
     CDS             complement(352605..353207)
                     /codon_start=1
                     /gene="infC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027874.1"
                     /locus_tag="brsh051_03260"
                     /note="frameshifted, insertion/deletion at around 352685"
                     /product="translation initiation factor IF-3"
                     /protein_id="BEH01045.1"
                     /transl_table=11
                     /translation="MRIEQALQLAHEHDLDLVEVAPSARPPVAKLMDYGKFKYENAQK
                     ARESRRNQANTVIKEMKLRPKIDEHDYETKKGHVVRFLKGGDKVKITIMFRGREQSRP
                     ELGVNLLRQLANDVSEDGVVEQAPRLEGRNMHMVLAPTRKKSEAKAAEAVQREKRMAE
                     RQEAAEENRRVEAELRSKSASGQPKKKKGPADNMDPDVLL"
     CDS             353306..353620
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03270"
                     /product="hypothetical protein"
                     /protein_id="BEH01046.1"
                     /transl_table=11
                     /translation="MSLVWLIGLGGPVAVMKKGLRGREDLTMSGSRASWALSHPPSPG
                     ILLPGTTAVPTQDQRSAVVGGGSGPHFVGSGLHETDQHGELYRDRVSGPKLVLTRDRL
                     SL"
     CDS             353617..354126
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03280"
                     /product="hypothetical protein"
                     /protein_id="BEH01047.1"
                     /transl_table=11
                     /translation="MNDTTIIVLISVALSAVAVVWAVLKWNSRRSARYLMRATGVILM
                     VVGAAFAGLTGQVVEWMRHLAQLTTTISIGLGLAALGLIAYFIGGAIKAPTKDEAKLR
                     EYERQAKRREEDAKAAAKADRLAKKAQGPAPKPAEPTVAPPPAAPGAGESTDPDDEVA
                     NILRKHNIE"
     CDS             complement(354184..355047)
                     /codon_start=1
                     /gene="hisG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977387.1"
                     /locus_tag="brsh051_03290"
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="BEH01048.1"
                     /transl_table=11
                     /translation="MPEMLRIAVPNKGALSESAAAMLSKAGYRQRSDTKDLVLVDDIN
                     NVEFYYLRPRDIAVYVGEGTLDLGITGRDMLLDSGANAEEIMALGFGASKFRFAAPAN
                     GAWTLQDLNGKRIATSYPGLLSDYLHARGISARLIHLDGAVESSIRLGVADAIADVVE
                     TGTTLRKAGLELFGDPILLSEAILVQRPQNRGDIDPLALAHLQQRLSGVIVARDYVLM
                     DYDIPVEQVEEASALTPGLESPTISPLAKEGWVAVRVMVPARGHQLLMDHLHDLGARG
                     ILVSELSACRL"
     CDS             complement(355087..355353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007054261.1"
                     /locus_tag="brsh051_03300"
                     /product="phosphoribosyl-ATP diphosphatase"
                     /protein_id="BEH01049.1"
                     /transl_table=11
                     /translation="MSKTFEDLYAQLTEIAATRPEGSGTVERLDAGVHAIGKKIVEEA
                     AEVWMASEYQTLDETAEEMSQLIYHVQTMMVKLGLTPDDIYRYL"
     CDS             complement(355377..357758)
                     /codon_start=1
                     /gene="ptsP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728172.1"
                     /locus_tag="brsh051_03310"
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="BEH01050.1"
                     /transl_table=11
                     /translation="MIGIVVVSHSRPLADDVVALAQQMVPADAPRIAVAAGMDDGSFG
                     TDAAAIALAIASVDSPDGVLVLLDLGSAVLSTELAIEFLDGDLAKRVMISPAPLVEGL
                     LSAVVSASTGASLVEVDQEARGALQAKSAHLTDGKHSPELLQVARPPAKQPAPNHRVV
                     WRATVRNPHGIHVRPAAMIVTSLRGLDADVTFSNASTGRGTARGDSLSSIAGLEVACG
                     QILEARISGPDADTARDVLAGLATQNYGEDLKPRAARTSEAGSGHPGRAAAVRAFGDV
                     PAAAERRAVMAPVTQVGLRPPVGDYRPLTPKDELARFNGAVAEVDEFLDSIIAGGEAV
                     PGILEAQRMMLADRELQHGVVGRITAGFSAVDAVDDQLTGMARSFDKFTDAYLRERGQ
                     DLRSLRRMLLLALLGRRLEQETPDEPRIWVLEELDAATAMRLDPRLCMGVVTIAGGSS
                     GHGMLAAQARGIPVLTGCREAAEITDGQLVAFDPVAREFWPHPDQALRVELARRNAER
                     TAAAERAQLRAHEPAVTTSGQTIKVEANIGSVDDAQAAAHQGADGSGVVRTENIFAKD
                     LTAPSVEAQTEVFVRIGQTIGGPITIRTWDPSGDKPLAFMPNQPEDNPALGERGIRMM
                     RKVPQIFRDQIKAALLAAQQVDLQLMIPMVTDPEEMAWAKQQVETVRAELGVDPVPVG
                     MMIEVPAAALRVAEFAALVDFVSVGTNDLSQYTQAADRTNDAVRQLARQDSPAVLELI
                     RLIRAALPGIPMAVCGDLASDLDATRTLIELGADELSVRPGMVAEIKEVVRAI"
     CDS             complement(357755..358363)
                     /codon_start=1
                     /gene="dhaL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728173.1"
                     /locus_tag="brsh051_03320"
                     /product="dihydroxyacetone kinase subunit DhaL"
                     /protein_id="BEH01051.1"
                     /transl_table=11
                     /translation="MELSPQILGGWLDAFAAEVAENEALLTDLDRQIGDADHGANMVR
                     GTKAVAALDPADFADARSYAKKTAMTLISTIGGASGPLYGTFFLRLAAALPDDGPIGH
                     AAWLEALRAGVQGVMDRGKANLGDKTMLDALIPATDAFENEPDHPWQSAADAAAAGRD
                     ATVPMVARKGRASYLGQRSAGVADPGATSATLLLVAAARTLA"
     CDS             complement(358369..359367)
                     /codon_start=1
                     /gene="dhaK_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728174.1"
                     /locus_tag="brsh051_03330"
                     /product="dihydroxyacetone kinase subunit DhaK"
                     /protein_id="BEH01052.1"
                     /transl_table=11
                     /translation="MGMKKLINDPGTVVADALRGIEAAHPGTLKVDHTNRLIVRGDAP
                     RPGKVAVISGGGSGHEPLHGGFVGPGMLDAAVCGEVFTSPTPDQVLAALQAVDSGEGT
                     LMIVKNYTGDVMNFEMAGELAAADGIEVTSVVVADDVAVTDSLYTAGRRGVGGTVVVE
                     KIAGAAAEAGRSLAEVTALAQRTADAARSMGLALTSCTVPAAGRPTFDLADDEIELGI
                     GIHGEPGRSREKLAPVHDLAARLVNPILDDLDFTGAPVIVICNGMGGTPLIELYGLYA
                     EVSDLLAARGVQIARNLVGNYITSLEMAGASITLVKADSELLDYWDAPVSTTGLRW"
     CDS             359432..361492
                     /codon_start=1
                     /gene="ftsH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030322.1"
                     /locus_tag="brsh051_03340"
                     /product="ATP-dependent zinc metalloprotease FtsH"
                     /protein_id="BEH01053.1"
                     /transl_table=11
                     /translation="MTDPQPSQQAEVPTPERSSDEPHRPVRSQAPSGPPPLDSPRPWR
                     TEGLPKESKGQNGKKEPKKSRLWQFWVIAGIALLGLWGLLTWQDASNAPPTIPYTEFI
                     SQVEAGNVKEIYAQGDTIQGELTNEAKLPDDGDDSTEEGNYTQFTTERPTFAQDNLLS
                     DLQAHGAVVRATPVVEQRGAVANLISSLVLWGLLIGVSIWAFRKIAKAGGGLGGFGMQ
                     REVKPIEKTAVRVNFSDVAGIDEVKEQVDEIVDFLKSPDKYRKVGARAPRGVLLEGQP
                     GTGKTLLARATAGEADVPFFSASASEFIEMIVGVGAQRVRQLFDEAKKVAPAIVFIDE
                     IDAIGRARGSSRASGSNDEREQTLNQILTEMDGFDGTEGVVVMAATNRSDVLDPALTR
                     PGRFDRVITVSPPDQIGREKILKVHTRQIPLATDVNLKALAQTTPGATGADLANLANE
                     AALRAARRNDTLVYQADFTNALEQIQLGVARSVLIPEDEKRRTAYHEGGHALLGMLQK
                     GADPVRKVSIIPRGQALGVTLSTPDTDRYGYDEQYLLGRIVGALGGMAAEAAVYGVVT
                     TGAESDLRSATSIARQMVGKWGMSAKVGPMTVLFDDVNPRELGISDETLSVVDAEVRA
                     IITKCHAKAVELLNENRDKLDAIANELLIKETLDEAEVYKIAGIERPVQDDFHSESVG
                     TSAD"
     CDS             complement(361568..362824)
                     /codon_start=1
                     /gene="mshC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977162.1"
                     /locus_tag="brsh051_03350"
                     /product="cysteine--1-D-myo-inosityl
                     2-amino-2-deoxy-alpha-D-glucopyranoside ligase"
                     /protein_id="BEH01054.1"
                     /transl_table=11
                     /translation="MHAWPAARVPNLPRNTNPEIDDRVRVWDTESRALKAVGPQTGSA
                     GLYVCGITPYDATHLGHAFTYLTFDLLQRAWRDLGLDVTYVQNITDVDDPLLERAEET
                     GEDWRELAASQVELFRTDMRSLRVLPPDHYVAATEALDLVIGTVQELDAKQFAYRVAD
                     EQYPDWYFRSDAVEGFGQISHLTRAEQLAEFAEKGGDPDRAGKVDALDSLVWLLKRDG
                     EPSWPSALGQGRPGWHVECTAIAQHYLGSDFSVQGGGRDLAFPHHEMCAAVGRAVTGE
                     RFAQAYVHVGMVALNGEKMSKSLGNLELVSRLRAGGVAAPVIRLALLAHHYRNDWEWF
                     PTDIERAQRRADAWVAAFRAPAGTPAGPVIDDLRRAMRGDLNSPRALAAVDEWTAAAL
                     AGDGTDSQAPTQVAEAVDALLGVSFD"
     CDS             complement(362872..363438)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003411102.1"
                     /locus_tag="brsh051_03360"
                     /product="DUF3090 domain-containing protein"
                     /protein_id="BEH01055.1"
                     /transl_table=11
                     /translation="MELTHRYAFPDRFVSGAVGEPEKRVFFVQTRQGSRMTNVVCERQ
                     QIRVLAEHISQVLTELEQIGGIRSDREAGRARPWDSDPLDVPLDEDFRAGTMAITWVP
                     ETSSLKVELFAQGVYRKMAHPGALGEDDKVLQVVITLDQARDFIVRTGKLLGSHNPSC
                     PFCGQPIWPNGHLCPRCNGYRKQLIDFA"
     CDS             363628..364518
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977503.1"
                     /locus_tag="brsh051_03370"
                     /product="undecaprenyl-diphosphate phosphatase"
                     /protein_id="BEH01056.1"
                     /transl_table=11
                     /translation="MGWLEAIVLGIVQGLTEFLPISSSAHQLVVGQLFFSGHDPGSAF
                     TAVTQLGTETAVLIYFWHDIVRIIKQWALSLVKKVPSSDPDARMGWFVIAGSMPIIIL
                     GLFFQDAIDTTLRNLWITVAMLGGVGLVLGWADRMAARREPVPGAARRQLGPKGLTDL
                     SWRDAIIYGLAQACALIPGVSRSGGTISAGLFLGYSRPAATRYAFLLAIPAVFGSGVY
                     KLKDIGEDACVAWGPTILATLIAGFVGYAVIAWLLRYITTHSFTPFVLYRLGLAVLLA
                     VLLLTGYLDPQAPIVTGCVS"
     CDS             364539..365486
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977155.1"
                     /locus_tag="brsh051_03380"
                     /product="aldo/keto reductase"
                     /protein_id="BEH01057.1"
                     /transl_table=11
                     /translation="MGASGLSVGRLGLGTMTWGGDVAPDTARALLRTFVDAGGDLVDT
                     APAYGGGRAEELLGRFMRSDLRRDDLVIATKAGFGTHGGSQVVDTSKGALLDDLADSL
                     RRLRTDHVDLWQVHAWGDAPLEETLAALDQAVSAGMVRYVGVCNYIGWQLGTAAAWQR
                     AVPGRARLVSGQIEYSLLARRAEVEVLPALQHHGMGLFPWSPLGRGVLTGKYRGGTPR
                     DSRGGRDHMAWFIEPYLDARSNAVVDAVARAADGLRLTTAQVALLWVRDAPGVTAPLL
                     GARTVQQLSSLLSVDDQTLPKPIVAALDDVTGGPHLGRE"
     CDS             365600..366115
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03390"
                     /product="hypothetical protein"
                     /protein_id="BEH01058.1"
                     /transl_table=11
                     /translation="MAPAPTTTVTVETTVYPTDENDPVSPAPYATASTSAAPAGALSD
                     LLITDVRTGAHDGFDRVVIEFDAGASNSVAWSAGYVTDPRAQGSGLPIVIPGASAVLG
                     VTVHGLRIPNGETVLSGLLDGSAHGGIRGVYLDPVFEGISVINIGLDAQRGFYVFGME
                     APNRLVIDIQS"
     CDS             complement(366197..366472)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03400"
                     /product="hypothetical protein"
                     /protein_id="BEH01059.1"
                     /transl_table=11
                     /translation="MRLILGGVMGEPATTYITSWSLRKEFVSGAEFEVGQISLPRWIT
                     NRQVQRVLTEQAEVGGWELMRLRRYRDGSCQAWLRRRIIRARPTYPL"
     tRNA            366756..366842
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00080"
                     /product="tRNA-Leu"
     CDS             complement(367041..367361)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03410"
                     /product="hypothetical protein"
                     /protein_id="BEH01060.1"
                     /transl_table=11
                     /translation="MFAFFLGVFGVHNFYLGQRKRGFGHIVLLGVALAGLLAAMLYML
                     FIVFWYSDLYLGNTMDRRAEVLLNVLVVLPLVLIGANLAWAIIEGIAILAGRSSQSKP
                     GPSP"
     CDS             complement(367476..368213)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03420"
                     /product="hypothetical protein"
                     /protein_id="BEH01061.1"
                     /transl_table=11
                     /translation="MSGFDVAITAVAGRYSQADSTRELWEALVDGRELNVNAPDPVSD
                     GHIPRVPSVANIDEFDHEFFGISPAEAELMDPQQRLMLTCAFEALENAGRASGDELRW
                     GVFASASFSTYLLNNVLSARPQVVEDSNMLALIGNLPDSVATRLAYKLNLVGPAMTVQ
                     TACSSSLVALQVACRSLLDYECDGAIVAACSLTVPQARTRSRGRGPTTPSQAPEDEAN
                     CADRRVSSMPTRAPGLGGRPGHRPRAA"
     CDS             complement(368213..371431)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03430"
                     /product="hypothetical protein"
                     /protein_id="BEH01062.1"
                     /transl_table=11
                     /translation="MTRTEAAVAPSTGCGEPGRPTSWPQNTMLRQFELNPADTTLTLV
                     RLMRVRGEVDPELLRCAVDSVLRRDPGLAVRLARTQSGWKSIPGPHPDQRCRLVEMDP
                     ETTEGDVITMARHLQEMAMPIENAPLVDAELIVTDKRATYLLVRASHLVWDARTGYLV
                     CDRVGQLCAGHDPYSDPDVAGAVLDPVRADEAEMERATESFRQDFKDFATFGHSAMLG
                     VKDEKGRLTGRRDELVLDGEFASSLRSTMSTHRIPASAFFIAVAALLQARLTDEEVVV
                     FGCPVSTRVCQQACGCHVNTLPVKVAVEGGRTFLEYVKTVQISILESLRRRGVDYSAT
                     GMTPVLGSLASCFTHQGVEPSGLDEEIRLEPLQVPLGHVAFPLSVVSSEFIDATGGGF
                     RCVIEVGSWADDIDVVGAFSSLIRQILSDPCSPLDSIGLVDPDGPSPVLEALAAYGRG
                     STATVVDMMGRTAQRYPDQVALIEPGRIVSHRQLDVDGRRLASEINARWPEAEHVVVC
                     HRWGIDEVLAVTSVLRSGRAYVPIDPDLISRIPSVFETLGRVPVIGDCETVATLADHG
                     VTAVELSELLAGAQDTVPDQAEVDLDAPAYVMFTSGSTGRPKGVEVSHRALGAFLTSW
                     LQVVTCGPGESWVRLHHLAFDASVLDILVPLVSGGAVHLPDLDVVRDVQRCARALVDS
                     RATSVLLTPSLADQIMRFLPDEGLPALRVTVLGAEAVPIAVASQWATRVMPRGGRVLN
                     AYGPTESTVACITGDLTSDDLSQDGGGAPLGTPLPHAGVATVDSALRLVPPGVPGELL
                     VAGESLATEYLGMPEETQRAFITDPGRLKGRWYRTGDRVRLCRDNRFVFLGRMDGQVK
                     LGGFRVELGEVSAALRRVTGAAVVAAFMDPEQPSRLMAAVVSDRARDVPTWKAGMRQL
                     LPACMVPQRIACVSSMPTNGNGKLDVAALARLIAHEQVPARTITDPVEREIHRTVASV
                     IGHEDFTCTENLFDAGLTSLSLIQVFDVLQSAYPEAGLAVVDLFQNPTIESLALRVRP
                     AREVELRDRELQEAREAERRARREHEWQRRREINAKHHRRDG"
     CDS             complement(371428..373752)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03440"
                     /product="hypothetical protein"
                     /protein_id="BEH01063.1"
                     /transl_table=11
                     /translation="MHASGARYKRAMLRRGMAGSWTQFVAVFCMAMLSVLAYTGLEGG
                     WRGMRVSLDDYARQSQTADIWVTLAPGVADVELPEVRDTPHVVGAESRHASVARVVTD
                     AADTWLSLTSTEDVDFWSISLPRPVEGSTPTDGGEGVWLSEGYMDAHGFDVGDRLMIR
                     SITGQDVQVMIRGEVLSPDQLYDVEESVFLVPEQDMFSYGYVTPATATKLWGEGWTNR
                     TPGRVVVRADDSDAAVDALWGSIGDRASRITTRETDPHIAPAYDRVKVIRNVSVLFAS
                     LFLLVGILAMYSSTKRLVDRELKTIATLQSMGYGRGELRLHFSMFGVITGLAGSVVGL
                     GLAPVLSRVVLASQSGQFDLPSWRVSYTLVPLVVTTLVVTACVAGGFLASGSALTDAP
                     ALLMRPGLVKVSSAAVRMRNMGSGNHWGVRWALRDTASNLMRFVMGIVGVAGCLMLLF
                     TGFGLPDTMQNRADTSFSPTSLDYAYRVTVTGMSSRPVAIEGLGALPQYLMQIPVLTD
                     PSDGFDRVLTILDEGDRFRQRTSDGPLPAESGLRVTEDTATRLGLAEGSRVVLDLPGD
                     LGRLDLEVSVIVATEMPQGFFMSRAQWESLGQQFSPSAILVGDDAVPDVIQADPRVVN
                     VVSRASQQDNAVNIRSSLGGIFNLMRVMAIILCVIVLTSLGNLTFDERRRQYATLSVL
                     GMSSGQLRRLSSLEVLVSALIGVLLGIPGGLWFLGIYVRQVASPRLHYAPVITPRSVG
                     IAVLIALLSACATVIPLGLRIARIDVVEALKEAE"
     CDS             complement(373752..374435)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010879314.1"
                     /locus_tag="brsh051_03450"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH01064.1"
                     /transl_table=11
                     /translation="MALIAARDVRRVYRTGNVDVRALDGVSLNIESGQLTTIVGPSGS
                     GKSTLLNILGGTDQPTSGSVVCDGVEIENLSEAGLTKYRRERVGFVFQFYNLIPTLTA
                     AENVGIACRGIKGAIEPSEILETLGLAGRERSFPHELSGGQMQRVAIARALAKRPALL
                     LCDEPTGALDSKTGDEVMRTLRQAAETSNAAVVVVTHNEGYSRLADRVVRLRDGKVST
                     ARRMLETDI"
     CDS             374785..375348
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011729044.1"
                     /locus_tag="brsh051_03460"
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="BEH01065.1"
                     /transl_table=11
                     /translation="MRTGRPRDPLVTQRALAATWDLLSTKGYSALRIDDIATSCGIAK
                     TTLYRRWPSLAHIVVDAVVSRIGDRTFTPTDDPVADLRAVSSMLVQSVNAGKDSWVSI
                     ALSLHEQSDSELRLRYRERIIDPVRELLAEVLERTALAGCLATTIPTDQLADMLIGGT
                     VYRLVFLHSPLTEDEVTTIIGGLLTAR"
     CDS             complement(375583..376446)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010908123.1"
                     /locus_tag="brsh051_03470"
                     /product="malate dehydrogenase"
                     /protein_id="BEH01066.1"
                     /transl_table=11
                     /translation="MPGAVKVLEGVAMELEDCAFPTLCGVEIGDGANHIFDGANVAML
                     VGASPRTKGMERSDLLGANGAIFAAQGQALAANAASDLRVVVTGNPANTNAYIAYHNA
                     PGVPAERFTALTRLDHNRALHQLAVKAKRPVGEVTNMTIWGNHSSTQYPDVFNARING
                     ENAACWVGDDAWINFEFIPTVAKRGAAVIAARGASSAASAADATIKHVRDWFAGTPAG
                     GWTSMGVVSDGSYDVPAGLVSSFPVTTSKGDWKIVQDLPISAFARHFIQTSVSELVSE
                     AEAVKELGFVK"
     CDS             complement(376664..377083)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03480"
                     /product="hypothetical protein"
                     /protein_id="BEH01067.1"
                     /transl_table=11
                     /translation="MTDTDRAWAWTALLLGIHQSEEVALSIAAWLSDVGTTGIGWFDE
                     HIRTNPLAGTNPAARAGVVAGQGVALWVVYRLTRDSRTLTRWVTSALVLSWAAAFCMH
                     LGMSARTRSFMPGTATSIIPGIPGAIWVLRRIRELTA"
     CDS             complement(377080..377619)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030370.1"
                     /locus_tag="brsh051_03490"
                     /product="HXXEE domain-containing protein"
                     /protein_id="BEH01068.1"
                     /transl_table=11
                     /translation="MNGQLEGHKRWTVPLSLALSFLANDGEELLTIVPSLPETLDRVS
                     ERTAGRVPIPGLLRDIDQTHINVGVAMMGALCAAAVADGVRSRGRGALYQDFQWVFGL
                     HGLSHIGASLVTKGYTTGVLSSPTVVLPQFAYVMRALDQAQVPHRIHPVRAISRVAGW
                     LAVSHLTGYIVSRGRRTAR"
     CDS             377767..378771
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03500"
                     /product="hypothetical protein"
                     /protein_id="BEH01069.1"
                     /transl_table=11
                     /translation="MPTPSSGALSHVQELFWNEAVNVRPTSDGCVIAGCMFPRSCGEP
                     IEAIAELTQTGATKDDVLSLLGLEPQRSEQLIDALTELGALVTSPPGLRQLAHGLSAT
                     LGDLLMDDQTLADSEHATAYRTTQATRQPRGTTTVQLPDVELADWLARRRTIRSFNDE
                     PVELAQLATLLSGLRHRPADDLPQGRRGWPSAGGLYAIDCYVHIKSNRVTGVPSGVYA
                     VDPIDNRLVRHSDARSWDESLHFLTNRMIHQSSALSLILIADLAVIMPKYHDMGYPLA
                     LIDAGVLAATISLAACTCGLGSCCIGDLDFDRAHEMLGLRPTQQVVHSIEVGRIDERS
                     "
     CDS             complement(378976..379401)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03510"
                     /product="hypothetical protein"
                     /protein_id="BEH01070.1"
                     /transl_table=11
                     /translation="MWGLRDGGELAGPECPVHVEVSGVSGGDVHTEVGEGGFVVGAFR
                     QFMPIHNIIDLLQHSEDAWAVEEEEVEINGEDLSVTGKPYDSETETGPCRDVHDLRDP
                     VVPELVKTLRGIIIVESAPIDDLDGVRGGFNRALDSVIR"
     CDS             379465..382341
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03520"
                     /product="hypothetical protein"
                     /protein_id="BEH01071.1"
                     /transl_table=11
                     /translation="MDSPRWERLRTAASARSLPPLAVVIESYVEALRRWSGTAEFTVN
                     FTTADRPSRHHPGGMVLGEYTSTMPFPVRAADDDFWLDASNNWTHLGRCLAHSGFSTL
                     DLARELRDRTGETISGGLPIVFTAMMADSRGFNDGSESLGQIVWSCSSTPQVLVDFQL
                     LESHRGVALSVDYREPYITHRIAQGILDDVVAMLEAIIDGEDPVSAVRLPKGDQTVWT
                     TVNSTGGRQGTRLLHEAALQAMAARPDHAIVCDNEGWHTNRELLDHARLVHQQLVAMG
                     VGVGDYVAVDGYRRASTIAAMLGVLQTGAAYIPLDPGQPPARHRQILDTSRARARITP
                     EGTIELHKESPRKRDTVTLDSPAYAIFTSGTTGTPKGVVISHRSVMNTIEDVIETHSI
                     GPSDRIAGVSSFSFDLSVFDIHGALISQAQLFLYEDQRDIPTLANGLVKDGITVWNTV
                     PAIMGLVVEELERTGAGLLRPYWKATGSQAFSVPWDLRLVMLSGDWIPVDLPDRISRL
                     ATGAHVLSLGGATEGAIWSIWFDVAEVSPTWRSIPYGHAMRNQTMWITDHHQRVSPVG
                     CIGEICIGGQGVALGYLNAPEQTDQAFVSTPELGRVYRTGDFGRMGQDGEIEFLGRRD
                     SQVKVNGHRIELAEIESATIRELDVIHVAAAVKQVPPDSKSVLCLYYVSDQEFTPSDV
                     RDTLRARLPQYMLPSHVMRVDCIPMSSNGKVNTALLPVPQPRHHTASTTQKWTPQQRL
                     IQRVWLDVLDLDDLGLSDDVFEAGADSLSVIQFHATLRAAGLTVSVYDVFENPTVQSL
                     ATVVGQQVPETASCRPAAKPISGRLYDPADHARAWGGLALLRQPDPQRILITGATGFL
                     GGYLMIQEMPQDTELWCLVRGGSQDEAEKRLWEILRARFGDEVTDTLTDRVHVVVGDM
                     ERANLGLDEAQLDSCMNVDTIIHAAADVSGQVQWSGVAVPSSRR"
     CDS             complement(382331..383572)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003901078.1"
                     /locus_tag="brsh051_03530"
                     /product="IS256-like element IS1081 family transposase"
                     /protein_id="BEH01072.1"
                     /transl_table=11
                     /translation="MTAPHIVDPARVLGNLLTEASPDMMRQLLQNMINALLSADADAV
                     CGAEWGQPSTERVAQRNGYRHRPLDTRVGTIDVAVPKLRSGSYFPEWLLERRKRAEAA
                     LITVIADCYLAGVSTRRMDKLVKTLGIDGLSKSQVSRMAADLDEHVAQFRHRPLGEAG
                     PFTFVAADALTMKVREGGRVINAVVLVATGVNGDGHREVLGLQVVTSETKPAWNTFFA
                     DLVARGLAGVRLVTSDAHAGLVEAIAANLPGASWQRCRTHYAANLMSVTPKSMWPAVK
                     AMLHSVYDQPDKKSVQAQFDRLLDYTAEKLPEVAEHLEAARADVLAFTGFPKDVWTQI
                     WSNNPAERLNREIRRRTDAVGIFPNREAIIRLVGAVLAEQTDEWAEGRRYLGLDVLAR
                     CRLSTITNAVEEVTEPLALTA"
     CDS             383697..384452
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03540"
                     /product="hypothetical protein"
                     /protein_id="BEH01073.1"
                     /transl_table=11
                     /translation="MSHFAAPGTIDARNLRAVENVIDLARHASARLFHVSTSQVMGVP
                     PEESGIYGELCRDVGQSFLDQYSHSKFESEKQCFEAFDSGLHGAALRLGNLCFDSRTG
                     AMAQTGLANTYAALINVIARFGSIPDNLAEITDLSYVDTAAHAVSALVHAPMLPDSHS
                     FHIMNPHRPSMETLHALVSAPCRQVPSSAFRSLLESHFTEHPDDVAVRNCLLNAHVWQ
                     DRYGAQFSARETNSLLADLGVHWPEPASLLAQA"
     CDS             complement(384509..384919)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03550"
                     /product="hypothetical protein"
                     /protein_id="BEH01074.1"
                     /transl_table=11
                     /translation="MLHSVYDQPDAHAVHAQFDRLLDYTSDKLPAVTDHLDHARADIL
                     TFTSFPVEVWHQIWSNNPTERLNREIRRRTDSVGIFPNRAAIVRLVGAVLAEQTDEWA
                     EGRRYLGLEILAKSRMALITNQPEQETTMPALAS"
     CDS             complement(385566..387101)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011727550.1"
                     /locus_tag="brsh051_03560"
                     /product="SIR2 family protein"
                     /protein_id="BEH01075.1"
                     /transl_table=11
                     /translation="MVQADLTRLAADAFLIPCDSELHVTGTWRPFVEPGAPWQAKHEW
                     FRPEGVQLEDGVAVLPDPTPKDPSPDQVVGLRVLVDTVGVESIPAMVSRSLDAVRRAA
                     ARATRHGGRALPLVALPILGVGQGKFPGRRAEAVRELVGQLLDFVTIHPVDVALTLRR
                     TADFAAAQWERQRRTRDLGADFWPELTPEQGELADELGTKAAHGELSVFAGAGVSRPV
                     GFPSWKDLLQGLSPDQKLVFTEETDYPQVAQDLNRPDLNDEVAKKLTTGKHALAHALL
                     VDLRTPSLVTTNYDPCFENAAIVIHQDEPLRVIARQLVIGGGPWLLKLHGDVAYPKTI
                     VLTRGQYDALENDLPALRGVVQTLMLTSHLLFVGFGFADDDFLAMSQAAQKVRDLATD
                     QPADAKAGTAIGLCQAKGRTYAELDYHHLRSDHDLTAAARQLEILLDRVAWRCQIAGR
                     GRASYLLDPGYQQDGTDQDRVLAEALTQLRATAEQWQGSSGAQAVRDLMDDLGWQPSA
                     ADR"
     CDS             387440..387667
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03570"
                     /product="hypothetical protein"
                     /protein_id="BEH01076.1"
                     /transl_table=11
                     /translation="MIVSNDNANATAARLGRGVVTVVPVTSNTTRVFPFQVLLPAAET
                     GIHVDSKAQAEQVRSVSVERLGRVIGRLSTT"
     CDS             complement(387799..389007)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03580"
                     /product="hypothetical protein"
                     /protein_id="BEH01077.1"
                     /transl_table=11
                     /translation="MEKCFAGSASGANTETLSIVGNIVEVVVMVDYLTHRVSNGGAPI
                     VFDAPGATDFFDVKGDRCEQFARFLKLKNAHVDQALIDAFCRQRKVRDGDKSMVPDII
                     THEGALREFYEVKPASTTGRRDGRQKIRNFCELNAGHGMPYCSDPNPEGGAVPRGNTY
                     NPNYRRVFWRGQYSSIPAQVSLRFERDSDSLVLYRFCVEVTPEVVNETVLLLLVKAAI
                     VTLILTRGAAIGVLVPAAAAYLLFMRSPLLGSVGQNGANGRADAKYAQRLLNQWRAPR
                     GLPLLAVDGVPGNNTITAIRDFQRAETPAWVDGLIEPGRNTIKRMETLFLNSLNDGFD
                     ASIINDGERREWVDDVTYAAALLAPGNQDPAPAPGEAVVVPIEPNAVVVTELQQILDM
                     VHDADFGPNQ"
     CDS             complement(389073..389894)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03590"
                     /product="hypothetical protein"
                     /protein_id="BEH01078.1"
                     /transl_table=11
                     /translation="MRPERTLTETQDHLNETESTMSFTIEMSHPLGPASQQGGYGGPG
                     VGGHQGPHWYIAFGMDLAAPAGTSVFAAFDAHLTKVQQHVPAADTGAVYGAQLFMRSP
                     NDMMGAFYTHITGVPAALTVGSRVSRGDYLGRIYASGGIPAHLHMALVEIIGGAPNGQ
                     YTGVNLYNSFLNTPGPWTVTFFQNGTPPSITAGGGGPTTIDLSSLRGVQQGLAALGFD
                     PGPIDGINGPRTRAAVSAFQSQVMLMSPPTGSADPVTKAVLAAKLRLAGFVVVGA"
     CDS             complement(389902..390774)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03600"
                     /product="hypothetical protein"
                     /protein_id="BEH01079.1"
                     /transl_table=11
                     /translation="MHEMVRQSWMRFNEPLEGIVNFMYLDVKGWVSTGMGNKIDETVR
                     PNSAPSAAERQASLRLANQLNWYDQSTGAAASPAEVAAAWDAVKARLDLAPQGHRAFE
                     GLTRLRVTNAEIARIVQLKLLEMERTLITRPEFSGFAAWPANAQLGTLSMSWGMGPMF
                     RFPKFQAFVASGRWAAAAEECKFNPDEGTIRYRNKLDRMYFLLAQKVADQHLPVEYLV
                     IALDSVLAVQHGLWMLGYNPGPQDGGDGPKTQAGVRSFQTAVGLPANGAWNDPATQME
                     LAGALASDGWTIAG"
     CDS             complement(390831..394100)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03610"
                     /product="hypothetical protein"
                     /protein_id="BEH01080.1"
                     /transl_table=11
                     /translation="MSSLFAPPELLSAYAMAEDGSGPDLPFGTHLRIFAGFGASFPLA
                     PFAVYKIVSQPSELLDVRVLDREGRPHRDLDLARLGVADIQLGLHDDDNWRTVRLELI
                     DPDARLEGAAVLGPRGRRFAGLVRDEPRWLFSGPFMHRLHLWGSSSQLGINPWRVPWY
                     ELFEGSHELAGVLALPIDGEYTWYAHGDSTAAEGRVERGAPQRLNPMDRPDGQDVGIS
                     SDQELRRVAAMLASGQLGGGLETLLAHLVDDRPPPWKQHEHQPMQDPNGKRQVVRAPR
                     LGTLQTAVMDPGLARHFGFATQFDDLPDLDGGGGWDTLAIVGLLALDPREYLRRGLDL
                     TALHDDQRPGTHALLESLMWALENSSGLDPRPAIAERMRFVRNEGLVAAPFLTVVAPV
                     PPWLPPTLARPQVVDHRWQSATDGYPSRLYRASLAFPQPQVASLAALAAQFDGEWTAR
                     HDQLDIADGDPGQRAVPRVVGHETDPSARVRGLGGGALEPAGLLSDKAIPDVGPLDYR
                     VWASDMFGRFGQPVDFTVEPPPRPVPPPPVLRYHLERAEIDPLVSADESPGVIRLMVA
                     IPHAFPASRFTPAESQLLGSAIVVPRIDDLAAGSWTIESLTLKLGGSNRTVGTTDSGF
                     TEVELPLPRLSPQQRGRWTLTGYFTDTTGVHSEVATLPIEVTDPRPPKVYPTGIGLFW
                     SSAPGPSSEVELMLTWPAVDGSKHRVYLSDQQGLRLRPQDVAEAVAGVAPSRGRVAAA
                     GCRRVLDGGQIDRTAFRLLTESPVVAGADGAVFTTRLPRSLETVQFLRIVPLGPDGAE
                     PPFDSCGIVAVAVPDSRGPVAPRIDGHVDPATGAATLRVVTDGFDRSALQRDEPGLFD
                     PGVAGTEPPRFRIRRAVGPVADPVYARVLREGPMQILNSAATPAVFEATFLDDGGVGR
                     GLEPFVRYVYWAEVRLPPERRIPAGVTLLDPPGGVTVPNPAARQPHPRPLSPPSAPRV
                     LMHLPPNPPDRPGVDTITVLREPGDAVDEVKLTITVADAPRSHALAIGPYRAAIWYQW
                     PGHTIRPAVAELAWPELSDGVVPIVVKVPVAVDPDAVLGLRVAFVDPAGRIGEIASLN
                     V"
     CDS             complement(394097..399562)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03620"
                     /product="hypothetical protein"
                     /protein_id="BEH01081.1"
                     /transl_table=11
                     /translation="MGTSIKDLLDRSGVFHQVICPREIDLLLSALELTGPAELPPGGV
                     LQGEVRLTQDLSQSPIPGFDFALALPTGVVQPAPFKLELLPAQDPTSFKFWLVLAEQG
                     QARFVFKFVEGIAGMALTGARLVVTPEGDAHLQALPPDDPKHAPVLVSRSAEAGVVLG
                     PALLVAGSADTPARIRFTPDTSSTAGIVALGLEPPTVVFGSSKIGFDLPALVIDDSIE
                     AGAAGTGAPGLDPPLATIAADEPSWRGLLARQLDFYLPAEVPLFGGQPIKGYLAVRTG
                     GGGVNLVVETKVPARPASGQRGALPAYSVRIECIDPTASGLSGLLPTCITATMELPLD
                     GAKAGFSEPSGANREITFAAGKPVRVTATLARDPVNAPGEFRISVGAAAQGQAGILSV
                     TSTSMGGAKIFNTAAALATALIADKDVERAAKVGDGTGVVLYSLVAVGAALSSLLTDD
                     SRFVLHGVEFESSGHGLPVGGPLTLKLDYSVAVRITKVDVGVLAVSMRPDQPMRIRVR
                     DARMSIDPRKSGLQMIGLDFDRAQLEVENPGAWNVAGLESLFDVLGSRSGRGSTFVEV
                     DLRFKLNLGPIRVSGATIRATLNNNGTVDATIRGLEAGLTIPGAIEGTGRIQLRSGGF
                     GADLLARLLPLNLAVDAGIEYAPPMIVLRLGVDLPAPIPLANSGFGLFGVGGLFGMAA
                     VPQYAADAEDDPVLRQLQWQPKGVGSFRVLPGQSTFGLEAVVGTLPDLGFSFSSRAGL
                     LISVPDVAVRGALNGRVLQPRVQISEPSYPPPSGLSFLGFIGVDSTALSFGVLGVVDL
                     RPLLEIRVPMAGHFPLQADSDDWYVYLGADGAPVQGRSMGPISAKVLPGILDIGADAY
                     LMLRGRGIADWPYGRGSAAAQLTITDGFVATFGFGVQTMFGARPIAWAELFASLDLLL
                     GTKPPTLAGFGRAGGSLHLGPFSLGVQAAVNFMVREQASYLWAQVTGRIELLFFDLEA
                     TVTLAFGDEPQLTLPDADRHPLDRFAGSVRDGSLGALTDDSYRVLAPLVEDPNRITPE
                     MYVWPDAIVSLPFAIAPVIGPDAGSQFPGILGPGALAPMKVGSEMLCYQWQLDALTLR
                     DVTAEPDPTVGGTVPPGAGLAASWQVPRIAGAGSSDVAELVLLSNGRDLWVNRLADAG
                     EERRPPILQASADLCRRRVSAQPGWAVGWLAGPANPGFRLPPEPVTTNRLHSRVQATM
                     HHFGVALETGPTALDEVFTVPPPFWIDPAQLIGWPASEEIKHVFHGHLDAPNLRAPAD
                     MTVGELIEAGCAFVAQQITLDPVETILDGLLVLAAERELFEIGERFAGIQVWDDLGEQ
                     WPVTDFIDLPTGQSAALLRAPSADGVSSITVTFPIGATLGVVGLGGVTVSAWEAAKRE
                     NDAIASEVSRLQQAASQGPKTDPSVNSPHERAILAPGRLYRIDVDMSWSGEISKQDKS
                     GQIVVVATRSDETTYTPQGSATALPTRRQLFFRTAPVPQPQPLPRYGAQGYLPWLLIR
                     QDMFQPEMLERYLGGYEPAQSEAYRFCDDPLRAHFRQDHVAALAKTYGFDLRVAVRRL
                     DRPGPQHALPQLLPMAWTAALRPGHLSYADQLRWSYAVDSACGVPRPGATGSASLQLD
                     PEAWYEVYVLAKAANPLLADGRLPGVTFRTSRWRTPRTMLAGLGFPTAGEPSPAGLVV
                     GDLLVNTPVSVGGGFSEDDQEYQRALSALGLEGWPLATVPRLSRLWVRGAGAGWLLAG
                     LMIESPEPIHRPGRLTVSLALKSAAGGETSFDIGRSDRSGSRLIHLASRPFQVNDPLG
                     GFAQFVLRARSWLGTEVIDLRGMSAVPRRPAFWEDPS"
     CDS             complement(399833..400399)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03630"
                     /product="hypothetical protein"
                     /protein_id="BEH01082.1"
                     /transl_table=11
                     /translation="MNTSHDDHPDPTVNPLVSEMLAAGKDQTTSIEGFVGKVEAGMVR
                     IYANLGLNHYIEVPEAALVRVVEARDPKGPAVLILRRDVPITYVQTHHRAGISVSQSI
                     TTSIDALSAIDIGDVNAAHDCGCGPVPAQAMARQSGGGPEVSICTWSCQERALQCLAR
                     SGPLTSLWCYLNYGLCRVGCEIPPVIYV"
     CDS             complement(400410..401411)
                     /codon_start=1
                     /gene="tgmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027302.1"
                     /locus_tag="brsh051_03640"
                     /product="ATP-grasp ribosomal peptide maturase"
                     /protein_id="BEH01083.1"
                     /transl_table=11
                     /translation="MTSSDQRPVLIVAPTEDVHARAVAAVLDRDFAVPAVIWDRATLP
                     RDTAIDFRVGAAGSTAQLHTDAGDFPLDDFRSVWWRRALGFEIDPAVSDPRVRRYCAT
                     ECDAFVKGVTRSLAVPFVNDPFAEIVASRKPFQLVTASRLGIPIPETLVTNNPAAVTD
                     FWQAHHGDCIYKPLNAPDWTLPETRVLTQDDLTHLVKLRHAPMIVQEKIEKGVDVRVN
                     IFGSQVFACEFDSALPEAQLDWRLDLTAQWRAHDLPTALGDRLVDLLRVLGLHYGCID
                     LRRQPDGEYRFFEVNPSGQFLFAEIDTGQPLLNALATLLVAQEAAAFEHHPEPSVRV"
     CDS             complement(401408..402010)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03650"
                     /product="hypothetical protein"
                     /protein_id="BEH01084.1"
                     /transl_table=11
                     /translation="MSTEQSSAHLRKLIESVKADWRGTHRKLPDPAIFALQDERVVAA
                     IESRFASGVRLTDIRQLEYNFATGLNALVFDFDRAADDLASLATDAFLVLLNGDGAVV
                     ALVDPFDPVQPNKYVPPLPTTGEQPFVLERPSATDTVAFEDAAVGQAEARARAFMSRL
                     GVVDGLLINTTWCDYATHTPVGWKSDRTSDDCAPIDTILT"
     CDS             complement(402416..403204)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03660"
                     /product="hypothetical protein"
                     /protein_id="BEH01085.1"
                     /transl_table=11
                     /translation="MSTFLKSGPAIALCMVVAGLLPVAAAHGCDGSYNMLGGIETCTN
                     GSEVEVNAGISAPGSSSGSSGGVAPASSVPVPEGAVVVGGVVVCVPNPGEACLTPIPV
                     APGAGGVDVAASARSAAASLGVPAPVIGLSPEPSGNRWGALGVGLPIWAWVDDPGSLS
                     ASASQDGIDVSLSASRGSVVFDWGDGTSSTCTQMVQRPVGVDPLMPSPVCGHAYLKAG
                     DYTITATSSWDVLWQALGQQGRVGLSSSATYQMPIREFVTVVIG"
     CDS             complement(403189..403575)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03670"
                     /product="hypothetical protein"
                     /protein_id="BEH01086.1"
                     /transl_table=11
                     /translation="MSSLELRDQFELRGDYSEFPAELQDFVADPYLSWLRETFEFMKE
                     KRWRAPEGAEPVLTLRPYPGVSRDGSEVALQACMDTRATPALDEQGQVVSEGAIGYLE
                     LYFKRYDDKLKLFYGTTNKVEVCPLS"
     CDS             403574..403759
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03680"
                     /product="hypothetical protein"
                     /protein_id="BEH01087.1"
                     /transl_table=11
                     /translation="MNTLSASAYNASISASTELGGAGTETEGDGEPGLSSTPSDEQPA
                     STSDTAKATTAKTERCI"
     CDS             404065..405078
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001072162.1"
                     /locus_tag="brsh051_03690"
                     /product="Fic family protein"
                     /protein_id="BEH01088.1"
                     /transl_table=11
                     /translation="MRGRPSRATVYARLDSQLTELRNRFGGLPSPEESAYVWADIWHL
                     EAHHSTALEGNTLVLREVETLLDQGKAVGAKPLREYMEVKGYGDAASWVYREALGAGD
                     RTANALITLQEVRHIHYLAMTLVWQVSPHPDATDAESPGNFRRHDIHPFEEGMTPPSW
                     PLVPSLLDEWVTTINEIPTRLSGGANLPELLAEAHNHFERIHPFIDGNGRAGRLALNL
                     VLVRLGYPPVVVLKEQRAAYLRAMQRADGGDFGPLGEILARGMIDNLNRFILPNVAGP
                     AKLVPLASLVEHDLSLVALRAAAKRGRLDAHQRSDGQWLSTRKAVEAYKKSRHPGARR
                     TTE"
     CDS             complement(405139..405930)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03700"
                     /product="hypothetical protein"
                     /protein_id="BEH01089.1"
                     /transl_table=11
                     /translation="MPIRLSYGFATLLCAAALSALPVAVAHADCVSAQGAYGSIQTCS
                     GGSSLDVSAGATAPGSSSGSSGGVAPASSVPVPEGAVVVGGVVVCVPNPGEACLTPIP
                     VAPGAGGVDVAASARSAAASLGVPVPVIGLSPEPSGNRWGALGVGLPIWAWVDDPGSL
                     SASASQDGIDVSLSASRGSVVFDWGDGTSSTCTQMVQRPVGVDPLMPSPVCGHAYLKA
                     GDYTITATSSWDVLWQALGQQGRVGLSSSATYQMPIREFVTVVIG"
     CDS             complement(405915..406481)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03710"
                     /product="hypothetical protein"
                     /protein_id="BEH01090.1"
                     /transl_table=11
                     /translation="MHRSVFAVVALAVSLVLAGCSPGGVDESPDSPSPSVSVPAPPSS
                     VNAETEALYAEAEYVFLQSMEFRYRFERDGDYTSFPEELGDLLADPFLASVRQLYDYG
                     QQHGLHGQAGTQPKLAIRPYPGASKDGSEVALRVCLDTTEAPALDADGQVFSEGGLFF
                     MELFFKHVDGRLKLFSGTTTEIEQCPFD"
     CDS             complement(406700..407068)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03720"
                     /product="hypothetical protein"
                     /protein_id="BEH01091.1"
                     /transl_table=11
                     /translation="MDRRAGMGAMKLTVPIDEDGQVDSRFGRAARMAVGTVTDGGQLA
                     DWQVYDVGWDVLHDQSAHGQHHARVVRFLKDNEIDRVVFVQAGQSMLHTIDKMGLLLV
                     QAPVMDAKDAILQAAALQEG"
     CDS             complement(407087..408226)
                     /codon_start=1
                     /gene="dprA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_176742183.1"
                     /locus_tag="brsh051_03730"
                     /product="DNA-processing protein DprA"
                     /protein_id="BEH01092.1"
                     /transl_table=11
                     /translation="MTDWDDERLARAVLTLVCEPGHLKLSRLISAHGAAATVDALRRS
                     GDESAWAQRAKKADEAALRRNAEAAGLRFLIPGDPEWPARLDDLGNAVEVQGLGGIPV
                     GLWAAGPLRVNEAAARSVAVVGARAATRYGEAVAGDLAAGLARESNGYVVVSGGAYGI
                     DAAAHRGALASQGESIGIYAGGLDEAYPRGNGRLFEELKAEHLVISEMAPGIRVTRAA
                     FLARNRLIAALTIGTVVVEAAARSGARNTASWASELGREVMAVPGSVHSAMSAGCHRL
                     IRDGQATLVSDVDDVRALLAPMGLGPALADRGPDRMLDSVDPELLAVRESMPARSGIS
                     VPELAAKCGQPVPRIVGALVELEVLGLVAQDQTGAWRLKRSARAS"
     CDS             complement(408223..409746)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223857.1"
                     /locus_tag="brsh051_03740"
                     /product="YifB family Mg chelatase-like AAA ATPase"
                     /protein_id="BEH01093.1"
                     /transl_table=11
                     /translation="MSTASAWSVALLGMEGTLVEVEAAIGGGLPRTVLVGLPDTALYE
                     ARDRCRAAVAGAGLAWPNQLLTINLTPASLPKAGSHYDLAIVAAILAASDVVPRRIAA
                     SSVLVGELGLDGRVREVRGVLPALLAAREVGFGTAIVPAGQVAEAQLVAGITVWGVGC
                     LADLIEVLHGRPVLGAGPEPAPAEPRPCAYAPDLADVRGQREACWAMEVAAAGGHHIL
                     LHGAPGVGKSMLAERLPGLLPDLSIEEALEVSAVHSLAGHSLNDGLIRRPPYSSPHHN
                     ASMAAMVGGGARVARPGAISLAHRGVLFLDEAPEFSVRVLDALRTPMETGKVTIARSG
                     SQVCYPARFQLVMAANPCQCGMLGVPGANCSCTPMSLRRYNERLSGPILDRIDIHHRL
                     LPSLVVSSDVTAGEASATVAARVAVARERQSSRLRELPWRLNGDLPGAELRKLPHPQG
                     MSLLDDAVRSGRLSARGVDKVLRIAWTLADLDARDRITRAHLAAALGLRQDSWRCAA"
     CDS             complement(409743..410138)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005081582.1"
                     /locus_tag="brsh051_03750"
                     /product="YraN family protein"
                     /protein_id="BEH01094.1"
                     /transl_table=11
                     /translation="MMRRSDSALDNRKQLGGWGEDLAADYLMSLGWVVTDRNWRCSVG
                     EIDLACLEPCSGDLPNGVIVEVKCRSGTGFGDPLEAITYAKRQRLRQLATSWRRASGL
                     AVSSLRVDAVGILKLPGSAPLIRHVRGVA"
     CDS             complement(410254..410565)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003096226.1"
                     /locus_tag="brsh051_03760"
                     /product="DUF2469 domain-containing protein"
                     /protein_id="BEH01095.1"
                     /transl_table=11
                     /translation="MSSDDLEAYEAKLELDLYREYKDVVDIFTYAVETERRFYLCNQV
                     DLKVRTEGGDVYYEVSMGDAWVWDMYRPARFVKSAKVLTFRDVSIEEIQHRELEVPDQ
                     E"
     CDS             complement(410562..411206)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003414713.1"
                     /locus_tag="brsh051_03770"
                     /product="ribonuclease HII"
                     /protein_id="BEH01096.1"
                     /transl_table=11
                     /translation="MSTIRPGKGIFGYERALWRAGFDLVAGADEAGRGACAGPLVAGA
                     VILDERAVRHLDGLNDSKLLSAATRERLYDEIVACALAWSAVEVSPSECDQLGMHEAD
                     LQGLRRALLRLDPQPGFALTDGFAVSGLACPGLAVWKGDQVAACVAAASIIAKVTRDR
                     IMIDYDAQYEGYGFAEHKGYCTAEHQRRLEDLGPCPIHRLRYENVQAAARVASQ"
     CDS             complement(411206..412024)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03780"
                     /product="hypothetical protein"
                     /protein_id="BEH01097.1"
                     /transl_table=11
                     /translation="MGRRRKGDEQVAEVDDLDAPPARRPSKFNQVVTFAGETLLAILV
                     TLVITALLRVFVFQVFQVPSGSMEETLELKDRIVAMRVSDFERGDIVVFEDPDAMWMG
                     VQPASTNPVREVLEALYLLPDSSQGYLVKRVIGMPGDHVACCDQQGRVTINDVAIDES
                     SYLYKDASGLSVAPSDTPFDVIVPADRIFVLGDHRDRSGDSRLHMCEATHNGVPAGMY
                     GFIPIGNVVGPVVAVVAPLNRITTFSVPQTFAGVPDAVDDPPAAPVLGEGSCGG"
     CDS             complement(412131..412478)
                     /codon_start=1
                     /gene="rplS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973398.1"
                     /locus_tag="brsh051_03790"
                     /product="50S ribosomal protein L19"
                     /protein_id="BEH01098.1"
                     /transl_table=11
                     /translation="MNPIIAEFDKASVRSDIPEFRPGDSVRVHVKVVEGNKSRIQVFA
                     GVVIARTGSGVQEAFVVRKVSYGTGVERTFPLHSPIIDHIEVERRGDVRRAKLYYLRG
                     LRGKAAKIKERRD"
     CDS             complement(412828..413595)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257749.1"
                     /locus_tag="brsh051_03800"
                     /product="succinate dehydrogenase/fumarate reductase
                     iron-sulfur subunit"
                     /protein_id="BEH01099.1"
                     /transl_table=11
                     /translation="MKLTLKIWRQPRGAQQGKLVEYQIDNISEDTSFLEMLDQLNEEL
                     TAAGEEPVAFDSDCREGICGMCGVVINGTAHGRGNSPVPTTTCQLHMRSFNDGDTITI
                     EPWKAQAFPVIKDLVVDRTAMDRIIQAGGFISVNTGSAPDAHANLAPKLQADRAFDNA
                     TCIGCGACVAACPNASAMLFTSAKITHLGNLPQGQPERFLRIKNMVGQHDSEGFGNCT
                     NIGECAAVCPKGIPLESISALNRDLVWSLFRKDGFTA"
     CDS             complement(413592..415616)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257750.1"
                     /locus_tag="brsh051_03810"
                     /product="fumarate reductase/succinate dehydrogenase
                     flavoprotein subunit"
                     /protein_id="BEH01100.1"
                     /transl_table=11
                     /translation="MTETTTPKFAFSDDADYFIVGDEIHDTKADTAQPIDKVWPDRQF
                     RAKLVNPANRRKITIIVVGTGLAGGAAAASLGEAGYNVLNFCYQDSPRRAHSIAAQGG
                     INAAKNYKNDNDSVYRLFYDTVKGGDYRARETNVYRLASVSGNIIDQCVAQGVPFARE
                     YGGLLDTRSFGGVQVQRTFYARGQTGQQLLIGAYQALERQVAAGTVEMFPRHEMLELI
                     VKDGIARGIVARDMVTGDVAPYTADAVILATGGYGNVFFLSTNAMGCNVTAGWRAHRK
                     GAYFGNPCYTQIHPTCIPVHGDNQSKLTLMSESLRNDGRIWVPKKAEDCTKDPREIPE
                     EDRDYYLERIYPSFGNLVPRDIASRQAKNMCDEGRGVGPLVKEKDANGVEHEVRRGVY
                     LDFSDAISRLGKHGVEVKYGNLFDMYKQITAEDPYELPMRIYPAVHYTMGGVWVDYDL
                     ETTIPGLFVAGEANFSDHGANRLGASALMQGLADGYFVLPNTINDYLAGHHLGGLPDD
                     DPAVVEAVTATKVQIDKLLSIKGNRTVDSFHKELGHIMWEYCGMARSEEGLKKAIGMI
                     RDLRAEFWRDVNVTGTAEDLNQTLERAGRLVDFFELGELMCIDALHRRESCGGHFRVE
                     YQTEEGEALRHDEEFAYVAAWEYTGAGNKPILHKEPLVYKAIELKQRSYK"
     CDS             complement(415616..416350)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257751.1"
                     /locus_tag="brsh051_03820"
                     /product="succinate dehydrogenase cytochrome b subunit"
                     /protein_id="BEH01101.1"
                     /transl_table=11
                     /translation="MATKLVTRDSSRTANNRAVHSTVFRKVLMSVTGLFLVLFLLMHM
                     FGNLKLLIPNVGLQEFDEYSHFLRTFLYPMLPERFFLMLFRGVLLLAAVVHIEAAVRL
                     TFRDYDARMGMGRYLKQRYLAGSFAARTMIWSGVIIILGVIFHLLQFTTQTITVGYTG
                     TVEPHMRVILGFQQWWLVLAYAIFVGAVCLHIYHGFYSAFCTLGARVGAFSEKVISVC
                     SWIVCLLVFFGFMASPLAIFFGLVTA"
     CDS             complement(416419..417129)
                     /codon_start=1
                     /gene="trmD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804623.1"
                     /locus_tag="brsh051_03830"
                     /product="tRNA (guanosine(37)-N1)-methyltransferase TrmD"
                     /protein_id="BEH01102.1"
                     /transl_table=11
                     /translation="MRIDVFTIFPDYLAPLQLSLIGKAIEDGLLEVHVHDLRQWTHDR
                     HRTVDDTPYGGGAGMVMKPEPWGEALDALLASYGPITDGPRPVLLVPTPSGRPFTQAM
                     ADELAAAPRIAFACGRYEGIDHRVIDWARQYFDVSEVSLGDYVLNGGEVAALAMIEAT
                     VRLVPGVIGNSLSLVEESYSAASDHLLEYPVYTKPASWRGFDVPEVLLSGHHGKVAQW
                     RHEQSVEITSRRRPDLIT"
     CDS             complement(417129..417656)
                     /codon_start=1
                     /gene="rimM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223850.1"
                     /locus_tag="brsh051_03840"
                     /product="ribosome maturation factor RimM"
                     /protein_id="BEH01103.1"
                     /transl_table=11
                     /translation="MSETVEVTVGVISRAHGVRGEVYVEPRTDEIKRRFTAGAQLRTN
                     QGGTLTVQTVKQPSGRLVVSFREITDRTAAEQQRGCVLSAVVPADERPSGQEEYFDRQ
                     LTGLTVLRADGTASGTIKEIVHGPAQDLLVIDLNGSEYLVPFVKALVPDVDLDAGSVR
                     LADVPGLLDDGAEEG"
     CDS             complement(417730..417987)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973401.1"
                     /locus_tag="brsh051_03850"
                     /product="RNA-binding protein"
                     /protein_id="BEH01104.1"
                     /transl_table=11
                     /translation="MLAEALEHLVQGIVTHPEDVRIRDKELRHGRMLEVRVHPDDVGK
                     VIGRQGRTASALRTVVQALAGREQVRVDFVDVDRKPGRGRR"
     CDS             complement(417990..418412)
                     /codon_start=1
                     /gene="rpsP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007444852.1"
                     /locus_tag="brsh051_03860"
                     /product="30S ribosomal protein S16"
                     /protein_id="BEH01105.1"
                     /transl_table=11
                     /translation="MATKIRLKRLGKIRSPHYRVVVMDSRTRRDGQAIEEIGIYHPKN
                     EPSLIRIDSERAQYWLGVGAQPTEAVVALLKRTGDWQKFTGDDSPAGIDPQPEPTDKL
                     ARFNAALAEADGEPAAEAISRKSKKAEAEEAAEATEEA"
     CDS             418622..419806
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015777090.1"
                     /locus_tag="brsh051_03870"
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="BEH01106.1"
                     /transl_table=11
                     /translation="MSEYDYLIVGGGEAANAAAHGIRELDSSGSIGIISADTDAPYDR
                     TALTKALWLDPEVNEQTISENTASDTGATILLDTPVRAIHRATHEVTISGGESVGYQK
                     LLLATGSAPTQLAGASDERIIAMRSLANYRKVRELVTDDPTAVVVGGGFIGTEIAAAL
                     AANGVAVTLIFPQQVLGSTVFPGKLADRFHQLYLDHGVTLVPGRLAKGALVGADQRPG
                     VLLDDGSEYFAGVVVAGLSAKPVLDLASEAGLEVNRGVVVDAHLKTSDPDIWAAGDIA
                     EYPDVILGRTRIEHVDHAQNSGATAGRSMAGSDETYDHTPYFWSDAFELGWEAIGRLD
                     ARLDTEVVELGEGRDVVYYLDEQSRPVGVLLLGVWDSIDKARKVLADAPTDRAELRSR
                     IV"
     CDS             419851..420465
                     /codon_start=1
                     /gene="rutB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012602395.1"
                     /locus_tag="brsh051_03880"
                     /product="peroxyureidoacrylate/ureidoacrylate
                     amidohydrolase RutB"
                     /protein_id="BEH01107.1"
                     /transl_table=11
                     /translation="MAESLTINPATTALVLIEFQNEFTSPGGVLHDAVAEVMDSTGML
                     DNTTALVDKAREAGVTIMHAPITFAPGYCELTRHPYGILKGVVDGNAFVKGTWGAAIV
                     DDLTPVAGDILIEGKRGLDTFASTNLDFILRSKGIDTIILAGFLTNCCVESTMRSGYE
                     NGYRVITLTDCTAATSTAEQENAIAFDYPMFSEPVASAEVAAAL"
     CDS             complement(420532..421605)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728338.1"
                     /locus_tag="brsh051_03890"
                     /product="amidohydrolase family protein"
                     /protein_id="BEH01108.1"
                     /transl_table=11
                     /translation="MASWHLNGVVLPGTEPVDLWIDDGLISAEPVAGAETLGSGWWIM
                     PGLVDAHSHIGLGAGGAVDRVTAEQQAITDRDSGVLLIRDAGAPVDTHWVDDRADLPR
                     IIRAGRHIARPGRYIRNFAVEVEPTELVAEVERQALAGDGWVKLVGDWIDRAAGDLRP
                     LWPADDARRAIARVHELGARVTAHCFAEQSVTELVAAGIDCIEHGTGMSAEVIEQMAA
                     QGTALVPTMTNLEYFPSFATAGEAKFPRYAAHMRALHASRYEVLGAALEAGVPIYAGT
                     DAGGSLGHGRIAQETELLARLGGVEFALGAASWRAREWLGAEGLEPGAPADLVAYRDD
                     PRVHLQTLREPALVMLRGQCYPR"
     CDS             complement(421633..423198)
                     /codon_start=1
                     /gene="ffh"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_016327355.1"
                     /locus_tag="brsh051_03900"
                     /product="signal recognition particle protein"
                     /protein_id="BEH01109.1"
                     /transl_table=11
                     /translation="MFDTLQDRLAATFKSLRSKGRLTDADIDATAREIRIALLEADVN
                     LSVVKEFVSRIKERASGAELSRALNPSQQIIKIVNDELVSILGGETRLLRYAKQPPTI
                     IMLAGLQGAGKTTLAGKLGAWLKEQGHSPLLVAADLQRPQAVEQLRVMAERAKAGIYA
                     PQPGNGVGDPIQVAQNSIDYAKHHLFDVVIIDTAGRLGVDTEMMRQAQMIKALTKPDE
                     TLFVVDAMIGQDAVNTALAFEQGVGIDGVVLTKLDGDARGGAALSIARVIGKPIMFAS
                     NGEKLTDFDIFHPDRMASRILGMGDMLTLIEQAEKAFDAEESAKAAEKLMGGGGQFGL
                     DDFLAQMQQIRKMGPLSKVFGMLPGASNMKAISEIDEKQVDRVEAIIRSMTPAERADV
                     GILNGSRRARIARGAGVEVRDVNELVNRFVEARKMMQSMGQMMPGMPGMGGGRRQPPR
                     QQAKKGKGGKKVSGNPAKRAAEAKAKADPALRAPSVPEALPTQAETQAAMKDFSLPPE
                     LQQMLNQQNKGPR"
     CDS             complement(423298..424509)
                     /codon_start=1
                     /gene="ftsY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_164278219.1"
                     /locus_tag="brsh051_03910"
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="BEH01110.1"
                     /transl_table=11
                     /translation="MEWIPWTVIIGVLLVAAIAGLSIVISKKRAEARGELPKKEAPAV
                     EGVASAELVETAPPVEVEAVEAEVVEPQIAAPLEETALVEPIAPVVPEIEEPEKAASR
                     LARLRRKLADSNNALARALADLLSSDRIDDETWDDFETTLITSDLGVGPTGELVGALR
                     QQLRIDGIADPEQAKDLLRSELIKLVNPDLDRTLKLEHADGAPAVLLVVGVNGTGKTT
                     TVGKLGRMLVAEDKTVLFGAADTFRAAAAEQLTTWGERVGVETIRSDEGADPASVAFN
                     AVEEGINRGVDVVLVDTAGRLHTKVGLMDELGKVKRVIEKKAPVNEVLLVLDATTGQN
                     GLTQARIFAEVVDVTGIVLTKLDGSAKGGIVVQVQRELGVPVKFIGLGEGADDLAPFD
                     AEQFVDGLLGN"
     CDS             424593..425072
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03920"
                     /product="hypothetical protein"
                     /protein_id="BEH01111.1"
                     /transl_table=11
                     /translation="MPSFLRLVIALGRRGERLLNGGFVGRDDLLFRRIGMVRLRLNCG
                     GNSGLRRQRSRDRRRWLGLPVEMTKYSAQPGSQLGLITPGASGSVHCHQEEDGQAEND
                     DKEQHHEEDSHCEPPVQLGRGRSTLSVGHTAHIDAAATPDAHLHATEVTASVRLSVR"
     CDS             complement(425059..428616)
                     /codon_start=1
                     /gene="smc"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011728333.1"
                     /locus_tag="brsh051_03930"
                     /product="chromosome segregation protein SMC"
                     /protein_id="BEH01112.1"
                     /transl_table=11
                     /translation="MYLKGLTLKGFKSFASATSLNFEPGITAIVGPNGSGKSNVVDAL
                     AWVMGEQGAKSLRGAKMEDVIFAGTSGRAPLGRAEVSLTIDNTDGVLPIDYTEVTISR
                     TLFRSGGSEYAINGHAARLLDVQELLSDTGMGREMHVIVGQGQLDQILQATPEARRGF
                     IEEAAGVLKHRRRKDKAVRKLESTQANLARLTDLIAEIRRQLKPLGRQAAVARKAATV
                     QAELRDAKARLLADDLTQARLALAGDQAAELELQARKQAAEAQLAAAHEAERAAELAL
                     DELKPRLAQAQENWYALAALAERVTSTQQVAAERMRHGDAQPATTSGRDPDALEQEAV
                     KIGEQEAELVEQVAAAEQVLAAATSRREEAELAEAAEARSYAAQLRAVADRREGLARL
                     TGQVNSLQSRLQTLGEEEARLQARLAEALARAEDAEHQYALLEMRLGGVSDGELGLDE
                     RYESAAAAQAAVSEEISALRSREQDAERLCATLAARIDALKLGLQRRDASGALLAGEL
                     ADGLLGSLSGMVKVDPAWQQAVSAALGTATEALVVTDLVTALDTFDRLKTEDLGRAGL
                     LLGDAPGQNPAEWPELPDGIGWAVDAIQADPRIVPGLWQLLDKVALVPDLEAARALVS
                     ALPQVRAATAEGDLVTSWFASGGSSAQPSVIEVQARIDEAQTQFDAARHETEQIRFAL
                     SAANERLRQAEQQTAIAAEQLNESDAQMSALTEQLSTLGQAGRGARADAARLQAAIEQ
                     AGRNQASNREKLAELEDRLAAAGSEHDLAEPDAAQRDRLAGLARQARETEMQARLALR
                     TAEERARSLAGRADSLHRAAQAERLARQQAQARADQLRREAAAAGAVFQGAQWLAARV
                     QLAKAAAGAERQAVEVARQEAEAALGHHRAAARASAKQLETLVEGEHRDQMARIELTM
                     QLERLTERALTELGLEADVLVDEYGPDQLIPVLVNPDGSAIDPEDDDLPEPVPFVRAK
                     QEARLRAAQRNLDALGKVNPLALEEFEAMNERHQFLAEQLDDLKKTRKDLLDIIDQVD
                     KRVQEVFAAAYDDVAKTFSEVFSRLFPGGEGRLVLTDPSDMLATGIEVEARPAGKKIR
                     RLSLLSGGERSLVAVGFLISLFIARPSPFYILDEVEAALDDINLSRLLSIYEELRENS
                     QLLVITHQKRTMEIADALYGVTMRGDGVSTVISQRLSER"
     CDS             complement(428618..429193)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003858634.1"
                     /locus_tag="brsh051_03940"
                     /product="GtrA family protein"
                     /protein_id="BEH01113.1"
                     /transl_table=11
                     /translation="MSEEPQPSRSRLLSTAVQFIKFGIVGGSGIVVNLIVTYIMTQLH
                     GGVGNDNAVIIDLPGRFAFRFTVLVWIVAFIVANTWNFQLNRSWTFKRAQTRSWWAEF
                     WPFFLVGAVAAAIGALIKVALTNPTSPVYLPSPIFNDHEGLRARAYWAQLFTIVLTMP
                     INYLINKVWTFRAVKDAKPEPASEPSEHEVV"
     CDS             complement(429205..430071)
                     /codon_start=1
                     /gene="mutM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223692.1"
                     /locus_tag="brsh051_03950"
                     /product="bifunctional DNA-formamidopyrimidine
                     glycosylase/DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="BEH01114.1"
                     /transl_table=11
                     /translation="MPELPEVEVVRAGLASSVGGRTIGAVRVLHPRPVRYHLSGPDAF
                     ASDLVGRRVGVARRRGKYLWLPLDDTDALLVHLGMSGQFRIDDADAPLLPNTRVLFDF
                     TDGGPQLRFVDQRMFGGLQLAPGGAELPRQIQHIALDPFDDGFDPDRVAAFLRARRST
                     VKRALLDQTMVSGVGNIYADESLWRARLHYNRATEGLSQRKAVELLNAAKLVMLESLD
                     QGGTSFDALYVHVNGNSGYFSRSLQVYGRAGQPCPRCATTIIREPFMSRSSYRCPRCQ
                     RRPPMSSAEHAR"
     CDS             complement(430064..430807)
                     /codon_start=1
                     /gene="rnc"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973423.1"
                     /locus_tag="brsh051_03960"
                     /product="ribonuclease III"
                     /protein_id="BEH01115.1"
                     /transl_table=11
                     /translation="MRADNGGSAASLPFLSLIEELDVPLDADLLDLALTHRSYAYEHG
                     QIPTNERLEFLGDSVLGVIVTEYLYRSYPDHAEGQLAKLRASVVSAVSLAMVARKLNI
                     GPMIKLGKGEISTGGSDKSSILADTTEALIGAVFLSGGREAAERLVHHIFDPLVDHAA
                     TLGAGLDWKTSLQEVAASLGLGPTVFDIEESGPDHDKRFAAWAVFGDRRFGPGKGHNK
                     KHAEQEAAAAAYKALTAEPASAGPAGGDA"
     CDS             complement(430816..431007)
                     /codon_start=1
                     /gene="rpmF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223689.1"
                     /locus_tag="brsh051_03970"
                     /product="50S ribosomal protein L32"
                     /protein_id="BEH01116.1"
                     /transl_table=11
                     /translation="MAVPKRKMSRSNTRSRRSQWKTTAVQTVTCANPACRAQHLPHTA
                     CPSCGQYGPRGDRRQVLEG"
     CDS             431433..431903
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_03980"
                     /product="hypothetical protein"
                     /protein_id="BEH01117.1"
                     /transl_table=11
                     /translation="MSVAAAFAVLAGLIAVSLALAAVLARTRGRGRVVRPSRAGSLPE
                     LPIADAELGDTATFVQFGMQSCAPCRATARRIQAFAAENSGVRHIEFDISQHPDLASK
                     LKIVSAPTTFLLDSHGNIRVRISGLPHPDELVHHVESLAPANDTNQPGAVDVHA"
     CDS             431890..432369
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013230720.1"
                     /locus_tag="brsh051_03990"
                     /product="DUF4395 domain-containing protein"
                     /protein_id="BEH01118.1"
                     /transl_table=11
                     /translation="MSTPETAVPTHKPKQIDPRGPRVAAAFTSILLAVTIVVALTGQN
                     VAALILLAVIVVLFALGAAGSPAYPWSLVFTKLIRPRLAPPAQTEDAAPPRFALLVGL
                     IITGIGLIGGLAGIQLAVPIAAGFAFVAAFLNASIGFCLGCEIYGLIVRIRTASSRD"
     CDS             432401..432868
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04000"
                     /product="hypothetical protein"
                     /protein_id="BEH01119.1"
                     /transl_table=11
                     /translation="MPSRLASRTLRPVATLHPLFAAIGNTPLVELSRIGGLPHGVRLF
                     AKAEFMNPGGSIKDRAAAAMVLDGIERGLLRLPSPDEPQQQLPTIIDATSGNTGIALA
                     MIGAALGIGTTLVMPENTSPERKATMRNLGATVIDTACWAAAHPTRCSASACG"
     CDS             432844..433467
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04010"
                     /product="hypothetical protein"
                     /protein_id="BEH01120.1"
                     /transl_table=11
                     /translation="MLGFGLRLNDGDEIDLVRQVRSVANPCLGVPFFRIPVQISRLPG
                     QVVIDVVDGPDISEFGDTADRIFEAPYVVGVQSNHVGLRLGGPMPVRQTTAEVLSRGV
                     PVGAVEAPAGDQLLVLHRGRGVTAGYPVLSVVTEPGLDLMAQLRPGDQMSFRRVSLAR
                     ATQNARQRRAQIDRLQNTVGQAFEALGLFDNASGDPRWSATPTSNNR"
     CDS             433480..434247
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014537817.1"
                     /locus_tag="brsh051_04020"
                     /product="SDR family oxidoreductase"
                     /protein_id="BEH01121.1"
                     /transl_table=11
                     /translation="MPYNDYRTALVTGASTGMGEAITRCLVAHDITVHAVARNESSLQ
                     KLAAELGVIPHALDLRDLDAVAEQLSGLEIDILVNCAGVSRPGNVLDSSADDLDALVD
                     VNLRAILQLARILVPGMVERDLGHVINISSIAGIYNFYGHTAYHATKAAVHQLSRQLR
                     NDTVGRRIRVTEICPGRVETEIFGRNMGGTPEALQEAWETYYEGYESLTTADIVSAVD
                     FAIAAPRHMNVSMMEILPTFQVPGGLVFDRREEPAGE"
     CDS             complement(434440..434976)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973424.1"
                     /locus_tag="brsh051_04030"
                     /product="DUF177 domain-containing protein"
                     /protein_id="BEH01122.1"
                     /transl_table=11
                     /translation="MNEHQTLDLRSPWVISIHELVRRPGELKEFHREIPAPANVGIEM
                     IGVPEGSPVDVDLRLESVSEGVLATGVVSAELVGECSRCLGEVREERDFDLQELYYYP
                     GRDAEEDALFVVDEYIDLDPPMRDAIVLELPFTPLCREDCLGLCPICGFNLNDDPEHN
                     HGEQIDPRWEGLELFKAD"
     CDS             complement(435139..435636)
                     /codon_start=1
                     /gene="coaD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005056942.1"
                     /locus_tag="brsh051_04040"
                     /product="pantetheine-phosphate adenylyltransferase"
                     /protein_id="BEH01123.1"
                     /transl_table=11
                     /translation="MTTSDAVPVRAVCPGSFDPITRGHLDIIHRAASVFSEVIVAVGL
                     NTTKNYMFDFDERLALTADAVADMDNVRVAPIEGLLVDFCKKQGAKVIVKGVRFGSDF
                     DYELQMSQLNRQLSGIETVLLPAGREFGTVSSSMLREVAHNGADISAFVTDAVNRAVL
                     AKVGR"
     CDS             complement(435633..436241)
                     /codon_start=1
                     /gene="rsmD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014466716.1"
                     /locus_tag="brsh051_04050"
                     /product="16S rRNA (guanine(966)-N(2))-methyltransferase
                     RsmD"
                     /protein_id="BEH01124.1"
                     /transl_table=11
                     /translation="MTRIIAGSARGNPLRVPPGERTRPTTDRVREAFFSALATWAGGS
                     GAPADQQLAGIRLLDLYAGSGAIGLEAASRGARDVVLVDSFRPAVEIIRRNAAATKLA
                     DRVSVRASDVGAFLGVPPAAPFDVIWLDPPYALAGRELDEVLSRLADGWLARDGLVVV
                     ERARRDPAPAWPPELADRWSRHYGETELYFARPAPVSVEEGQ"
     CDS             436382..436807
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003896644.1"
                     /locus_tag="brsh051_04060"
                     /product="pyridoxamine 5'-phosphate oxidase family
                     protein"
                     /protein_id="BEH01125.1"
                     /transl_table=11
                     /translation="MSDNNSPVTIIPEESCWGYLASQEVGRLGVSSHDVPEIFPINYY
                     VDGESVIFRSAEGSKMDLLALNKNVVFEVDGWTDEGGWSVMVKGIAERITDEDELARA
                     RKAPLLPWIPTVKTIFVRVTPTIGISGRHFVFGPEPKQA"
     CDS             436814..437641
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011015208.1"
                     /locus_tag="brsh051_04070"
                     /product="sugar phosphate isomerase/epimerase"
                     /protein_id="BEH01126.1"
                     /transl_table=11
                     /translation="MWTISGFADEVADDFAAQLEFLNQRGIRFTELRSAWGVRVCDLN
                     DTQVHRIKQMLDDSGIAVSALGTDLGKIRLDDDFGAQLDRARRAADIAWYLETSDVRG
                     FSFFMDGDDDPQACRDEVIDRIGQLVAILDEAQIRYLHENESDVWGATPQRCADLASQ
                     MPRLGFGLILDPANYVQANVRPYSDAYPVVQQATRYVHVKDAHLSDGTICVAGEGDGQ
                     WPELLAALKNDGYDGFLSVEPHLARQEAFGGFSGADAWTRAHESLIRLLSAADVPYS"
     CDS             437653..438834
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776250.1"
                     /locus_tag="brsh051_04080"
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="BEH01127.1"
                     /transl_table=11
                     /translation="MNDQVRLGVVGVGVQGRLYAELVSTGRAPSLRLSALCSANPKSR
                     SHQDHAATAAGLGVPLFTDYIEMLDSGEVDAVVITVPHFEHPRFAAEAIERGVHVLLE
                     KPAGIYGKQVTRMLDVAAEHPQTTLAMMFNQRANPLFVDLKSMIDSGEFGALRRTSWL
                     LTHWWRPDAYYASSSWRASWGGEGGGVLVNQAPHQLDLWQWLCGAPLRCFARLRFGFR
                     RDIPAEDEVSASLEFPGEASGVFVTCTNDLVGTDRLELSFDKARVLVEDSLRMTIHRF
                     VDDEREIARSISAEDAALVPSGAFDRSVFFSSETREYTSAWGEQHSLLLDNFGKHILD
                     GTPLIAPAEEGLTSVRLANAMHLSAWTGQDIDLTTFDDDLYLAELNKLIEAEGRFPTR
                     A"
     CDS             complement(438892..439416)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011021228.1"
                     /locus_tag="brsh051_04090"
                     /product="pyridoxamine 5'-phosphate oxidase family
                     protein"
                     /protein_id="BEH01128.1"
                     /transl_table=11
                     /translation="MTQIAYTQRACHDQERITDFLRTQRVGVLGLHTDDYPYPVPVNY
                     VWHNDAVYFHGVGSGRKGELLQQAPKVGFTVFVEHGTVTARVACHADTAYLCVMVFGT
                     AQQVTDPAEAADALQALVDKLTPGYYRSTITARMIERYRSGTGGNPVAVFRITPDLVT
                     AKENTATADELFTI"
     CDS             complement(439492..441702)
                     /codon_start=1
                     /gene="recG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223647.1"
                     /locus_tag="brsh051_04100"
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="BEH01129.1"
                     /transl_table=11
                     /translation="MSGPWRTEAFRQLATPLAEVLGAPTSKALAALKLVTVADLMGHL
                     PRRYLSGTETTELGGLEPGEDVALVAKVAEMIAYPAHTPNGRGRLEVKLTDGTGFLRA
                     TFFGKDRYTKFWQAQLSKGVKGIFVGKVGAFNYQMQMSHPNFVMLDAQGNIVGRADQA
                     KTSMAHQVSRSGLVGIYPATSKMPTWQIAECADLVLDIVKGIDDPMPAELRSRLGLPQ
                     LYEAYRSIHRPDSIEAAERGVDRLKFDEALALQVTMAYRRADAAGHTAAPVLPSDDGL
                     LAAFDQRLPFVLTAGQVEVSEEIFADMARTRPMQRLLQGEVGSGKTVVALRAMLAEVD
                     SGRQAVLLAPTEVLAGQHFESLRSLLGDLGAGQVLGAPENATEIVLLTGSQGAAQRRA
                     ALDAIAGGGAGIVVGTHALLSETVSFADLGLIVIDEQHRFGVEQRAVLQGRAELMPHL
                     LVMTATPIPRSIAMTVFGDLEVSTLREIPAGRQDVQTTIVHALVRPAWLERAWQRIGE
                     EVAIGRQVFVVCPRISANDEVVPGDLPNPSVEELSGYLADGPLQGLRIGVLHGRLAAG
                     EKDSVMAAFAAGELDVLVATTVIEVGVDVPNASMMVIMDADHFGISQLHQLRGRVGRG
                     AFPGVCLLVTYTDGTTPADQRLAAVAATRDGFELAEVDLEQRREGDVLGASQAGGRTT
                     LKLLRVLDDAEMLAESREIAEMLVGRDPDKSSDWLADLVTETELRADADFLERS"
     CDS             complement(441852..442037)
                     /codon_start=1
                     /gene="rpmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973430.1"
                     /locus_tag="brsh051_04110"
                     /product="50S ribosomal protein L28"
                     /protein_id="BEH01130.1"
                     /transl_table=11
                     /translation="MAAVCEVCGKGPGFGHNVPWSKKKTNRRWNPNIQRVRAVVNGAP
                     QRLNVCTGCLKAGRVTR"
     CDS             complement(442206..443894)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804669.1"
                     /locus_tag="brsh051_04120"
                     /product="ribonuclease J"
                     /protein_id="BEH01131.1"
                     /transl_table=11
                     /translation="MSALQTPPRLAPDTLRIIPLGGLGDIGRNMTVFEINGKLLVVDC
                     GVLFPEDDQPGVDLILPGLDYLDDRLDDIVGLVLTHGHEDHIGAVPYLLRRRQDIPLY
                     GSKLTLAFVDGKLREHRLRDTAMYHQVVEGDTVVAGPFELEFFAVNHSIPDALAVAIK
                     TSAGVVLHTGDFKMDQLPLDKRITDLRGFARLSSDERGVDLLMADSTNADVAGFTLPE
                     KDIEPALERVFGQAPQKLVVACFASHVHRVQQILNLAVRHGRKVVYVGRSMVRNMTTA
                     QELGYLKVPGGTLIELNDIEQYPEDQVVVISTGSQGEPLSALARMANREHPIVQVGSG
                     DTVLLASSLIPGNENAVYRVINGLTRLGVTVVHKGNALVHTSGHASAGELLYTYNVVK
                     PRNALPVHGEARHLVANAKLAQATGIPADHTIVAEDGDVIDLADGIARRTGRVDASYI
                     FVDGTTVGDVTETSLTDRRILGEEGFISVIAAVDLRSQTIVAGPDINARGFLEDPTIF
                     DSITEDIRGALNDALEEGVDDPHRLQQLVRRVIGRWVSRTYRKRPMIVPVVIAV"
     CDS             444254..445183
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011265874.1"
                     /locus_tag="brsh051_04130"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BEH01132.1"
                     /transl_table=11
                     /translation="MGALLLAAMLAACGAPNDSASSQPAQSPGASGFPVDVVSGATGS
                     TDTITVDQRPEAIVSLSPTATESLFAIDAGAQVVAVDEQSNYPAEAPVTQLSGYTPNV
                     EAILNYSPDLVITAMPDPDTVASLAAAGVPTLALPPASTLDEAYDQLARLGQATGNTD
                     QAAALVADMKSRIEQAVSAAPDLSGVSYFHELDPTLYTVSSSSFIGEIYGLFGMKSIA
                     DAAPGGDAFPQLSEEFVVDANPDVILLADAQCCGVTPESVAQRPGWAEVRAVQQNQVF
                     VLNADIVSRWGPRVVDFVESISSYASQLNLEHA"
     CDS             445180..446277
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011014890.1"
                     /locus_tag="brsh051_04140"
                     /product="iron ABC transporter permease"
                     /protein_id="BEH01133.1"
                     /transl_table=11
                     /translation="MTTTRTAGTVTGTMPSTAPAVVPSAPRRARRALRWVLAVVVLLA
                     ALLAGALVGPAGLTPASVLAELANALPGVDIDSGLTTQQQAILWQIRLPRVILGSIVG
                     ATLAVSGAAYQGVFRNPLADPYLLGVSAGAGLGATIAITAGGGIGAFGVPAFAFAGGL
                     LAVGATYALGATVGGGRTSTVIILAGVAVAAFFSAIQTFVQQRFDDSLLAVYTWILGR
                     LSTNGWSDIVTIAPYVVLSWVVLLLHRRVLDVLALGDVEAASLGINVPRVRLVLVLTA
                     TLGTTAVVSVSGLIGFVGIVVPHAMRLIFGSSYRLLLPLSMLFGAAFLVLTDVAARSL
                     IAPAELPIGVVTALLGAPFFLVVLRRGRAIS"
     CDS             446274..447053
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003856445.1"
                     /locus_tag="brsh051_04150"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH01134.1"
                     /transl_table=11
                     /translation="MSILECRDLCITRGQAQVVSDLTLSVRQGEWLAVVGPNGAGKTS
                     LLHAIAGLIPLSGELRLAGQNPATLTRRQYARIVALMPQQPAVPAGMSVRELIALGRT
                     PFLHRFGTESSDDRRAVDTEIIRLGLTEFADRPVDQLSGGELQRVILARALVQEPRLL
                     LLDEPTSALDIGHQQTVLELVDQLRRERGITVLAAMHDLTLAAQYADQMLLVERGRLV
                     DSGRPSDVLQSVQLNRTYGARVEVLARDSGPAVIPVRPNRA"
     CDS             447078..447614
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04160"
                     /product="hypothetical protein"
                     /protein_id="BEH01135.1"
                     /transl_table=11
                     /translation="MTHELHPDSVRLAMPAEALGIVEVQRAWLAGQPRLAAVLDELDA
                     ETMAQAWVSAILRPPLATYRVLVALDQSNAIVGFAAVGPSDDPDAEPTDAVVAQFCIH
                     PDALGQGHEDRLMHAIADTLRADGFARATWWANADDDSTRELLDASGWAPDGAHQEIG
                     DEDDHVRIKQVRLHTALV"
     CDS             complement(447642..448337)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04170"
                     /product="hypothetical protein"
                     /protein_id="BEH01136.1"
                     /transl_table=11
                     /translation="MKRSWIAVVVVVALAAAVIGGDQLLRIHVESQIGQQIESQHGGA
                     ADVRLGGWPFALVGLTKRLPDAQVSVVDAEVANEARKATVERVDIAVTGLSPIDDLGR
                     ANAERLDATASITWNQLSVLLGFPISRVHDDRISAKTSVEIMQRVIPIELQAELSLQA
                     DGALVLDNPSVALADYTLPLPSTIVQLALDQLAPDLQLPTPAGLSYQGLSIGADTISV
                     RLTGQNVAVGDFM"
     CDS             complement(448362..449102)
                     /codon_start=1
                     /gene="dapB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228101.1"
                     /locus_tag="brsh051_04180"
                     /product="4-hydroxy-tetrahydrodipicolinate reductase"
                     /protein_id="BEH01137.1"
                     /transl_table=11
                     /translation="MIKVAVFGAKGRMGREICKAVDEAVDLQLVAGVDAGDDRTEVEK
                     AQVVIDFTHPDAVMDNIKWCIDHGINAVVGTTGFSPAKYDEVRGWLAAKPGVNVLIAS
                     NFSIAAVLLMHFAAKAAPFFESVEVIELHHPRKVDAPSGTAITTANVIAGARADADCP
                     PMPDATVKELDGARGAVVDGVHVHSVRLQGLFAHEEVVFGNPGEMLTIRDDSFHRSSY
                     MPGVLGAVRAVGKRPGLTIGIDDLLGIA"
     CDS             449195..449653
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04190"
                     /product="hypothetical protein"
                     /protein_id="BEH01138.1"
                     /transl_table=11
                     /translation="MEDPTCDPRNLVPPASSTEAFKALDHAHQQLIAAEIAELITITH
                     AADLWRIDDDAVCEGIERLMQPGHDGTPKVGEFLALEVGALLGMSPQSALFHIGDALD
                     LRHRHPALWTAVLAGKVRVWQAMKICREAAHLSAAAVWQNSTRRSPTGCR"
     CDS             449611..450264
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04200"
                     /product="hypothetical protein"
                     /protein_id="BEH01139.1"
                     /transl_table=11
                     /translation="MAELDKTVANGLSMMPLPRIMAALPGWITAADEDLARKRAAAQR
                     QSRKVQVSRIEDGHVTIWGKVDPADGIAFDRALTGIAKTLPTQPDPLFGSDLDRRRAA
                     AVGILARQAFGQDALPSHTLVVHINADDPALSPAISTSENARAATENTGTPAPATGVA
                     RVEGWGPLLTERLPQFLAESNVIVKPILDPGQLQASDCYETPDRMRFAIEQRNRVQR"
     CDS             complement(450331..452550)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973290.1"
                     /locus_tag="brsh051_04210"
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="BEH01140.1"
                     /transl_table=11
                     /translation="MEGENLKFAEAIIDNGTFGKHVVRFEAGVLAQQADGAAAVYLDG
                     DTMLLSATAAQKSPRESIDFFPLTVDVEEKMYAVGRIPGSFFRREGRPSENAILACRL
                     IDRPLRPAFVKGLRNEVQVVVTVLALNPQVEYDVVAINAASMSTQIAGLPFHGPIGAV
                     RVALIDEQWVCFPTVEQEQGATFSMVVAGRVLADGDVAIMMVEAGGTEATWNLVRSGK
                     TAPTEDVVAGGLEAAKPFIKVLCDAQAELAQQIDKETYPYPVFKEYEDDVYEQVLVLG
                     QEELDRIEQIADKLDRQAAEKDLKHSILDQMNNNEAFEGREGEISAAFKSMQKKIVRG
                     RVLRDGKRIDGRGPKDIRPLSSEVGIIPRVHGSSLFQRGETQVLGITTLNMLDMEQKL
                     DTLSAVTSKRYMHQYDMPPYSTGETGRVGSPKRREIGHGALAERAIVPVLPSREEFPY
                     AIREVSEAIGSNGSTSMGSVCASTLALLNAGVPLRASVAGIAMGLMSETDESGQTHYL
                     ALTDILGAEDALGDMDFKVAGTSEFITALQLDTKLDGIPSDVLAAALLQAKDARTTIL
                     GVMNEAIDTPDEMSVNAPRIITVHIPVEKIGEVIGPKGKVINQIQDDTGANISIEEDG
                     TIFIGATSGEAAELARQMINAIANPTMPEKGERYLGTVVKLTTFGAFVSLLPGKDGLL
                     HISKMRQLNGGQRVENVEDVVSVGQKLQVEISDIDDRGKLSLVPVIEESEEKTSEQN"
     CDS             complement(452896..453225)
                     /codon_start=1
                     /gene="rpsO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004111957.1"
                     /locus_tag="brsh051_04220"
                     /product="30S ribosomal protein S15"
                     /protein_id="BEH01141.1"
                     /transl_table=11
                     /translation="MSKSPHSQPAPGAPRNELERLIMDAETKKKIIEEYATHPGDTGS
                     PDVQIALLTARIAHLTEHLKIHKGDHHSRRGLMLMVGQRRRLLNYVAKEDIDHYRALI
                     ARLGLRR"
     CDS             complement(453291..454205)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973315.1"
                     /locus_tag="brsh051_04230"
                     /product="bifunctional riboflavin kinase/FAD synthetase"
                     /protein_id="BEH01142.1"
                     /transl_table=11
                     /translation="MRRSVVAIGNFDGVHTGHQQLLRTAVEHAQELGTEREPLQVIVV
                     TFWPHPMSVVAPGHQPLLLTSLSDRIDLLRRYGADEVRVVQFTRDVAAWSPQKFVDTI
                     LGPLDPAVVVVGENFTFGNRAAGTPQMMREFGKGRFDVDIIHLVSIDSERTCSSFVRS
                     ALATGDVAAAARHLGRLFRLSGVVVVGDQRGRELGFPTANLPVAADLATPADGVYAGW
                     LRRLDQPSAIRMPAAISVGTNPTFDGVERRVESYVLDRTDLELYGINIAVEFVEHLRG
                     QVRFGSIDELIEQMNKDVAATRAVLGID"
     CDS             454410..455009
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011405274.1"
                     /locus_tag="brsh051_04240"
                     /product="MarC family protein"
                     /protein_id="BEH01143.1"
                     /transl_table=11
                     /translation="MELIVSSAMVFILIMDPFGNVPLFLAALAHTAPERRRRVIVREL
                     LIALGIMLAFLFGGQAFMRVFHIDAPALTVAGGVILMLIALRMVFPTPERNLREKAPD
                     DEPFIVPLAIPYVAGPSLLAMVIVLVSGNPDALPSYLVALVLAWLGSALVLYFSHGLN
                     RVLGPKTLLAVERLMGMVLVIVATQMTLEGVAEFFQIVR"
     CDS             complement(455080..455625)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223369.1"
                     /locus_tag="brsh051_04250"
                     /product="HdeD family acid-resistance protein"
                     /protein_id="BEH01144.1"
                     /transl_table=11
                     /translation="MELLGKQAAWVLIGQGALAIVLGAIVLTWPGLTVAAFALVWGIY
                     ALVDGIGELALGATSAGVQGRGWLIFSGILGIVAGIIVVFNPFMSAAVLTWVLGIWLI
                     VHGVFVFAGGFSLPGNHKWWVVVSGVLLVIAGAIFVANPAEAALSLAFLLGWLAIVWG
                     IFCTVAGIALMIGARRVGSQL"
     CDS             complement(455692..456564)
                     /codon_start=1
                     /gene="truB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003414147.1"
                     /locus_tag="brsh051_04260"
                     /product="tRNA pseudouridine(55) synthase TruB"
                     /protein_id="BEH01145.1"
                     /transl_table=11
                     /translation="MNATASGLLIIDKPTGWTSHQVVGRVRRVFGTRKVGHAGTLDPM
                     ATGVLIVGLNRATRLLGHLALHDKAYSATIRLGASTTTDDAEGEPTGGADASSLSLPQ
                     VAVAMGAFRGAIMQRPSTVSAIKVDGKRAYARARAGENVQLATREVTVGRFEVLAARP
                     VAGYLDVDVEVECSSGTYVRALARDLGDALGVGGHLTMLRRTRIGRYLLDDAVALDSL
                     TAETPLMSMAEATRLSFPVVEIDEAGARDVGFGRALDTQVPAAVTGIIGPSGELLALY
                     RPDGECSRPVAVFV"
     CDS             complement(456646..457845)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529926.1"
                     /locus_tag="brsh051_04270"
                     /product="ATP-grasp domain-containing protein"
                     /protein_id="BEH01146.1"
                     /transl_table=11
                     /translation="MTTFVYISPAYPPTNVYFCERLAASGVTVLAIGDAPYDELPNGL
                     TAALTEYYRVDSLEDYNRVYRAMAHLIARHGRVDWVESNNEYWLQLDARLRTDFNIHT
                     GRRAEKVNEIRSKVDMKQVYLRAGVPTARQIRITTLEAAQEFVAQVGYPVIVKPEFGM
                     GATHTYQLRDDAELAGFCSEPADGPMVMEEFVTGDIISYDGIVDHDSVPVFEAATLWP
                     PSIMDIVLNDLDLAYQVLDEMPDRLRELGQRVLKAFGVRNRWFHLEFFRLSDAKPGLG
                     EVGDFVALEVNMRPAGGVTVDMYNYARNADVYQIYADVVSGHDTGAARQATQDPARCV
                     YASRRDHRDYQLSSDRLAEIYGDAIVAHQRNLELFVPQMGNEYYLLRTTDAGRATAFI
                     DDVLRRA"
     CDS             complement(457990..458448)
                     /codon_start=1
                     /gene="rbfA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804655.1"
                     /locus_tag="brsh051_04280"
                     /product="30S ribosome-binding factor RbfA"
                     /protein_id="BEH01147.1"
                     /transl_table=11
                     /translation="MANPRIAKLEDQIQRIIAEMLGRRVKDPRLGFVTITDVRLTGDG
                     REATVFYTDLGRSLDGREADAAGGVSDTATALESAKGLLRTTIGQQLGLKFTPTLTFV
                     PDASEKTAQEMEDLLARVQAADAELAKEREGSAFAGEADPYKKPVEPADE"
     CDS             complement(458529..461450)
                     /codon_start=1
                     /gene="infB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014877447.1"
                     /locus_tag="brsh051_04290"
                     /product="translation initiation factor IF-2"
                     /protein_id="BEH01148.1"
                     /transl_table=11
                     /translation="MAKVRVYELAKELGLESKELLSTLNEMGEFVRSASSTIEAPVVR
                     RVTEKVKGVHKDAKSGAVDHAPAPKKSGAPAPKPKTSATPQTPQPDAPQAAAGAKVGP
                     RATPGPHPVPGPRAVPGPRPTPGQHAAPGPRQSNGNGQGGQASQSKPAQQRPHPKPGV
                     SSQPQSRPASPQSQGGPRPTPGPRRTPAPGGTGSGKAASGPRPGPTPANVRRPGAPRP
                     GNNPFSSSQGMGQARRPSQPRTGSRDGGAPRSGEGRPPRPGGGDRMPRPNPAMMPKHA
                     NPSLGTQQGAGGGGGGRGGRPGGPSRGRGGPSMGGAPGGGMAGGPGGRGGRGGRGGTQ
                     GAFGRAGSNRRGRKSKKQRRQEFDEMQAPSIGGVRIRGGDGQIVRLRRGSSLTDLAEK
                     INAEPAQLVQVLFNLGEMITATQSVPDETLEILGAELNYKIQVVSPEDEDRELLESFD
                     LEFGENEGGEHDLEARPPVVTVMGHVDHGKTKLLDALRDTNVQGKEAGGITQSIGAYQ
                     IETEVDGEERAITFIDTPGHEAFTAMRARGAKSTDIAVLVVAADDGVMPQTIEALNHA
                     TAADVPIVVAVNKIDKPGADPAKVRGQLMEFGLVPEEYGGQTMFVDVSAVTRVGLDNL
                     LEAIILTADAALDLRANPTMDAQGVAIEAHLDQGRGPVATVLIQRGTLHRGDSIVAGA
                     AHGRVRAMINDRGDTIDEAPPSMPVQVLGLTSVPGAGDNFLVVEDDRMARQIAAKRDA
                     NRRAALQAQSSRRKTLEELFEQLEKGETSELTLILKGDGAGSVEALEDALSKIEVSDE
                     VGLRVIDRGVGAITETNVSLAAASTPHAVIIGFNVRPTVQAARLADQENVDIRYYSVI
                     YDAIDEIEAALKGMLKPIYEEKTQGTAEIREIFRSSKFGNIAGCMVTDGHIRRNAKAR
                     LLRDGVVVAETSIASLRREKDDVTEVREGFECGLTLANYSDIQIGDVIETYEMIEKAR
                     D"
     CDS             complement(461753..462058)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804653.1"
                     /locus_tag="brsh051_04300"
                     /product="YlxR family protein"
                     /protein_id="BEH01149.1"
                     /transl_table=11
                     /translation="MPDRASRRPARTCVGCRESCDPAGMTRFVLDGSVLRVDASGHAP
                     GRGAWLHADPHCADTARRRGAFARSFRRKVDDAVLADWPASSSPDQACHDSDEALPD"
     CDS             complement(462051..463037)
                     /codon_start=1
                     /gene="nusA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030401.1"
                     /locus_tag="brsh051_04310"
                     /product="transcription termination factor NusA"
                     /protein_id="BEH01150.1"
                     /transl_table=11
                     /translation="MNGMDIDLSALRAIERDKEIPLEYLLKALEDALLNAYLKTDGAK
                     PGARVVLDRKLGTVAVMVPDLNEDGEQVGEYDDTPADFGRVAAATARQVIFQRLREHE
                     DEQKYGRFAASEGDILTGVIQQDRDTRSVRVDLGQIEAIMPLAEQAPGEEYTHGKRMR
                     VYVVSVRKELRGPQVIVSRTHPNLVKKLFALEVPEIEQGIVEIKEIAREAGHRSKIAV
                     HSNNPEVNAKGACIGPMGQRVRAVMHELNEEKIDIVDWDADPAKFVANALSPAKVNQV
                     IVLDPAARAARVIVPDYQLSLAIGREGQNARLAARLTGWRIDIQPDTAVEGA"
     CDS             complement(463034..463525)
                     /codon_start=1
                     /gene="rimP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011014804.1"
                     /locus_tag="brsh051_04320"
                     /product="ribosome maturation factor RimP"
                     /protein_id="BEH01151.1"
                     /transl_table=11
                     /translation="MKHTGLEEELAAVLAGHQLELDDLEVQAAGKRRVVRVTVDGDGP
                     SGTGPDLDQIADATRAISQALDDTDALGDAPYTLEVSTRGVSRPLTKPAHYRRNLTRL
                     VTLTLADGTSLTGRISAADERSVTVDVDGEERTIGFDQISKAVIQVEMNRRLTDDHDE
                     AGE"
     CDS             463635..464666
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04330"
                     /product="hypothetical protein"
                     /protein_id="BEH01152.1"
                     /transl_table=11
                     /translation="MIPPDHHRGLRRREFMRLALAGSAAVTLAACAPNPLITADQSPK
                     PQPTLDDARRQTAQSAADLAALATACAGLEDADEAFAAWCTALAAQHQAHLSVLCQAD
                     PLGGVLADPTPIEQITAATPAVPAAQAEAMQVLAQRHAELAELTSSVAATQSGGSDAD
                     QTAGMALLWISQWLCAQVAATAFGSGDAAALSPAPVQGEAVPARTEMGDAAQARQVVL
                     SHQRALVFGLQALYGRADYTQPIDGQLAARLSEAMRERDATAAAITAGGATPEPQPPE
                     YAMPGDVTDPSQTAQIWGALELAVMNAWARLAAVDAAGRADASQQALTQAGRARDLGT
                     ALPFWPGWV"
     CDS             complement(464676..466424)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223963.1"
                     /locus_tag="brsh051_04340"
                     /product="proline--tRNA ligase"
                     /protein_id="BEH01153.1"
                     /transl_table=11
                     /translation="MITRMSHLFVRTLREDPADAEVPSHRWLVRAGYIRRVAPGIYSW
                     LPLGLRVLHRVEEIVREEMNAIGAQEVLFPALLPAEPYKATNRWTEYGDTLFRLVDRK
                     GSDMLLGPTHEEMFTLMAKDQCSSYKELPLTLYQIQIKYRDEARPRAGILRGREFVMK
                     DSYSFDIDKAGLDASYQAHRAAYIRVFDRLGFDYVIVQANSGAMGGSASEEFLAVSPN
                     GEDTFVRSPGGYAANVEAVQRPLAAEVDASDVPAAQKHATPDSPTIDTLVAQANALFP
                     RADRQWVAHDTLKNVIFNLRQPDGTVEPLAIGLPGDREVDDTRLAAAVSPAEVEAFSE
                     EDFEKFPQLAKGYIGPAGLKAAGVRYLLDPEVVPGTAWLTGADTAGYHVINLVAGRDF
                     QIDGHLDVAVLRDGDQAPDGSGPLSLARGIEMGHIFELGTKYAEALGLKVLDADGKLQ
                     TVTMGSYGIGVSRAVAVVAEATCDDKGLCWPRSLAPFDVMVVATGKGDEIAEAAEKLA
                     ADLDASGVSVLLDDRKASPGVKFKDSEILGTPTCVVVGRALAQGNVEIRDRRSGRARL
                     VPLADALPEVLTEIEI"
     CDS             466530..468149
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04350"
                     /product="hypothetical protein"
                     /protein_id="BEH01154.1"
                     /transl_table=11
                     /translation="MNAQPSVATPAGKRAISIQIVLAIVGSQALAWFLIIVARLAANV
                     FGSSSLPVGQIWAAAVLIVVAGAAQAASDIVQGRSAAEAEAGLHRRVLQHAFDLGPAM
                     FTGRQTGAITAMLTDQTERVAGYRQTFIGPMIGAMVSPVLILVSVAIAIDPIAAAVLL
                     ISVPFIPLAVGGFQRAFRKVSAASRQARGKLANQFLEAIQGLTTLVLLGAAGRVGDQL
                     ADTGEENRKATMALLARNQLILLVTDAAFSLFMLTAAALVAWWRLDVGAINAAQALGL
                     VLVSALLCAPMEQIGSFFYVGMAGMAAQRQIRAFLGRDTPSQVQVAGSGSDLAVELRQ
                     AGFGYAPDRPVFSGLDLRVPPRSTTVIVGPSGSGKSTLMSMLAGDLLPDAGQCYVGGI
                     ALTAASRDQVRAASAMVRQRSWLFYGTLAENLRIARPQATDDELHQALTKVALDDWVG
                     SLPDGLDTQVGEHGLAVSGGQAQRIALARAMLSGRDLLLLDEPTSQVDQESERVILDA
                     IDEIAGRHTIVMVSHRLTATERADQILELNR"
     CDS             468146..469840
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011014865.1"
                     /locus_tag="brsh051_04360"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH01155.1"
                     /transl_table=11
                     /translation="MTTTKQLRRWLISVARPVLKPLGASIVFRHVDQLAGLALLAISA
                     GAVTKVAGNALGAPASETAWLPNTAAMLAVVLVTVSLVKGLARYLEHFFGHLVAFKAL
                     ELLRVRLYQALVPQTPALMQRSTSGDLLVRATKDIDRIEVFFAHTFPPAVTAVTVPVI
                     GVLAIGGIASWPVALVAAAGLVVSLATAWLGSGANLAVSHRVAGLRGRISQHVTDSVQ
                     GMAEVTGYGHVTRRLDELVGLDAQVAAAQRSRSRFQAARNGLQVIAMGATTLVATIVA
                     VGQGLGLVPTAVTIALIWRLFDSTAAVKDFMSSLDVSMAAAERVHRIVTVAPLITDPE
                     SSAQLPDGPLAVAWNQVSYSYPSEGIAREPAVKDVTIDVPAGTHCCLIGHSGCGKSTL
                     LQLALRFDDPQSGRVLVGGVDVRRLEAAQLRSRVALVSQSPFLFHGSIADNLRVASPD
                     ATDDQLHEVLRIAQLDEEVEAMPGGLGAPIGEQGQRLSGGQQQRLALARALLTPADVF
                     LLDEFTSHLNRDLADRVREGLRAARPRVTIIESTHLLDAVRADQVVRLDAGRLVSA"
     CDS             complement(469850..470710)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_030873433.1"
                     /locus_tag="brsh051_04370"
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="BEH01156.1"
                     /transl_table=11
                     /translation="MSGSLRILDDEDLPEFLALLGQDPLSNLFVASRVATFGLAPESL
                     GCAVYGYHVHGELIGACHVGSNLVPVGELPEALDAFVQAIGTRRHVASIVGPAAAVAR
                     LHAGLCERWGSSWTRPREIRSHQPLMVIRVPPLVEPDRRIQRVDTSHFDAYVKAAVAM
                     YTEEVGVSPLDSSGSYPRYVRLLMQLGRAIGGVVPADDARRQPERVWFKSDIGSVWRH
                     YCQVQGVWLDPQLRGRGLSIPAMAQVVVLCQQQYPVVSLYVNDFNTRARRLYTEIGFD
                     TVGELATVLY"
     CDS             complement(470724..471866)
                     /codon_start=1
                     /gene="ispG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804644.1"
                     /locus_tag="brsh051_04380"
                     /product="flavodoxin-dependent
                     (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase"
                     /protein_id="BEH01157.1"
                     /transl_table=11
                     /translation="MSINLGTPPTKPMVLAPRRPTRKIKVGTTYIGGDAPIAVQSMTT
                     TLTSNINATLQQIAELTAAGCDIVRVAVPSQDDADALPAIAAKSKIPVVADIHFQPRY
                     VFAAIEAGCAKVRVNPGNIKAFDDKIADIARAATDHGTSIRIGVNAGSLDQRLRPMYE
                     ADPAGALVQSALNEAALFEEVGFFDFAISVKHHDPVIMVDAYRRLSQACDYPLHLGVT
                     EAGPAFQGTIKSATAFGALLAEGIGDTIRVSLSAPPVEEVKVGIKILESLNLRPRQFE
                     IVSCPSCGRAQVDVYKLANDVTEGLKEITAPIRVAVMGCVVNGPGEAREADLGVASGN
                     GRGQIFVHGEVIATVPEDEIVQTLIAEANRIAAEITESGSPEVLVS"
     CDS             472036..473172
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_189284839.1"
                     /locus_tag="brsh051_04390"
                     /product="LOG family protein"
                     /protein_id="BEH01158.1"
                     /transl_table=11
                     /translation="MNTAHVPTLEIESLRDWDARIGSADKIAGWVMQAIDLSGRADDL
                     RRVDPHGAAFLGCSLPPDLTDELRERGALIFPPLPHVPFHVYRSGLYSPSELYDAILA
                     GELYTQTTDSRIYSWATSLPTPDDLSASLAMTLHDHAISDALEELLEASPPERTVGIL
                     GGHAVRRGSDDYIGAARLASQLTLAGFTVVTGGGPGAMEAANLGAHLAGQPAALVHAI
                     DHLASAPTYQGNETMWVATGMEVRAQTHPTGRSIGIPTWFYGYEPTNVFASAIAKYFS
                     NALREDVLLRHCRGGLIYMPGAAGTVQEVFQAATGNYYAAQHDLISPMIFVGLEYWTE
                     TLPVWPLISALGDGRGMGDRLLLVDDVDDAASHLVSRLSTAAAG"
     CDS             complement(473191..473826)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005080700.1"
                     /locus_tag="brsh051_04400"
                     /product="NAD(P)H-binding protein"
                     /protein_id="BEH01159.1"
                     /transl_table=11
                     /translation="MSKITVYGATGMVGSAIVREAVARGHSVVGVSRGGTPKTPVEGV
                     RYVRGEIGDAADVVSKAQDCDIVVFAVPGPRDGSPVQPIIDAHAAIVDALAKAGVTAR
                     IFVVGGAGATLAADGTRLLDTPGFPDAYKPEARSFAEILEIYREAPESLDWVMLAPAP
                     QIAPGPAAARYQLGDDHPAGSFVSAGTFAKAALDELEHPAHHRVRFTVAER"
     CDS             complement(473854..474921)
                     /codon_start=1
                     /gene="rlmN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013363517.1"
                     /locus_tag="brsh051_04410"
                     /product="23S rRNA (adenine(2503)-C(2))-methyltransferase
                     RlmN"
                     /protein_id="BEH01160.1"
                     /transl_table=11
                     /translation="MDLTPEQRVEAVRSAGLPAFRAKQISNQWFTRLDADPASWTDLP
                     AGLREQVHQAWFPTMLTPVGEQSADHGTTIKTAWRAFDHAIIESVIMRYRDRTTICIS
                     SEAGCGMACPFCATGQGGLQRNLTASEIVWQVHDAARRLAAGELPGGPGHINNVVFMG
                     MGEPMANYKAVLAAVRQIHAPNPDGLGISARGLTVSTVGMVPRMRQLADEDLPVTLAV
                     SLHAPDDELRDEIVPLNKHFNVDAVLDAAWDYAAATRRRVSIEYILIKDINDQAWRAD
                     LLARRLKARGDWGWFHVNLIPLNPTPGSKWTASRREDEQAFVEHLEHAGVPVTVRDTR
                     GRDIDGACGQLAANLDARAAK"
     CDS             complement(475066..475959)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04420"
                     /product="hypothetical protein"
                     /protein_id="BEH01161.1"
                     /transl_table=11
                     /translation="MSGQDPGEVSPPAEAVAKPATKKRSAGRNLPVAIASGVVLYAWI
                     LGSLLWWQWGFIVFLIAGIVVGAFEIWRALTGIGMHVVYTPIAVGTPLTLVTAHYLAQ
                     HNGQLTGAGVLLAGLALMVIACLLGRLRGPVRGFITDAAASVFTIGYVPLLLSPLVLL
                     LAQPDGNLRVIYYFILVPCSDTGAYAVGSLFGKHKMAPHISPGKTWEGLAGAVALTCI
                     IGAVLGPVMIGASWWAGAIIGVVLSLAATVGDLIESMIKRDTGIKDMGRIIPGHGGAM
                     DRLDSLLVAAPLAWLTMLVLV"
     CDS             complement(475962..476519)
                     /codon_start=1
                     /gene="frr"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973383.1"
                     /locus_tag="brsh051_04430"
                     /product="ribosome recycling factor"
                     /protein_id="BEH01162.1"
                     /transl_table=11
                     /translation="MIDDIIKDTVKKMAGAIDFARQDFATVRTGRANPAMFNKLEAEY
                     YGTPTPLQQLATFQSPEPRVMLISPFDASALNAIEKAIRNSDLGVNPASDGKAIRVVL
                     PELTEERRKEYIKIVRAKAEEGRVAVRNIRRHAVDQVKKAEKDKAIGEDEAKRAEKRL
                     DDETKKSVDTIDQLLKAKETELMAV"
     CDS             complement(476575..477288)
                     /codon_start=1
                     /gene="pyrH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223864.1"
                     /locus_tag="brsh051_04440"
                     /product="UMP kinase"
                     /protein_id="BEH01163.1"
                     /transl_table=11
                     /translation="MTEPYRRVLLKLSGEAFGGGKLGVDPLIVRSVARQIAHLVAAGT
                     QVAVVVGGGNYFRGVELQRGGMDRDRADYMGMLGTVMNSLALQDFLEKEGVPTRVQSA
                     ITMGQVAEPYIPRRAERHMEKGRVVIFSAGSGMPYFSTDTVAAQRALEVKAEILLMGK
                     NGVDAVYDCDPNTHPEANRYDELTYDEFLAKGLKVADATAISLARDNNLDMLFFGLDD
                     ESNIGRAVAGERIGTWVHA"
     CDS             complement(477438..478247)
                     /codon_start=1
                     /gene="tsf"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003893881.1"
                     /locus_tag="brsh051_04450"
                     /product="translation elongation factor Ts"
                     /protein_id="BEH01164.1"
                     /transl_table=11
                     /translation="MAITAADVKKLRDQTGAGMMDAKKALTEADGDFERATELLRVSG
                     ASKVAKRSDRSANNGLVAATGSSLIQFGSETDFVAKNQEFVALAEAIVAAVEAGEAVD
                     VESARALPLDDGTVGEAIGALEAKIGEKLELAHVARFDGAVHTYLHRRSQDLPPQVGV
                     LVEYEGDDEEFVHAVALQIASMRPDYVSREDVPDEVVEREKRIATETAIEEGKPEKII
                     PRIVEGRVNAFYKEACLLEQQSITDDKKTVGQLAKEAGVTITRFVRFVVGA"
     CDS             complement(478283..479209)
                     /codon_start=1
                     /gene="rpsB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_106517497.1"
                     /locus_tag="brsh051_04460"
                     /product="30S ribosomal protein S2"
                     /protein_id="BEH01165.1"
                     /transl_table=11
                     /translation="MAVITTRQLLESGVHFGHQTRRWNPKMKRFIFNERNGIYIIDLR
                     QSLTYIDKAYSYISGVVARGGQVLFVGTKKQAQETIAEQATRVGMPYVNQRWLGGMLT
                     NFQTINKRITRLKELESMDLENVVPGGLPKKELLGLRREMGKLDKSLGGIRDMGRLPQ
                     AVWIVDTKKEHLAIDEARKLHIPVVAILDTNCDPDEVDFPIPGNDDAIRSVSLLTRII
                     ADAVADGLLKRSNADSPQATEAEPMPDWERELLAGGEAAQAEAAEAEEEATEAAEVLA
                     EAAPVVEEVAEAAEALAEVVAAEAAAPAEPAN"
     CDS             479593..480561
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04470"
                     /product="hypothetical protein"
                     /protein_id="BEH01166.1"
                     /transl_table=11
                     /translation="MNPGVLLVRTAQRHSPGLALILAVWLMLGPTAAASADASGRVAP
                     LPGPVLRGFQIAEYNWLPGHRGVDLAGTAGDLVTAAAAGTISWVGVIDGVPMMTVQHP
                     DGLRTTYQPVEASVAAGQRVAAGQPIGVLTAGHCAQQACLHWGLRDGDDYLDPLLWLG
                     GWGEAEVRLLPRSAVPRQQPPPGAVEATDVLPLTGDLPVAGPLTSGFGSRVNPISGLA
                     EFHDGIDIGAACGAPVQVLWPGTVVFAGTAGGYGQRVEIDHGVIGGVQTRTSYSHLSG
                     FGVSAGQHVAAGTVIGQVGSTGYSTGCHLHYSGVRNGALVDPRTIG"
     CDS             complement(480566..481507)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003414689.1"
                     /locus_tag="brsh051_04480"
                     /product="tyrosine recombinase XerC"
                     /protein_id="BEH01167.1"
                     /transl_table=11
                     /translation="MSVDADASAPIPAALQDAFDAFADYQRLQLNRSQHTVRAYSGDL
                     EQLGQWLADAGIARLDQVQLPDLRSWLASQHDAGLAAASLQRRSGAVRVFFRWAKRQG
                     LVDEDPAAALKSPKIPHRLPETLTQTDAATLMDAVLAAAAEDPSPLGVRNLAILEVLY
                     GSGIRVSELCGLDVADIDRERGVIRVLGKGNKQRTVPLSDPARRAVESWLARRAEWLT
                     ASSAQAVFLGRQGGRLDPRVARRVVHQAMHAIPQAPDVGPHGLRHAMATHLLEGGADL
                     RSVQEMLGHASLATTQIYTHVSNERLKQAFRQAHPRA"
     CDS             481654..482247
                     /codon_start=1
                     /gene="def_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973751.1"
                     /locus_tag="brsh051_04490"
                     /product="peptide deformylase"
                     /protein_id="BEH01168.1"
                     /transl_table=11
                     /translation="MPTPQEWAAKGKVLRVTRWTEPVMRNPTRPVTQFGEDLHQLVAD
                     MFATMAAADGVGLAAPQVDVDLALFVFYCPDKDDHLQYGVVCNPVVTLPEGKDRRLDA
                     TEEGCLSWPGAYQPLARPDVAVCEGQNENGEPIRIEGTGLLARCLQHETDHLSGTVFG
                     DRLSKRSRRLLNEQHDSMAALYPADWPVSRKRAPADL"
     CDS             482342..484048
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003229258.1"
                     /locus_tag="brsh051_04500"
                     /product="NAD-dependent malic enzyme"
                     /protein_id="BEH01169.1"
                     /transl_table=11
                     /translation="MSKDYEIVHTNGRDIARIACRGRDVLHNPMINYGTAFTKEQREA
                     LGLTGLLPNAVISLDAQVRRVYKQYRHEPSDLAKYNYLTAMQDRNETLFYRVLTDNIQ
                     EMLPIIYTPTIGLAIQEYSHWFHKPRGIYLDIDNPDGIQAALQASGKGPDDIDLVVVT
                     DSEGILGIGDQGVGGVAITVGKLSVYVAAAGIHPNRVLPVVLDTGTDNLDLLNDPAYL
                     GVRHARVRGERYDAFIEKFVGEVTERFPQALLHWEDFAAGNAHRILNRYRDEICTFND
                     DIQGTAGVVVAAVLAAIRTSHTRLADQRIVIHGAGTAGVGIAHLLLDIMVSQGIDRDQ
                     AIRQFWGLSSRGLLIEGGKLRDFQAPFARPADEVAGWKLDTLGHYELADVVRNVHPTI
                     LIGTSAQPGTFTEEIVRDMASHTDQPIIMPLSNPTTKAEALPSDVLEWTGGRALIATG
                     SPFDPVELNDTRYEIAQANNALIFPGIGLGVISCRASRVSDTMIGAAAQAVASAVTDR
                     SPGASLLPAMTQLRSISARVAVAVAEQARREGLAQRHLDNPIQQVYDAMWQPVYPEVE
                     VI"
     CDS             complement(484073..484882)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977273.1"
                     /locus_tag="brsh051_04510"
                     /product="RNA methyltransferase"
                     /protein_id="BEH01170.1"
                     /transl_table=11
                     /translation="MANLVPITDPTDERLDDYVRLRETSLRRKLETDGGLFIAEGAKI
                     IRRAVEAGYRPRSFLLAERWLPELTDLLDDSAAPVYLVTEELAEQVTGFHVHRGALAS
                     MHRTVGLRMSDLLDARRLVVCEDIVDHTNLGAIIRSAAGLGWDGVLLAPRATDPLYRR
                     AIKTSMGTVFEMPWARMANWASDLRKLQEAGFEIVAMALRDDAVPLAEFAGQLRQAPR
                     KIALLLGTEGDGLSAHWLDQADAVVRITMHHGVDSLNVAAAAAVACFALAE"
     CDS             484953..485957
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003855200.1"
                     /locus_tag="brsh051_04520"
                     /product="bile acid:sodium symporter"
                     /protein_id="BEH01171.1"
                     /transl_table=11
                     /translation="MTPTALTRRPWWRRIDYFMVAIVSAAVLATFLPARGAGVEVVDW
                     ASKITIAILFFLYGVRLQPAETLAGLKHWRLHTVILAFTFVAFPIVGLALRVAVPGLI
                     NEDVYRGLLYICLLPSTVQSSINFTSIARGNVAAAIISASMSNLLGVFITPLLAISLM
                     STTGMHLDPSSILDIAAQILLPFVLGQLSRRWTADFVMAHPKLKLFDQASIVLVVYRA
                     FGQGVREGLWQRTGLSDIAMICVAIAVILPLMLWLTWMVAGWLGFNRRDQIAIQFCGT
                     KKSLATGVPMASVMFPAAQVGMIVLPLMIFHQAQLMVCSSLASRYARKPEEWLDETNR
                     "
     CDS             complement(485974..486756)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_078324130.1"
                     /locus_tag="brsh051_04530"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BEH01172.1"
                     /transl_table=11
                     /translation="MVAVAELAGVSVRRGTALLLHDVNFKVEEGDRWVIIGPNGAGKT
                     TLLALLSTQMHPTTGVVEVLGEYLGAVDVFELRPRIGVASSSIAHRIPNREKVADVIV
                     SASYGVMGRWRETYEEMDHARALELMRLMHVEDLAGRTYGTLSEGERKRVEIARALMT
                     DPELLLLDEPGAGLDLRGREILVKTLSELCEDPDAPTMVLVTHHVEEIPEGISHAMLM
                     AHGSVVAAGPIDEVLTDEKLTAAFGMPLHITKIDGRWTARAA"
     CDS             complement(486804..487295)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015776701.1"
                     /locus_tag="brsh051_04540"
                     /product="DUF456 domain-containing protein"
                     /protein_id="BEH01173.1"
                     /transl_table=11
                     /translation="MTADVLVTVITGVLVVIGVLGTIFPILPGSILVIAGLLLWAIVI
                     GGPIGWTVFGLGLLLCGVGMTASTLLTGKRLKGRQIPNRSILIGAVVGVIGAFVIPVV
                     GLFVGFIVGLFGSEWYRLREPRQAWDASVVAMKSVGLGMLIEFSCAGLAVACWTVGIF
                     LYF"
     CDS             complement(487298..488071)
                     /codon_start=1
                     /gene="fabI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977009.1"
                     /locus_tag="brsh051_04550"
                     /product="enoyl-ACP reductase FabI"
                     /protein_id="BEH01174.1"
                     /transl_table=11
                     /translation="MGILEGKKILVTGVTLNTSIAYSVARIAQQEGAEIVVSNFGRGM
                     GLTRRVVKKLDPVPEVLDLNVTDAEQLAALPGQLRELGFDHLDGVVHSIAYAHPERAL
                     GGAFLTTEWDDVAMAVQTSAYSLQSLTMAVRELLGRGSSIVGLTFDATVSWPSYDWMG
                     VAKAALESTNRYLARYLGPDGIRSNLVAAGPVDTIAKKAIPGASSFNDIWDGRAPLGW
                     DASDATPVGKAVVALLSDWFPATTGTMVHVDGGLHSTGA"
     CDS             complement(488073..488801)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226771.1"
                     /locus_tag="brsh051_04560"
                     /product="beta-ketoacyl-ACP reductase"
                     /protein_id="BEH01175.1"
                     /transl_table=11
                     /translation="MSETANTSSGRVAVITGAGRGIGAAIAETLRDAGYRVASFDISD
                     AAPEGVLGVACNVTNTESVDEAFKKVEAEYGPVEILVANAGITRDTLLMRMSDEDWEK
                     VLDVNLTGAYRVVRRAVRGMVKQRFGRIVATSSVVALLGSAGQVNYASTKAGLIGMAR
                     SVAREVGGRGITFNVVAPGFIQTAMTDVLDEATQKSYAERIPVGRMGTIADVAHAVKF
                     LVEDETGYITGAVIPVDGGLGMGH"
     CDS             488844..489731
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804543.1"
                     /locus_tag="brsh051_04570"
                     /product="methyltransferase domain-containing protein"
                     /protein_id="BEH01176.1"
                     /transl_table=11
                     /translation="MAQKQPAIVVCFVRACWFVPGLRAKMEPMPAIDAAIGLLTCPVC
                     ADALTREHRQLRCGRGHSFDIARQGYVNLLRGPAPANADTAEMVAARERFLSAGYYQP
                     IREAVCSACEPGGRLAEVGVGPGYYLGAAVAATHPPAHLGLDISVAAARRAARRMMAC
                     AVADTWQTLPIGSGSLDRLLCIFAPRNPPEFARVLATGGQVVVVAPRPQHLAQLRARL
                     GLLNVEDDKLARLDASFAAAGLELVSRQELTFDIDLDAAATADLVGMGPNAFHDGARD
                     FPRALTTTVAVAISSYESD"
     CDS             complement(489787..490035)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976983.1"
                     /locus_tag="brsh051_04580"
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="BEH01177.1"
                     /transl_table=11
                     /translation="MNRLSKGKRVSGELRNEVQQSFVERYEAGESIRSLAAECGRSYG
                     FVQGLLKDAGVTFRQRGGARSPKKDTDGESAAASMAAS"
     CDS             complement(490220..491830)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976982.1"
                     /locus_tag="brsh051_04590"
                     /product="ABC-F family ATP-binding cassette
                     domain-containing protein"
                     /protein_id="BEH01178.1"
                     /transl_table=11
                     /translation="MGTTMLQATDLEVRAGARLLLEPTTFRVNPGDKIGLVGRNGAGK
                     TTMMRILAGEGIPAAGQVTRRGEIGYLPQDPRETDVAMLARDRILSARGLDTILVRLR
                     NYEKQMAATSGDEQQQAMASYARAEAELMAAGGYGAEAEAARIAANLGLPERVLGQPL
                     HELSGGQRRRIELARILFSAADTLLLDEPTNHLDADSIVWLRDFVKTYDGGVMMISHD
                     VGLLDQTVTKVFHLDANRTTLDQYSMGWSTYLQQRQLDEKRRKRERQNAERKAAQLRL
                     QAEKLGAKATKATAAQNMARRAEKLLAATEGERAVDKVAKITFPSPAPCGKTPLMAKD
                     LTKNYGSLEVFTGVDLAVDKGSRVVILGLNGAGKTTLLRLLTGIETPDTGEVVPGHGL
                     KLGYFAQEHDLLDPQASVLQNMMQAAPDLNETEARRVLGGFLFSGDDDHKPAGVLSGG
                     EKTRLALATLVVSSANVLLLDEPTNNLDPASRKEVLDAIRRYEGAIVLVTHDEGAVEA
                     LEPDRVIVLPDGTEDLWSEDYAELISLA"
     CDS             492177..492605
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04600"
                     /product="hypothetical protein"
                     /protein_id="BEH01179.1"
                     /transl_table=11
                     /translation="MARVDAAGYTRLDELLTDLAAATARFGLGLAGAGAFPAPGLAKA
                     LWLGADDPGGELAALARGCRTAARRAGISVADEPFVGHLTIARYRHPADARPQIDALD
                     ATTIEPWPVTEIVLIESLLGQGDDGSVRYVVRERYPLSSY"
     CDS             complement(492621..493007)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224702.1"
                     /locus_tag="brsh051_04610"
                     /product="metal-sulfur cluster assembly factor"
                     /protein_id="BEH01180.1"
                     /transl_table=11
                     /translation="MTNPSDLVRDELPGDPVPATWATATAEQKKLVILEALKEVVDPE
                     LMVNVVDLGLIYDVLIDDDLNVTLEMTLTSPACPLTDQIEWEAQAVLGQLARSVTINW
                     VWMPPWSIDLITDDGREQLQALGFMI"
     CDS             complement(493009..493473)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003894513.1"
                     /locus_tag="brsh051_04620"
                     /product="SUF system NifU family Fe-S cluster assembly
                     protein"
                     /protein_id="BEH01181.1"
                     /transl_table=11
                     /translation="MSVEQLYQDIIIDHYREKHHSGLRAPFGAEVHHVNPSCGDEVTL
                     RVSMDGDTIGDVSYDAEGCSISQASTSVMCDLVIGRDVADSMALFDEFRDMMESQGRI
                     EPDEDRLEDGIAFAGVAQFPARVKCAMLGWSALRDALIRAGVELPASRDDKE"
     CDS             complement(493470..494717)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976898.1"
                     /locus_tag="brsh051_04630"
                     /product="cysteine desulfurase"
                     /protein_id="BEH01182.1"
                     /transl_table=11
                     /translation="MWNSAAIRADFPILDREINGHPLVYLDSANTSQKPREVVEAVEA
                     HYLRHNANVARAMHTLGAEATAAFEGARVKVAEFVHARSSDEIIFTKNASEALNLAAY
                     TLGRRLKPGDEVVISVMEHHSNLVPWQLACQASGATLRWFDITDDGRLDLEAAQRDGL
                     INERTKVVSVAWVSNVLGTINPIRQIADWAHSVGAIMVADGSQGVPQRATDVTALGVD
                     LLAFTGHKLCGPTGIGVLWGHYDLLEQLPPFLGGGEMIEVVRMEGSTYAPPPHRFEAG
                     TPPIAQAVGLGAAIDYLNRIGMDALAAHETEITAHMLDGLGALDGVHILGPAEAVDRG
                     GAVSFVVDGVHPHDLMQLLDSRGVAVRGGHHCAAPLHKRLAVQSSSRASGYLYTTPEE
                     VDALVEAVAWGYDFFNSRARRSL"
     CDS             complement(494717..495478)
                     /codon_start=1
                     /gene="sufC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976897.1"
                     /locus_tag="brsh051_04640"
                     /product="Fe-S cluster assembly ATPase SufC"
                     /protein_id="BEH01183.1"
                     /transl_table=11
                     /translation="MADLVITDLHVDVETESGPKPILHGVNLTIKTGEIHAIMGPNGS
                     GKSTMAYALAGHPKYTITSGSATLDGVELTGLSVDERAKAGLFLAMQYPVEVPGVSTS
                     NFLRTAKTALDGQAPKVRTWPKVVSGALTRLEMDPDFATRSVNEGFSGGEKKRGEIVQ
                     LDVLNPKVAVLDEIDSGLDIDAVRIVADGINRYAAQGDRGVLLITHYTRILRYIEPTH
                     VHVFVNGQIVESGGKELADELEISGYDKYVKAVHA"
     CDS             complement(495485..495826)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976896.1"
                     /locus_tag="brsh051_04650"
                     /product="non-heme iron oxygenase ferredoxin subunit"
                     /protein_id="BEH01184.1"
                     /transl_table=11
                     /translation="MSPVAVATLDELSDVPLGVDVPGSDLELAIVRIGDEVFAIADEC
                     SHGNVRLSEGDVDAEHCTIECYLHGSMFDLRTGAALNLPAVLPVPVYPCVIDGDQILV
                     DIDHPSTHQEN"
     CDS             complement(495823..497016)
                     /codon_start=1
                     /gene="sufD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976895.1"
                     /locus_tag="brsh051_04660"
                     /product="Fe-S cluster assembly protein SufD"
                     /protein_id="BEH01185.1"
                     /transl_table=11
                     /translation="MSTTITRSEPRVVSVSGAFTSHLHPTPSWQLTDHTVPTGREENW
                     RFTPVKRFKPLMTDGPFGQISVTTTLPEGVTSRTIDAAAAKDLSFDPPVDLVAAKAVQ
                     AEQALLIEVAPQAVLDAPVVITTDGSDELAASHMIITVGHHAEATIVLQRTGVSRLAS
                     KVEVQVDEGARVDVITVQDWATGAVHGGQYSIRIGRDAKVRSFQATIGQGDVRLVERV
                     EYAGPGGELNQLGIYFVQSEQHVEHRLLVDHNHPNTVSLVDYRGALQGAGAHSVWIGD
                     ALIRKTAVDINTYETNKNLMLTEGCRADSVPNLEIETGEIRGAGHSSSTGRFDANQLF
                     YLRSRGIPEEQARRLIVEGFFLDIIRRIGLPEIEARLVEALNVQLASIEDLSHDALLS
                     EDDQA"
     CDS             complement(497066..498508)
                     /codon_start=1
                     /gene="sufB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805064.1"
                     /locus_tag="brsh051_04670"
                     /product="Fe-S cluster assembly protein SufB"
                     /protein_id="BEH01186.1"
                     /transl_table=11
                     /translation="MTTDIKPQASEQPTQSEQIEALSQYRFGWHDSDAAGATAKRGLD
                     DSVVRGISALKNEPEWMLQRRLKALKLFERKPMPTWGADLSEINFDTIKYYVRSTERQ
                     ANSWEELPADIKNTYDRLGIPEAEKARLVAGVAAQYESEVVYHKINEELERQGVIFLD
                     TDTGLKEYPEIFEEYFGSVIPAGDNKFAALNTAVWSGGSFIYVPKGVHVQIPLQAYFR
                     INTENMGQFERTLIIADEGSFVHYVEGCTAPIYKTDSLHAAVVEIIVKKHARVRYTTI
                     QNWSNNVYNLVTKRSTVDEGGTMEWIDGNIGSKVSMKYPAVWLMGPHAKGETLSIAFA
                     GEGQHQDTGSKMVHCAPYTSSTIVSKSVSRSGGRSSYRGLVEVQPGARHSSSSVKCDA
                     LLVDNISRTDTYPYVDVKEEDVSMAHEATVSKISEDQLFYLMQRGLSEDEAAAMVVRG
                     FVEPIARELPMEYALELNRLIELQMEGAVG"
     CDS             complement(498505..499233)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_176742174.1"
                     /locus_tag="brsh051_04680"
                     /product="transcriptional regulator"
                     /protein_id="BEH01187.1"
                     /transl_table=11
                     /translation="MERVEIENRAEMTSQPGSQAAATDASTRQRVLDLLLERGTMTAA
                     EFADALSLTAAGVRRHLIALVDSGEITTIEQSGPRGRGRPASVYQLTADGRKGFGQAY
                     DDLALSALAELVAIAGPDAIGRFAERRLADLEDDYRRRRGTDPDKDPMEVLAEALSAA
                     GYFAETAAGGELCQHHCPVVDVATEYPQLCDAETSVFARLLGSDVSRSATIAHGAQAC
                     RLHVGGPTPLPNPVSALADRKVNA"
     CDS             499433..500902
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015777065.1"
                     /locus_tag="brsh051_04690"
                     /product="gluconokinase"
                     /protein_id="BEH01188.1"
                     /transl_table=11
                     /translation="MLALDVGSTASRGAIYDANGSPVRPRAKVPHAFTTRADGTSIID
                     PDQIVREVTQLIDQLVDLTVGHPVAAVSLDTFASSLVGVDAQGAAVTPCFNYNDNRCA
                     DEVALLRAEVDEDRIQALTGCRFHASYLPARLRWLARTEPATVATVTRWMSLGEYVWL
                     RLLGDTAAGTSVAAWGGLLNRHTGQWAPAMLELAGITEDQLNRIADPADGLSPQKGSK
                     ARKLWPSLKQAHWCAPIGDGYAATCGIGDASGSPVISLATSGAMRMLVDDPVGTGGLD
                     LPRGLWSYRVDSQHSLIGGAVNDVGRATEWMMRELRLPDDAIVAAQLHEPPSAITPLV
                     LPFFTGERSTGWVGSARATLHEVDFSTSALELYRGVLEGIVWSFQRIIDQLVQVGGPI
                     ASARVGGRVAAEAPGLLTVMADGLSLELVAVNIKRSTLLGNARIALDVVAPGIERTAV
                     QTAAALRPDPHCVEFYDRRQLQLDRLYEAVVRSAQSAVG"
     CDS             501007..502533
                     /codon_start=1
                     /gene="zwf"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976881.1"
                     /locus_tag="brsh051_04700"
                     /product="glucose-6-phosphate dehydrogenase"
                     /protein_id="BEH01189.1"
                     /transl_table=11
                     /translation="MDATWTNPLLDSADRRLPRLAGPSVLVLFGVTGDLARKKLIPAI
                     YDLANHGALPPGFGLVGFARRDWTKEQFIEQLATSVRQNSRTPFRAEVWRQLVGGIDF
                     VQGTFDDANAFIRLKKTLDRFDREHGTDGNHAFYLSIPPKNFEQVIEQLNAHGMTDQT
                     HGWKRAIIEKPFGHDLASSTELSRVVSAAFPAESVFRIDHYLGKETVQNLLAFRFANM
                     MYEPVWNRNFVSDVQITMAEDFGIGGRAGYYDGVGAARDVIQNHLFQLMALTAMEEPN
                     TFDPHDLRREKEKVLEAAKVPDRLDVHSANGQYAAGWQGGRLVRGFLEEDGINPESRT
                     ETYAAMRIDIDSRRWAGVPFYLRTVKRAPRRVTEIALNFKRTPHMPFSQPDIEALGVN
                     SLVLRIQPNEGIEMNFGAKVPGTQMEIRQVSMDFSYSGSFTESSPEAYERLILDVLLG
                     DPPLFPRQREVELSWQILDPVLELWAQAGQPEQYPAGTWGPHGSQEMLARDGFAWRRP
                     "
     CDS             502542..503453
                     /codon_start=1
                     /gene="opcA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003972335.1"
                     /locus_tag="brsh051_04710"
                     /product="glucose-6-phosphate dehydrogenase assembly
                     protein OpcA"
                     /protein_id="BEH01190.1"
                     /transl_table=11
                     /translation="MSIRLENTDAHEINETLYRLRMEGKAPAKSGLVLTLVVNTTAEG
                     YEQAMEGAQAAGELHPSRILVAIRGMHNDVGLNAEIQTEQSAAEVITLEFAGEVDQHA
                     DSVLLPLLLSELPVVIWSRDLVPGDPARCDLSALAHRKIVDSMTTDDPMATVYELARS
                     HQPGTTDLSWTRLTRWRALLVAALNQVRSTVTSAEVVGPLSSAPSELLAAWLRMRLQV
                     PVLRPDAVSSYPGLHMVKLVTEAGDVVLQRFSPIEASLSLPGQPDRRVALARRTVPQL
                     LSEELSRLSGDEAFDHLMAFMATEEQS"
     CDS             503457..504200
                     /codon_start=1
                     /gene="pgl_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976879.1"
                     /locus_tag="brsh051_04720"
                     /product="6-phosphogluconolactonase"
                     /protein_id="BEH01191.1"
                     /transl_table=11
                     /translation="MSLQRIYRYRSLDELTVSMAGRLAKRLSELQQQKERVHLALTGG
                     TTALALYESLARLAQANPLDPSRLELWWTSERYVPTTDQMRNATRALTVLARTLPFVP
                     SQVHPMPSSTGTMDSDEAAYAYSKELADVTFDICLLGLGVDGHVASIYPNHPSLQVQS
                     ETNLSVVGVTNAPIEPSERITLTLKTFNKSNEIWLLASGEEKADVVARAVVHHDPLLP
                     AGLVHGASATYWFLDRGAASKLPYYHCRF"
     CDS             complement(504226..504582)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_034284344.1"
                     /locus_tag="brsh051_04730"
                     /product="RNA polymerase-binding protein RbpA"
                     /protein_id="BEH01192.1"
                     /transl_table=11
                     /translation="MSGGNAIRGSRIGAGPMGEAERGDSAPRTRVSFYCANGHETRPA
                     FAMDAEIPEQWECIRCGLPASTDQQNPPPPPKNLPYKTHLAYVKERRSDEEAVAILAE
                     ALDGLRSRRARGEVIY"
     CDS             complement(504626..504895)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04740"
                     /product="hypothetical protein"
                     /protein_id="BEH01193.1"
                     /transl_table=11
                     /translation="MTLVPLMAWPVLTLSIVLSVLSVILTGFILLHKGRGGGLSDLFG
                     GGMTTGMSGTSVAERNLDRLTIIVAGLWLLCIAGLLVLYSTGAGA"
     CDS             complement(505043..505825)
                     /codon_start=1
                     /gene="tpiA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976873.1"
                     /locus_tag="brsh051_04750"
                     /product="triose-phosphate isomerase"
                     /protein_id="BEH01194.1"
                     /transl_table=11
                     /translation="MSRTPIMAGNWKMNLNHIDAVGLVQKLAWTLADERYDTAQCEAV
                     VIPPFTGIRSVQTLIDGDKLPLKHGAQDLSPHDDGAYTGDISADMLVKLDCSYVVVGH
                     SERREYHAETDEIVNAKAAKALSKGLIPIICVGEGLDVRKAGRQVAHTVAQVTGALAG
                     LSAADVASLVIAYEPIWAIGTGEVATPADAQEVCGAIRKAVAELYDEATAEAVRIQYG
                     GSVKSSNVVDIMAQPDVDGCLVGGASLKAEEFAKIVLFYQKA"
     CDS             complement(505831..507054)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_164930207.1"
                     /locus_tag="brsh051_04760"
                     /product="phosphoglycerate kinase"
                     /protein_id="BEH01195.1"
                     /transl_table=11
                     /translation="MRSVNELLDNVRGKRVVIRCDFNVPLDGDVITDDGRIKAALPTL
                     TKLRDAGARVTVLAHLGRPKGQVNPKYSLAPVAKRLGELLGAEVKLAADVVGPSAQEL
                     SASLTDGQICLAQNVRYEPGEESKIDAERAALAAQYAKLGDIYVSDGFGVVHRKQASV
                     YDIAKLLPAYAGELVAKEVEVLSKLTTNPDRPFTVVLGGAKVADKLAVIDNLLKVADA
                     LVIGGGMAYTFLAAKGYPVGNSILDASKVEVCAEYLKTASAEGKKIVLPVDVRVSDGM
                     DFAARKVIGEVEVVPADQIPAGKEGLDIGPESEKLFADTVRSSHTVFWNGPAGVAEIP
                     AFAEGTAAVAKALTEVDGLTVIGGGDSAAVVRELGYADDQFGWISTGGGASLEYLEGK
                     ELPGLAVLEESAKGE"
     CDS             complement(507163..508167)
                     /codon_start=1
                     /gene="gap_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224666.1"
                     /locus_tag="brsh051_04770"
                     /product="type I glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="BEH01196.1"
                     /transl_table=11
                     /translation="MTVKVGINGFGRIGRNFYRAAKEQGADLEIVAVNDLTDTKTLAH
                     LLKYDSILGRYKGTVEHDDSSIIVDGKAIKVLAERDPANLPWGDLGVEIVVESTGFFT
                     DGTKAKAHIDGGAKKVVISAPGKNVDGTFVIGVNDDKYDPETDNIISNASCTTNCLAP
                     LAKVLQDAFGIERGIMTTIHSYTGDQRLLDAPHSDLRRARAAALNMIPTKTGAAQAVA
                     LVIPELKGKFDGLAVRVPTPTGSLTDLTFIPGREVTVEEVNAAVKAAAEGPLEGILAY
                     TEDPIVSTDIVGDPHSSIFDASETKAIGNLVKVLSWYDNEWGYSNRLVDLTELVASKL
                     "
     CDS             complement(508296..509279)
                     /codon_start=1
                     /gene="whiA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014877572.1"
                     /locus_tag="brsh051_04780"
                     /product="DNA-binding protein WhiA"
                     /protein_id="BEH01197.1"
                     /transl_table=11
                     /translation="MALTQQVKSELATVRVQKPETRAAELATMLRFSGGLHVVSGHIV
                     IEAELDSGAAARRLRQAITDLFGYDCEVLVLASSGIHRTTRYVLRLTRQGEALARQTG
                     LIDSRGHPARGLPAQVVGAGISEQVAVWRGAFLARGSLTEPGRSMALEITCPSSEAAL
                     ALVGSARRLDIAAKAREVRQVDRVVVRDGDAIAALLTRMGAHASVLAWEESRVRREVR
                     ASATRLANFDDANLRRSARAAVAAGARVERALEILGDEVPDHLRQAGLLRLEHKQASL
                     EELGQLHDPPLTKDAIAGRIRRLLAMADKAAAEQDIPSTQAALTPEMLDEE"
     CDS             complement(509349..510284)
                     /codon_start=1
                     /gene="yvcK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028061.1"
                     /locus_tag="brsh051_04790"
                     /product="uridine diphosphate-N-acetylglucosamine-binding
                     protein YvcK"
                     /protein_id="BEH01198.1"
                     /transl_table=11
                     /translation="MSPPKVTALGGGHGLSASLQALRQITDELVAVVTVADNGGSSGR
                     LRRELGGLPPGDLRMALAALCGDDPLGRQWASVLQSRFHSSGPLNGHAIGNLLIEGIW
                     QQFDAVQGLDMVAGLLNVCGRVLPMSLESLTIEADVIGADPLHPDEPVVVQGQHEVAV
                     TSGDVAAVRLVPANPPACPEAIASVHDADYIVLGPGSWFTSVLPHLLVPELAEAIVSS
                     SAHRILTLNIEPEEETKGIGAAQHLEILAEHAPRLRFDAVVADSSFGADDRNLRTFAG
                     VLGAELVVADLRCCDGSARHDPQRLAAVFRQVMGS"
     CDS             complement(510281..511180)
                     /codon_start=1
                     /gene="rapZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_093455885.1"
                     /locus_tag="brsh051_04800"
                     /product="RNase adapter RapZ"
                     /protein_id="BEH01199.1"
                     /transl_table=11
                     /translation="MGLVSEPQTSSQPESASPRVVIITGMSGAGRRTAAHAMEDLGWF
                     VVDNLPPSMLSQLVETARRGGQNRVAVGLDVRSREMFDQLPRSLAQLEVQGIRCEICY
                     LEASDVAIVRRQESSRRPLPLQGGGSIIQAVAKERRMLRNLRADADVVIDTSNLNVHQ
                     LAHRVGHIYGSGDDQATRFQIMSFGFKNGVPVDADMVFDVRFLPNPHWVPYLRPQTGL
                     SREVSEYVLAQPGAAEFLDQLVSLIDIIGPGYFREGKRQATIAIGCTGGKHRSTAMSE
                     AFAARLRAEGVQVSVLHRDLGRE"
     CDS             complement(511224..513209)
                     /codon_start=1
                     /gene="uvrC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_071831611.1"
                     /locus_tag="brsh051_04810"
                     /product="excinuclease ABC subunit UvrC"
                     /protein_id="BEH01200.1"
                     /transl_table=11
                     /translation="MADPASYRPAPGSIPTEPGVYRFSDPNGQVIYVGKAINLRNRLN
                     SYFADPASLHFRTQTMVRTASKVEWTVVHNEVEALQLEYTWIKQYDPRFNIKYRDDKS
                     YPWLCVTWSEEFPRVFVGRGAKRKGYRYFGPFGQAWAVRESVDLLLRVFPMRSCTNGV
                     FRDAHASGRPCLLGHIGKCAAPCVGRVTAAEHREIAADFCAFWSGNSRGLERKLTKQM
                     EEAAASMEYERAAVLRDARDALRQATEKSAIVLPDGTDADVFAVAADPLEVAVQIFHV
                     RSGRVHGERGWVADRADETDLAELMEGFLFTFYADNQGSETRTGGTIPPEIIVPVAPA
                     SVDLLAELLSEQRGARVNIHVPQRGDKKTLLETVTRNAEQALILHKTKRASDLATRSE
                     AMAELQEALGMALPPLRIEGFDISHLQGTEVVGSMVVFEDGMARKSEYRRFVIKSFEG
                     SNDVAAMDEVLRRRFNRLLADRAEMAEAAAGSDDGPSLIDANTGAPRKFAYAPALVVV
                     DGGLPQVNAAQQVLDDLGLADEVLLIGLAKRLEEIWIPGEDFPLILPRTSEALYLLQR
                     VRDESHRFAITHHRNRRSKAMVESVLDAVPGLGEVRRKTLLTQFSSLKKLRAASLDDL
                     LALPGFGPSTAQAVLDALAQEVAGEAINTATGEVTEV"
     CDS             complement(513211..516210)
                     /codon_start=1
                     /gene="uvrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028066.1"
                     /locus_tag="brsh051_04820"
                     /product="excinuclease ABC subunit UvrA"
                     /protein_id="BEH01201.1"
                     /transl_table=11
                     /translation="MKDRLVISGAREHNLRDISLDLPRDAMIVFTGLSGSGKSSLAFD
                     TIFAEGQRRYVESLSAYARQFLGQMDKPQVDFIEGLSPAVAIDQKSTSRNPRSTVGTV
                     TEIYDYLRLLFARVGHPHCLVCGAPIDKQTPQQIVDQVLAQPEGTRFQVLAPMVRGRK
                     GEYGELFRNLSTQGYARVLVDGQIFRLPEVPGLDKQRKHDIDVVVDRVAVKPTAKQRI
                     TDSVETALGLASGLVILDFVDLDEDDPARRRSYSERLACPNGHDISLDEMEPRQFSFN
                     SPWGACPECAGLGTTLEVDPDLVVPDQMKSLAQGAIAPWASPMVAAHYSHVFESMAEK
                     YGFSVDTPWEDLEPAVRKYILMGAEDPVLVRYRNRFGRVRTYSQKYEGALPQVRRRYD
                     EAETDAARDRWGAYLREIPCAVCHGARLKPSTLAVTIADKNIDEVSRLSIDELAGYLG
                     ELTLSDRERAIAGQVLKEINQRLRFLLDVGLDYLTLSRSAGSLSGGEAQRIRLATQIG
                     SGLTGVLYVLDEPSIGLHQRDNRRLIETLLKLRDLGNTLIVVEHDEDTIRSADHVVDI
                     GPGAGEHGGRVVVSGTLDDLLASDESLTGAYLTGRRSIALPAQRRLGNGHEMVVHAAA
                     ENNLKNVTVGFPLGRFIAVTGVSGSGKSSLVNAIVYRSLAKRIYGAKDVPGRHKGITG
                     VESINKVVHVDQSPIGRSPRSNPATYTGVFDKIRTLFSQTPEAKARGYQPGRFSFNVK
                     GGRCENCMGDGTIRIEMNFLPDVYVPCEVCHGARYNRETLEVRYKGKTIAEVLDMPIE
                     QAAEFFAPISAISRHLKTLVEVGLGYVRLGQPATTLSGGEAQRVKLASELQRRSTGNT
                     VYVLDEPTTGLHFEDIRRLLDVLGRLVDGGNTVVVIEHNLDVIKTADWVIDMGPEGGF
                     RGGQVVATGTPEDVARVPESHTGHFLAEILRGREVPLAQPEPEPLLAVQPAPAKKRGR
                     KPADAAGTSKTSATKTKRTTTRRTPAA"
     CDS             516349..517083
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028067.1"
                     /locus_tag="brsh051_04830"
                     /product="maleylpyruvate isomerase family
                     mycothiol-dependent enzyme"
                     /protein_id="BEH01202.1"
                     /transl_table=11
                     /translation="MAWDLARQEALSTFAPVAEVRKIKLEATQRLLGDTISLSERAWQ
                     EPGRLPGWTRAHVATHLARNADAFVRAIDSVLTGRRGLMYDSDDDRELAIERGSERSG
                     LELQIDLDTSAGNLSERLDLLDSVPGRLTVELSPGTFLRSDLLPLARLYEVIIHHVDL
                     DCGFEVSQINPLTARWLLEWSVLSYQAPYGMAVRLVSTSGFTAVLGASNSETVISGPD
                     AVLLGWLTGRLSAAEALHLPAQPPLI"
     CDS             517135..517797
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805114.1"
                     /locus_tag="brsh051_04840"
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="BEH01203.1"
                     /transl_table=11
                     /translation="MTGLFHTSAHDSPVRFDAGNVSCTKVSVGPMDNNAYLLDAGGPV
                     VLIDAADDAPRLLELIGDGGLAAVITTHRHHDHVGALAEVVRTTGAQAWTGAPDVEAI
                     EQQTGVRSIPVWTGDLIEAGGIRLEVIGLVGHTPGSIALVLRSGRADEPVNIFTGDSL
                     FPGGVGATGSAQQFNSLLADVSTKIFDRFDDETIIHPGHGDSTTIGVERPQLAQWRAR
                     GW"
     CDS             complement(517881..518885)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003897538.1"
                     /locus_tag="brsh051_04850"
                     /product="TerC family protein"
                     /protein_id="BEH01204.1"
                     /transl_table=11
                     /translation="MHVTPVAWIVTLTVLTAVLALDVRHMMKHPHEPSMKECALTITG
                     FVSAAILFGVGIGLFAHPLPESGKTSWHYAVEFFSGYLTEYSLSIDNLFVFIIILGSM
                     GVPRKYQQFALMCGIILALVFRGIFILAGAALIERFAWVFFIFGAFLLYTGIKLVIDY
                     RKHDSEEDSHNEADTALMRFVKRVVPSTEEYHGTHLSVKIDGKRLFTPLFFVIATLGS
                     VDIMFALDSIPAIFGLTQEPYLVFTANFFALMGLRQLYFLLGNLLQRLVYLSLGLAFI
                     LCFIAVKLVLHAMHHYHWIGFEVPTLLSLLVIVLTIAITAVLSLLKTKRKNDDTPIEA
                     "
     CDS             518793..519023
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04860"
                     /product="hypothetical protein"
                     /protein_id="BEH01205.1"
                     /transl_table=11
                     /translation="MGMLHHVPDIKCQDSGQDSQSDDPCHRCYVHRVTFRLEGRLEVS
                     PLIFQIIRTATFAGKAKASKIPYGGTNLHVDL"
     CDS             519039..519194
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04870"
                     /product="hypothetical protein"
                     /protein_id="BEH01206.1"
                     /transl_table=11
                     /translation="MRRLPADPGDYSIEGIWETVAQKILQTMQQILQKIWGQCSRRRD
                     QRAASTI"
     CDS             complement(519170..521260)
                     /codon_start=1
                     /gene="uvrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028069.1"
                     /locus_tag="brsh051_04880"
                     /product="excinuclease ABC subunit UvrB"
                     /protein_id="BEH01207.1"
                     /transl_table=11
                     /translation="MRPVEEITRRLAPFKVHSEFQPAGDQPAAIDELERRLKAGENDV
                     ILLGATGTGKTATIAWLAERLQRPMLVMQPNKTLAAQYTAELRQFFPENAVEYFVSYY
                     DYYQPEAYVPQTDTFIEKDSSLNEEVERLRYSATNSLLTRRDVIVVATVSAIYGLGTP
                     QEYVDSMLSLHVGDEIDRTSLLHKLVEMQYVRNDLAGTRGTFRVRGDTLEIFPMYESN
                     AVRVELFGDEIDALSTMHPTTGELLSTDDEMYVFPASHYVAGPERMERAIAGIEAELE
                     VRLKELESQNKLLEAQRLQMRTGYDIEMMRQIGTCAGIENYSRHIDGRAPGSAPNCLL
                     DYFPEDFVLVIDESHVTVPQIGGMYEGDMSRKRTLVEHGFRLPSAMDNRPLRFEEFTE
                     RIGQTVYSSATPGPYEVARSNGVVEQIIRPTGLIDPEVIVKPTKGQIDDLLGEIRIRA
                     ERDERVLVTTLTKKMAEDLTDYLMERGVRTRYLHSEVDTLRRVELLRELRLGEYDVLV
                     GINLLREGLDLPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVSGQVHMYADKITP
                     SMSSAIDETNRRRAKQVAYNTEHGLDPQPLRKRIADITDLMAREDADTQYWVSGAQNR
                     GRRGGASPVLADQLRDLDTAGLPAAELANLIQELTEQMHQAAAELQFELAARLRDEVA
                     DLKKELRQMVEAAR"
     CDS             complement(521331..521930)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003974662.1"
                     /locus_tag="brsh051_04890"
                     /product="hypothetical protein"
                     /protein_id="BEH01208.1"
                     /transl_table=11
                     /translation="MDELVMRWNRRFPRLHGLGAELLIRWQEPHRCYHDPRHLAECLQ
                     ALDRLDGGDVEELALWFHDAVYQGRRGSDERSSARLARQLLGEEGERAGVVDEVARLV
                     RVTEHHRPWPSDSAAQRVSDADLAIFGARAERYRESVADLRRENAGVPDDQWRLIRLW
                     HLRGLQRRGVIYATPRARALWQARAEANIAAELRAITRG"
     CDS             complement(521946..522314)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04900"
                     /product="hypothetical protein"
                     /protein_id="BEH01209.1"
                     /transl_table=11
                     /translation="MNAAVLAIIQAAIVLVAGATAVWWGGVAVTWVFGRLSPAAETAV
                     LRGGEWIGRVERTAVFATVLTGFPEGIAIALALKGIGRYPELKTGSKVASERFIIGTF
                     VSLLVAAGLGGLSRWALQVI"
     CDS             complement(522311..522973)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04910"
                     /product="hypothetical protein"
                     /protein_id="BEH01210.1"
                     /transl_table=11
                     /translation="MTKHGGHPVAVINVDQHASRRRPDLVPDALAELAGVDGLVFQFE
                     RTAGDEVQGVCAAPQAVVDVVLRLTRMGGWRIGIGIGAIDEPLPASTRQARGPAYLVA
                     REAIEARRATQSLRLLSALPDQGRGNVGVATYGGFQKAAWYAESALIALRALAGRRTA
                     EGWEVVDLIERGSTQRVVAQQLGITQAAVSQRLTAAGHDELNRLAGLATITLAAAMAW
                     SQ"
     CDS             complement(523008..523616)
                     /codon_start=1
                     /gene="coaE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976822.1"
                     /locus_tag="brsh051_04920"
                     /product="dephospho-CoA kinase"
                     /protein_id="BEH01211.1"
                     /transl_table=11
                     /translation="MSVLSVALTGGIGAGKTTVARLLAQRGAILIDSDVLSREVVEPG
                     TPGLEAIVERFGPAVLAADGSLDRQALGTIIFADAQARADLNGIVHPEVRRRRAELIA
                     SAPDGSIVISVIPLLVEGGLQDGFDGVIVVDVPIDTQVDRLKARSDLDDQQARARVNA
                     QASRDERLEVADWVIENSGSYDQLRQQVEVVWDALNKKVRSL"
     CDS             complement(523613..524779)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973161.1"
                     /locus_tag="brsh051_04930"
                     /product="ferrochelatase"
                     /protein_id="BEH01212.1"
                     /transl_table=11
                     /translation="MTLTHSHWDSHTRLGFMLAAGLYHGIMLVSFGGPRVPDDVMPFL
                     RNVTRGRAIPSERLELVAEHYYHFGGASPINAQNDALAAALGAELAARGHRLPIWVGN
                     RNWSPYLTDAVQQAHQSGCQRILAVLTSGYASYSSCRQYRDDLDAALVQTGLTGELKV
                     DKVRQFFNHPGFVTPFADGLVAALGRLSSHDPTLTSADVEVIFTGHSLPIGAAMSSGF
                     GAWREATGGAYLAQHRQVAEQVVQAVNLLQRAAGGPEVTHWQLAWQSRSGPAAQPWLE
                     PDVNDAIAGLPGLGRKAVVTVPISFISDHMEVIWDLDIEAAATAAGLGLGYARAATPG
                     THPKFVTALADMIEERQSGRGDRAHIGRYGAWPDSCPPDCCPAPVRPHHQGARP"
     CDS             524818..525972
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001046898.1"
                     /locus_tag="brsh051_04940"
                     /product="TIGR04053 family radical SAM/SPASM
                     domain-containing protein"
                     /protein_id="BEH01213.1"
                     /transl_table=11
                     /translation="MAGHPSGIGSVKPVNWAYDRAPMIIYWELTNACGLACKHCRATA
                     MPEPAPGELTTEECLQVLDTIAGFGSPLPHIVMTGGDPLRRPDLEILIKAAIDRGVGV
                     SLAPAVTPLLTAERIAWMKDLGVGAISLSLDASNALAHDGLRQVAGTFDATLEALRQA
                     AAVQLPVQVNTLVSADNADDLEAMYQLLSAEKLMQWSLFFLISVGRGTQLTELDPGEA
                     ERLLMHWGARSATAPFRIKTTEAMQYRRILAQRMFAEGKTREQIEASRASAGFGIRDG
                     NGVVFISHLGKVTPSGFLPIEVGSVREQSLVEIYRDAPLMRQLRRPEQFKGRCGVCEF
                     HRWCGGSRARAWARTGDPLETDPMCPYQPNHRYAEAMQATAQPADAQPVG"
     CDS             complement(526103..527602)
                     /codon_start=1
                     /gene="rpsA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976820.1"
                     /locus_tag="brsh051_04950"
                     /product="30S ribosomal protein S1"
                     /protein_id="BEH01214.1"
                     /transl_table=11
                     /translation="MVVVRPTEHINQQSEPYYMTSSTEASNKVAIDDIGTPEAFEAAV
                     DSTIKYFNDGDIVTGTVVKVDRDEVLLDIGYKTEGVIPSKELSIKHDVDPFDVVKVGD
                     EVEALVQQKEDKEGRLILSKKRAQYERAWGTIEKIKESDGVVTGSVIEVVKGGLIVDI
                     GLRGFLPASLVEMRRVRDLQPYVGQELEAKIIELDKNRNNVVLSRRAWLEQTQSEVRQ
                     SFLHQLQKGQIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSEVVEVGQQV
                     TVEVKDVELDRERVSLSLRATQEDPWQTFARTHQIGEIVPGKVTKLVPFGAFVRVEDG
                     IEGLVHVSELAERHVEIPEQVVAVGDEVMVKIIDIDLERRRISLSLKQANQGVDIAAD
                     DFDPSLYGMTASYDENGNYIYPEGFDPETNEWKPGFEEQQAAWEAQYAEAQARWLALK
                     KQAADAEESAVAAARAEATEYTSDATPVEGSLASDEALQALRNKLTSGS"
     CDS             527819..528544
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04960"
                     /product="hypothetical protein"
                     /protein_id="BEH01215.1"
                     /transl_table=11
                     /translation="MPHRNTRIAIVIVVIVLIAGLAIMVGVRLHQPGDTNQVALGEPS
                     QIAAGPETSQASETTEPATSTSAVPESCPSDPQPIASPVQMTLIGHGMELPMLSLGMD
                     ASGAAPEAPPGNEGYTVAWFNQGPLVGSSEGKAVLSSHTFQYGGALGNQLNNGLLSLG
                     DIVKISGSDGSAACYRYSGSTHVMVADYDPTSDILYDYYGDPKFALIVCSDYTSGGDA
                     LGRMIYYGDLIGGDEAAQVGGGS"
     CDS             complement(528584..531277)
                     /codon_start=1
                     /gene="polA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014467407.1"
                     /locus_tag="brsh051_04970"
                     /product="DNA polymerase I"
                     /protein_id="BEH01216.1"
                     /transl_table=11
                     /translation="MTSAQPKVMLIDGHSMAYRAYYALPVDSFATATGQHTNAVFGFT
                     SMLINILRDERPTHVAVAFDVSRSTFRTVEYQDYKATRSKSPDEFNGQVALICEVLDA
                     LNIPHLSLDGYEADDIIATLSRQADERGWENIIVTGDRDSFQLVDDNTTVLYPVRGVS
                     ELARMTPEAIEAKYGVGPQRYPELAALVGETSDNLPGVPGVGVKTAAKWLASFSGLEN
                     LLARADQVPGKAGASFREHIEDVRRNRHLNRLVNDLTLDLGLTDLELHGWDRTAVHQL
                     FDALEFRVLRERLLEAFPDDDNVAEQSGFELAGERLAAGQLAGWLAEHAHGPLTGVDP
                     SGRWGSGRGEITALALAGSDGTACWIDVADLDAPDEQALAHWLADPAYPKALHSAKGP
                     MLAVWEQGWQLNGLVCDTELVAYLLRPDQRSYDLADLSIRYLKRELRVDSSGEGAVGQ
                     QTLDFGDSSDDDESQAAMLRARAVVDLSTTMTAELDSLGQLRLLNDLELPLQRILARM
                     ERTGIALDCEVLDQLYHEFDARVRSAEQAAWDLVGQQVNLGSPKQLQAVLFDQFDLPR
                     TKKIKSGYTTDAEALEGLYARTGHPFLEHLLAHRDATKLRQAVEGLRKSVADDGRVHT
                     TYLQTIAATGRLSSADPNLQNIPIRTEAGRRIRSAFCVGEGYEALMSADYSQIEMRVM
                     ADASGDEDLIEAFRSGVDFHTVTASKVFGVPADQVTGVQRASVKQMNYGLAYGLSAYG
                     LSTRLGVSVAEARELMDDYFTTFGGVRDYLNDVVAQARRTGFTETLAGRRRYLPDLIS
                     SNRQRREMAERMALNAPIQGSAADIIKIAMIGLDTALTSSGLKSRVLLQIHDELVLEV
                     GPGEREQVTELVREQMAGAANLMVPLDVSIGYGPTWLDAAH"
     CDS             531246..531779
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_04980"
                     /product="hypothetical protein"
                     /protein_id="BEH01217.1"
                     /transl_table=11
                     /translation="MSITLGCALVTGEFTCPTVAGSLGDPETTGAGAGAKCRSCATVN
                     PMTESEIAQFDVPDSPFDTKLGLEITERSAERVCGRAPVAGNTQPYGLWHGGASAVMV
                     ETLGSLGGAAHAGAGRRAVGTELNISHLRSARSGWVHGVATALYLGATSAVYQVELTD
                     DDGRLLASGRLSCRILD"
     CDS             complement(531791..532402)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976804.1"
                     /locus_tag="brsh051_04990"
                     /product="response regulator"
                     /protein_id="BEH01218.1"
                     /transl_table=11
                     /translation="MSDSKKASAAKHPRVLVAEDEALIRFDLVELLNDEGYEVVGQAG
                     DGEKAVELARELEPDLVVMDVKMPKMDGIAAAEIIASERIAPVVMLTAFSQRDLVEQA
                     REAGAMAYVVKPFDASDVVPAIEIAMARFAEIRALDDEIEDLEERLASRKIVDQAKGL
                     LQESLGLTEPEAFRWIQKTAMDLRKSMREVAEGVIDHAKASRS"
     tRNA            532637..532720
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="brsh051_t00090"
                     /product="tRNA-Leu"
     CDS             complement(532842..534200)
                     /codon_start=1
                     /gene="pyk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805095.1"
                     /locus_tag="brsh051_05000"
                     /product="pyruvate kinase"
                     /protein_id="BEH01219.1"
                     /transl_table=11
                     /translation="MEELITAGLDVARFNMSHGDHAEHKKRLDETRAAAQAVGKTVGL
                     LADLQGPKIRLGNFVEGKVNLTYGQEFTITTDDIDGDAHRASTTFKGLPGDVKPGDTI
                     LIDDGRVGLEAVSVTDNDVVTKVTVAGPVSNHKGINLPGVAVNVPALSDKDEADLRWA
                     LQNGFDMIALSFVRRADDINRVHEIMDEEGVRLPVIAKIEKPQAVENLNEIVDAFDGF
                     MVARGDLGVELPLEEVPLVQKRIIRKARKWAKPVIVATQMLDSMISAPRPTRAETSDV
                     ANAVLDGADAVMLSGETSVGAYPVETVLTMARIVENTERHGIKEISKIKWDPHTTGGV
                     IAMSAAQAAQQLGAKYMVAFTQSGDTARRMSRLRAEIPLVVFTPEEKTAHWLTLCWGA
                     QVFTTPSYPSNEDMVVAVNEIMQDLGLAKVGDPVVIVFGSPIGVIGKTNTLRVHRIKE
                     RD"
     CDS             complement(534334..535317)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976742.1"
                     /locus_tag="brsh051_05010"
                     /product="RluA family pseudouridine synthase"
                     /protein_id="BEH01220.1"
                     /transl_table=11
                     /translation="MHHRCCDLVDHLVVPLGASLMALLLVPDGLDDERIDVAAARMTG
                     LSRSRIADLIDAGAVQLAGSVVTRASGRVHAGDLLEVDISEPVRQAKVVPVLADGLRI
                     VHEDSELVVVDKPAGVAAHPSLGWTGPDVVSHLAAAGVQVSTSGAAERQGIVQRLDVG
                     TSGLMVVAKSEHAYSVLKQAFRDRSVDKTYLALAQGHPDPFSGTIDAPIARHPGHDWK
                     FAVIAGGRHSVTHYEAVEVLRAATLLEVHLETGRTHQIRVHLSAIGHPCVADPLYGAD
                     PVLAARLGLQRQWLHAVRLGFIHPGSGEYVTFSSEPSPDLLSALRLLRAES"
     CDS             complement(535257..535703)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05020"
                     /product="hypothetical protein"
                     /protein_id="BEH01221.1"
                     /transl_table=11
                     /translation="MAVMVPLLYALDQFTKHLAVDRLTVGQPVEVIPGLLWFSLHFNP
                     GAAFSMGTQFTVVLSVLALGVLAGLLAFAAPRVRSWLAAVGIGWLIAGVAGNLTDRLF
                     RDPGPFLGHVVDFIAIRGFAIFNVADMCITGAAILLIIWSFRSERR"
     CDS             complement(535811..536236)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05030"
                     /product="hypothetical protein"
                     /protein_id="BEH01222.1"
                     /transl_table=11
                     /translation="MATTKPDEAVLTALPVLDGEDPWTAEEVAAVRAELIEERDRLRA
                     AVAHAQAELAELMTEGSDGAGRDPADVGSSNFERDQELSLHNNQRNMLDQTEQAVKAL
                     EAGTYGYCENCGKPIGKARLEAFPRATMCVTCKQRQERR"
     CDS             complement(536354..537526)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05040"
                     /product="hypothetical protein"
                     /protein_id="BEH01223.1"
                     /transl_table=11
                     /translation="MTLSLDEVRNIRFPMARKPSEDGYRASAVDNFMDKLEISYAQLT
                     EELEQLRAGGSGGEAASSEADDALRNELKNAQAASSRLAGELDALRNEHASLQTASSQ
                     LHQENERLSSEVAQLRGQLDELRASSDLSKTGGEQLRAENENLHRQLEELRGQLNNSQ
                     QELAAAQQRAEAAQQAPAPAPRQVLDGSDGDVRQIRVTTSSEASSAVVRLVELATEQA
                     ETLLADADAEAHRRITEAVGQAERTTAEARARAEQLDHESRSRADQLDRESKARAEQL
                     DTETRQQADRILGEARGRADRLDAEVRERRAELFTGLENDRDVLVDRVNQLRDYEENY
                     RRTFNGFLQSQIDQLGQTSISPSQRPDTDAMYGLGQPHVSTPRLDALVDESRQELN"
     CDS             complement(537695..537985)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804708.1"
                     /locus_tag="brsh051_05050"
                     /product="YggT family protein"
                     /protein_id="BEH01224.1"
                     /transl_table=11
                     /translation="MQTAGWLLYMLLQVYIWLLLARMIISWIPMFAPRWRPRGILASL
                     FEIIYTLTDPPIRALRKIIPPLNLGGVSLDIAFMAVFIGVYVLQRVIVQVFF"
     CDS             complement(537998..538501)
                     /codon_start=1
                     /gene="sepF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804707.1"
                     /locus_tag="brsh051_05060"
                     /product="cell division protein SepF"
                     /protein_id="BEH01225.1"
                     /transl_table=11
                     /translation="MAQTIRKAAAWLGLVRDEEDERYGDDVEQFSEPIYGYERSEEVS
                     AVTPINRRPAQQDHYRDAADVETRVSDPVKADLGRIITVHPRAFNEARTIGEHFRDGV
                     PVIMNLTDMEDADARRLIDFGAGLIFGLRGTIERVTSKVFLLSPNNVNVTAEDKERIK
                     GGFYNQS"
     CDS             complement(538602..539372)
                     /codon_start=1
                     /gene="pgeF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_173521163.1"
                     /locus_tag="brsh051_05070"
                     /product="peptidoglycan editing factor PgeF"
                     /protein_id="BEH01226.1"
                     /transl_table=11
                     /translation="MFAEFIDPAGNGGVGVAFTDRLGGVSEGALGRLNLGRSDLDEID
                     HLRTNMSRVRQAAGITPIVAVHQIHGTAVHLADDDGRDWSSDGWIGNGAPGVARLPVA
                     DAIVSTTPGLAVMIRVADCVPVILADPARRIVAGAHAGRVGLLEGVLPAAVAAMGDAG
                     ARRITAWIGPHICGDCYEVPAQMAADAAERIPECAAVTSWGSPAIDLGAGAEAQLEHL
                     GVEVHRADPCTLTSTSLFSHRGDGPGAGRQIGLVWLAE"
     CDS             complement(539380..540558)
                     /codon_start=1
                     /gene="ftsZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976733.1"
                     /locus_tag="brsh051_05080"
                     /product="cell division protein FtsZ"
                     /protein_id="BEH01227.1"
                     /transl_table=11
                     /translation="MATASQNYLAVIKVVGVGGGGVNAVNRMIESGLKGVEFIAINTD
                     AQALLMSDADVKLDIGRDLTRGLGAGADPEKGRQAAEDHSDQIEDALKGADMVFVTAG
                     EGGGTGTGGAPVVAKIARSLGALTIGVVTRPFSFEGRRRANQADSGIANLADEVDTLI
                     VIPNDKLLEMTDVRVAILDAFKQADQVLMQGVSGITDLITTPGLINLDFADVKSVMSN
                     AGSALMGIGSARGDDRAREAAEQAISSPLLEASIDGARGVLLSIAGGSDLGLFEVSEA
                     ANLIEEAAHDEANIIFGTVIDDALGDEVRVTVIAAGFDSGQPTPKAKPAAAAQQPETR
                     PQPKAEPMINRSDEQRRFTPNFSASDDGHNEPTHMTKRPVVAPVADDDDDLDIPDFMK
                     "
     CDS             complement(540878..541606)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05090"
                     /product="hypothetical protein"
                     /protein_id="BEH01228.1"
                     /transl_table=11
                     /translation="MTANGTSGRTDLGPRLDLRRKTQQRARRKRAIIIGAALVVLAVL
                     AWVALFSSALATREVTVTGTQLTTTDEIVQTARVPLGTPLTRIPADAIRQRLLALPEV
                     ADVVLHRNWPHELGIEVIERTMVYQRINAGSYQWVDASGKIFHTASEPVEGVVADTAG
                     DEQRMLADVATVVSALPADVVAQTTQVTASTIDHIVIELADGRQIVWGNASLSDEKAA
                     LLPVLLAQPGTVFDVSAPGHPAIR"
     CDS             complement(541603..543054)
                     /codon_start=1
                     /gene="murC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030625.1"
                     /locus_tag="brsh051_05100"
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="BEH01229.1"
                     /transl_table=11
                     /translation="MLRQIIEVLPAAEAGAIHFIAIGGAGMSGIAEVYNELGMPVSGC
                     DRSDSPVLHQLSELGIATAVGHDVAHLNGIDTVVVSSAIRQNNSEVVAAKAAGLRLWH
                     RSAALAALMIGRRGVSVAGTHGKTTTSAMTATMLAHAGADPSYVIGSPLAATGRSAHL
                     GSGDVLVIEADESDGSFLQYPTEIAVITNIEADHLDNWGTAKAYHEGFRDFAHGPTVR
                     SVVINADDPGSRDLASELRKAGVVKVITYGEAADADYRLSDLRFKDTASSARLHAEGR
                     THQLDLQVPGRFNLANAAAAFAVGRLLGIDAADLLAAAAQFTGTLRRFQLIASQPLSD
                     DPDAAPVRIYDDYAHHPTELRASLGAALRARGSGRLVACFQPHLYSRTRDFAEEFGRA
                     LCLADIAIVTDVYGAREEPMPGVSGALIANAAKAHAGSTTEVHYVPDKAELPRVLADL
                     VRPGDLVMTLGAGDVTLVGPLLVDQLKKRVSRG"
     CDS             complement(543054..544166)
                     /codon_start=1
                     /gene="murG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011729656.1"
                     /locus_tag="brsh051_05110"
                     /product="undecaprenyldiphospho-muramoylpentapeptide
                     beta-N-acetylglucosaminyltransferase"
                     /protein_id="BEH01230.1"
                     /transl_table=11
                     /translation="MVNVILAGGGTAGHTSPLIATAQAITAIAPDTQITCIGTARGLE
                     TRVVPEAGLDLELVPAVPLPRKINLDLFRVPGRLAGAVRQAKKILRAHDADVVCGFGG
                     YASLPAYLAARRLKIPVVIHEQNALPGLANKIASRFAVAVLTSFPGTELKGARFEGLP
                     VRRAITDLAEAGRTAAAASARQSFGLAPDLPVLLVSGGSQGARSLNDATVDAADRLLA
                     AGIQVLHVWGPKNYHDGLTERVDQTTGARYVPVGYVDAMERAYAAADLMLARSGAGTV
                     VEVATVGLPAIMVPLPIGNGEQARNAKPLVDASAAICIDDAELTADRLVSEVTALFAA
                     PGKLAAMSAAAQKLMRPDAAARVAHVVLDAAQAGER"
     CDS             complement(544201..545517)
                     /codon_start=1
                     /gene="ftsW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804701.1"
                     /locus_tag="brsh051_05120"
                     /product="putative lipid II flippase FtsW"
                     /protein_id="BEH01231.1"
                     /transl_table=11
                     /translation="MSVASEVRKPGRPAGPAAASRPAAAKRRKRGLEGGLADFGSHGE
                     GNLARVLSQPLADYYLVLVSSALLVGLGVLMVLSASSVWSSVTNQGDAYYYLVRQLVF
                     LAMGIPAAWWLSRRSASAYAVLGWLGMIFSIVLLALVFTPLGEDAYGNRSWLRLGPLG
                     TIQPSEFAKAALILWSAAVLANRTKTLSDPRRLLFPFLLGFLVIEGMVLLQKDLGTAV
                     IIALIMFAVLWFVGAPMRVIAALGSVGAVVIGLMVVTDPERMHRLFSFVNPSDAVSDQ
                     PMNAIYALASGGWWGVGLGHSRQKWGGLYNGAQTDYVLAVLGEEMGLVGTLIVLCLFF
                     VLAFTGLRIAARSSNRLLAYAASGMTAWIVIQALVNIFVVMRLLPVVGVPLPFLSQGG
                     SALLANLVAVGILLGAARQEPEAARLLAAGRKTRQPRMTSVVDTRR"
     CDS             complement(545514..547013)
                     /codon_start=1
                     /gene="murD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976729.1"
                     /locus_tag="brsh051_05130"
                     /product="UDP-N-acetylmuramoyl-L-alanine--D-glutamate
                     ligase"
                     /protein_id="BEH01232.1"
                     /transl_table=11
                     /translation="MTTDRPLAWLRIADRYSPWREAAVVVAGLGTSGFAAADALLELG
                     ARVIVLDDLDSDENREKATLLEHLDATVRLGPGSSATLPDDIDLVITSPGWRPDYPLL
                     AAAAAAGVPIWGDVELAWRLMHPDRIVPWLGVTGTNGKTTTVQMLDSMLRAAGLKSAA
                     VGNIGRPIIEAINDEIPYDVFAVELSSFELHWTHSLELHSAAVLNLHADHLEWYGPWL
                     GDPDAAMDGYRADKARIYHNVRHSCVYNVAEPVTEKMVADAEVIEGARAIGFTLGIPS
                     ISMLGIVDDLLVDRAFVAQRHDSALPLANVADVHPNAPHNIENALAAATLARSFGVPG
                     PAVAAGLRNLKLGGHRIATVATIDGVTWVDDSKATNPHAANSSMRAFDSIVWIAGGQT
                     KGTSFDDLVTAHASKLRAAIVLGVDRQVVADALARHAPGVPVVVIDRHDAKGAMTEAV
                     QAAAAFAERGDTVLLAPGGASKDMWPGYAARGDDFAAAVRGLPGGGVRQ"
     CDS             complement(547080..548150)
                     /codon_start=1
                     /gene="mraY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976728.1"
                     /locus_tag="brsh051_05140"
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="BEH01233.1"
                     /transl_table=11
                     /translation="MKLIIVAGVVALAGTLIGTRAFIGFLVRRGYGQFVRDDGPATHS
                     AKRGTPTMGGLAIVLAVVLAYALAHLVNLELPSYSGLLLLGLLVACGLLGFIDDWTKI
                     SHKRSLGLTSRGKLLGQLVIGAAFGTAALFGPNAYGDTPASTAISFTRDIEWLRLPLV
                     AAIVWMTFMVIASSNAVNLTDGVDGLATGALTMVFGAYTLINIWQRNQWCRPGSTAGP
                     MCYQVRDPWDLAVISAALAAACFGFLWWNAKPAKIFMGDTGSLALGGAVGGLAILTRT
                     ELLLIIIGLLFVLEASSVAIQVSYFKLTHGKRVFKMAPLHHHFELLGWDEVTVVIRFW
                     IICGVSVVTGLSVFYAQWILGQ"
     CDS             complement(548154..549596)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976727.1"
                     /locus_tag="brsh051_05150"
                     /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-
                     alanine ligase"
                     /protein_id="BEH01234.1"
                     /transl_table=11
                     /translation="MRTRSAAELAALIEAGGEPCTVTADPDTVVGPAVVIDSRQATSG
                     ALFVALPGENVDGHDYVAAAAALGATAAIVTHQVDAPLAELVCEDAQQGLTALARSLH
                     AEARAAGLQTVAITGSAGKTSTKDLLAQILAAVGPTVSPAGSHNNELGNPLTVCQIDE
                     RTRYLVSEMGARAIGDVAYLCSIVHPSVSIVLNIGTAHLGEFGSKARTAEAKGEIVEA
                     LDPDGWAVLNAGDPFVDAMAPRTQARIARFMVGGTEPVDAELFVRATDLKPDDLDRYS
                     FVLTVTGPGATAHSAKVQLRLIGEHQVADATAAATAALVLGVPLETVAAALNQATARA
                     RWRMELHELPNGAAVINDAYNANPESMAAALRAVAAIGERRRASRPQARTIAVIGDML
                     ELGETSPELHAGIGQLAAELGYDEIVALGEHAQDIVGGAERVGARARIAEVQTVAGSL
                     ELQPGDVVLVKASRGLSLDEVADQLVGGEE"
     CDS             complement(549593..551185)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011729660.1"
                     /locus_tag="brsh051_05160"
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-
                     diaminopimelate ligase"
                     /protein_id="BEH01235.1"
                     /transl_table=11
                     /translation="MASEEQHSQAQPAPQTFPQPLSQLLAGLPVQLPDADPIVSRVSF
                     DSRRVRPGDLYVGLPGTRSHGALFAEAARSAGAVALLSDPAGARLADGQHLPVVVCDD
                     PRYVMAIASARVWGHPARNMTSFGVTGTNGKSTTVLMLASALDAAAHRVGSIGTLGFL
                     VGGEPVQIDHSTITTPEAPDLQAIIATLAARGADVMAMEVSSHALALNRVAGIQFDVA
                     GFTNLGRDHLDFHHTMEAYYQAKAQLFTPGYAKRAVINGDDEAGRRLMRQAAELGLPA
                     VSVGLSDGCDYRVVAWQPHGPGSRFTLAHDGAQLDAFTCLPGEYNVRNAATALAMIDQ
                     AGYDMTAALPGLAAAVIPGRMQPVPLDGEAAPHVYVDFAHTPQAIASALSAFSHPGFT
                     GRRVIAVFGAGGDRDPDKREPMGAVGVHGADIVLVTDDNPRSEDPAAIRARVLAGARE
                     AIASAAPGSHDARVEAYDGGDRATAIEQALRLARAGDVVVILGKGHERSQQFADRTID
                     FDDVAVTQDRWAQISQAPGGPS"
     CDS             complement(551188..553038)
                     /codon_start=1
                     /gene="ftsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028132.1"
                     /locus_tag="brsh051_05170"
                     /product="cell division protein FtsI"
                     /protein_id="BEH01236.1"
                     /transl_table=11
                     /translation="MGKNSRRRARPGLPIASTNKRITIFFVFVAIMISLASGRALLLQ
                     GIDADANAQAAAAQLSQSQVLKADRGVIYDRNGEVLAETQPAFSVIADPYSISSNGYD
                     PDHMTSDQRAKADKAPAAIAEILVKYLGGNKDDYLTQLTDTRTADGGPNQYELIARKV
                     SAAVYQQMAAELTAGGWYGIYSAPDPVRYYPNGTLASNVLGFVNYDDEGAAGLEYGQN
                     QYLSGTDGKQTYQSSRYGTIPLGDSTLIEPVNGATYTLTIDSELQWMAETSLANAVAS
                     AQAKSGTIVVQAVDTGEILAMATVPTFDSNNPGSADADDLGNRVVTDAYEPGSVQKVL
                     TMAALLDAGLITPDTKVQVPEQILSGDAPIRDAWSHGTLDLTARGVLAQSSNIGTVEL
                     ARQMDKATLSNYLASFGLGTSTGIELPGETGGALGILPGTDMADYTRDQISFGQGLSV
                     TALQEASAISAIVNGGVYHQPTVIASATTAAGDAISFDRAEPRRVISPEASAAVVNMM
                     EASVASPEMTTADSKTIDGYRMAGKSGTAQKADQYGNYNGGYTGSYVAVAPAEDPQIL
                     VYVVIDEPVNGYYGGTVAFPTARQMMMQALPRYGIAPSTDVPAYTDPLTY"
     CDS             complement(553113..553724)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05180"
                     /product="hypothetical protein"
                     /protein_id="BEH01237.1"
                     /transl_table=11
                     /translation="MSALHAPITPGSDSQPTVLRAVPRQSHQLAQLPFILFIAVLLGG
                     GLTGVLVLSTTIQTQSGELAALQSQEAELRYQEAALVAQAQDLRSSQNLADQAWALGM
                     RPNPNPAFIKMPSGEILGVPTEVSGNELPGMVPPAPVSVPVTTPAPEPTSTTEPSTEP
                     STESSTEHTTEPTTTAGDQDGTEQTDESTNSETTQPAAGEVNP"
     CDS             complement(553721..554764)
                     /codon_start=1
                     /gene="rsmH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976723.1"
                     /locus_tag="brsh051_05190"
                     /product="16S rRNA (cytosine(1402)-N(4))-
                     methyltransferase RsmH"
                     /protein_id="BEH01238.1"
                     /transl_table=11
                     /translation="MDVSEPVAARNPPDPAPLAVDDHGAVVHTPVMRERITALLGPAL
                     QTPGAIHVDVTLGMAGHASAILADCPNARLIGIDQDADALAIAERTLHRFAGRFELVQ
                     ARFDELADVLDDLGIAEINSLLADLGLSSLQIDQRDRGFAYAADAPLDMRMDARNPRT
                     AAQVLNTSSQAELVRILRRYGEEPHAERIARAIVTERAREPFSRSARLVDVISAALPA
                     AVRHGGGHPAKRTFQALRIEVNGELDALAGLLPDALGRLAVGGRIAVLAYHSLEDRLV
                     KQTFAAAISDAAPPRLPVVPEPLLARFEPLTRGAEKPTADEIASNPRAASARLRVVKR
                     IRPGHVPILKEAR"
     CDS             complement(554936..555385)
                     /codon_start=1
                     /gene="mraZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804693.1"
                     /locus_tag="brsh051_05200"
                     /product="division/cell wall cluster transcriptional
                     repressor MraZ"
                     /protein_id="BEH01239.1"
                     /transl_table=11
                     /translation="MELGVVPMFLGTHTPKLDDKGRFFLPAKFRDELAEGLVVTRGQD
                     RCLAIYPMATFVAKTQQMASAPATVRQVRDFQRMLASSASDEVPDKQGRISVPAVLRD
                     YAGLDKDIVVVGAIDRVEVWNPQAWEEYSAAQEASFAELNEEIFPIL"
     CDS             555637..556596
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976721.1"
                     /locus_tag="brsh051_05210"
                     /product="MoxR family ATPase"
                     /protein_id="BEH01240.1"
                     /transl_table=11
                     /translation="MTPKLDVPQVQRTAEAMRTAIASVIEGKTEQIDLAILVLFAGGH
                     LLIEDVPGVGKTMLAKALGRAIDCRVRRIQFTPDLLPSDITGVSVYNQETREFEFKPG
                     GVFANIVVGDEINRASPKTQSALLEAMEERQVSVDGQTHRLRPPFMVVATQNPIEMEG
                     TYPLPEAQRDRFMARIEMGYPTRGAELEMLSAHGAANPLASLQPVTDGATLTKLAAGI
                     GEVHVSQAVKEYIVDIVDATRSSSDLRLGASPRAGLQLLRAVRVRAAVTGRDYVIPDD
                     VQALLASVLSHRVLLTSAARLAGRSGADAVTAAAATVALPRSI"
     CDS             556599..557840
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_193486197.1"
                     /locus_tag="brsh051_05220"
                     /product="DUF58 domain-containing protein"
                     /protein_id="BEH01241.1"
                     /transl_table=11
                     /translation="MQAWRRLTPRGRIVGVFGLLAGLAGVVFTQRDLFWLGAFAFAVV
                     IGALLMVSWPVKGLRHERRLAVTSVPVGTEFGVWLTLTSSGGGLPRMLHFEDVVPPSM
                     GIRPRFALSGGIPSDGYRVGYRLTGAQRGRFRIGPLLVRSLDPFGLARNDMAFVTTTE
                     IAVTPKIYELGGLRAGSSGSSAEARSARAGLVGQDDVLVREYRRGDDVRRVHWRSTAR
                     AGELMVRREEQSWQPTTRLLVDNRRCAHVGGGPDSSFEWAVSAAASAGLALLGAGSIL
                     ELADADGLSLSPDSDRSVRSQQLLYELTDITLTSAESLAAGLFAGGENRLPSSSVLAV
                     LGQLTDADLATLIEATPRSGSAHALLLDVQSFAGGSSRSAQARYAVELANRGWMVTLV
                     TGSTTVPQAWTALHEATEVLA"
     CDS             557837..559996
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_193486200.1"
                     /locus_tag="brsh051_05230"
                     /product="DUF3488 and transglutaminase-like
                     domain-containing protein"
                     /protein_id="BEH01242.1"
                     /transl_table=11
                     /translation="MIGSLRNSIATAVAAFLGAVPLVQLSADPRLLPGAAVVVVVLTG
                     LGWLARRLSRLTWPGTVAQLLAGFIMVWIGSASASGAAGQTRPWQVFALTWNQAGAHI
                     YGQSVPMAADDATLVLLLTGVGVLTIAIDLAFIAVRSVLLAALPLLGGYLTSMIVLDE
                     AVGIGSIVAVCSGWLLLLASRTIDHEQRWPRGLSSKDDAKFNARGFTGLAAGLGIVSI
                     ATAVVAGLAIPPDGQSWLPRGNVGNNQSIDLIDPTIQLNENLHRPDERPVLSYTTSAP
                     DGVRLRSTALTAMNADGWQLQQMDLLPGTPEAPSLSGTQTPVTTQIAIGDFQSNYLPA
                     PYLPLSWDVDGSWSYDPRTLTVLNVDRRRNNQAVAGLSYSVDSLLAQPDADELANATA
                     DSIDDTGLDDDVPSEIIDLAHQITDGAQSDGAKALALQNWLNDPARFTYDLNAPEGTG
                     YEVLVNFLFNDRRGYCIHFASSMALMAKAVGIPARVAVGFTAGTQQADGSWLVTSHNM
                     HAWPELYFAGLGWVGFEPTVSLGSQQPPQTEPTPQTPEAEPTPQAPENPEDTPAPDVP
                     APLPSPVARISIDPRVLAGILAGLVALASPALARMGIRRKRLASSDAGDRVAGAWREL
                     QATAVDLGMPWPAATPRQVAAMAWPGLDAEGRAALRRIALLVERRRYAAAPPPVAEVA
                     TDVGLISAQWYSSVSKGRRLAARMLPRSLFLGRKRRV"
     CDS             complement(560014..561135)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064976.1"
                     /locus_tag="brsh051_05240"
                     /product="glycerate kinase"
                     /protein_id="BEH01243.1"
                     /transl_table=11
                     /translation="MAPDSFKESMTAAEAAAAISAGVRTVFPDAQCVEVPMADGGEGT
                     TDALVSALDGRWRMISTHDALGRPIEAGYGLTPDGLVIIEVASAVGIGQINPDERDVL
                     HSSSLGVADLVRDALDNAANRFIIGLGGSATTDCGAGMLAGLGVKWLAADGSELAPNP
                     AALADLDRADLSGLDPRLADVEIDLACDVTNPLLGPHGSAAVFGPQKGAGPDDVRYLD
                     GILEKVAEALVAAGAPDVREEPGAGAAGGLGAAFLAIGARMRRGAEVVAEAAHLAEAI
                     DGADFVLTGEGGMDFQTLSGKTPAGVADVAGRYGVPVIAFAGTLGRGADDLVGRGFEA
                     VVPIMPGPGTLADALADGPNNLERAAATAMRLIKLGAAG"
     CDS             complement(561232..561603)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804692.1"
                     /locus_tag="brsh051_05250"
                     /product="DUF3040 domain-containing protein"
                     /protein_id="BEH01244.1"
                     /transl_table=11
                     /translation="MALSEEEQRLLEQLEASLAADDPKLAQTLGSSSTPRQIHGRRAT
                     LAGVLFVVGLVLLVVGMQTSWAVSVIGFIAMLVATVIALGSWRKATDSDARGKRTPPP
                     NSEPFMGKMEDRWRRRQEGGF"
     CDS             complement(561903..562565)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05260"
                     /note="frameshifted, insertion/deletion at around 562605"
                     /product="hypothetical protein"
                     /protein_id="BEH01245.1"
                     /transl_table=11
                     /translation="MVVIQGLALAGTLVLALGDALVVIRDGGSEVNVVVISLYGLVTG
                     LVGFGVARWLRRSAPGSDLIAAEASQWQAGSVLSVVMFVGAIAVAILLTTPLRDVARF
                     ADPILVIIACLVLAAVPVRLIRSGMNELLEGAPPPELAARIITVIETVRAEFGLPSPI
                     TRAGKVGQKIYVEVDFVVAPDTWSIAQEDEVRRAVINGLSPLGLDVWAYVAVTSDPVL
                     AD"
     CDS             complement(562969..565137)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05270"
                     /product="hypothetical protein"
                     /protein_id="BEH01246.1"
                     /transl_table=11
                     /translation="MTIERVNAAKPSRWTTWLGLILVPVLVLGGLLWATWSSDQRLDT
                     VRAAVVNQDEAVELAGQIVPMGRQLTAALVDSDRVQNLAWEQATLDGARAGLKTGKYA
                     AMVVIPQEFSAAATSYAGPAADAHQATIQVETSPVAGIADATLGKVVAQEAARVLNGT
                     LTTAYLDQIYIGFNQMGEQFVTMADAASQLAEGSAQLADGLNQSAGGAGQLAAGVGQA
                     ADGAAQLSGGTSQLAGGLNTMAGSVAALPDGAAQLADGSAQLSDGVGQYVDGINQIVD
                     PAIDVLADYPQLVEIVQRISGDQEGLDQAVATMRQVQDGVAQLEALNDMSRDELARRF
                     PCPPDLQAVEGGCDSYYEAIRLGIGSANDTMNQVRADDTLGPVIETLDALPDQLAGVQ
                     LPEGGINVLDTLTQLRDGGEELKTGAQQLSGGVSEFAAGMAPLVDGIQQSADGASQLA
                     DGAAQLSDGMTQLNDGAGQLADGMAQLADGGAQLADGTSQFADGLAAGKDQIPSYSDS
                     DRQNLSEVVSSPVATGNLLGTATVGTGWATALMVLALWAGAMATFVVVRALSKQLLSS
                     ARPSAYLVAEAMLPGVIVVGIQAVAVTAIGQIAMGLPFGTLIGLLGITLLAGLAFVAV
                     NHALVAWLGSAGRFVSLGLVIVAMAPMITNAIPGVFATVRAISPMAPALDAMRSLITG
                     SSGTVVSVFQLVFWLLVGLAASAVAIIRRRTTTIAELIDP"
     CDS             complement(565134..567773)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805171.1"
                     /locus_tag="brsh051_05280"
                     /product="MMPL family transporter"
                     /protein_id="BEH01247.1"
                     /transl_table=11
                     /translation="MLAIWLALLALFGVLALTIGGAFDDTFTIPGSSSGRALEMLSVT
                     FPEAADASATIVVGAPDGTRIDSDQARQAMESYVDFLDSDLDFVKGVQLPYSDYVKGL
                     VSDDGSHALVRVLVEGSTSTFTDEQRAELTDAAQKITELLPGSTVAVGGDVFSVEMPH
                     ISVVDGLGVLVAIIVLTAVLGLLAAFMPIVSALIGVGIAVCIVMIAAGITTVSSTALI
                     LVVMLCLAVGIDYSLFIISRHRDQLLKGMDAQESAARAVATSGSAVVFAGLTVIIALV
                     GLSIVGLPFLSVMGMFTAVGVGIEVCLALTLLPALLGLLGDRLRPGARKARRLENRRP
                     GRLARWWVRVVTRWPLVTVLIVVVGLGTLALPARNIEMALPNSGRSSVGAPDRVAFDL
                     VSREFGIGFNGPLVITGSIVESNDPMAILDGMRAEVEAMDGVEMVAAAVPNANADTAM
                     IQVIPTTGPDDPATADLVHNLRNQHQHWLDEYGVDTAVTGLVAVQIDITAKLGAALLP
                     FGLFVVGLSLILLMMAFRSIVVPIKAAVGYLLSVLAAFGLVTVVFNDGVGASLINLSE
                     PGPIISFLPIILMGILFGLAMDYEVFLTSRMREEYMHGNRSWIEDGFVHSSKVVIAAA
                     LIMVSVFIFFVPTGIGAIKPIALGLALGVAIDAFLVRMTLGPALMKLAGSRVWWLPAW
                     LDRRLPVIDVEGEALAHQTKLAAWPSSDDASAIHAERLLAASGDRVLFSNLDISVDPG
                     ELLVIEGDRSARLALMFGLSGRARFSDGEAKVLGHVLPEEGSLVRTRAPLLLATTADP
                     AGELDCGKGGIVFVPALDELPRAVLSALSEALAVPIDKDAPPTTWVLGVGPGTDPESY
                     LPGDYRVLRLSPQLAALAGGVVR"
     CDS             567955..568569
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225737.1"
                     /locus_tag="brsh051_05290"
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="BEH01248.1"
                     /transl_table=11
                     /translation="MSTKRAQTQDRLMDAATALFAEKGVLAASVEEICERAGFTRGAF
                     YSNFESKDELLLAVVQRKREAILKAATDAIDSIPDEPIEPQTLDEIIKQALLIFQATH
                     PIDEQWLLARSEIRLHALRNPSVRQAVRLVDSSLDELLIEAIQAVVDRHGVVMTVPPG
                     QLVILLTAYQEALATSAMLTGENSFEPLIAERSAQLIRALLRIS"
     CDS             568701..569474
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003855465.1"
                     /locus_tag="brsh051_05300"
                     /product="succinate dehydrogenase cytochrome b subunit"
                     /protein_id="BEH01249.1"
                     /transl_table=11
                     /translation="MSARARVDTVAQPGRGAIQVGPPPATSSPRHRHRLPSWALKVTM
                     AVTGVVWAAFVAIHLFGNLKIFQGPEAYNHYAHWLREAFYPLMPKQSVLLAMRAVLGA
                     ALLMHVGCAAIIWRRGRQARGTHRVKIRGPRAWGARLMPVTGILILCFIALHVLDLTL
                     GWGVQSSGFSQATADESFAYQNLVASFQRPQMAIFYSALMAVLAIHVAKGFTTVASDL
                     GAMGHRWRATLAVIGGLLAVAILIGNGAIPVLVLTGVIS"
     CDS             569471..571519
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011013606.1"
                     /locus_tag="brsh051_05310"
                     /product="fumarate reductase/succinate dehydrogenase
                     flavoprotein subunit"
                     /protein_id="BEH01250.1"
                     /transl_table=11
                     /translation="MTLGNRVRDQLGRITSRTPADTSVFVAPASTVPGARVGYDLDGR
                     VPAGDPSTAWDRRRAEYKLVSPLNTKKMTVVVVGTGLAGSGAAAALGELGYDVHAFTY
                     HDAARRAHSVAAQGGINSARAKKVDGDSLQRFVTDTVKGGDFRAREADAFRLGAQSVR
                     VIDHMNAIGAPFAREYGGTLATRSFGGVQVSRTYYTRGQTGQQLQVAGAQALQRQVAR
                     GTVKLHTRTEMLDLIVDAGVCRGVVVRDLVSGQVWAQPAHAVILASGGYGSVYFHSTL
                     AMNCNASASWRACRHGAFLANPSFVQFHPTALPISSHWQSKTILMSESLRNDGRIWVP
                     KTPGDSRPAGKIPDKDRDYYLERKYPAFGNLAPRDISSRAAKEQIDSGHGVGPLSNSV
                     YLDFSDALHSLGREAIAQRYGNLFEMYERATGEDPYVVPMRIAPGAHFTMGGLWSDFN
                     QMTALPGLFVGGEVGWAYHGANRLGANSLLSACVDGWFTLPFSLPNYLNPLLGQPLPG
                     AGDACVRDAVARVERRTAALLGVGGSQAASKFHRRLGEIMYRGCGVERSAASLTQAIA
                     DIADLRAEFWDDLSVPGSGAQLNQGLERAGRVADFLELAELMCVDALDRQESCGAHFR
                     TEYQDSGEAQRDDAHWAFVSAWEVDGAPQGAADHALSFVRHAEPLHFEAVQLATRSYK
                     "
     CDS             571516..572262
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011013607.1"
                     /locus_tag="brsh051_05320"
                     /product="succinate dehydrogenase/fumarate reductase
                     iron-sulfur subunit"
                     /protein_id="BEH01251.1"
                     /transl_table=11
                     /translation="MKLRVEVWRQAGPDTEGHFETHEVDGLEPHLSVLEMLDALNEQL
                     IDAGQEPVAFESDCREGICGACGITVDGQVHGPEDNLPACHQRLVGLNDGATIHLEPL
                     RSACFPVVRDLIVDRSGLDELIRAGGYVSISAGTAPDADALPITEQVAETALDFAACI
                     GCGACVAACPNGSAHLFAGAKLAHLSMLPIPADEREQRARSMIRVTDEIFGPCSYYGE
                     CARACPAKVPLAAVAAVNHERMLAGLRRKL"
     CDS             572437..573747
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005098430.1"
                     /locus_tag="brsh051_05330"
                     /product="inorganic phosphate transporter"
                     /protein_id="BEH01252.1"
                     /transl_table=11
                     /translation="MPPELVILSLVVVTSLAFDFTNGFHDTANAMATSIATKAFKPKT
                     AVTLSAILNLVGAFLSVEVALTVTNSVVNIQDSSGAPRPELLQDGGQELLLIVLAGLV
                     GAIIWNLITWLLGLPSSSSHALFGGLIGATLVGLGASGVNWLGDGTKPDGVIGRVVLP
                     ALMSPLIAIVVATVGTWLVHCITRHVLARYRDTGFRWGQIGSASLVALAHGTNDAQKT
                     MGIITLALIASGRWTDLQQVPLWVKVACALAITLGTYTGGWRIIRTMGKGLVELTPPQ
                     GMAAEFSTASVILISSHMGFALSTTHVATGSILGSGVGKKGAKVNWWVAAKMMAAWCI
                     TLPSAALMGALMWLIGHTIGGLAGALVISALLVASAIWMYRHSLRTRVDHNNVNEEWS
                     DNGSVTAPQPAEPLPVAAHAAAQDAFAELEKLEPHTELELAEAR"
     CDS             573752..574042
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05340"
                     /product="hypothetical protein"
                     /protein_id="BEH01253.1"
                     /transl_table=11
                     /translation="MQILAQLMEGAGEVLVYAVILGAGLPALFAVGVWALSFGARGVD
                     DVVEHHPHPVAKVFAGACFAVVVLAILAGIGIIVGHGFGVTLQFGWPVFVAK"
     CDS             complement(574046..574966)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005812829.1"
                     /locus_tag="brsh051_05350"
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="BEH01254.1"
                     /transl_table=11
                     /translation="MTTVSIIGLGAIGAAHAARIAEAAPLTQIRVIATEPRAERLRAE
                     GVTVNGIRYDFPVVEPAEPVEPADLIIVAVKHHDLAEAIGQLAGHVGPQTVICSLLNG
                     ITSEEELSAAYPQASVPLAVSVGIDAVRDADGVRFTTVGRIEFGDAVPGEPSEGVRRL
                     DELLTTFEIPHRISSDAPRTLWWKLLLNVGANQVSALLEAPYGLFQSDGPARDLMVSA
                     QREVVAVARARGVNLSEDDIDQMIGIIGTLGPSNYTSMAQDALAHRRTEVDQFAGTVV
                     ALGEQYGIDTPVNRVLLQAFEAKHQLWGVA"
     CDS             complement(574999..575628)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027962.1"
                     /locus_tag="brsh051_05360"
                     /product="NUDIX domain-containing protein"
                     /protein_id="BEH01255.1"
                     /transl_table=11
                     /translation="MNDASIFSVVSVDVVALAYERENRQILLGVHHRAAPPFEGELAL
                     PGVVLRSGERLERAASRAIAKLGLPSPGQALGQLRTFDEPSRDPRGPSLSVAMWAAYP
                     PETLAHPGPVWLPLDSTDHLAFDHDEIVADGRRILAGMLWRDLTFTRALTGDQFTATD
                     AVAITAQLTDRSVHRANLNRELGKLDGLTEAGLAPASGGRPPKIWRWAS"
     CDS             complement(575625..577001)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005460670.1"
                     /locus_tag="brsh051_05370"
                     /product="adenylosuccinate synthase"
                     /protein_id="BEH01256.1"
                     /transl_table=11
                     /translation="MTLTTAPRQTIIVAGLGYGDESKGATVDYLAAALPDVVAVVRWS
                     GGAQAAHNVRHGHRHHTFSQFGSGTFCDVRTILRAPMLVNPILLVAEADALESQGVVD
                     PLGLVTADANCLVTTPIHIAMNRAREIARGAARHGSTGLGIGETVAYDLAVRAHAKAG
                     ETIGNFAAPADAPSVPALRVGDLRDQAATVRALDALARYADPLLQAVDDPDAVCGTVQ
                     QLADELCASAEDIAIVDDLAGVLGAAMDAGTVIFEGSQGVLLDEWHGFHPHTTWSTIT
                     PRHLVGELEAAGRRPFVLGLTRAYSNRHGAGPMPTEDRRLQLPEPDNREGRYQGGWRT
                     GHLDLPALRYAAKVAGRVDGVALSHVDMLPFASRSGVPLLVADSWNSRREPLGSPTHH
                     DLAGLQALTRTAQHARPDLMPLSTDPCEVARLIDAAVGAPVVLIADGPQRSNRVLVGE
                     MGSNRRAG"
     CDS             complement(577030..577992)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05380"
                     /product="hypothetical protein"
                     /protein_id="BEH01257.1"
                     /transl_table=11
                     /translation="MGRGYWDTSAYTQAAAARRAAGRQDFGYTAAMRNLPRNQRRAAA
                     SLDAYGAAAREACDSAEHPASTPIAVMFDVTGSMGQVPVTLQKRLPDLLGLLTRGGYA
                     TDPQILVGAIGDDRYDTVPLQVGQFESDNRIDEQLRDIYLERGGGGDRMEGYALAAYF
                     LATRARLDSLDNRGRKGYLFIVGDEMNKPQLYAESVRRFIGDEVRQDMAVDEVYRMLD
                     EKFFTYYIVPRLTSYYNEPWLEDHWRRIVGERFLRLEDPQAVCELIALTVGLMEDSIS
                     LEEGLDDLQRIGSTGTAAVGKALARINRGAAVAVATGGVLPADL"
     CDS             complement(578035..578982)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05390"
                     /product="hypothetical protein"
                     /protein_id="BEH01258.1"
                     /transl_table=11
                     /translation="MNQITAAEAIERITQAGSARDLFAGDYTQPAAARRARRTYRLLI
                     ALIHPDLATRNGIDPARAGEAAAKLNDLYLHWWAGTERQDTTRTPHVVGEYDRYLLGA
                     RIRRTSQISTYATGQQGLFVAISRTQVADTDRLIAASRALAARGLAAFGPEPVDHGLV
                     SGRSWVAYRLPAGLYCLREVRTGYPEGLDGRDWAWMARRILMALNGADQPRAGLSLDA
                     VLVHPGEHGIVLTGWGSQPARPMPAESRTDPDGDDLARLFDQMLDHRPDARRQRAWAT
                     AAAQTAIGGPRGWLAEYDLLLRRIYGERRYRPFAIPQTA"
     CDS             579107..581368
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223681.1"
                     /locus_tag="brsh051_05400"
                     /product="AAA family ATPase"
                     /protein_id="BEH01259.1"
                     /transl_table=11
                     /translation="MTEEHSPSANEILAHELAVEQAHVDTVYRYLASATAAARNVQAE
                     SRAKYLTDRADWMREEDGTALFERDAFAYQAAKRLAVLDAEHEGLVFGRLDFIDDEDK
                     RYIGRLGVRDDDYEPLVIDWRAPAAEAFYRATAADPMGVSRRRVLRCRDDKVIGIEDD
                     LLDEAGSSDLVVIGEGALLAALQRARGPRMRDIVATIQAEQDMAIRAPHQGVTIISGG
                     PGTGKTVVALHRAAFLLYTYRKRMEAGGVLVVGPTDLFMSYIERVLPGLGEDSVTLKS
                     VGELATDVLGFGSQRVDEAEATLVKGSLRMLPVLRRAVHEPMTPENIRLRVSVKGEIL
                     TLEAPELGAIRREVLASQKANRARPATEKALTDALWKKLPTDIAALLDLSREVFDEIV
                     TSQASYAMFLNAWWPTLTPELVLARLADPALLRKFGHDVLDADERHVLADSLAHARGF
                     VPGGERQHPDWSISDIALLDELAAMIGPAPIEREVDPTLFLDDGTEVAELVTLADTLT
                     TTREIDPDDDGVVTHAHVLVDEAQDITPMQWRMLRRRGPQASWTLVGDPAQSSYPSDD
                     ETRRAMRDLIGRGASRTFRLSTNYRSPAEIMDLAGRVITSVYPDADVPASVRRTGVQP
                     ELLALPDAPRGERLGRVLTRLAAEVDGSIAVICAAGRLASVRDTIASMPLPDELRNRL
                     TVLTALQVKGLEFDATIVLAPDEIVQQTAGGVRVLYVALTRATQRLVTLDLTDGRPGA
                     WRESLELPANGSE"
     CDS             complement(581292..582191)
                     /codon_start=1
                     /gene="metF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028143.1"
                     /locus_tag="brsh051_05410"
                     /product="methylenetetrahydrofolate reductase [NAD(P)H]"
                     /protein_id="BEH01260.1"
                     /transl_table=11
                     /translation="MSSHESIGELLANTSQATFSFEFFPPKDEAGQELLTRTIAELKP
                     LKPDWVSVTYGANGSSRQRTLNATMAILATTDFRVMGHLTCTGQTVDEIKAVIDAYGD
                     AGVTNILAIRGDMPGGASEPWRAHPGGLHNATELVELIASRGDFSIGVAAFPDGHATS
                     TPELDAQILLGKQQAGASFAVTQLFFELGHYFEMVGRARSAGCTIPIVPGIMPVTSVK
                     QLGRFAEMSGADIPAEVARRLLSVADDPDQVRHTGAQIAAELCERLLAGCAPGLHFFT
                     QNRSRATREILAMLRADRPSGRG"
     CDS             582268..583359
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_171512886.1"
                     /locus_tag="brsh051_05420"
                     /product="polyprenyl synthetase family protein"
                     /protein_id="BEH01261.1"
                     /transl_table=11
                     /translation="MRLDPSDPTSRSFRDAITAELAAFLSAKSAALADVSPALTELTE
                     VAADFASGGKRLRPAFAYWGYVGAAGDHDVPAAIWPVISAFELLHAGVLIHDDVLDQA
                     DSRRGRPTVHRRFEAWHRSSGGHGDAAEFGRAMAVLLGDQLLVWSDELACGAGLDPES
                     WRRASPYWHRVRTEVNSGQVLDLWAQYQVGSDDTLGAEQIAAKVLEEKTSRYTVQRPV
                     QFGAAAGGAGDDALAALGRFGLVLGRAFQLRDDLLGVFADQEQSGKPAAGDLIEGKRT
                     VLLARALDGLNQAARRRLESLIGTPLTDDQIAEARALISSSGAVDQVESLIDADYAAA
                     AAALSECELTEPGYLALTELARQCVERTF"
     CDS             complement(583383..584015)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05430"
                     /product="hypothetical protein"
                     /protein_id="BEH01262.1"
                     /transl_table=11
                     /translation="MSARMGLTTRLALARTLVWTGLQNEPKTLAERVRQLCSQRADLI
                     VISQPDAIGDDLLIGYRAARQAADGRAILGIRADARLAARSTADLVVSDAGTRIAPGH
                     PHGLVMAVAEGTQAARQALADARVDAVVLPAGAVTEAARLAPPADPGSKPWFAAVDSV
                     SSGRTVVEAGARRLAFPLPGETGVRAYRQLLDAAWRDEMEQVSLAAFAKR"
     CDS             584191..586383
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012805031.1"
                     /locus_tag="brsh051_05440"
                     /product="Stk1 family PASTA domain-containing Ser/Thr
                     kinase"
                     /protein_id="BEH01263.1"
                     /transl_table=11
                     /translation="MTRTTTDRLVGDVLDGRYEVLQRLARGGMATVYRAWDRRLERIV
                     AIKVMHDGLGDDADFVAKFDREARAAARLCDQNVVSIFDQGYDHGRPYIVMEFVEGST
                     LRSIITRDAPMTPLRAIQMIEPVAAALAVAHDAGLVHRDVKPENVLISDRGAVKVADF
                     GLARTVSSQTSTSTQGLLIGTVSYLPPELLTTGRAHSWSDVYSTGIVLFEMLTGTKPY
                     TGDAPITVAYKHVNEDVPLPSQVLTARHPGQARRDPIPDYVDALVASCTRRNPKSRPV
                     DGRELLRRIRRVRRALERGVRSDEALCALVFPASALPWAQEVTTALDPDSMATSVLAA
                     TASAPSQPTLTPQPQAQPSPPTAFRPDPVRSTRVMPAMTDQQVTARPATASTYSSAPT
                     HPAGPPAPPPLPPTEDVPMPASQRYPSLSRTATYRRRRAFTATILVVLLTLVVGLTSW
                     WFTSGRYVAAPSVINLTQAEAQGVADQAGLTITFAQEYSETVPTDLVISSDPVPGDRI
                     VRGSQMSAVISKGPERFAVPQVAGMTLNDAKQALSEANLATGTITEQWSETVATGLVI
                     SAGYTAGEQLKRDTPVDLAVSIGREPLTIPSVVGKPKDEAAKTLTDLGFQVAYGDEQV
                     SATVPAGSVISQNPASGTGYRSDTITLVISKGANLTKVPAPATNEKPATYYDRLTAAK
                     FAPELVYSGANLGPNVGKIAKVTDEDDNVLTADSELPEGAKVKVYVSL"
     CDS             586380..587399
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002195333.1"
                     /locus_tag="brsh051_05450"
                     /product="DMT family transporter"
                     /protein_id="BEH01264.1"
                     /transl_table=11
                     /translation="MITSRDRLFYSPADRLAPLSLLFMAVLWGSTFFVLHDMLDRIDA
                     ADLLAVRFTIAAVVFGAVVHRKLLWSRTTVRQGAILGLIFGSAQLLQTYGLAHTSASI
                     SGFLTGLYVVVTPILEGVLLKARVRQRVWLAVALATVGLAALTIVPGAGTTKFGIGEA
                     LTVASALVYAIHIIYTGRVATQDKAVTLAVVQTAGVAVVCTIAALPGGIGLPQRASDW
                     WAVLYMALLCGALTAVLQVWAQSKVSPTRAAVIMSTEPIWAATFAIMAGQEPFSMRTL
                     LGGTAMVIAMILSSLPDRSMMREPVVVPAQTVTPPRAGYRGRRSAGSNSALTHAYRSD
                     PDPAH"
     CDS             complement(587302..587943)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003897237.1"
                     /locus_tag="brsh051_05460"
                     /product="MBL fold hydrolase"
                     /protein_id="BEH01265.1"
                     /transl_table=11
                     /translation="MQITHLGHSCVLIETAGQRVLVDPGDFSTAWRGLTDLDAVLVTH
                     QHPDHADPVWLPRLLDANPNAMVAVESSVVDIVDLPDRTRRLGPGETIDIGSLTVETI
                     GGQHAVIHRDYPRIGNVGFVFRAESEPSVLHPGDSLDAVAEGIDIALIPAFGPWAATR
                     ETIDFARAVAAPRGFLIHDGLLNERGLGLIDKHVSALSSTQLIDVRDTRPWAV"
     CDS             complement(587996..589030)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142473.1"
                     /locus_tag="brsh051_05470"
                     /product="GntG family PLP-dependent aldolase"
                     /protein_id="BEH01266.1"
                     /transl_table=11
                     /translation="MIDLRSDTVTRPTAQMRQAMATAPVGDDVYGEDPSINELEARTA
                     ELLGHEAGLFCPSGSMANMLGVWSLVPVGREILCDRRAHIVRAEMGAHAALNGITMRT
                     WTSSSGTPGIARTSDITDLLELGCGPYLVETAAIEIENTHNFGGGTIHPIETLREIRE
                     ICRQGGVAMHLDGARLWNAHVATGVPMREYGSLFDTVSVCYSKGMGAPVGSVLVSSAQ
                     RIAEARVQRKRLGGGMRQAGILAAAALYALDHHIDRLADDHANARLFAEQVTAAVPAA
                     IDLEHLATNIVVMDAGERLAADVIAAAADRGVRISKVGAHQLRAVTHLGIDADQCREA
                     GRIVGELLAS"
     CDS             complement(589036..590421)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976701.1"
                     /locus_tag="brsh051_05480"
                     /product="3-deoxy-7-phosphoheptulonate synthase class II"
                     /protein_id="BEH01267.1"
                     /transl_table=11
                     /translation="MSELIPSLAELHAMPQVQQPTYEDADRLNWVVNRLRELPPLVFA
                     GECDDLRDKIARVANSQAFILQGGDCAETFDGVRADNIKSKLRVLLSMSVVLTYAAQV
                     PVVKVGRIAGQYAKPRSKDTETRGAITLPAYRGDAVNGFDFTPKSRRHDPDRLIQMYN
                     ASAATLNLVRAFVTGGFADIRQLHAWNASFVQDSRIEHRYEQMAGEIERALGFMLACG
                     VKDDTLSVVDFYASHEALLLDYEYAMTRIDSRSHRPYDTSGHMVWIGERTRQPNGAQV
                     ELLRRVSNPLGIKLGPNTAGTDAIELADRLDPNRVPGRITFIARMGADKVREKLPSII
                     EAVEQTGRKVAWVCDPMHGNTFETANGYKTRSYAAVVEELNGFFDVHDQLGTWPGGVH
                     VELTGEDVTECLGGAFQLSETDLDARYETACDPRLNRSQSLELAFMIAERLNQSRLLR
                     RVPQRVPDWNE"
     CDS             complement(590470..591135)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976695.1"
                     /locus_tag="brsh051_05490"
                     /product="response regulator transcription factor"
                     /protein_id="BEH01268.1"
                     /transl_table=11
                     /translation="MPTGPVPTSIRVMLVDDHPFWIDALGEDLTEMGCEVVAVAHEGK
                     QVMVRATATRPDVVVMDLNIPQPDGATCTQLLTSEFPDLKVLVMSASGERDDVLRAVK
                     AGASGYVLKSATKQELLDAVRKTAEGEAVFTATLAGLVLGEYRRMANNPASADDSPAL
                     TPREAEVLRLVAKGLSYRDIAELLFVSHRTVQNHVQNVLRKLQLHNRVELTRYAIQQG
                     LDT"
     CDS             complement(591247..592398)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013231016.1"
                     /locus_tag="brsh051_05500"
                     /product="DUF5931 domain-containing protein"
                     /protein_id="BEH01269.1"
                     /transl_table=11
                     /translation="MSSAQTFPRDPNLLRTIYRAAGWARMALVVHMIVVNCMRLSQVQ
                     RPVLLVVVCVVVAGWSVIACLLNVRSRWRTSGLMILDMAITLAVVGSSRYILGIDVLR
                     ESYLGVACYWMLAAPAVLGIWRGAVAGLVGGILVGTAQFLQAPSVAPRAWGDVLLMAA
                     IPYFIGLLVEQLSATIAERDRNLSTLAALEERERLNRIVHDGVLQVLAMVAREGNELG
                     PRGRLLASLALRQEDQLRATLQDRSVDLVGGGLLDTDKTDVTIMLEKHQSDTVTVSTM
                     AGQLNMAASRADELDRVISEVLANVGKHAGPGAHAWILLEQEGNELIVSVRDDGVGAT
                     QEQLDAAAAAGRLGVKESIVGRVLDLGGGSKLTTSPGSGVEWEFRIPLE"
     CDS             complement(592391..593269)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05510"
                     /product="hypothetical protein"
                     /protein_id="BEH01270.1"
                     /transl_table=11
                     /translation="MPDLPRDLTGFRQLADRLRHPWRIDADDIDKLPEGACIVAVNRV
                     SPFDHLNVAASLGREATVVFEPDSGRHLVPGIRHTRWLADPDSGNSPAAVLDRGEILI
                     VFPEGATDGDGTLHKGHAQFAALALSTGVPIVPAALIPLSVNDLLPELRYRLRIGEPI
                     ETGRFAEAQLSSNVLDGFMLRGLTDLVMTRIGQLAGRRYVDSYTGTAKKVRIPGEPVK
                     ISEWRDQRAERRAAEEQRRASEAELARLLDEQDAAIIDEAVEAARQQAERAALAEQRA
                     RAQRRRTNKQPPDSDE"
     CDS             complement(593276..594073)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224330.1"
                     /locus_tag="brsh051_05520"
                     /product="lysophospholipid acyltransferase family protein"
                     /protein_id="BEH01271.1"
                     /transl_table=11
                     /translation="MTAWYSFFKATLVRPAVKWWFRVKIEGTEKIPDGGCVLAANHLD
                     AGDTFSLPSLIKPKVTFPAKKELFMGKSLKGRVVAWFLTAVGQAPIDRSGGRASVAGL
                     GSVEDVLDAGGVVAIFPEGTRSPDGRLYKGHTGVARLALTSGRPVLPVAMINTRMVKS
                     KVGIPTMRDARIIIGDPMDFSEYRDQVNDLHVLRWVTNEVMGAIQQMTGQTYVDVYAS
                     RVKRGELKGTELSKQLLAYPNQNQTRPVPATQFPAGAPVLDDPTVRE"
     CDS             594233..594682
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05530"
                     /product="hypothetical protein"
                     /protein_id="BEH01272.1"
                     /transl_table=11
                     /translation="MTDSDHSDDTDQRFAELIKAEFGNSDGPELFGTRMTGLPRPPRS
                     APASRPVIDGYFDLQRAIEEVELNDDDVEHWTPPEPPAVGRPEYRHVLGTGLIVAALV
                     VGIMVLAGWRPDLWVGVLTLVCAGAGLAVLLSSLPRQPEIGSDGAQL"
     CDS             complement(594790..595857)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_030869422.1"
                     /locus_tag="brsh051_05540"
                     /product="hypothetical protein"
                     /protein_id="BEH01273.1"
                     /transl_table=11
                     /translation="MLAVAGVLLSVVTGCSATASQASPDTATTAGHILAALSAADEAA
                     FDRVFATSADAARVGLWWDNLRQIELLSIVDGAGGSWQIGWRVPGEQGVATNLIVPQW
                     QCDAQQCLLGDIEQRPDSPAPIWLTEAISVEQDEAVTLIGGGDLDSWRQAAEQSAEFV
                     RSTEAAGLIRPSSRQVIEVPGNSQAFEQVMAASAFDFIGTGAITWTADSGGPGPTGQP
                     APARIVINPDATSDAGTESRYLLLVHEQTHAATNWLGHPAAGQLWVSEGLAEWVMLQA
                     SPQAQQGSTQTLIDACPAASTPPADADFTDPDDLELAYAWSAAALDRLITGRDAASTI
                     STLWQTPGAQPDLESPLVACG"
     CDS             complement(595886..596098)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05550"
                     /product="hypothetical protein"
                     /protein_id="BEH01274.1"
                     /transl_table=11
                     /translation="MFMGTMRIDCNRCVVRGDACGSCVISVLCGPPETVDFSSDEQTA
                     IVWLAAAGLVPPLRMQTGNQASGTEG"
     CDS             complement(596171..597241)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05560"
                     /product="hypothetical protein"
                     /protein_id="BEH01275.1"
                     /transl_table=11
                     /translation="MSLSRRMLTTVIGSVAAIALTIGLVPAAHAEDAVGAAQKDLTQL
                     QIEAAEVQRNLEASKQAQVNSQRQYDLTTEDLADQRTLVEAMRTQVGRVAVAAHQQAA
                     GLGTAKLLFTSDSEDSFLADIAVMQSITSITDEQMIRLAAEQSRLTELETTQAAALQK
                     VTDEVAQQTELAAEYDKKVASAQQVVNRLTEAQKAALADAQNAAILAASAALFSSGDS
                     GVSRSGLDLPTGSGQGVWPATGPITSPFGYRTNPIGGYSELHDGTDVGAACGTPVVAS
                     WTGVVTSARFESGWGNRIVVDSGIYKAAYNHLQSMSVVAGQTVTAGQVIGAVGTTGYS
                     TGCHLHFSTWVNGQITDPMSIF"
     CDS             597535..599241
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224085.1"
                     /locus_tag="brsh051_05570"
                     /product="DEDD exonuclease domain-containing protein"
                     /protein_id="BEH01276.1"
                     /transl_table=11
                     /translation="MDDLGTPLAEATFCVVDLETTGSGPEATITEFGAVKVRGGEVLG
                     EFSTLVNPGTHIPGFIAVLTGITNQMVVDAPTLSQVLPSWLEFSRGTVLVAHNARFDI
                     GFLKRACEQFDYPWPGQMVVDTVGLARQALLPGEVPNVKLHTLADHFHASTQPNHRAL
                     SDARATVDVLHGLLERVGNLGLLTVDDLKEFEHRVSPQRRAKRTWATDLPEAPGIYIF
                     YARRPGQQRQVLYVGKATNIRRRVRTYFTSSETRPRMDEMVRVATGVEAVVCATELEA
                     EVRELRTIAAHSPRYNRRSRRQDKVAWVKLTCDRYPRLSIVTSPGDDQATYWGPFSSR
                     SAAQEACEVIYDSYPLRQCTMRIGRKAAGAGCVLSELGKCLAPCQGIDPDGYHEVVEQ
                     VREALTTDLRPTVARVGQRIGQLSAQQRYEQADVLTARLRSYVATTQRFHRLVGFSRC
                     RQIVAAQWVPGPSANPGWQIHVIRYGRLAAAATAAPGQDPMATADQAIRLAESVLPSP
                     HGLPSCSVEEAERIAAWLERPGVRLMDIDGEWSMPLHSGIDGADLPRLALGTSSPAPA
                     VA"
     CDS             599289..599570
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003976675.1"
                     /locus_tag="brsh051_05580"
                     /product="Lrp/AsnC ligand binding domain-containing
                     protein"
                     /protein_id="BEH01277.1"
                     /transl_table=11
                     /translation="MITAIVFVHVDNDRIPEVAEQIAAIDGISEVYSVTGRIDLIAIV
                     RVASFDDVAPVVADALAKVPGVRQTETHLAFRAYSRHDLDATFSIGISD"
     CDS             complement(599693..600202)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005116126.1"
                     /locus_tag="brsh051_05590"
                     /product="peptidylprolyl isomerase"
                     /protein_id="BEH01278.1"
                     /transl_table=11
                     /translation="MTQATLHTTKGDIVVELFDDYAPKTVANFVGLAGGTREYRDPKD
                     GQTKQGPYYDGTIFHRVIDGFMIQGGDPTGTGRGGPGYTFADEFYPDLVFNRPYLLAM
                     ANAGAGTNGSQFFITLGPQPHLNRRHSIFGEVTDPASQQVVDAIGSTPTGRADRPLED
                     VVITSVDIA"
     CDS             600426..601346
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05600"
                     /product="hypothetical protein"
                     /protein_id="BEH01279.1"
                     /transl_table=11
                     /translation="MSCKYKKARTAAHKAAEEALEQGTNAFDEAVSHVTPIAKQASRQ
                     VADLSHQAADLGRQAADYVVPAFEDARERITPKVEEVVERLQPAVTQAYETVSDKVQH
                     EWYPKLQEFWDEANENPSVIEASKRGRSVVAALRGDLQLPEAVAVPEVVVDKPRKHRV
                     LGRLFTILGIAAAVAAIVVVVRAVLGNDDDGWSPQQPMRPDQDVEDDSWGESPFADED
                     ETVLDDEAAAEEDMIAEGSPATEPEAGLGALEGAYVGTEPPAGYVIKGNERSMKYHTP
                     QAAGYERTNADIWFNSEEAAVAAGFTKAQR"
     CDS             complement(601591..601803)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05610"
                     /product="hypothetical protein"
                     /protein_id="BEH01280.1"
                     /transl_table=11
                     /translation="MTRQGSPVSLISCRTQARNGSAFTRQSALVQGAAVVLEVRVVLR
                     AGAGAGGARIVMVSPEGEPDADFASS"
     CDS             601733..602191
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05620"
                     /product="hypothetical protein"
                     /protein_id="BEH01281.1"
                     /transl_table=11
                     /translation="MNAEPFRAWVRQLMSDTGLPWRVIARASRVPSATVYALLRGQDQ
                     RSMATLPQLEAERLFRLDHHRLAYLQQEPADPQQVRLLLLSLAMAGCSNRQIAEFSGI
                     DTLTVRVLMTGDRAWCSRLQQVRAEAACEAWGINPDMVVRKRAPAARIGR"
     CDS             602188..602904
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="brsh051_05630"
                     /product="hypothetical protein"
                     /protein_id="BEH01282.1"
                     /transl_table=11
                     /translation="MSAPVTQWLLLSAVAIPLVVAQAIIVATHPEPGDDEPDAHLKPR
                     YADLVRPGGVSVLLVLAVTGCLPIAAAPPAVRPAWVVWTSAVLVLVYVDARTTWLPIR
                     ANHFAAACLIAA