LOCUS       AP024110             2800413 bp    DNA     circular BCT 26-AUG-2021
DEFINITION  Methyloradius palustris Zm11 DNA, complete genome.
ACCESSION   AP024110
VERSION     AP024110.1
DBLINK      BioProject:PRJDB10664
            BioSample:SAMD00252853
KEYWORDS    .
SOURCE      Methyloradius palustris
  ORGANISM  Methyloradius palustris
            Bacteria; Proteobacteria; Betaproteobacteria; Nitrosomonadales;
            Methylophilaceae; Methyloradius.
REFERENCE   1  (bases 1 to 2800413)
  AUTHORS   Miyadera,T. and Kojima,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2020) to the DDBJ/EMBL/GenBank databases.
            Contact:Hisaya Kojima
            Hokkaido University, Institute of Low Temperature Science,
            Microbial Ecology Group; nishi-8, kita-19, Sapporo, Hokkaido
            060-0819, Japan
            URL    :http://www.lowtem.hokudai.ac.jp/en/index.html
REFERENCE   2
  AUTHORS   Miyadera,T., Kojima,H. and Fukui,M.
  TITLE     Methyloradius palustris gen. nov., sp. nov., a methanol-oxidizing
            bacterium isolated from snow
  JOURNAL   Arch. Microbiol. (2021) In press
  REMARK    Publication Status: Available-Online prior to print
            DOI:10.21203/rs.3.rs-687530/v1
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.7
            Genome Coverage       :: 635x
            Sequencing Technology :: Oxford Nanopore GridION; MGI DNBSEQ-G400
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..2800413
                     /collection_date="2019"
                     /country="Japan:Gunma, Ozegahara moor"
                     /db_xref="taxon:2778876"
                     /isolation_source="reddish brown snow from a moor"
                     /lat_lon="36.9175 N 139.1988 E"
                     /mol_type="genomic DNA"
                     /organism="Methyloradius palustris"
                     /strain="Zm11"
                     /type_material="type strain of Methyloradius palustris"
     CDS             101..1537
                     /codon_start=1
                     /gene="dnaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E8Z2"
                     /locus_tag="ZMTM_00010"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BCM23742.1"
                     /transl_table=11
                     /translation="MENFWPACLVRFEQELSTQQFNTWIKPLRCEAVNGSVRLLAPNR
                     FVQQWVKDRFMQRIQTFAEEILLRPVDIDLILIDKVKEEKVDKVKSKTSAESSDNGLN
                     ELENLESLVKNSLAKTEKIVEPASKKTTKKTSTSTVESNGLNSAFNFDNYVTGRANQL
                     ARAAAVQIANNPGTDYNPLFIYGGVGLGKTHLLQAIGNHLKELRPEAKIRYLHAERYV
                     SDVIKAYENKAFDEFKRQYHSLDLLLIDDIQFFAKKSRTQEEFFYAFNSLIEAKKQIV
                     ITCDTYPKEIVNVDERLRTRFSWGLTVAVEPPELEMRVAILLKKAEEAKFVLHEDVAF
                     FIAKQVRSSVRELEGALNRIVAMAKFTGHAIDVQLAKDALKDLIAVRGRQITIENIQK
                     TVADYYKIKVAEMYSKKRTRNFARPRQIAMSLARELTNHSFPEIGEAFGSRHHTTVMH
                     ACDEIESLRQSDNNVARDIAFLTQVIRD"
     CDS             1782..2885
                     /codon_start=1
                     /gene="dnaN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YW6"
                     /locus_tag="ZMTM_00020"
                     /product="DNA polymerase III subunit beta"
                     /protein_id="BCM23743.1"
                     /transl_table=11
                     /translation="MNIKINRETFLKPLSSVTSIVERRHTLPILSNLLLEAKDNQIVL
                     TATDLEMQISLSVNTDIGGSLSTTISAKKLLDICRSLPDNAEINMTTSESRVQVKAGK
                     SRFNLQTLPAADYPVMTKAQTATSTLIKIGQSSLKRLFKQVEFAMAQQDIRYYLNGLL
                     FEVSGNQLNIVGTDGHRLSFTSTELNQSYEKQEIILPRKTVIELIKLLDESDEEVSIE
                     ITSGQVNFSFGDIKLISKVIDGKFPDYTRVIPTGHQNNFTIDRTSILLSMQRASILSN
                     EKYRGIRMVLGTNSLRLVSTNSEQEEAEEELEVSYTGDSLDIGFNVTYMIDVLNNVDN
                     EQVIFSFADANSSCLVTVPQDNNYKYVVMPMRI"
     CDS             2971..5379
                     /codon_start=1
                     /gene="gyrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YW7"
                     /locus_tag="ZMTM_00030"
                     /product="DNA gyrase subunit B"
                     /protein_id="BCM23744.1"
                     /transl_table=11
                     /translation="MTDYDSSSIKILEGLDAVRKRPGMYIGDTSDGSGLHHMVFEVLD
                     NAIDEALAGHCDDIKIIIHPDNSISVSDNGRGIPTDIKTDDKHEPKRSAAEIVMTELH
                     AGGKFDQNSYKVSGGLHGVGVSVVNALSDWLKLKIYRAGKVHQMEFKRGVPVSPLVIT
                     GTSEKRGTEVHFLASVETFVLVEYHFEILAKRIRELSFLNNGVKIELIDQRPNGKSEN
                     FAYSGGVKGFVEYMNRTKSVLHPKTFYAIGEKDGMTVEVAMQWNDSYSETVQCFTNNI
                     PQRDGGTHLTGLRTAMTRTLNQYIEQSEQAKKAKVETTGDDMREGITCVLSVKVPDPK
                     FSSQTKDKLVSSEVQPVVSEVVSAKLAEFLQENPIDAKIICGKIVDAARAREAARKAR
                     EITRRKGAMDTMGLPGKLADCQEKDPALCELYLVEGDSAGGSAKQGRDRKNQAILPLK
                     GKILNVEKARFDKLLSSQEITTLITALGTGIGKDDFSVEKLRYHRIIIMTDADVDGAH
                     IRTLLLTFFYRQMTELVERGHIYIAQPPLYKVKQGRDERYLKDEHELDEYLLQSALKG
                     AELLTKEGGETLTGEPLAAIAKQMVLTEAVIRRLVSLYDESVLRALQDIPDIAELDLN
                     TKEGAEKAAAQLRPLLGHTGSEVIVGFNQETESYRLEVNKYVHGNLQCCVIDSDFLAS
                     GDYRQISRISIMLQGLIGAGALIKRGEKEQSVSTFKAALDWLLGEAKHNLGIQRYKGL
                     GEMNPEQLWETTMDPKVRRLLKVQIDDAIAADEIFTTLMGDQVEPRRAFIENNALGVN
                     NLDI"
     CDS             5512..6966
                     /codon_start=1
                     /gene="hsdM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011242272.1"
                     /locus_tag="ZMTM_00040"
                     /product="DNA methyltransferase"
                     /protein_id="BCM23745.1"
                     /transl_table=11
                     /translation="MFEQTFKSIDNILRIDEGVATELDYTEQTSWILFLKYLDALEVK
                     KADEAVLLGKSYQPIIDTPYQWNTWAAPKTADGKFDHNNALTGDDLTNFVNTKLFSYL
                     KGFKQRATSYQTIEYKIGEIFDEITNRIKSGYKLREIIERVDELRFNTQAEKHELSSL
                     YEDKIKRMGNAGRNGGEYYTPRPLIRAMIQVIQPKIGQTIYDGAVGSAGFLCEAYEYL
                     RSTDNLSTSDLAMLHTNTFYGKEKKSLAYVIAIMNMILHGIEAPNLLHTNTLTENIND
                     IQEKDRYDIILANPPFGGSEDKQIQQPFPIKTGETAFLFLQHFIKSLKAGGRAAVVIK
                     NTFLSNTDNASVSLRKLLLESCNLHTVLDCPGGTFQGAGVKTVVLFFEKGAPTRNTWF
                     YQLEPGRNMGKTNPLNDADLAEFVELQKSFADSAKSWRVPFSDINTDTYDLSVKNPNG
                     NEAVAHRSPQAIMEEIALLDAESAEVLAGIKALL"
     CDS             6963..7319
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00050"
                     /product="hypothetical protein"
                     /protein_id="BCM23746.1"
                     /transl_table=11
                     /translation="MSFSVYILRCADHSYYTGHTDNLEQRIAQHNQGYFPTCYTYKRR
                     PVELVFIQNFATREEALDSEQQIKGWSRKKKEAMMHGDWAEVSRLAKCTTPVRPELVE
                     GQCGSTSSPRADGEHL"
     CDS             7316..8530
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010876574.1"
                     /locus_tag="ZMTM_00060"
                     /product="type I restriction modification system subunit
                     S"
                     /protein_id="BCM23747.1"
                     /transl_table=11
                     /translation="MKAEWQLKTLGEVCEVVNGGTPKTGVDEYWGNEHLWITPAEMGR
                     RATPYVNDTERKITSQGLKNSSARLLPPNSVILSSRAPIGHLVINTKPMATNQGCKGL
                     VPNDGLAHKYLFYFLMVNIDLLNDLGSGATFKELSGGKLKEVKIRLAPPPEQQRIVAI
                     LDKTFEGIAKARANAEQNLQNARALFESHLQSVFTQRGLGWSEKKIGDVCDLVNGFAF
                     KSSDVVDTSQTQLVRMGNLYGNNLSLDRSPVFYPDNFSEIYRNYLLVEDDLIMSLTGT
                     TGKEDYGYTVKIPKCSHALLMNQRIVKFEILNAEVINRNFLMYYLRSRVFLDKLYLTA
                     NGTRQANLSSLVIKTLPLPICSTEKQLSITTKLDVICKETQRLEILYQRKITCLDELK
                     KSLLQQAFAGEL"
     CDS             8860..9972
                     /codon_start=1
                     /gene="fic"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9K5"
                     /locus_tag="ZMTM_00070"
                     /product="adenosine monophosphate-protein transferase
                     SoFic"
                     /protein_id="BCM23748.1"
                     /transl_table=11
                     /translation="MSSLSWQADQPYLALPRLPPQADIESKLILKQCITARAALAELK
                     QAAELIPNQAVLINTLPLLEAGASSEIENIVTTTDKLFQHLRNEDQADPATKEALRYS
                     RALFEGFKALNQYPLSTRTIEEICTQIKGVQMNVRRVSGTALSNHKTGEVIYTPPVGE
                     DVLRTMLADWERFLHNAIDIDPLIRMAVAHYQFEAIHPFTDGNGRTGRIVNSLFLIQE
                     GLLTLPILYLSRYIIQNKADYYRLLLQVTREQDWESWILYVLKGVEETATWTTAKIAA
                     MKALNEHTVEFVRQKLPKIYSYELVNLIFELPYCRISSLVEAGIAKRQAASVYLKQLV
                     EIGVLIEAPVTKEKLFIHPKLMQLLSKDSNEFQRYQ"
     CDS             9978..12299
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000819018.1"
                     /locus_tag="ZMTM_00080"
                     /product="DEAD/DEAH box helicase"
                     /protein_id="BCM23749.1"
                     /transl_table=11
                     /translation="MNEAETRAELIDPALKTAGWGVVEGSYIKREHITLGRLQGGGKR
                     SNQEIADYVLVYKNHKLAVIEAKAFDKPYTEGVAQAKTYAKKLGSRFAFATNGQRIYG
                     IDMQTGKEADVAIYPSPEALWQQTFAEQNAWRDAFGEIPFEDKGGTWSARYYQHNAIE
                     AVLEAIANNQQRILLTLATGTGKTFIAFQLAWKLFYSRWNLSRELDHEKQRRPRILFL
                     ADRNILADQAYNAFSAFPDDALVRIAPDEISKKGRVPKNGSIFFTIFQTFMSGLGADG
                     EPAPYFGEYPPDFFDFIIIDECHRGGANDEGNWRSILKYFSPAVQLGLTATPKRKDNV
                     DTYAYFGEPVYVYSLKEGINDGFLTPFKLRQFATTLDEYIYSPGDGIVVQGEVVPGKL
                     YKEGDFNRVIKIAAREQYRVKLLMDLINQGEKTLVFCATQEHALEVRDYINQIKTSKD
                     PEYCVRVTAADGALGDQYLKAFQDNDNTIPTILTTSQKLSTGVDARNVRNIVLFREVN
                     SMIEFKQIIGRGTRLFDGKDYFTIYDFVKAHHHFSDPEWDGEPDPVEPTEQSEKTRGA
                     SQAEQPRAPYVPEPRPEKILIKLSDGKTRQIQHMMATSFWGADGKPMSAAQFLESLFG
                     VLPEFFKDEDVLREIWSQPETRKKLLEGLGERGFGLPILAEMQKIIDAEQSDLYDVLA
                     NVAFALPPLSRDTRASEAKTKVHQKFADKQAEFIDFVLGQYVKQGVEELSQEKLKDLL
                     ELRYQSIHDATQVLGNPNEIRQLFVDFQQYLYL"
     CDS             12489..13694
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088458.1"
                     /locus_tag="ZMTM_00090"
                     /product="ergothioneine biosynthesis protein EgtB"
                     /protein_id="BCM23750.1"
                     /transl_table=11
                     /translation="MNEVVSMSNLLRTAFINTRQKTIALAEPLSEADMTIQAAEFVSP
                     GKWHLAHTSWFFEEFMLRPLGISFVQSESYRFLFNSYYETIGKRQPQYARGLITRPAL
                     AEVLEYREAVNQAVLKLINAGLDNHQLEILEIGINHEQQHQELFLTDILYNLAQNPLY
                     PAYIPAPQDVIKKNVAHSTDSVITFAGGLCSIGHEASGFSFDNELPSHLVFLQPYGLS
                     RHLVTNAEWVEFIEDGGYQTPLLWLADGWKKLKEEDWQMPLYWQKQDEYLAYGLHGLR
                     ALDLQAPVSHISFFEADAFARWAGKRLPTEAEWEVAARTSDPESELQDLYQSVWQWTA
                     SPYVAYPGFKAATGAVGEYNGKFMNGQYVLRGSSFATPASHARVSYRNFFYPHQRWQF
                     NGLRLAEAA"
     CDS             13700..14686
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088459.1"
                     /locus_tag="ZMTM_00100"
                     /product="dimethylhistidine N-methyltransferase"
                     /protein_id="BCM23751.1"
                     /transl_table=11
                     /translation="MNKMTEIPQITNQAFLQDVLDGLSQKQKTLPCKWFYDETGSQLF
                     EAITKTREYYPTRVETRLLQQAALELTSLIPELQVLIEPGSGASVKTRALLQTQAQLK
                     HYIPIDISAEFLQAVAAQLQADFPQINTVPVVGDFSMDMPTIDWHGIAKTGDCVVFFP
                     GSTIGNFSPEEASKLLSDFHQLAGEHAISKKKWLLIGVDSTQNTAQLVNAYNDAAGIT
                     AAFNKNLLVRANQELQANFELDQFKHEARFNPVESRIEMHLVSLQKQVVEIAGSSFVF
                     ESGESILTENCYKYAQPRFLEMAQKSGWQSVKTWQDQQESEFCLFLFRASAP"
     CDS             complement(14689..14973)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141965.1"
                     /locus_tag="ZMTM_00110"
                     /product="hypothetical protein"
                     /protein_id="BCM23752.1"
                     /transl_table=11
                     /translation="MAQATWNGQVIANSDEFEMVENNVYFPRSAIKSEFFKESAHTTI
                     CSWKGVAHYFDVVVNGKTNANAAWYYPEPKEAAKNITGYVAFWKGVEVTK"
     CDS             complement(14992..16158)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004527146.1"
                     /locus_tag="ZMTM_00120"
                     /product="cystathionine beta-lyase"
                     /protein_id="BCM23753.1"
                     /transl_table=11
                     /translation="MSRKLSRWTQLVQPDFSQKTSLKSLTTPVERASTVVFDTVEKLR
                     KRDWLDKNQYTYGLLGTPTTRKLEEQLAMIDGVPHAMLLPSGLSAISTTLLALLKSGD
                     RVLMPSNSYEPGLTFLRSLQSQFHVELDFYDPAHPENLVIKENTKLLWIETPGSVTME
                     VADLPALAKIAHAHGVLVAIDATWAAGIALPAFELGADIVIQALTKYQSGGSDVMMGS
                     ITVESDSIYQQLREMQIKLGLGVSPEDCHLILRSLPHYPLRYRVQDQSARTIAAKLQQ
                     QPLIEAVLHPALPGAPGHNIWARDFSAAASLFSIVFKPEITQVQIDRFVESLQLFHLG
                     FSWGGAVSLAIPYLRNQMHAGYAYEGCLVRFYIGLEDTQDLITDLEQAFQTLDN"
     CDS             16291..17658
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004185874.1"
                     /locus_tag="ZMTM_00130"
                     /product="C4-dicarboxylate ABC transporter
                     substrate-binding protein"
                     /protein_id="BCM23754.1"
                     /transl_table=11
                     /translation="MTPIKTFIQPFQILFNKISALYGKSFIWSIIVVLGISLFVCVLV
                     FTFFNSAAPTTLTIVSGPDGSIFRKTADKYKVILEKQGIKVKIIPSDGSSDNLDILMN
                     PKIKVDVGFVQGGSLEDKTDKPENLLSLGSISYQPLMIFYRGEPKTLISEFKGKRIDI
                     GEDGSGTHSLAIALLKANGINTDDSKYLIEKYPGNAVRALLDNHIDAIFVMGDSASLE
                     LIQKLIQTPGIQLFNFVQADAYARRIKYLNKIQIPEGALDLGKNIPENDISLIAPTVE
                     LIARDTLHPALSDMLLEAAKEVHGTAGLTRKAGEFPSPVEHEFKISPDAARYYASGKS
                     FLYRNFPFWMASLINRMLAVIVPIALLLIPSLRIAPAVYRWHMQSRIYPWYKALLELE
                     RDAFSAKADESKREALIKQLDYIEASVNKIKIPATFGDLFYGLRGHISFVRQRLLAEQ
                     QTVDT"
     CDS             17753..18106
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00140"
                     /product="hypothetical protein"
                     /protein_id="BCM23755.1"
                     /transl_table=11
                     /translation="MASRISVEALNAYRQGIFAGKQRLRSKAPESISSYLIGLWQQGH
                     SVGLQMPATKPLPPKNLTEENQPVSENLPHLADFLNEDVAKEAMAEESAKQNKTQEAV
                     DKTHELYGFTAELAT"
     CDS             18395..18721
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00150"
                     /product="hypothetical protein"
                     /protein_id="BCM23756.1"
                     /transl_table=11
                     /translation="MSKIVVEHQPSVSRLETLGVSKWPTWQKEVSVFPWFFPEQEIAY
                     ILEGECVITPEGGEPVKFGKGDLVTFPAEMSASWEVVQPLHKHYQLDGSFIGRIARRV
                     KRALKL"
     CDS             complement(18777..19205)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199535.1"
                     /locus_tag="ZMTM_00160"
                     /product="outer membrane protein chaperone"
                     /protein_id="BCM23757.1"
                     /transl_table=11
                     /translation="MGYVQIDKIMQSPISLEAGKKLQNEFSPRNADLDKLKKQIADKQ
                     ASMDKDLATMSETDRRKRSQELSTMQIDFERKQRELSEDFNQRKNEEMSNLQDRVNKA
                     VATVAANEGYDLIFYGSAAYVGKDADITDKIIKAINATNP"
     CDS             complement(19506..20399)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011143390.1"
                     /locus_tag="ZMTM_00170"
                     /product="carboxymethylenebutenolidase"
                     /protein_id="BCM23758.1"
                     /transl_table=11
                     /translation="MKLSEFGLKPIDVQNSVVETQPEGFTRRGFIMTSLAVGFAVATQ
                     PVMADTIVTDSSGLVAGEVSIPVSDGKIPAYRAMPAKPGKYPVILVSQEIFGVHEHIK
                     DMCRRFAKLGYYAIASELFARQGDVSKMTDIGEILSTVVAKVPDDQVMSDLDATLAFA
                     KASGSANGEKVGIVGYCWGGRTTWLYAKHNPAVKAGVAYYGLLDGMKSDIKANDPVDI
                     AGTLKVPVLGLYAGNDSMITAPAIDKMQAGISKSGSGSEIIVFPGVNHGFNADYRPTY
                     DKTAATYAWKLTRDWLKDHGV"
     CDS             complement(20468..21466)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00180"
                     /product="hypothetical protein"
                     /protein_id="BCM23759.1"
                     /transl_table=11
                     /translation="MSRYGSIYGLYKRLFNNPKISAVTISLPPPLVEKPEQALHIDTN
                     ETAPSADVSSAQYELVDTLFYRWLFPHHLPTLNAKETEILGILDETLHSDQLSSQLVK
                     RMPGLIPQVLQTLKNENFSVTDVAKKLSQDIVLVEAVTRLASAAMKNSREEVKSIEQA
                     VVILGQNGLRQLITSVAFKPIINISDGAFTKTCGPILWKHSEASAAINRKMAIASSTN
                     PLDAFLAGLMQYIGLIVALRIVDQMTNSLDAIGSPEFYDGLIRTSKKLTCKIAKEWQF
                     PETLIQALEDSPVSALGETLRLSDYLSKLLLLSKNKQLQDNETELIEIPEHLIQFC"
     CDS             complement(21572..21805)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036496.1"
                     /locus_tag="ZMTM_00190"
                     /product="hypothetical protein"
                     /protein_id="BCM23760.1"
                     /transl_table=11
                     /translation="MDSLMHTMPNLFDQLGLPSDEASISQFIATHSPLPHGLPLADAA
                     FWTDSQKAFLRDEILNDADWAEVIDMLNAALHI"
     CDS             21883..22140
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00200"
                     /product="hypothetical protein"
                     /protein_id="BCM23761.1"
                     /transl_table=11
                     /translation="MNIDLKKAVSAALNGDWTAAHEIAQESDEQIACWIHAVLHKIEG
                     DESNSRYWYSRARKRYEDFADSSSELKAIAKFLEKKSLENQ"
     CDS             complement(22155..25232)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887704.1"
                     /locus_tag="ZMTM_00210"
                     /product="ACR family transporter"
                     /protein_id="BCM23762.1"
                     /transl_table=11
                     /translation="MNFSAWSIRKPTPAILLFIILTAAGFVGFKALGVQNFPDFDLPT
                     VTVTVNLPGATPSQLETTVTRIVEDSISGIGAVKHITSTVSDGNSTTLVEFELEKDLQ
                     EAVNDVRDAVTRVRPQLPADVQEPIISRVNTPGGALMTFSIHTDYMDEADLSWFVDNT
                     VSKTLLPVKGVGKVTRLGGITREVAIRLDPLKLQAMNVTASELSSQLVSVQQEAPGGR
                     GNLGGMEQTMRTIGNVNSIEAIAAMTIPLSDGRKIRLDEVATIKDGMAERRQIALLDG
                     KPIISFQVFRARGASEISVAKAVRAAVAKLMEDNPRIKIDEISNTVRPVEVSYKVSMD
                     ALYEGALLAVLVVWLFLRDWRATFVSAIALPLSVIPTFAVMSMLGFTLNVITLLALTL
                     MVGILVDDAIVEVENIVRHLRMGKPPFQAALEAADEIGLAVIATSLTLVAVFLPTAFM
                     SGIPGKFFKQFGWTAAIAVLTSLIVARLLTPMMAAYLLKDQPAHKEDGTVMKRYLEAV
                     RWCLTHPVLTSVATAIFFIASIALVSRLPSSFLPAGDTAQTTVTVESQPGSTIEQTMA
                     LAEQARRLIQPIKEVENIYTSIGTGTSAGSGASTTGDVRKATLTATLASIGERKRTQQ
                     QIEKEIRTKLNQIPGARISIGYGGNGEKLTVVLAGDDAALLQDTAQKVTSDLRTLPNL
                     GNITSSASLLRPEIVIRPNFAKAAEYGVTAQAIGQAVRVATTGDYDVSLPKLNLPERQ
                     IPIRMMLEQNARDNLETVKQLRVKSSNGTIPLQNVADVTINGGPAQIDRYDRRRNITI
                     SIELQGRPLGDVTKEVNQLKSLQKLPAGVHRVASGDTERQAELFGGFLLAMVAGVFCV
                     YGVMVLLFNDFLQPFTVLAALPLAVGGALGLLALLGYSLSLPSLIGLIMLMGIVTKNS
                     ILLVEYAITARRDHGLDRTAAIIDACHKRSRPILMTTIAMIAGMLPMALGLEGDSSFR
                     APMAMAVIGGLMTSTILSLLVIPVVFEIVDELKVRLVKRFSGKSVQQVKAIEA"
     CDS             complement(25232..26365)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887703.1"
                     /locus_tag="ZMTM_00220"
                     /product="hemolysin secretion protein D"
                     /protein_id="BCM23763.1"
                     /transl_table=11
                     /translation="MKYLSLDLKFTSASIQAFLISTLAINLVACGAKSPSAEAAKAQP
                     VIAVELVSPSTKDWQEQITASGNVAAWQEATIGVEVGGVKLDSVLVNVGDQVRKGQLL
                     AQFNEDSLRTDLAQQEAAVALAEANLGKANSEYDRAKLLETTGSISQQDITQYQTTAA
                     TASANLASAKALRDASLLKIRYAKIIAPDDGVISSRTATVGAVGTVGSELFKLIRNNR
                     LEWRAEVDAENLGRIQSGKAVTLLRPDGKQVIGSVRQLAPTIDSNTRYGLVYVDLPAH
                     SGLTAGMYVKGLFSTGVKPALTVPESTIMFRDGNNYVMKIDAENRAHQIKVTTGRRQD
                     QQIEISNNLSVDDKLILSGASFVNDGDLVSVSANTSINKDGAQ"
     CDS             complement(26362..27846)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267829.1"
                     /locus_tag="ZMTM_00230"
                     /product="membrane protein"
                     /protein_id="BCM23764.1"
                     /transl_table=11
                     /translation="MSIKHMLNQQHTIKTLSFVMLSFSLTACMVGPNYQKPAPEQVGI
                     AEQWHAKLPHGGELKNLAQWWQQFNDPAMTSLIEQAEKNNPSIAKAVGSVREARANLR
                     IQKANQLPTLDGNAGVTRAKSGTSFGGTTTGITTSAGNSEQTTQTASLDASWEIDLFG
                     KIRRGVEASRANLASAEFSWDDARVSLAAEVANAYINLRQCEVLVNVYETELSSNLET
                     DRLTNLKLKAGFVPPSDQMQTEAAIAESETKLETQKSNCAQYVNQLVALTSLPYADVE
                     QQLTANVAQIPMPPADGVPAIPAVTISQRPDVAATERLLNAASANIGVAIAKRLPSIS
                     LTGAIGVTSISSQSYNTWSFGPSLSLPIFDGGSGAANVEAARAKYDQALATYRSQVLT
                     AVQEVENALVRVDSITRREVSAEKAEERYSRYFASIQQKYQLGAASLLELEQVRRTLL
                     SSREQLAAAKLERSAAWVALYKAAGGGWQPVENVAETNPEKTTP"
     CDS             complement(27836..28315)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015039522.1"
                     /locus_tag="ZMTM_00240"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BCM23765.1"
                     /transl_table=11
                     /translation="MTEISKNTPTNIAIPESSGPEDSILLLIKNVHFAILRTVDKNIA
                     PLDLTAMQWAPIMAIAKGYAKTAADLANIANIDTGAITRMLDRLESKGLLVRTRSTDD
                     RRVVNLELTEEGQRMALQIPAVLFKSMNLHLNGFNSEELATLKSLLTRMLENIPDVD"
     CDS             28772..29398
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00250"
                     /note="frameshifted, insertion at around 29383"
                     /product="hypothetical protein"
                     /protein_id="BCM23766.1"
                     /transl_table=11
                     /translation="MFKSNTLHPARLFGVSLAILLVVANHLVVAADANSDAQEQIRQQ
                     ERERAQREQLTPTPDVRLDQGEPATALTLLPKDESPCFTIQSIVLTGDSSPQFQWALT
                     AANQKNDPPTGRCLGSQGINIVMKRIQNAIVAHGFVTTRLLAAPQDLNTGVLTLTLIP
                     GRIHAIRFAPETSSRATQWNAVAAKPGDILNLRDIEQSLENFKRARSQ"
     CDS             29430..30446
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00260"
                     /note="frameshifted, insertion at around 29383"
                     /product="hypothetical protein"
                     /protein_id="BCM23767.1"
                     /transl_table=11
                     /translation="MRLTLSADNSGIKSTGKNQGSVTISGDDLLSLNDLFYISYNHDL
                     GNRDAGSRGTQGTTVSYSLPFGYWMLGFNSSNYNYYQAVAGTNQTYLYSGTSTNSDVR
                     LSRVVWRDAVRKTTINGRLWMRSSSNYIDDTEVQVQHRRMAGWELGVNQREFIASATL
                     DINLALRQGTGMLGSIPAPEESFGQGTSRPRLIIADVQFNLPFSIANQRLRYSLSARG
                     QSNQTALVPQDRFAIGGFYTVRGFDGESILSAERGLLIRNDLGLSLGGTGQELYLGLD
                     YGEVGGQSSDLLVGKRLAGAVVGLRGGVKGLNYDVFLGEPIMKPDGFQTARSNIGMNL
                     IWTY"
     CDS             30458..36553
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00270"
                     /product="hypothetical protein"
                     /protein_id="BCM23768.1"
                     /transl_table=11
                     /translation="MNKKFERNVSMTATLRPLTFSILLAIGAVGVISGVDAAGIVADG
                     SAPSNQQPVVLNAANGVPQVNIQTPSAAGVSRNIYTQFDVQQQGVILNNSRTDVQTQL
                     GGYVQANPYLAAGTARVILNEVNSSNPSLLQGYIEVAGSRAQVVIANPAGVTCDGCGF
                     INANRATLTTGTPILNGGSLDGYRVQRGTVSIIGNGMDASQTDYTDIIARAVQVNASI
                     YANDLRVTAGSNQVNTANTTGTPIAGTGITPTLAIDVAQLGGMYAGKIQLIGTEAGVG
                     VTNAGQIGASAGNVVVNVNGLLTNTGTISSTGNNTLQADSITNTNGSITAGQLLGINA
                     NGLTGDGNLLSNGDISVQLSSDFASTGQLLANGNLSFTTTGNFINQSDLLAGSILTIT
                     AANIDNTAGREISGANTHLTASNTLTNRGLIDGSDTFINATTLNNIGTGSIFGDHVAL
                     QATTLTNDVETVNSTTTAAVIAARTSLDIGATTLNNREHSLIFSSGDMTIGGSLDANH
                     LAAASATTVNNNSATINALGALNLSADQVNNTNEHFSTQVVNLSTSFYQLWQSASPIH
                     DPDWLHSMGTLWTASQVTILPRASYEVDLLSSADGVTDHFIRYDINETISETQVLSSD
                     PGQILAGGNMLITANNVLNDKSQIITGGSLTGNIGTLNNTTVAGQHIITDSGLARNYF
                     RIPEDGRDSQGLTTSAYNPAPTVQSINLTPTAYEQNTTPSGSVATIGTLNTTLPNSGL
                     FQPNPNPTANYLVETNPRFANYRTWLSSDYLLQQLSFDPATTQKRIGDGFYEQSLVRD
                     QVAQLTGRRFLDGYASDEAEYQGLLSNAVTVAKAWNLVPGVALSPAQVAQLTSDIVWL
                     VQKTVTLPDGTTTQALVPRLYVSVQPGDLNGSGALISGNTTNLNIGGNLNNSGSIAGR
                     TVLALNAVNVNNLGGNITATDVNVNATNDINNIGGTISGKDSLSATAGRDLNVESTTS
                     TQTNSQGYTTNINRVAGIYVSNADAVLIATAGRDVNLNAVQISNSGANTNGTGGTLIQ
                     ASNNLNIGTVTTGNQETIVWDSKNHISQGGTAEVGSNIQTKGDVTLMAAQDLNAKAAT
                     VTSDNGNITALAGNKVNLTSGQSTQNLDASFQTKRHGFLSSKTITTHDVINKTNSEGT
                     TLSGDTVTVLAGYSADQNGQLQQTTGSGNITIEGSNVVSTNGTTVNGTGSITVTTAQN
                     TDNETHLRDTKKSGLLGGGGGIGFTIGSQQLINTGTSQTTTNTASTVGSTAGDVNINT
                     GKVYTQSGSDVLAPQGNINISAQSVEINAAQNTSVVSEETKFKQSGLSVSLGSGGLNS
                     LQTLAKTTQGSFKSEPTQNKVLNALQTYANTASLVEDGAAVTEAIKAGDIGSAASASG
                     IKLSVSIGSSSMQSSTTSSLVSNQGSAIKSGGNVTIQATESDLNVIGSKLSAGKNLTL
                     EAKDNINLEASADTESIDSNNKSSSTSIGLSMGIGKGGAGLSLDLAASRGKGQANSNS
                     IIFNNTKISAGDTLSLKSGEDTNLLGANASANKVKVEVAGDLNLQSLQDTSTSKAKQS
                     NTGVSASIPLTGAGSVSGSISMNKQNSNSSYASVYEQTGIAAGEAGFDIKVKGNTDLK
                     GALIDSAAASDKNQLVTGLLTVSNIQNQMSAEASTSGITVGTDMFTGKYAATKGIAGN
                     LMDNGEAEIQDQSITRSAIAPADITITDEAKQLAVTGKTAEETIATLDRDTTDTNRVL
                     AKPDVEALQNQAQQEQVDKQLLLTTITTFTDEAFKKSFLTKAKMYEIARDEKTGKVIT
                     DENGNPVTRELNDEEKLSLKANGGNKRLNVFTNGIFNDETSAANYSVQITEAPVGEKV
                     YLVYFPDANNFFSELMIAAYQKNLEGTTLGLTNATQEIVNLSQQYGSEGLNLVGHSRG
                     GMTIGNALEALENMGNNQNILSGTNIKLVGSAYSAQDAANSLSDLSGGAQTSVQLQNH
                     VDDFVGRLIGGNPTTYGNTPTGSSMIQEWIHIFGASPTTHSCYGAASSACNDKYGVPI
                     TINIPSKDSTDGVQK"
     CDS             36550..37251
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00280"
                     /product="hypothetical protein"
                     /protein_id="BCM23769.1"
                     /transl_table=11
                     /translation="MKKYLSMLLLLMLNGCGGYSIHNIDKPPPEDYDTWKKQGESQLR
                     IKKTLLECGAIAPSTLGWSYMKAYEKIGLINQKDQTNHGFLVDRCMLKAGFVQQNTSW
                     TIQDACADPRYRDYPACQPDTIIPAPSFEKRLNGWYCKVKTNYDFCLKYSLNVSGCSP
                     ERASNPPPECLDSNQSPSSSIGSNGSTDKQYKNNLSPLNPDSDKAIRLQRDIRNQSNQ
                     QMNEMLRNRAPRIGR"
     CDS             complement(37420..38610)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105208.1"
                     /locus_tag="ZMTM_00290"
                     /product="hypothetical protein"
                     /protein_id="BCM23770.1"
                     /transl_table=11
                     /translation="MSLVTTCPACATSFLLKPEHLAAHRGDVRCGQCDFVFNALDKLG
                     ETVEITHTETPTAEIIEPLAEIIVEATAETDLEISESAITTEPEITWPEIIEPQPEVE
                     IESSPDIKSELPPEIPAITLDDDPFGVTSFDEIAQKPVEEPNPEQLGDAFDQTDFTDL
                     APSTETSITNTPSPHADLVDYRIEPEVTETPIVDVEPEKTSGTSVTDMHVSEKPEPEA
                     TSTTFIDSISKTDEQLPEKQSRRKWLSIILAVILVIAALVQSTYYFRTQLSIMLPGLK
                     PYLVQACAKLGCTVELPKNIKLLVIDDSSIQEDTEHADVIHLSSTLINNAEFPQAYPM
                     LELTLTDANDAPSLRRTFKPSEYLPPNTKIADGIPAGEELHIDLALTTNGEKVSGYRV
                     QVNY"
     CDS             complement(38607..39494)
                     /codon_start=1
                     /gene="prmA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5FAH7"
                     /locus_tag="ZMTM_00300"
                     /product="ribosomal protein L11 methyltransferase"
                     /protein_id="BCM23771.1"
                     /transl_table=11
                     /translation="MAWLSLKIEAKDNTAELISDSLMDIGALSAIIEDANAETPDEQP
                     IFGEPGDPPPGIWQQNIVSALFDEQIIVKDVMRSLAKVTGLQDLPYSTEIIQEQDWVR
                     ATQSQFDPIRIRDDLWIVPTWHSAPNPDALNIVLDPGLAFGTGSHPTTHLCMAWLADH
                     IKNEDSVLDYGCGSGILAIAAKKLGAAKVIGTDIDEQAILSSGFNAEQNAVDAKFHLP
                     KDMPEGIYDIVVANILSSALSVLAPALAKSCKPQGQIALSGILREQTEQVSTIYTQWF
                     DMHPPIFMDSWVLLTGTKR"
     CDS             complement(39512..40861)
                     /codon_start=1
                     /gene="accC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004522043.1"
                     /locus_tag="ZMTM_00310"
                     /product="acetyl-CoA carboxylase biotin carboxylase
                     subunit"
                     /protein_id="BCM23772.1"
                     /transl_table=11
                     /translation="MFEKILIANRGEIALRVQRACRELGIKTVAVHSEADREAKYVKL
                     ADESVCIGPAPSSQSYLNIPAVISAAEVTDAEAIHPGYGFLSENADFAERVEQSGFVF
                     IGPRAETIRLMGDKVSAKNAMRAAGVPCVPGSEGALPDDPEAIIMIAKKIGYPVIIKA
                     AGGGGGRGMRVVHTEAALIASVNMTKAEAQAAFGNPVVYMEKFLEQPRHIEIQILSDQ
                     HGNAVYLGERDCSMQRRHQKVLEEAPAPGISQKLRDKVGERCADACRRINYRGAGTFE
                     FLYENNEFYFIEMNTRVQVEHPVTEMITGIDIVQQQIKIAAGEKLAFRQRDIQYHGHA
                     IECRINAEDPYNFVPSPGRITTFHMPGGPGIRVDTHAYQNYLVPPHYDSMIGKLISYA
                     DTREQAIAKMRIALSEMVIQGIKTNVPLHLDLMNDAAFHTGGTSIHYLEHKLGISSK"
     CDS             complement(40888..41340)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015369456.1"
                     /locus_tag="ZMTM_00320"
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit"
                     /protein_id="BCM23773.1"
                     /transl_table=11
                     /translation="MDLRKLKKLIDLVEESGISELELTEGEEKVRISRNIPSAQGAMQ
                     YAQPYYQPAPAAAPVAAVAPAADVPPVIEGHVVKSPMVGTFYRSPSPDAKSFIDIGST
                     VSTGDTLCIIEAMKLLNEIEADHSGVIKAILVENGQPVEYGEPLFIIG"
     CDS             complement(41383..41850)
                     /codon_start=1
                     /gene="aroQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZYA8"
                     /locus_tag="ZMTM_00330"
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="BCM23774.1"
                     /transl_table=11
                     /translation="MVAKSTKSVLVLHGPNLNLLGLREPEHYGKNTLADIDKLLADKA
                     KSAGIALKSFQSNAEAELIDQVQALATEPVDFLIINPAAFTHTSVALRDALAAVRIPF
                     IEIHLSNVYSREAFRHHSYFTDIAVGVISGLGTQGYLSALDYAISQLNSPSIQ"
     CDS             complement(41992..42534)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00340"
                     /product="hypothetical protein"
                     /protein_id="BCM23775.1"
                     /transl_table=11
                     /translation="MLTRKKWPYWIAGSFLLLLAGTIYLVISKDDAPNLSLLSTQSLY
                     ASAWPDTQGKTQALGQWKNKVSVVNFWASWCQPCREEMPDLSAVYDKYAARGLVVLGV
                     SVEDHEKMAAYANKIKVSYPLLAGDMEGSDMSDNLGNYQGVLPYTVIIDASGKIVKSF
                     SGSIDQAMLEAAIVPLLTKP"
     CDS             complement(42552..44369)
                     /codon_start=1
                     /gene="dsbD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8KDH5"
                     /locus_tag="ZMTM_00350"
                     /product="thiol:disulfide interchange protein DsbD"
                     /protein_id="BCM23776.1"
                     /transl_table=11
                     /translation="MVSSNALAEPSSVSSLFTQSSNDDEILSPDQAFKISVEALDSKT
                     LRAVFQVAPSHYIYRERIKFDIAPAKDGAKAISVSSIDLPPGDIKQDPNFGESHVFHK
                     NFEALVHLNISKSTPQNSSPSTLSLLASYQGCSEKGLCYAPIHKTLEVALLPDIATNL
                     SVKANNPTATETNSDNDATDLLKSGKLWLIAIGFFGFGLLLSFTPCMLPMIPILSGMI
                     VRDAQSPNASLKPSRLRVFNLSLAYTLGMALTYTLAGIGAGLSGHLLSSALQNGWVLG
                     FSAFIFVLLALSMFGFYELRLPSKFENTILNTSNRFNGGRFIGLFIMGAFSALIVSPC
                     VAAPLAGALIYISQTHDVLLGGVALFSMAIGMGVPLLLIGLSAGLLPKTGHWMVTIRQ
                     FFGVIMLAVAIWLISPVIPISLQLLLWAALLIVPATYIGAFNRLDASASAWRKFCKSI
                     GIIMLLLGVTLIIGAASGAKSALQPLSGLRVSADAGHKLPFQRVRNIAELDSAIKSAA
                     GKTVMLDFYADWCVACKELEQFTFSDQRVANALQNVVLLQADMTQNSVEDSALLKRFN
                     LFGPPGIIFFDASGQEIAQAKTIGYKNADTFLTILNKLN"
     CDS             44739..45152
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00360"
                     /product="hypothetical protein"
                     /protein_id="BCM23777.1"
                     /transl_table=11
                     /translation="MPLIFILLILLAFPTLEILVLIKLGNLYGSWLLLYLVLMAILGI
                     RLIREEKQVMAGRFIQSISQGRTPLRAIFGTAKNVIAGILLIIPGVISDAIAVILLLI
                     PGPKPMLGDQPNTPKYTNKRAANDDVIEGEFRRED"
     CDS             45232..46254
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004185343.1"
                     /locus_tag="ZMTM_00370"
                     /product="CDP-6-deoxy-delta-3,4-glucoseen reductase"
                     /protein_id="BCM23778.1"
                     /transl_table=11
                     /translation="MSYQVTIQPSGHQFQVAAGETILDAAINASFNLPYGCRNGTCGA
                     CKGRVLEGRVEHEAHQSSTLIQAEKDTGLALFCCAVPQSDVVIECREVSTNNGIRPRI
                     MPARVQKIERLADDVIALSLKLPSNERLQFLAGQYIEFLLKDGQRRAFSLANAPHDDE
                     LLELHLRHVPGGLFTDHVFTQMQEKAILRLEGPFGSFYLREDSDKPIIFVAGGTGFAP
                     IKGMIEHLLHVGSKRKILLYWGARALKDLYLPVLPQTWLDANKNLSFIPVLSEPLSTD
                     AWQGRTGFVHQAVLDDLGDLSAYQVYSCGAPIMVDTARASFQAAGLPADEFFADAFTY
                     AHPSAN"
     CDS             complement(46255..47439)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004526333.1"
                     /locus_tag="ZMTM_00380"
                     /product="porphyrin biosynthesis-like protein"
                     /protein_id="BCM23779.1"
                     /transl_table=11
                     /translation="MRWLFWMLLILGLAVGLALLTGNNQGYVLIVRPPYRLELSLNFL
                     LVLIIASFIFLHGLLRLIHYTRRLPATVLAYKQDKRLREGQAAFKTGLHALVEGRYNL
                     AAKSASQAIDLGENISISALIAARASHKLRQKSQRDYYLAEAERLAPDDALSRLLTQT
                     ELLLDDRQYGEALSALQKLEKIEPKHPPAMRLALKIHVHLGNWDSVVTLLQQLEKRDA
                     LESWQIREIRQQAHQHLIKRYSGDLASLLAYWKKLPEEDRLNNRLAYLAATTLLQSNA
                     PDQAAEVLGMSLTKGWDTKLAALVGDCITSQPMKQLEQAEFWLLKHEGDANLLLSLGK
                     MCVRLSLWGKAQSYFEASISVTPSAAAHVALAKLLESRGETEAAYKHYRLSTQFLKDV
                     DY"
     CDS             complement(47439..48602)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00390"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BCM23780.1"
                     /transl_table=11
                     /translation="MTEENKISPDNEQNAALTTSEESASQTLEERRNAERRTGSGVSF
                     LTSAALVIAVLALLGTVWQSISSRHGYTKLERGLTERLEKFDAANQQSLALAKNSDER
                     SIESSARTSILEEKLGESLDQQESLETLYVELANNREERLLAEVEQLLIIANQQLQLA
                     GNIKLSLLALQTADSRLQQLDSLQVTQLRKSVAQDIQRLQAMPLIDVVGMSLKLESLA
                     DSVDHLPLVSERHPESAMPVENAVPNQNRWQKLTYEIWQDFKSMIRIERIDRAEPPLL
                     APDQNFFLRENIKLRLLTARIALLQHDEVTYRKDLEAADHWLKAHFDLRELETKNALA
                     TIETLSASNIVLDVPDISPSLALVSKYKLSLERTNINSHDSKAAAKTPTRGAK"
     CDS             complement(48660..49442)
                     /codon_start=1
                     /gene="hemD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015703978.1"
                     /locus_tag="ZMTM_00400"
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="BCM23781.1"
                     /transl_table=11
                     /translation="MRELVLNKLGIAITRPASQATKLSKLITENGGTPILFPLIEITT
                     LDDYGVFEQKISELNEYHWAIFISSNAVQHGMPRLLKHFGHIPSNLKFAAIGPVTANE
                     LAKFGALDVLTPQDRFDSESLLGLSEMQSVKNQRIMIFRGIGGREILAETLKTRGAQV
                     DLAECYQRTNPQMDTNLLATLWQNKQLHAVVVTSSEAMRHLLDLIINSNQAADWIKHV
                     VLCVNHARIAEAPLTLRLKVAIAHAPGDEAMLQCVIDAVSAN"
     CDS             complement(49442..50383)
                     /codon_start=1
                     /gene="hemC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9K0P6"
                     /locus_tag="ZMTM_00410"
                     /product="porphobilinogen deaminase"
                     /protein_id="BCM23782.1"
                     /transl_table=11
                     /translation="MTTPTKLVIASRESALAMWQAKHIQSRLQALYPNSTIEILGMTT
                     TGDQILDTPLARIGGKGLFIKELEQALEDGRADLAVHSMKDMPMHLPEGFALAAIGER
                     EDARDAFVSNDYSALDDLPAGSIVGTSSLRRQSQLQARFPDLKIESLRGNLQTRLRKL
                     DEGQYAAIILAAAGLIRLGLASRIAQYISAEHSIPAVGQGALGIEIRADRLDLLPILA
                     PLNHPATASCVEAERGMSRALSGSCTVPLGAYAVREGDTLQMTGFVASIDGRQVLRET
                     VSGTANEPEALGKALASKLIAQGADKILAALDEPHPK"
     CDS             complement(50469..51215)
                     /codon_start=1
                     /gene="algR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038604.1"
                     /locus_tag="ZMTM_00420"
                     /product="DNA-binding response regulator"
                     /protein_id="BCM23783.1"
                     /transl_table=11
                     /translation="MNQSDTVRILIADDEAPARNRLRELLGDIANLNIIGEAKNGKEV
                     LELVAETPVDIVLLDIRMPQMDGIEAAEHLQKVSPPPAIIFTTAFDAYALQAFDMNAV
                     DYLLKPIRVERLQTAINKARALLPAQLTAIKPLQPKRNFFSVHERGRVLLVPVADVIY
                     MRAELKYTTLRTRDREFLIEDSLTSLEQEFSEQFLRLHRNCLVAKDAILGYEKRTIEG
                     EQRWVALLKNLTETVAVSRRQMHVLKELGN"
     CDS             complement(51215..52384)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00430"
                     /product="hypothetical protein"
                     /protein_id="BCM23784.1"
                     /transl_table=11
                     /translation="MASIKQNTGFSNAQAADAEGDLTPVTDETVAETTIAAGALLPDS
                     LTSLQTPSNRLSVKLPDFRNLGICLRIIVIMNLLALFGAIFEADHLSDVLTKFTQVLA
                     LLQPIVLLTILLLYVIYPYLLKLSYRWSTAFVLLLSIMATSGVHFIGSLILGVDAMPS
                     LVRAWILAAAMSGLVLYYLNLRQRALTPAIAEARLQALQARIRPHFLFNSINAVLSLI
                     RGQPARAETALEDMADLFRVLMADNRDLVPLADEISLSRQYLSLEKLRLDERLTIIWQ
                     IDSMPPDALIPPLVLQPLLENAVYHGIEPMPAGGEITIKIYTHRDEVHLILSNPFSKQ
                     TSPHNGNKMALSNIKERLSLHFDAEAVLTSQVLGQNSQGQHYEVHIVIPYKKNLL"
     CDS             52416..53819
                     /codon_start=1
                     /gene="argH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5FA15"
                     /locus_tag="ZMTM_00440"
                     /product="argininosuccinate lyase"
                     /protein_id="BCM23785.1"
                     /transl_table=11
                     /translation="MQQKSKDNTQQNKAWSGRFNEPVAELVKRYTASVGFDQRLAEFD
                     IQGSLAHARMLGAQGIISVEDVAAIEHGLGEILQEIQSGAFEWLLDLEDVHLNIEKRL
                     TDKIGDAGKRLHTGRSRNDQVATDVRLWLRSVTDDVIAGIRKLQLSIVDLAEEHADTI
                     MPGFTHLQVAQPVTFGHHLLAYFEMLQRDAARFADARKRINRLPLGAAALAGTSYPIN
                     REMVAKELGFDGVCENSLDAVSDRDFAIEFTAAAALVMTHLSRFSEELILWSSPRFAF
                     IDIADRFCTGSSIMPQKKNPDVPELVRGKTGRVNGHLVALLTLMKGQPLAYNKDNQED
                     KEPLFDTADTILVTLEIYADMLRGIKVNKTNMRQAALEGFATATDLADYLVKKGTPFR
                     DAHEAVALAVKHAVGKGCDLADLSLEELRQFSAKIDDDIYGVLTLEGSIASRNHIGGT
                     APEQVRAAVGRARKSLV"
     CDS             complement(54238..55347)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004186023.1"
                     /locus_tag="ZMTM_00450"
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="BCM23786.1"
                     /transl_table=11
                     /translation="MRKCPYCDFNSHESPTTRGKGEIPEDAYVKALIADLEQAVPNIW
                     GRKVRSIFFGGGTPSLFSAEAIDRILSAVRALVQLEYDAEITLEANPGTFEAERFAGF
                     KAAGVNRLSLGIQSFNEQHLKALGRIHDATEARNAAAHAIEIFGNVNLDLMYALPEQT
                     LQQALTDIETAIGLKPTHISAYHLTLEPNTAFHHSPPPLPDDDASAEMQEAIEDLLAN
                     NGYEHYETSAFAKKGKRSRHNLNYWLFGDYLGIGAGAHSKLSFHDHILRQSRTKHPNA
                     YLKGVAENTHIDTERTLTSDDLGFEFMMNALRLTDGFHVDQFSATTGKPLLSIEPALK
                     AAESKGLIVRTPTQIAPTMLGQRFLNELLQMFLVD"
     CDS             complement(55451..55696)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002214913.1"
                     /locus_tag="ZMTM_00460"
                     /product="hypothetical protein"
                     /protein_id="BCM23787.1"
                     /transl_table=11
                     /translation="MTKSENNWPKWLRDDGTVVSCTEKVKVMTENFDEIKQIAQDALE
                     DGLLMEVGEEQMREALHKLVDELVNPYQNRHTDHTSK"
     CDS             complement(55716..56324)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9K0G6"
                     /locus_tag="ZMTM_00470"
                     /product="non-canonical purine NTP pyrophosphatase"
                     /protein_id="BCM23788.1"
                     /transl_table=11
                     /translation="MPQLFKKLVIASGNKGKLNELQKLLEPLNIEVLPQSHFNVPEAE
                     EPFVTFIENALAKARHASRLTGLPALADDSGICVDALQGAPGVHSARYAGEPKSDVRN
                     NEKLLQELNGKTNRQAHYYCVIVLVLHADDPQPLIAEGIWPGEILETLQGTGGFGYDP
                     LFLDDKTGKSAAELPPEIKNRISHRGHAMSKLLQKLAHFEPN"
     CDS             complement(56327..57043)
                     /codon_start=1
                     /gene="rph"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63RV5"
                     /locus_tag="ZMTM_00480"
                     /product="ribonuclease PH"
                     /protein_id="BCM23789.1"
                     /transl_table=11
                     /translation="MRPSNRTPNQLRTVEIIRHYTKHAEGSVLVKYGDTHVLCTASVD
                     EKVPGFLRGKNQGWVTAEYGMLPRSTGSRMDREAAKGKQSGRTQEIQRLIGRSLRAII
                     DLEKLGERSIQIDCDVIQADGGTRTASITGAYVALHDAVSLLLEKGLIKESPLKDAVA
                     AISVGTYKGTPVLDLDYIEDSDCDTDMNVVMTGSGGFVEIQGTAEGDPFSREAMNQML
                     DLAQSGISELIQKQKAALSS"
     CDS             complement(57138..58085)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00490"
                     /product="hypothetical protein"
                     /protein_id="BCM23790.1"
                     /transl_table=11
                     /translation="MKFSVFQGSRQGPRPYNQDRLAYAYTKDAILLVLADGMGGHRHG
                     EIAAHMAVKMLTEAFQQSSNEKLRNPSDFLHAQIMRIHERIESVRIAKELLEGPRTTI
                     VAVIVQHEYLYAAHVGDSRLYHFREKQILHKTEDHSIVEKLRRQGQLDEKSMRTHPER
                     NKIYNCIGGNKAPEIELTHKHELWDGDTLMLCTDGVWGALPDEKITQILLSGYVNQTV
                     PKLLDAAETSAGKDGDNMSAIALQWGEGKQNNKHAVSTATMPLGSTTTIMMDPAAGLE
                     STIQLSQGEPAPAFSDDDIESAIAEIQAAINKGKKPSPN"
     CDS             complement(58109..59056)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00500"
                     /product="hypothetical protein"
                     /protein_id="BCM23791.1"
                     /transl_table=11
                     /translation="MQAAAAHNQALPIGHKLQGYEIRKVLSYGGFSFVYIAHDEDKVA
                     VAIKEYLPISLALRAEGTNVRVNSEESSNNFRHGMKCFFEEGRALANIDHKNIVRVIN
                     FFRANDTVYMVMQYERGKSLQEYILNRSTPLSESFVRRVFSELLNGLREVHTQKLLHL
                     DIKPSNIYIRLDGTPVLLDFGSARQTLTDIVSTLPPSYTPGFASPEQYFERKNLGPWS
                     DIYSVGASMYACLVRGAPISADVRVKKDAYVPAKKVGKGIYSQNLLAIIDSCMELDPL
                     ARPQSVYALQKALLDDFASLEEQKPNLLNKLVTILNKSL"
     CDS             59252..60133
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003687657.1"
                     /locus_tag="ZMTM_00510"
                     /product="hypothetical protein"
                     /protein_id="BCM23792.1"
                     /transl_table=11
                     /translation="MIYSMTGFSALESDTPHGMLLIELRSVNHRYLELQLKLDDSLRS
                     FEGLARELITAKLGRGKVECRMSLIASRNSNKKQEINAEVLQQLADLTKAVHGHFPES
                     QPLSVADILRWPGVLAMDGASADSADSEALADAIRSNLNKVLDDLVVARSREGEKLKT
                     LILERLAEAEILVKQVKPLLPMQTKAYQDRLTSKLQEAVKTVDEDRIRQELVIFAQRV
                     DVDEELTRLTAHLDEVKRILNDDNAAGKRLDFLMQELNREANTLGSKSVSTEVSQVSM
                     ALKVLIEQMREQIQNIE"
     CDS             60155..60763
                     /codon_start=1
                     /gene="gmk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HTM2"
                     /locus_tag="ZMTM_00520"
                     /product="guanylate kinase"
                     /protein_id="BCM23793.1"
                     /transl_table=11
                     /translation="MLGNLFIITAASGAGKTSLVRELLAADQQIKLSVSYTTRKPRPG
                     EVDGEHYHFVDEAVFLRMLGEAEFLESAHVHSARYGTSQKRVEAVLQQGDDLILEIDW
                     QGAEQVRRIYPQAISIFILPPSIEALEKRLHGRGQDSNEVIAKRLAAARDEMSHVVEF
                     DYVTINDIFELALEDLRAIIRTQRLKRDKQLRRHETLINTLL"
     CDS             60831..61043
                     /codon_start=1
                     /gene="rpoZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62I01"
                     /locus_tag="ZMTM_00530"
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="BCM23794.1"
                     /transl_table=11
                     /translation="MARITVDDCLEKIPNRFQLTLVAAYRSRQLANGSEPLVNTHGHK
                     DKPTVMALREIAAGKVGLEVLNRGHA"
     CDS             61238..63457
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004194871.1"
                     /locus_tag="ZMTM_00540"
                     /product="guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /protein_id="BCM23795.1"
                     /transl_table=11
                     /translation="MAKSAVKRQQEPSKPTVAPLLPADSEESQLTILLRQYLKFEDIA
                     QVWEAYRFSAKAHEGQTRKSGEPYITHPVSVACVLAGLHLDVPTLIAALLHDVVEDTG
                     VTKQQVADQFGKQVAELVDGLSKLDKIEFQSATQAQAENFRKMLLAMSQDVRVILVKL
                     ADRLHNMQTLEVMAPEKRRRIARETLDIYAPIANRLGLNSIYQELEDLSFKYLYPMRF
                     RVISKAILAARGNRKEVVGKILDALKLRLKEMNVEADITGREKHLYSIYKKMTGKTVT
                     FSQIYDIYGFRVIVKDLPTCYLALGILHGLYKPIPGKFKDYIAIPKANGYQSLHTTLF
                     GPFGTPIEVQIRSGEMHNIADAGVAAHWLYKTTDAHLTALQQQTHQWLQRLLDIQSES
                     ADSLEFLEHFKVDLFPDEVYVFTPKGKIMALPKGATAVDFAYAVHTDIGNRCVAVKIN
                     QELAPLRTELHNGDHLEIITAAHAHPNPAWLNYVVSGKARAHIRHFLKSMQSTESAHL
                     GERMLNQALRALHADPAAIHDAQWQKLLRDYGAKNKEEILTDIGLGKRLNVMVAHQLL
                     AVTDEQVEGPIRQSNKPLGSITIRGSEGMAVQFAQCCRPIPGDPILGFINKDKGLIIH
                     THDCQAIRKFRVDPEKWLDVEWDPDTKKLFKVNLKLAAANQRGMLAKIAAGIADAGSN
                     IDNVSMESDDTSYTTMNFTVQVENRAHLADLMRRLRKIPDVVRINRVKGAGQEQKIQ"
     CDS             63501..64133
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00550"
                     /product="hypothetical protein"
                     /protein_id="BCM23796.1"
                     /transl_table=11
                     /translation="MGEYFNAGQRQLQDEFDTRRLADRLQGGIIQPIINELDAEFIEA
                     QNMFFLATVDDQGHANCSYKGGSKGLVKVVDETTLAFPIYDGNGMFMSAGNVLVNGEV
                     GLLFIDFERQARVRVNGVASITLEDPLLSNWPETKLVVRVKVRETFPNCPRYIHKMEF
                     VEESGFVPKAQCETPAAPWKKLEIVADVLPAYDEHLASNEQDVLAAINRK"
     CDS             64167..64544
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002116996.1"
                     /locus_tag="ZMTM_00560"
                     /product="reactive intermediate/imine deaminase"
                     /protein_id="BCM23797.1"
                     /transl_table=11
                     /translation="MAKEIIRTEGAPQAIGTYSQAVKVGDTVYLSGQIGLDPATMQMV
                     DGIEAQVHRVFTNLKAVAEAAGGSLNDVVKLNVFLTDLSHFALVNTIMAEYFSTPYPA
                     RAAVGVASLPRNALVEADGVLVV"
     CDS             64579..66645
                     /codon_start=1
                     /gene="recG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63R07"
                     /locus_tag="ZMTM_00570"
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="BCM23798.1"
                     /transl_table=11
                     /translation="MAINLPGLADIKAISKPLLANLQKLGIVDVQGLLLHLPLRYVDE
                     THITAIRDLRSGEQAQVEGEIVHAEVQYKPRKALIAQLQDAGGQLLVLRFLHFYPSQI
                     AALKVGTKLRALGEVRQGFFGYEMVHPQCKSVRDETPVKETLTPVYPTTAGLSQASLR
                     KWISWALNNGDLSETLPAFAYEPQALPSFAQSLKNLHHPAPEADLYQLEDHVSPYWQR
                     LAFDELLAQQLSMRRHYARRRSIGAPALKPSKALITALLRSLPFALTSAQQKVAVEIG
                     NDLTQNHPMQRLLQGDVGSGKTIVAAMGALQAIENGWQAAIMAPTEILAEQHYKKMQD
                     WLAPLNIKVTWLSGSQNKTDRAISLEAIADGTAQLVVGTHALFQEQVVFAKLGLAIID
                     EQHRFGVHQRLSLRQKGQTSKTKAPHQLMMSATPIPRTLSMSYYADLDVSVIDELPPG
                     RTPVATKLVADARRDEVLTRVREACEQGSQAYWVCPLIEESEALQLKTANDTYAWLQE
                     SFPELRVGLVHGRMKTAEKQAVMAAFTAGEIQLLVATTVIEVGVDVPNASLMVIEHAE
                     RMGLSQLHQLRGRVGRGAAKSACILLYQNKLSDTARARLKIIYESSDGFEIAKADLAL
                     RGPGEFLGLRQSGVPMLKIADLERDTELLETAQGLAEQLLKEYPTYVDKHLERWLSRA
                     EELVKV"
     CDS             66680..67243
                     /codon_start=1
                     /gene="ubiC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83F94"
                     /locus_tag="ZMTM_00580"
                     /product="putative chorismate pyruvate-lyase"
                     /protein_id="BCM23799.1"
                     /transl_table=11
                     /translation="MKIQLQLQKASHQGRRSQWLKNPINSGVYRNWLIDKGSLTLRLQ
                     LRAKDFKVKPLKVENAKPQIDEASLLGVAQHQLALLREVQLIDGATPLVFAHSILPHR
                     SLSGAWLGLRRLGNKPLGATLFSNPKVKRTPLMFKKLACHQPLYQRATAHLEIKPITL
                     WARRSVFILGNAQILVTEVFLPGILAL"
     CDS             67240..68127
                     /codon_start=1
                     /gene="ubiA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63R13"
                     /locus_tag="ZMTM_00590"
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="BCM23800.1"
                     /transl_table=11
                     /translation="MTIEPIDWPKLSAKLDAYERLMRLDKPIGILLLLWPTLWALWLA
                     GEGRPHWLIVAMFVMGTILMRSAGCVLNDIADRKFDAHVERTQQRPLATNEVSVKEAL
                     ILALILVLSAFAIVLHLNKPSILLSFAALFLAASYPYTKRFFAIPQAYLGIAFGIGIP
                     MAYAALTNIIPLVAWLLLVANIFWAIAYDTEYAIVDREDDLKIGIRSSAILFGRFDVL
                     AIMACYLIMLSILVFVGVHLGLQWPYFIGLAAAAGIAVHHYFLIKKRERAQCFRAFLH
                     NNWLGLAIFLGIFVASKLG"
     CDS             68231..68671
                     /codon_start=1
                     /gene="rplM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63QW3"
                     /locus_tag="ZMTM_00600"
                     /product="50S ribosomal protein L13"
                     /protein_id="BCM23801.1"
                     /transl_table=11
                     /translation="MKTFSAKAHEVKRDWFVVDATDLVLGRLASEIAHRLRGKHKTIY
                     TPHVDTGDYIIVVNADKIKVTGTKELNKLYHRHSGYPGGISTTNFGKMQERFPGRALE
                     KAVKGMLPKGPLGYAMFRKLKVYAGAKHDHVAQQPQPLTIQSQA"
     CDS             68683..69075
                     /codon_start=1
                     /gene="rpsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6PCU2"
                     /locus_tag="ZMTM_00610"
                     /product="30S ribosomal protein S9"
                     /protein_id="BCM23802.1"
                     /transl_table=11
                     /translation="MIGKYNYGTGRRKSSVARVFLKSGKGNIVINDKPADEYFSRVTS
                     RMILRQPLELTENIASFDIQINVHGGGESGQAGAVRHGITRALIDYDATLKSALSKAG
                     FVTRDAREVERKKVGLRKARRRKQFSKR"
     CDS             69253..70293
                     /codon_start=1
                     /gene="argC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q889Z3"
                     /locus_tag="ZMTM_00620"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="BCM23803.1"
                     /transl_table=11
                     /translation="MSLDKIKVGIVGGTGYTGVELLRLLAIHPAIELSAITSRGEAGL
                     PVADMFPSLRGYVDLPFSDPAQADLSGCDVVFFATPNGIAMQQTADLLDKGVRVIDLA
                     ADFRIQDVATWEKWYGMKHACPDLIAKAVYGLPEVNREKIRTAQLIANPGCYPTAVQL
                     GFLPLLEAGVIDETLLIADAKSGVSGAGRKAEVSALFAEAGDNFKAYGVAGHRHLPEI
                     SQGLAGMANKPVGLTFVPHLTPLIRGIHATLYAKLTKDIDLQHLFESRYIKERFVDVL
                     PKGSHPETRSVRGSNQCRIAVHRPQGGDTVVVLSVIDNLVKGAAGQAVQNMNIMFGLA
                     ENTGLEVVPLLP"
     CDS             70311..71018
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00630"
                     /product="hypothetical protein"
                     /protein_id="BCM23804.1"
                     /transl_table=11
                     /translation="MRRVTRGIKRHFGATAKNVAVKSHRPWYWQILLVLLLLGTGFFA
                     GSWRYSMNEVTNLAGNLKQLQEENKQLQAKLVYGERQLQVERAAQSNLTKEIALLQEE
                     DMRHKEDIAFYQHILVEKPTASEVKLYSFKINRLPQKNQYEYHLLLVQNGKHDDFVKG
                     TMKFAIGGMQADKMVLLPVTANAGLVDANVNFKFFQRIDGSFSLPDNVNQGYIEASFF
                     EPGARDPKLSQKQELPI"
     CDS             71068..71484
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003120826.1"
                     /locus_tag="ZMTM_00640"
                     /product="hypothetical protein"
                     /protein_id="BCM23805.1"
                     /transl_table=11
                     /translation="MFSKSQNKAQNRIDTLIGAETKIEGDIHFTGGLRIDGSVRGNVT
                     ESPTSPSTLVLSESARIIGAVSVSHIVINGKVEGPVRANEYIELQTKSRVIGDVYYKS
                     LEMHTGAVIEGKLIYLGETTQGKIEDKTTLLPVDKD"
     CDS             71542..71892
                     /codon_start=1
                     /gene="erpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63QW5"
                     /locus_tag="ZMTM_00650"
                     /product="putative iron-sulfur cluster insertion protein
                     ErpA"
                     /protein_id="BCM23806.1"
                     /transl_table=11
                     /translation="MNAITEMPSPLVFTDNAAKKVKELIDEEGSPDLKLRVFVSGGGC
                     SGFQYGFTFEETVNEDDTQVERDGVALLIDPMSLQYLMGAEIDYQDSLQGSQFVIRNP
                     NATSTCGCGSSFSA"
     CDS             complement(71958..73253)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2RTZ5"
                     /locus_tag="ZMTM_00660"
                     /product="citrate synthase"
                     /protein_id="BCM23807.1"
                     /transl_table=11
                     /translation="MTKPTKVTLTFDNGAEPIELPILSGNLGPDVIDIRSLGKHGIFT
                     YDPGFLSTASCNSNITFIDGDEGLLYYRGYPIEQLAQHCDFMEVSYLLIHGNLPTLEE
                     KATFTNTITHHTMLHDQLTNIFRGFRRDAHPMAVMVGVIGSMSAFYHDAMDIKDAKNR
                     EMSIYRLIAKVPTVAAWSFKYNEGQPFTYPQNRFNYAENFLHMMFSTPCEEYVPNPVI
                     AKALDRILILHADHEQNASTSTVRLAGSSGANPFACIAAGVASLWGPAHGGANEAVLK
                     MLEEIGDASNIDKFIKRAKDKSDTFRLMGFGHRVYKNIDPRATMMRQTCYEVLEELGL
                     GDDPLFKVAMELERIALEDEYFISKRLYPNVDFYSGIVLRAIGIPTNMFTAIFALART
                     VGWTAQWNEMISDPEAKIGRPRQLYTGAVRRDIVPIEKR"
     CDS             complement(73299..74366)
                     /codon_start=1
                     /gene="anmK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6PC60"
                     /locus_tag="ZMTM_00670"
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="BCM23808.1"
                     /transl_table=11
                     /translation="MSGTSLDGVDAVVIDFKDHQCQVLHTANLAYPDSIRSELLALHA
                     ASHNELERTALIANRLSILYADCVKQLLSNAALSASQIKAIGCHGQTIRHRPELGFTL
                     QIVNPALLAELTGIDVVADFRSRDIAAGGQGAPLVPAFHQATFGSADKNRVVINIGGI
                     ANLTSISASGHVIGFDSGPGNMLMDAWAEEHLGKRYDHDGNWAASGQVIAALLARLLA
                     HPYFKQTPPKSTGRDLFSSAWLADYLTPDYAPADVQRTLLELSAQSISMALTDFCGEV
                     DEIYLCGGGALNSALVARLQQLQSPVKIQLSDTLGIRVQWVEAAAFGWLAKQCISRQT
                     ANLPAVTGAKGTRILGAIYAS"
     CDS             complement(74404..75801)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010931221.1"
                     /locus_tag="ZMTM_00680"
                     /product="hypothetical protein"
                     /protein_id="BCM23809.1"
                     /transl_table=11
                     /translation="MQPSEPSYNPNGNNPGGLPNTKPRSFKQRILAQNPATQLRKLRL
                     RWLLVLSSIPLFGIYTAFGIAPQTITQDIPISTVIEQVALPQLDEALSTAQNDETFWQ
                     ADQVRRDDTLASLMTRLNIRNQEAIDFLRRDPDASALASQLRPGRSIQAQTTDSGELL
                     QLQYQTDNKSIFKVERSDSGYQAKMLDASFVTHSVLKSAEIKSSLFGATDAAGIPDQI
                     AIQMADIFSSYIDFHTDLRRGDRFVVVYEAVYNNGELVRTGQVLAAEFTNQGKTYNAV
                     MYRNPEGQVSYYTPDGKNLHKSFLRSPLEFSRISSGFSLGRLHPILNTIRAHKGTDFA
                     APIGTGVKAPADGTVAFVGVQNGYGNVIILQHQNGISTKYGHLSRFAQGLHKGMKVSQ
                     SDVIGYVGMTGLATGPHLHYEFMVNGENRDPLKVALPSAIPIDQKYKADFSTHSANLA
                     AQLRLLSASNMAALE"
     CDS             75895..77091
                     /codon_start=1
                     /gene="tyrS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHB3"
                     /locus_tag="ZMTM_00690"
                     /product="tyrosine--tRNA ligase"
                     /protein_id="BCM23810.1"
                     /transl_table=11
                     /translation="MKPLEETLAIIKRGSDELLIEQELIEKLKTGKPLRVKAGFDPTA
                     PDLHLGHTVLLNKLRQLQELGHQVLFLIGDFTGMIGDPTGKSATRPPLTAEQVQENAK
                     SYAEQVFKILKPELTEVVFNSKWLTELGAAGMLKLAASHTVARMLERDDFSKRYKSNQ
                     SIAIHEFLYPLLQGYDSVALNADLELGGTDQKFNLLMGRELQKHFGQSQQCVLTMPLL
                     EGLDGVNKMSKSLGNYIGVSEPANDIFSKIMSISDELMWRYIELLSFESIETIGQWKI
                     EVAAGANPRNIKVGFAQEIVTRFHSKQAADEALADFQLRAKGGIPDEVPEITISLTQE
                     TINIAQLLKQSNLVASTSEALRMIDQGGVKLDGEKVTDKALQLTRPTAIVAQVGKRKF
                     ARITIN"
     rRNA            77593..79128
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="ZMTM_r00010"
                     /product="16S ribosomal RNA"
     tRNA            79222..79298
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00010"
                     /product="tRNA-Ile"
     tRNA            79325..79400
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00020"
                     /product="tRNA-Ala"
     rRNA            79793..82680
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="ZMTM_r00020"
                     /product="23S ribosomal RNA"
     rRNA            82945..83052
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="ZMTM_r00030"
                     /product="5S ribosomal RNA"
     CDS             83262..83696
                     /codon_start=1
                     /gene="rimP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P67217"
                     /locus_tag="ZMTM_00700"
                     /product="ribosome maturation factor RimP"
                     /protein_id="BCM23811.1"
                     /transl_table=11
                     /translation="MEDLYTLLERSLTQLGYELVDLEVSNRGKLLRLFIDKPEGVNID
                     DCVLVSNQLSNSLAVDHDIDYDRLEVSSPGMDRVLKKEADYVRFTGERAQVKLRILVE
                     NRKNFVGVLRGLEDGMLLIECEGIVHKLALSNIDKARLSPEF"
     CDS             83739..85205
                     /codon_start=1
                     /gene="nusA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WHY6"
                     /locus_tag="ZMTM_00710"
                     /product="transcription termination/antitermination
                     protein NusA"
                     /protein_id="BCM23812.1"
                     /transl_table=11
                     /translation="MSREILLLVDALAHEKNVGKEVIFTALELALASASKKRFTDDAD
                     VRVEINRENGSYESFRRWQVLADDLIENPAAQITVADARAKDLAEGDFVEEPLESIEF
                     GRIGAQAAKQVILQKVREAEREQILDDFLARKEHLVTGVIKRMEKGNAIIEVGRIESL
                     LPRDQMIPKENLRVGDRVRAYLSRVERGGRGPQLILSRIAPEFLSKLFELEVPEIEEG
                     LLEIRAAARDPGLRSKIAVKSNDQRLDPIGTCVGMRGSRVQAVTGELAGERVDIILWS
                     MEPAQFVINAMAPAEVSSIVVDEDAHSMDVVVDEEQLAQAIGRNGQNVRLASELTGWT
                     LNILTVEEAAKKNEEEYTSTRSLFISKLDVDEEVADILVQEGFSTLEEIAYVPMSEMS
                     EIDAFDEDTINELRKRARAALLTEAIAKEEKLEEASEDLLTMEGMDDATAHLLASKGV
                     STMDDLADLAVDDLVELTNMDAERAKQLIMTARAPWFA"
     CDS             85316..87997
                     /codon_start=1
                     /gene="infB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63TP8"
                     /locus_tag="ZMTM_00720"
                     /product="translation initiation factor IF-2"
                     /protein_id="BCM23813.1"
                     /transl_table=11
                     /translation="MGQTSVAQFASELGLPAELLLEQLKGAGVNKSADADSLTEQDKT
                     LLLEYLRKEHGAQEPKNKITLTRKQVTEIKKSDSTGKNRTIQVEVRKKRVLMRRDPSE
                     EAAEQQVIEEQVIATVIEEVIEPVAEVLVVEEAVVEVELPPVAEVVEPVQPEIVVEAA
                     PPVVAEKGTLKKSVLSADQIAKREDEARRQSALVALQTEEIRKKQELQQRRVEEEAKK
                     VAAAAEAAAPTKLSEGTLHKPAAKEGAKTEDKTKKAAKNNKAWSDAENKKRGIKTRGD
                     VGATQGWRSHKSKSKSHKDGDDQQHAFNAPTEPIIYEVLVPETISVADLAHKMAVKAG
                     EVIKTLMKMGMMVTINQVLDQETAIIVVEEMGHNAKAAAANDPDTFLEETEHAEAIFE
                     SRPPVVTVMGHVDHGKTSLLDYIRRSRVASGEAGGITQHIGAYHVETPRGMVTFLDTP
                     GHEAFTAMRARGAKATDVVILVVAADDGVMPQTIEAIHHAKAAGVPLVVAVNKIDKPE
                     ANLERVKQELVTHEVVPEDWGGQTMFVGVSAKTGEGIDSLLEAVLLQAEVLELQAPKN
                     TPAKGLVIEGRLDKGRGSVSTILVQSGTLRRGDMILAGSSFGRVRAMLDEAGNDIKEA
                     GPSIPVEILGLSDVPNAGEEIIVLNDERKAREIALFRQGKFRDVKLAKQQAAKLENMF
                     EQMGEGEVKTLQMIIKSDVQGSYEALATSLQKLSTDEVKVNIIHTGVGAITESDVNLG
                     AASKAVVIGFNVRADAGARKLIESSGVDVRYYNIIYEAVDEVRAALSGMLAPEQKESA
                     IGTVEIREVYRISKVGAVAGCYVQDGVIRRNSKIRVLRANVVIHTGELDSLKRFKDDV
                     KEVKSNFECGLSLKNFNEIEVGDTLEVFEIVEIARTL"
     CDS             88004..88369
                     /codon_start=1
                     /gene="rbfA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZNR3"
                     /locus_tag="ZMTM_00730"
                     /product="ribosome-binding factor A"
                     /protein_id="BCM23814.1"
                     /transl_table=11
                     /translation="MAKEFARSDRVAEQIQRELADLLQFEVKDPRVGRVTVTEVEVTG
                     DLAHAKIYYSAKVGSPEIQQGLEKSAGFLRSQLSKRMLLRTVPQLHFVYDASIDRGIK
                     ISQLIDEALASDQSTEQKP"
     CDS             88438..89340
                     /codon_start=1
                     /gene="truB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P72154"
                     /locus_tag="ZMTM_00740"
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="BCM23815.1"
                     /transl_table=11
                     /translation="MQFKRIKRDISGVLLLDKPLGISSNQALQQVKRLYQAAKAGHTG
                     SLDPLATGLLPICFGEATKFSHFLLDADKSYRALVALGSTTTTADAEGEVLATKEVNV
                     NQALVEAVLKAFTGPINQVPPMYSALKHEGKNLYEYARAGIEIEREARNVTIYSLVLN
                     SLNEHTIDMTVVCSKGTYIRTLAEDIGQMLGCGAHLNGLRRLTSAHFLLNQALTIEQL
                     EAMTAEQRDACLLAPDVAIDNLPRVDIDEDSAFYLMRGQEVWKSGLNIQSQFRIYNHL
                     GIFLGLGEQTADGKIAPKRLVSSK"
     CDS             89417..89686
                     /codon_start=1
                     /gene="rpsO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62IN0"
                     /locus_tag="ZMTM_00750"
                     /product="30S ribosomal protein S15"
                     /protein_id="BCM23816.1"
                     /transl_table=11
                     /translation="MSISTAEKAKIVGDYQQAPSDTGSPEVQVALLTSRISGLTEHFK
                     VNAKDNHSRRGLLALVSQRRKLLDYLKRKNADRYRSLIERLGLRK"
     CDS             90019..92151
                     /codon_start=1
                     /gene="pnp"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5F9Q7"
                     /locus_tag="ZMTM_00760"
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="BCM23817.1"
                     /transl_table=11
                     /translation="MFNKVKKTIQYGAHELTLETGEIARQAAGAVLVSYGDTVVLVAV
                     TARHDVKAGQDFFPLTVDYQEKTYAAGKIPGGFFKREGRPSEKEILTSRLIDRPLRPL
                     FPEAFYNEVQIVATVLSSDSEIDSDIPAIIGASAALAISGIPFYGPLGAARVGYLNGE
                     YVLNPTASQMKESELDLVIAATATAVMMVESEAKELPEDVMLGSVVYGHEQMQSVINI
                     INEMAAEVGKEPWEWTPPEADTALIEKMAALAANDINEAFKIKAKGERSAKLDEIKSR
                     VFAELITEETSTTEANKIKTELFNLEAKTVRSQILNGEPRIDGRDTRTVRPISIRTGV
                     LPRTHGSALFTRGETQALVVATLGTGRDEQVIDALQGEYKDRFMLHYNFPPYCTGETG
                     RVGTPKRREIGHGRLAKRALVAVLPSQEEFGYTFRLVSEIMESNGSSSMASVCGGTLA
                     LLDAGVPLKAPVAGVAMGLIKEGNRVAVLTDILGDEDHLGDMDFKVAGTEEGVTALQM
                     DIKITGITKEIMEVALSQAKEGRLHILGIMKEAISGVSQELSAFAPRIITMKINPEKI
                     RDVIGKGGAVIRSITEETGATIDIEDDGTIKIGCVNAEAGEDAKKRIEAITAEVEIGQ
                     TYEGPVIKILDFGAIVSLLPGKDGLLHISQIAHQRVNAVGDFLKEGQIVKVKVVEADE
                     KGRVRLSMKALIDPPVAEEQQAAQSQES"
     CDS             complement(92254..92676)
                     /codon_start=1
                     /gene="dksA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:G3XD14"
                     /locus_tag="ZMTM_00770"
                     /product="RNA polymerase-binding transcription factor
                     DksA"
                     /protein_id="BCM23818.1"
                     /transl_table=11
                     /translation="MAEAISRQFVPYQAKADEEYMNDKQLNHFVAILNAWKSELSHDI
                     DRTVHTMQDEVTMFADPNDRASQESDMALELRNRDRERKLIKKIDETLNKIKEHDYGY
                     CNGCGVEIGLKRLEARPTATLCIDCKTLDEIRERQVAK"
     CDS             complement(92827..93684)
                     /codon_start=1
                     /gene="folD1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87YR0"
                     /locus_tag="ZMTM_00780"
                     /product="bifunctional protein FolD 1"
                     /protein_id="BCM23819.1"
                     /transl_table=11
                     /translation="MTAQIINGKAIADSMLNQILLRVKTRLDQGKRAPALAVILIGND
                     PASSIYVRNKRLACEKVGIRSIVYELPASTSEAELLTMINGLNADDAIDGILVQSPLP
                     PQIDEKLVIEHISAAKDVDGFHPYNIGRLTVRQPTLRSCTPFGVIKMLQATGIELMGL
                     DAVVIGVSNHVGRPMALELLLAGCTVTCCHRHTKDLQANVERADLLVVAAGKAGLVKG
                     EWIKPGGVVIDIGINRLANGSLCGDVDFATAKERAGWITPVPGGVGPMTIATLMENTL
                     LALELRETI"
     tRNA            93766..93842
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00030"
                     /product="tRNA-Pro"
     tRNA            93907..93983
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00040"
                     /product="tRNA-Arg"
     tRNA            94006..94081
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00050"
                     /product="tRNA-His"
     CDS             complement(94156..94575)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00790"
                     /product="hypothetical protein"
                     /protein_id="BCM23820.1"
                     /transl_table=11
                     /translation="MFIIRTLFSLALITVVGCTSEKSVLETNLLEAAARSDSQKVTLD
                     LSKLITAPIEKICIGGAYLLPDGLEKIAHRKISQEAMADKGEFVFWVFLANNKSIYLQ
                     LKSTKQLSYQSNLENTCTDSSILTIENHLIGFSETSK"
     CDS             complement(94610..95611)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011104854.1"
                     /locus_tag="ZMTM_00800"
                     /product="integrase"
                     /protein_id="BCM23821.1"
                     /transl_table=11
                     /translation="MGRRRQTNLDLPPHMHVKHGAYYFVGRDKKWIRLSEDKALALSK
                     WAELEGETPIPPNQEKPIKGSVGELITRYMIEIAPRKAASTYQGNKMEAENLKKVFAK
                     FQARAVLPTHIAKYLDTRGQKSTVRANREISLLSHIFSYGMRWGAVNSNPCIGVAKHK
                     EKGRDRYIMDAEFEGVKSIAGELIATVMDFAYITALRKGDILTLKLEQITDEGIWVKQ
                     NKTGAKQLYEWSPGLTDVVARAKALKRPIRGLYLFCTRQGLPYSDSGFKAMWHRVQVK
                     WAEQGGNRFTFHDIRAKALTDAKGLGLDAQSLAGHSSAAMTEHYIKQREFKKVKPLK"
     CDS             complement(95614..95823)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00810"
                     /product="hypothetical protein"
                     /protein_id="BCM23822.1"
                     /transl_table=11
                     /translation="MFMSPEELIELTDYKLASHQCRWLTEHGYPFDTSASGRPKVLRS
                     YLEQRLCPQTTTSNSNEPDFEALNR"
     CDS             complement(96006..96671)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00820"
                     /product="hypothetical protein"
                     /protein_id="BCM23823.1"
                     /transl_table=11
                     /translation="MAKTKKPWPNKATSWSYYMQAIEPSGKEINEAFPEYHPMWVIQS
                     QDKIVSGSHFKFMRTHLLQITRPECAAYLRVSASVIQSWENDRTPIPFMAFELLRLVY
                     ESVHFRLSHKNWQGWFIKPDGRLVCPERGNLSFSSDELAFIRETHAAKRFFEREYELL
                     RDEIEPLRAELAELKSSNGNDGLLDELKAIEARLATLTAQVSSNKVVPINRSKSTQEV
                     KAA"
     CDS             complement(96671..98011)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00830"
                     /product="hypothetical protein"
                     /protein_id="BCM23824.1"
                     /transl_table=11
                     /translation="MMIEPTSATSKLAPHASLGISAKSSNAKSLKSQTEIDADKSKNK
                     KIRYELQRHSQSLFYDRNAIKQHRVCSCHRNLTGDSIAIFRKVDQSEARIAGLVSCGS
                     AWVCPICNAKITEARREQMQQAITAHSKAGGSCLLMTNTFPHEIDLPLDEGLSKFAMA
                     LDHWKNSRTYKRIFGTSLASIQYAETRGKPLKKVTKGEFPIVGSVRSLEVTHGSNGWH
                     PHTHQVLFMQDESLLNSRRAIDELVESWCVSLIHAGLGDNSKLNDMLTHALDIRGGDY
                     TADYVNKFGREPELYNGWTIAHETTKANSKAGFRNLNGDFHATPFQLLKMSLEGDEKA
                     GALFLEFGRCFEGKRMNYWTNGLKDFFSLNDLDDEDLAAESAEVEVEEEVVLYLNAEE
                     WRLVLKTNARGELIEAARIGGKDAVMELLDILPYIKHSHSGAYSVNRPKGQWVN"
     CDS             complement(98008..98226)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00840"
                     /product="hypothetical protein"
                     /protein_id="BCM23825.1"
                     /transl_table=11
                     /translation="MSHSLYVVRDKTSGHFINELPAGHGHDLFVPDIAHAFVWRDRSV
                     ANNLSISLSHGGRTCEVVEIEPTEGVES"
     CDS             complement(98375..99046)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00850"
                     /product="hypothetical protein"
                     /protein_id="BCM23826.1"
                     /transl_table=11
                     /translation="MAIKKEYALTRAEFDEAIVTLRLNVSEVSKETNIPRSYMSEFRN
                     GDRQLRPEHLAKLKDYFESKGIVFEDSPPEPASHPPATLPNAPPLAAAPYKFLPVYLD
                     VDQPAVIKTQGVIQDNDARLAVLLQQTASRDDGFFSESEFSEDTQEALQEVFTLMAAN
                     YVLWRSLSGWPALGLSASGADPQTIKDIVFETFREALVKAGLFRDAPPDEPDEEAETE
                     EELPA"
     CDS             complement(99218..99682)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00860"
                     /product="hypothetical protein"
                     /protein_id="BCM23827.1"
                     /transl_table=11
                     /translation="MSDDKKHTENTNGYVPPEDTIGVRIKARRNELALNVEELARLTQ
                     QYDYGDEKKGISASMLRRYEYEDGSKPGTREIRLLCDALDVSADWLIRGIDPNLNQET
                     SNLSVAAESFINAVKLIIQEKNDPFSNMGKTQIDWKNIERSEKIEKAKNPNK"
     CDS             99878..100420
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00870"
                     /product="hypothetical protein"
                     /protein_id="BCM23828.1"
                     /transl_table=11
                     /translation="MNQQSFDINSQEFYYHVSPIHLENGSIIKKGNWGRVIKLYIGNC
                     NGLNLFKERVLEDVRLDHYSTKPSRLDAIFLLLNLDAAKHYLTVDNEAQRTSLIYKVK
                     PLNRNAPGHLANYSKTIVQPPLCHFDNMEQVAHNYWTGVGLYDAIPMLNPTLNTYVPV
                     TTVELIAMCDIEIVECLNLL"
     CDS             100402..101166
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00880"
                     /product="hypothetical protein"
                     /protein_id="BCM23829.1"
                     /transl_table=11
                     /translation="MSELIMSIEIYQKYLEARSTSIFNGKFMEYDWEGFPELVGGEWL
                     IYSQMLTEFSREISNVINDLTNYTFWLDCWDQVLAGVGDDEKMSILHDYVNPLAITAL
                     NLPYAIRSRLIFGNAHLSHQANRFIDGEEWKDDLPLDDAIYFSVADKYCSKWFSYTKL
                     KLALEKIDNKEYKEKTDDFRNKYNHRFSRRIELGISGLVNRHVSTTGEVSYSLSAVSP
                     LKLGEIVETLEKQCQHCYKAFNRFQKLIHEQIALAK"
     CDS             complement(101173..101454)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103139.1"
                     /locus_tag="ZMTM_00890"
                     /product="transcriptional regulator"
                     /protein_id="BCM23830.1"
                     /transl_table=11
                     /translation="MDMHNPAHPGEVLKEYLPENLSITDAASHLGVTRAALSRVLNSR
                     AGISAEMDLRLSDALGTSPGFWARIQVQYDIWQAKQHHHTHIERFPQAA"
     CDS             complement(101464..101745)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005737444.1"
                     /locus_tag="ZMTM_00900"
                     /product="protein killer protein"
                     /protein_id="BCM23831.1"
                     /transl_table=11
                     /translation="MIKSFQHKGLEQFFRTGSKAGIQPHHATKLNIQLTALNAAESAE
                     DLRAPGAWRLHQLTGELAGFWSITVNGNWRVIFKFNGSDAELVDYLDYH"
     CDS             101668..101850
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00910"
                     /product="hypothetical protein"
                     /protein_id="BCM23832.1"
                     /transl_table=11
                     /translation="MVWLDASFATSPKELLQAFVLKTFNHSFSVRYSYTHAIRSYDNT
                     YTHATQVIRANSLYYS"
     CDS             102194..103627
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011462141.1"
                     /locus_tag="ZMTM_00920"
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="BCM23833.1"
                     /transl_table=11
                     /translation="MASAQLPVLMIIDDDPLITETLHFVLSKSFDVYVAESRTQAKSV
                     LRQLDQPPSLALVDLGLPPVPHKPDEGFKVIGELLAHSPTMKILVLSGQNEDVNVKHA
                     LALGAVDFIAKPCDVERLQGILQNALKLQDAELEEVSNPTENYGLLGESQPMQALRKQ
                     ISQFADAPFPVLIEGESGSGKELIASSLHRMSQRSKQPYLSVNCAAISPMLAESILFG
                     HGKGAFTGAANSHTGYFEDAGEGTLFLDEIGELPLELQAKLLRVLENGEYQRIGETQT
                     RKSKARIVAATNRDLREEVRLGKFRIDLYHRLSVFTIDVPALRTLEQDRYLLLEHFSQ
                     FYARETGQKPFTLDPKAKQRWLVYHFPGNVRELRNITIRLTAKYPGQLVNEQQLSSEL
                     DLMEIAESNEALNMADDNALSNHAHRHLQTEANINLDQVLKAWEKAYVNAALKVTHGN
                     LSQAAKLLGINRTTLYSRIQIQEEYKE"
     CDS             103627..105030
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00930"
                     /product="hypothetical protein"
                     /protein_id="BCM23834.1"
                     /transl_table=11
                     /translation="MYYAHFGLKEPPFKITPNTEFFFCGGNRGAVLDALIYAINSGEG
                     IIKVVGEVGSGKTMLCRMLQTLLPEKVETVYLANPSVAPEDVLHAIAFELQLKLTKNA
                     DRLQVMQVLQKYLVDRHAQGKQVVIFVEEAQGMPIATLEEIRLLSNLETKHDKLLQIV
                     LFGQPELDVNLNQNQIRQLRERITHSFYLGPLDQASIDEYLIFRLRSAGYFGPHLFSK
                     SAIKLLSKAAEGLVRRVNILADKALLATFAANAYQITPKHVRAAIKDSEFGVNFYQQA
                     KRRWLIALAAALIFVVLVAFLFVQFKSNNKPVPQSAPAEKQVSQAKVEPPKQDVIAVA
                     PIETAEPQKVVETPQPATTASDTSDILDNRLAATLDWLKQQPESTVSIQIMGGTSDEQ
                     LRTHLQSLSAQLELDNIYVFRTKVSNRPFLTVLYGSYPNREEAQRAIQKLPLTLKINH
                     PQLRTVGGILKETKQFQ"
     CDS             105104..106948
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00940"
                     /product="hypothetical protein"
                     /protein_id="BCM23835.1"
                     /transl_table=11
                     /translation="MRMKNLSNILLLALIGAGFAGCAHQSVVTPSNGHIDGQSNPSQP
                     SQAIAADIPKPVKTPAYLPPPKAKAKEQTYSVVVNDVPVKEILFALARESKLNVDINS
                     GVQGRVTLNAVDQTLPAILERLSKQVDLTYKIDNNVLYIGPDLPVLRTYKVDYVNMSR
                     DTTGFIGVAAEISGTGRSASTGSSGSSTTGTSGGSSSSGAASNSSRTQVASISQNHFW
                     ASLIQNIKDILAETDKEVIISRGDGSDQTEASTTTQTPPTDGSNPSDKTNITVNLKPT
                     AQDREAARTEYKTLFAATVIANQEAGIISVRGTSKQHEKVQEFLDKVMSSAKRQVLIE
                     ATIVEVRLNDGYQAGIDWSRLNNAGAGGVTIQESLTPLISSSASNTAASAGLVAGFVN
                     GAKNFSASISLLNQFGDTKVLSSPKLMVLNNQTAVLKVVDNLVYFTIQSQISQGSVLG
                     GANLQSVTTTANTVPVGVVMSVTPQINDTGEVNINVRPTISSLIRYVPDPNPQIIGVV
                     NQGIPEIQVREMESMLQINSGNTAVLGGLMQDQIQRNTDKVPGLSNIPGLGRLFTSRN
                     DTSRKTELVIFLRPTVIKNATLESDELKTYKQYLPEPQLEKKLDGNGY"
     CDS             106955..108139
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00950"
                     /product="hypothetical protein"
                     /protein_id="BCM23836.1"
                     /transl_table=11
                     /translation="MSLLIKALEKAEKGKTGDAKSASPEGHPQPTPILPVDELSLEPL
                     FADAGLTSQKKQPEFESKNAKQQAAADVFAARNSANQTSKMVLVVAGLSIALLLLIGF
                     KFYSYLQTLNQPEVVIAKVTEPISPVSTGVIAPQSQTLESSIPANEIQKEAHVDEVAT
                     NDKQDLNQVEKPKLLAQKPPSQALVFGTPVEKSAETDVKITRSAPANVVSPALLVAYQ
                     AFMNGDDVTAQRNYRQVLQSDIRNVDALLGMAAIAARQGRNDDAAGWYGKVLEVEPRN
                     TVALSELAANTSQADPVATESRIKNLIAQQPEAAYLREALGNLYADKGQWPAAQQAYF
                     DAFHMDASNAEYAFNLAVSLDQLGKPNLALDYYKRALALIPATGSNIDRAQLESRIKQ
                     LQ"
     CDS             108226..109890
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011387874.1"
                     /locus_tag="ZMTM_00960"
                     /product="type II secretion system protein E"
                     /protein_id="BCM23837.1"
                     /transl_table=11
                     /translation="MVQQSLISQDQLRIALMEQDQSNIPLGRQLVRLGFVTEAMVRDL
                     VAHTIGQESIDLTVVIADADALKLVPEHFARRYHILPISYEEPTKQLIVAMADMFNVV
                     ALDQLRAMLGGQIQVKPLLAGEAQLEEYIDQFYGYELSVDGILREIETGEIDYQSLQQ
                     DGDEYTQPVVRLVGALLMDAVKRNASDIHFEPEYAFLRIRYRIDGVLQQVRSLHKTFW
                     PAIVVRLKVISGMDIAETRAPQDGRLQISLCGRPIDFRVSSHPTIHGENLVLRVLDRE
                     KSIIPLERMGLRNTTLDELKLMMTRPEGIMVVTGPTGSGKTTTLYSLLSFQNTEAVNI
                     MTLEDPVEYPVTMMRQTSVAEVNKLDFANGIRSIMRQDPDIILVGEIRDSDTATMAFR
                     AAMTGHQVFSTLHTNSALGTFPRLLDIGISPDIMAGNIIGVVAQRLVRVLCPHCKQAH
                     TPDDEERKLLNVKTREDITIYRNVGCKRCTYTGYRGRMAIIELLRIDADMDALIARRS
                     HLDEMRKLALDKGFITLADDGVRRILEGYTSLSEVMRVIDLTSRIR"
     CDS             109896..111101
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011387875.1"
                     /locus_tag="ZMTM_00970"
                     /product="type II secretion system protein"
                     /protein_id="BCM23838.1"
                     /transl_table=11
                     /translation="MPTYNYKAVDQIGRTANGEMDALNEIDLELRLDRIGLSLITFRL
                     ARKTAGLFGGKKINLQDLVMFCFQMEQLTSAGVPLLEGLADLRDSNPNLYFQKILAAV
                     IDDVEGGKLFSEALARHSSVFNNVFVSLIKAGEQTGKLPEVFENLATTLKWQYELVSQ
                     TKRLIAYPLFVLVVVLGAITFLMIYLVPQMVSFLRNMGQDLPIQTKILIFISNAFVSY
                     WWLILSVPVLLIIILKVAVKQSAEVRYRYDYIKLHLPVTGEILQKIILARFARYFALM
                     YQTGIPILDAIKTCEDIVANKVVADALNRAHQQINAGDSMSESFRNAGLFPPLVVRMI
                     KVGEGTGGLDKSLLKISYFYDRDVNEKIESMLKMLEPALTVILGAILAFIMFSVLGPV
                     YDSFSKLKI"
     CDS             111124..112719
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00980"
                     /product="hypothetical protein"
                     /protein_id="BCM23839.1"
                     /transl_table=11
                     /translation="MALFTKIVLCASGNHLTAGVWSWRKLRSFQVFDNDAQGKEDFAH
                     FLQKFPNTKIYLLADSVEEDYRVENLPHTFGGAKHELVERKLSQIYRNTVFRVAHFIN
                     REKDKRKDDRYLFLALNKVEFLNGWLEVIEAQQAPLTGVYMLSMLSQVILRRMRLVEP
                     HIILSERLNSGLRQTYLHNGNLRISRLAPMPPEAENQLAYFYLVETEKTRLYLISQRF
                     ITRETPLKMLLPGLDDSSKVICRHIEQEQGIDCERIDLSDLAHSIHIKPQLLDANPEL
                     LHMHLLAIGNVPDNLAPASLVKQHQVQLIRQGINLASIFIVLLGLLMSGLYVKQALDL
                     TADTKQAALDTQMQNQRYADVAKNFPSTPIASNDLATAVEINNTIKQYGKAPRRMMQV
                     ISNALEASPEIQLDRLHWLQTNDVSLKDDDKTLVAVPSEKTSQQSSFVPDPTVLYEVG
                     FINGQIKMFNGDYRAALESVNHLAELLKADSNVENVEILQAPVNVSSYTALQGSTNDE
                     KAALQAAAMFKLRVILKREVPTT"
     CDS             112716..113327
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_00990"
                     /product="hypothetical protein"
                     /protein_id="BCM23840.1"
                     /transl_table=11
                     /translation="MKLSRQDWQKLRYPAIGFGLALILMTLLYTYVESVRDQAQQTLD
                     KQTSQLNQARQKFQTSGQEKDTIVKYLPLYQQLISDGFIGEEHRIEWIDDLRTIHDQN
                     KLFKINYSIASQEDYKPTFNLNAGTFKPKRSVMKLELAMLHEGDLLGLIEQLDARQAT
                     PFILRDCEIVRLSRTISNSYIPNMQANCELDWITLREPEQPHG"
     CDS             113320..113847
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01000"
                     /product="hypothetical protein"
                     /protein_id="BCM23841.1"
                     /transl_table=11
                     /translation="MDNFVIRLLMLAGLMISITAHASDSFGRLFTTPAERTNLNYMRQ
                     TARLQSQEQADGIEKVAPPVIPSEISMQGYVKRSDGKKGTVWINNQPMQENTSNSEVT
                     VGKMHGDNNQVPLTLPANGKNLSLKAGQIYKPETDSVSEVSAHSSSEKELKGTIGNSE
                     LPMTNQLNQADSNQK"
     CDS             113851..115212
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01010"
                     /product="hypothetical protein"
                     /protein_id="BCM23842.1"
                     /transl_table=11
                     /translation="MIFGFKIINSVYSVRKESGATLILLLFIIALAATAYSLKVFDAS
                     DLKAERDRKTMLALAEAKTALLGYAASPNLNAICTSSNCPRPGDLPCPDTNNDGVKET
                     TCGNASGTTSQAARLGRLPWKSLGLEDIRDGNGERLWYAVSSRYKENSRFSPLNSDSV
                     GTISLRDSTGNLISTSLVAIVFSAGPPLVRQDGVLQLRDTANENVASNYLDIAFGEDN
                     ADFVDGTNNGFIIGPIRSVTGSDMVNDKLLTITQSDMIPVIETRVLAESQNGLLDYYC
                     GLGNVNYSTKSCSGAGGFFPKPASFSDTGCLGNVAIGTGTCGEGTLTHGRISANPTIP
                     WTSTSIFRGTSVGNWFQLNAWRELIHYAVAPACMTGTTNCLGSGGFLTLNNSIVTPVN
                     IKQFILIATGVTLPTQLRTSALDKSAEANYLEGENLFPLDNSYIRTSPLTNAINDRAI
                     SLP"
     CDS             115209..115961
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011387882.1"
                     /locus_tag="ZMTM_01020"
                     /product="hypothetical protein"
                     /protein_id="BCM23843.1"
                     /transl_table=11
                     /translation="MINSLNIHLMKIRYRGFTLVEMAVVLVIVGLLLGGVFVPLTAQL
                     DQRNATQTQKTLTEIKESLLGYTAINGRLPCPADNTSAGLENPLGGGACVTPYAGFVP
                     GVTLGITPTDTQGFAIDGWGNRIHYAVTTSNSNAYTTVNGLKAIGFTIASPNLYVCSA
                     NGGSSNCGSANSLTTSAPAVIYSIGKNGLTGGTGIDESQNPNPNSADNNAVFVSHDIT
                     ASGAPNGEFDDMVVWLSNSVLINRMLSAGQLP"
     CDS             115972..116718
                     /codon_start=1
                     /gene="thiF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003807436.1"
                     /locus_tag="ZMTM_01030"
                     /product="adenylyltransferase"
                     /protein_id="BCM23844.1"
                     /transl_table=11
                     /translation="MNDNQLLRYSRHILLPQVGYEGQDKLVNSHALVVGAGGLGAPVA
                     LYMAAGGVGTLTICDFDTVDLTNLQRQIIHTTQTVGINKALSAQKTLHAINPEVLVNT
                     VTEKSTEASMMALVAQADVVIDCSDNFKTRYTLNKLCVELKKPLVSGAAIGFEGQVTV
                     FDMRHGDSPCYHCLFPDTGSDQEMRCADNGVFAPLVGMIGTTQAAEAMKLLMDIGESL
                     QGRLLLLDVLAMEWRTIRLSKDPACTVCSN"
     CDS             complement(116719..117561)
                     /codon_start=1
                     /gene="qmcA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002116544.1"
                     /locus_tag="ZMTM_01040"
                     /product="membrane protein"
                     /protein_id="BCM23845.1"
                     /transl_table=11
                     /translation="MTEFMIVLLIPVVVAIWLGIRIVPQGEEWVVERLGKFHSVLRPG
                     LNLIFPWIDRVSYRVTTKDIILDVPQQEVITRDNAVILANAIAFIKVSNIERSVYGIE
                     NFQVAMRNMVQTSLRSIIGGMDLNQALTSRDRIKAELKVAIADEALDWGLTVKSVEIQ
                     DIKPSQNMQHAMEQQASAERERVAVVTCAEGEKQSLILNAEARLEAARKDAEAQEIAA
                     KASAESIRLIAEAVKENNSSATFLLGDRYIQALQKVSDSNNAKIILLPGDVVSAVKAL
                     VGGK"
     CDS             complement(117587..118030)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013095908.1"
                     /locus_tag="ZMTM_01050"
                     /product="membrane protein"
                     /protein_id="BCM23846.1"
                     /transl_table=11
                     /translation="MNTLWTWGILGLILLAIEMATGTFYILWFGVAALVIALMMAIFP
                     STPVALQFFLFALISLASLTVWKLNYKKTSTDSRIGQSQGEEIGRVGTITQKVSAKQS
                     GQIEFAQGVMGSRSWPVVSDEEIEPGAEALITAIEGNSLRVKRAN"
     CDS             118145..119710
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256609.1"
                     /locus_tag="ZMTM_01060"
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="BCM23847.1"
                     /transl_table=11
                     /translation="MTAPVQIVWFKRDLRVTDHAPLAQACLAGPVLPIFAWEPTVWVG
                     DDYVAQHQAFARECLQELRQQLATLGLTLIEWPLGIIDALQDIRQRQQIAGLWSHEET
                     GNGATFDIDRLVASWCKAHQVNWHEIPQHGVVRRLKNRNVWNANWERQMQQAVAMLPT
                     NINAGPVIQISQIGQPIAAGTDKPNRQHGGTVAASKLFEGFLQGRAANYRRGMSSPLT
                     ATKNCSRLSPYLAWGVLSMREVVQATRARRVELKEMNDPETKGLAAGLVGFESRLHWH
                     CHFIQKLESEPEMEFQHLHPAYAGLRDEAMADVESQRRLQAWVSGETGWPLVDACMAM
                     LRKTGWLNFRMRAMLMSTASYLLWLHWREPGLHLAREFLDYEPGIHWTQTQMQSGTTG
                     INTLRMYNPIKQAMDQDPTGRFVRQWLPQLANVPDTWIFQPWLMPPALQLKTGCVIDR
                     DYPSPVVDIETAMREARARLSVVRRSPEAQSQIKQIVKKHASRKGMPGSTRDAKGKEQ
                     TKKKTKTPQLSLF"
     CDS             119710..120960
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01070"
                     /product="hypothetical protein"
                     /protein_id="BCM23848.1"
                     /transl_table=11
                     /translation="MQTLLSVMNSNKPAEKLNLACDLTDRYQRIREYFPKVAGAELST
                     EWRGGRVEAMRRLATVNGDNYGKTRNFLEGDVTRLSPYLRHGCITLKEAFESVRARFG
                     KRAEKLLFEFAWRDYWHQVWYLKGDAILSDMEPAKVALGRGALPEDIKNAQTGLPCMD
                     GFINDLLDTGYVHNHARMWFAAYAVHWRKVDWRAAADWYYAHLLDGDKASNSLSWQWV
                     ACTFGSKPYFFNKENLAKYSNESYCKSCTAKCPFDNTYEVLSEELFDSTNTPPAKTYK
                     IAPLAKVETMQGVNTIVLVHDEMLSPAHPLLRRMDKKIFVFDPALHGDWALHRLQFVA
                     DCLIEMEDVEVWFGDTRQVLNQLGAGQVITQATPNPTIHVLLGAYKVDYLAEEPLTDI
                     KLTSSDLRRFSKYWQKMGPAILNP"
     CDS             121084..121650
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003094011.1"
                     /locus_tag="ZMTM_01080"
                     /product="hypothetical protein"
                     /protein_id="BCM23849.1"
                     /transl_table=11
                     /translation="MNIIFWLVLLVAVVYIIMLYNGLVSLKNNVSKAWANIDVLLKQR
                     HDELPKLVDTCKQYMKYEQETLDKVIKARSQVSSARESQDVRALGAAEGALRSGLGSL
                     FALAESYPDLKANEQFVQLQSRISSLENALADRREFYNESVNVNNVRVEQFPDLVVAR
                     MFNFKTFDLLSFDASELTDVDIGQRFSS"
     CDS             121671..122588
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112766.1"
                     /locus_tag="ZMTM_01090"
                     /product="hypothetical protein"
                     /protein_id="BCM23850.1"
                     /transl_table=11
                     /translation="MFSGIRGYYVEGLTASSHFGLFYIAIHSKERMVWVGCLALMAVI
                     SFFAWVSNYRRSRLVSDTPISRIASAAQGYVELSGRASVDRDNLIASPLSGTSCIWYR
                     YWVYTKNSKDGWVQSDHGVSSSTFEINDGSGKCQIDPDNAEVIGPDRKTTYDGGYKNV
                     EELLYGGGIIYALGEFTTVGGANSTLDLKQDVSELLASWKQNPVALKQRFDLDKNGEI
                     DMREWELARREAVKEVTMQHREIRSQSGVNVIRAPRDGRVFILSSLSPDKLKSRFLLW
                     GALHLSILIAAATASFWLWQGHYVQGLLN"
     CDS             122666..125623
                     /codon_start=1
                     /gene="valS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9K1H7"
                     /locus_tag="ZMTM_01100"
                     /product="valine--tRNA ligase"
                     /protein_id="BCM23851.1"
                     /transl_table=11
                     /translation="MSTDQTTENTSANSALAKSFDPKEIENRWYQFWESQGYYAAGLD
                     TQKQDNFCILLPPPNVTGTLHMGHGFNQTLMDALTRYHRMRGDNTLWQPGTDHAGIAT
                     QIVVERQLDAQGVSRHDLGREKFLEKVWEWKEYSGGTITKQMRRLGTSPDWSRERFTM
                     DPALNKTVTETFVRLYNEGLIYRGKRLVNWDVKLGTAVSDLEVVQEEEDGFMWHINYP
                     LADGSGHLTVATTRPETMLGDVAVMVHPEDERYAHLIGKNVKLPLCDREIPIIADDYV
                     DREFGTGVVKVTPAHDFNDYAVGQRHKLPLISVLTLAGNVVGGTNADVLQREMELAKY
                     EADGDIGRLIEEPLPGKEAWELVPAKYWGLDRFDARKQIVIDLEAQGYLVKTDKHKLK
                     VPRGDRTGVVIEPMLTDQWFVAMSKPDADGKSITQKALDVVADGQIKFYPENWVNTYN
                     QWLNNIQDWCISRQLWWGHQIPAWYGDAGQIYVAHDEAEAKALAAKDGYTGNLKRDDD
                     VLDTWYSSALWPFSTLDWTGDEAKDAANVALQQYLPSSVLVTGFDIIFFWVARMVMMT
                     THITGKIPFKHVYVHGLIRDAEGQKMSKSKGNVLDPIDLIDGIGLDELIKKRTTGLMN
                     PKQAEQIEKRTRKEFPEGISAFGTDALRFTFASLASPGRDIKFDLQRCEGYRNFCNKL
                     WNATRFVLMNCEGDDNGFKDCATEPEGFLTFSQADRWIVSILQKAEADIEKAFADYRF
                     DIVAQVIYKFVWDEYCDWYLELAKVQMQTGSDGEKRATRRTLLRVLETILRLAHPVMP
                     FITEEIWQTIAPMADKSGPSIMLQPYPKAEPKKIDENAEAWVALLKQSVDACRSLRGE
                     MNVSPATRVPLIAAGEAEKLKVYAPYIKALAKLAEVEIVAELPDADAPVALAGDFKLM
                     LKIEIDVAAEKERLGKEITRLQGEIAKAQAKLGNEGFVARAPAAVVEQEKQRLSEFSA
                     ILMKLQHQFNKLT"
     CDS             125644..126135
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01110"
                     /product="hypothetical protein"
                     /protein_id="BCM23852.1"
                     /transl_table=11
                     /translation="MSSSTSIYLLRTMQQHHVALSRMADQKANIVIAGSVAVLLFSMG
                     RIDAGEYSAWIFALATTALASATLAIIAVKPSISLIKKPVQQTNPLFFGHFAQMPEDE
                     YVAEIMGLLEKDESIYKAMIQDTYQLGHTLYYKKYNYIGYSYNVFLFGITLTAGLALL
                     RFL"
     CDS             complement(126166..126411)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004193727.1"
                     /locus_tag="ZMTM_01120"
                     /product="hypothetical protein"
                     /protein_id="BCM23853.1"
                     /transl_table=11
                     /translation="MEFNKELDARGLNCPLPILRCKKSLAEIEGGQVLKVTATDPGSV
                     KDFQAFCRQTGHEIVEFAEVEATPKKEFVFHIRKRIS"
     CDS             complement(126437..126757)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01130"
                     /product="hypothetical protein"
                     /protein_id="BCM23854.1"
                     /transl_table=11
                     /translation="MTGYKEIDTTTLFEMMANEPLTLVDVRNDDEVARGIIPGALHIQ
                     LAMIPVKHDVLDKQKSLVFYCHSGIRSGQASAFLASKGYKNVYNLQGGILAWGRAGYS
                     FVPK"
     tRNA            complement(126907..126982)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00060"
                     /product="tRNA-Phe"
     CDS             127188..128228
                     /codon_start=1
                     /gene="cobT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EYK9"
                     /locus_tag="ZMTM_01140"
                     /product="nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /protein_id="BCM23855.1"
                     /transl_table=11
                     /translation="MIQTQIQPISTALASALLNKINNKTKPLGSLGRLEKLALQVGLI
                     QDTLTPELNKPVMMVFAGDHGIVQAGVSPFPQEVTQQMVFNFLSGGAAINIFSQTNAM
                     QVRVIDAGVNHHFGMVPGLIDAKIGMGTQNFLTTPAMTQAQCEQALTVGISLAHKEFE
                     SCSNVMGFGEMGIGNTSSASALMAVLCELPPEQCVGRGTGLDDAGLQKKIDVIKAAVA
                     QHKLDAKDACQVLATFGGFEIAMMVGAMLGAAEKKCVLLIDGFIATSALLVASKMQPE
                     VLEYCVFAHCSNESGHRLLLHYLKAEPLLDLGLRLGEGTGAALAYPLVKAAVNFLNEM
                     ASFESANVSQAE"
     CDS             128235..129002
                     /codon_start=1
                     /gene="cobS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6GZK9"
                     /locus_tag="ZMTM_01150"
                     /product="adenosylcobinamide-GDP ribazoletransferase"
                     /protein_id="BCM23856.1"
                     /transl_table=11
                     /translation="MIKEWRLLLLAIGFFTRIPMPAHPDFKETDLNASVKYFPLIGWL
                     VGGFGALIYWLALHIFPLEIAILLSMIATIYLTGSFHEDGLTDAVDGLGGGWEKEQVL
                     TIMQDSRIGTYGAVALILALFLKFETLIHLPVLVLPCVMVAAQSISRLAGVFVIATQQ
                     YVRTNGKSKPLATKLNGLELCIAILFGLLPLLLLTWQAVVCGVFAVFLIWCWFSLKLK
                     KRLGGYTGDCLGAMQQLTEIAFYLAVLAWSGQSWKFI"
     CDS             128987..129571
                     /codon_start=1
                     /gene="gpmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000424906.1"
                     /locus_tag="ZMTM_01160"
                     /product="phosphoglycerate mutase"
                     /protein_id="BCM23857.1"
                     /transl_table=11
                     /translation="MEIYLVRHTTPEVATGICYGQTDLDVAASFEEESKRLHEKLQHI
                     ANPMIYSSPLQRCLKLATVTAKALGHNTINQDDRLKELHFGDWEMQAWNDIPQGLIDV
                     WAEDHVMQTPPNGESFHQLFLRVKAFLEEISAGKAGSGEPVILFTHAGVIRAFTGYAL
                     GLPLINAFRLHIDYASVTKIIIDDKVMRIGFVNR"
     CDS             129572..131134
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01170"
                     /product="hypothetical protein"
                     /protein_id="BCM23858.1"
                     /transl_table=11
                     /translation="MSETTQSKTASYSKTPSKHAKPAAGLVVAKTNAKSIQQHNALGA
                     ELLATGDFKSALTSFNQAIAIDANDLEAYIGAGRALTVLKNYDYAIAHLQYAVELKPD
                     DAAAHHFLAVALQKARQFDAAILSYQRSIELKPEDIASYLNLANTLAEADRHQDALDI
                     YDGVIAHKPDDAMAYNNRGNLYLDCKYVDEALADYDKALAIAPNEMKFIWNKALLKLL
                     MGDFETGWQLYEYGFKTEGFARGVRKQCPQPAWLGDFSIEGKRIVLYAEQGYGDVMQF
                     VRYAPMVAALGAEVILEVPKPLVKLIEAMKGDFKVIAQSSVFTEFDAHCPLMSLPLVF
                     KTRLETVPADVPYLFADQEKTADFALADKQKLQVGLVWSGSTTHNNDHRRSIPLATLR
                     PLLDLPVSFHNLQKEIRANDQVVLNLLPQIKSYTERLQDFTDTAALIAQLDLVITVDT
                     SVAHLAGAMGKPVWILLPYVPDYRWLLNTESSPWYPTARLFRQKTVGDWGTVLTELIA
                     ALQVFDNKTSFI"
     CDS             131211..133148
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011203819.1"
                     /locus_tag="ZMTM_01180"
                     /product="hypothetical protein"
                     /protein_id="BCM23859.1"
                     /transl_table=11
                     /translation="MLGTQGLAASSQRQIDANTAAQLLQQAIDFQQANKFDQALAIYH
                     ELLAAHPNDYRVLTLVSTVHLHLKAFEQCLTYTTKSIAINPNQADAHDIAGDAYTYLN
                     RFEESAASYEKSIALKPDNAEAHYNCANALKLAKLDDQALVHYQLVIALKPDYAEAHH
                     NLGVILWQKKQLNEALLCFNKAIELMPKYANAYMNCGNVLADLNKHEFAVAHYNYAIE
                     LNPNHAITYNNRGAAHNKLKAYDFAMEDYARAIELDPNYGAAYINQGNTLLALGRRDD
                     ALASYNKAMQIDPNNSQSYTNRGNLYLDSQQFDLAIADYDHASELAPDNATCLWNKAI
                     IKILLGEYEEGWHLYEYGWDAEGPPRGHRKPYSQPSLVGNDPKAAHIAKEALAGKRVM
                     LHAEQGLGDAIQFARYAPMVEALGAKIILNVHKPLLGLMRTLSPDYQLIEKEQEYAEF
                     DYHCALMSLPFYFKTTVDTVPAAVPYLAVDQSKKAGLKLAEKKGLRVGLVWSGSTTHT
                     KDYKRSVPLAKLAPLMELPIEFHSMQKEIRPNDQATLDAGMPIQLHISELNDFTDTAA
                     LIDEMDVVISVDTSVAHLAGAIGKPVWILLPVVPDYRWLLDREDTPWYPTAKLFRQKT
                     IGDWDSVIAELVDALKTFHVQ"
     CDS             complement(133142..133441)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036266.1"
                     /locus_tag="ZMTM_01190"
                     /product="plasmid stabilization protein"
                     /protein_id="BCM23860.1"
                     /transl_table=11
                     /translation="MSYAVRYTQQAKDDIERLFDFWLDQDTATAERAILTIEQAMHLL
                     KTFALSCRKAEPSNPFLRELIIPFGANGYVAMFEIEDKETVTILSIRHQREDDFH"
     CDS             complement(133442..133711)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006312252.1"
                     /locus_tag="ZMTM_01200"
                     /product="hypothetical protein"
                     /protein_id="BCM23861.1"
                     /transl_table=11
                     /translation="MKTATIPSLRVSPELRHAAENVLQQGETLSSFVEQSLKTNIERR
                     KFQQEFIARGLASSDEAKKTGIYYSDDEVITELKSKLAAKLTDNT"
     CDS             complement(133777..134301)
                     /codon_start=1
                     /gene="cobU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038175.1"
                     /locus_tag="ZMTM_01210"
                     /product="adenosylcobinamide kinase/adenosylcobinamide
                     phosphate guanyltransferase"
                     /protein_id="BCM23862.1"
                     /transl_table=11
                     /translation="MTTSLILGGARSGKSAYAEKIASESDLTVTYIATAQVYDSEFGE
                     RVAHHKSRRAKHWKTVEVPHQLATTLQAEASPDHCLIVDCLTLWLAQCICPECAPPEG
                     VDWQAERAALLTVLPTLPGKIIFVSNEVGMGIVPLGEINRQFQDEAGRLNQAIAALCE
                     EVIFVAAGLPLKLK"
     CDS             complement(134334..135122)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011086933.1"
                     /locus_tag="ZMTM_01220"
                     /product="cobalamin-binding protein"
                     /protein_id="BCM23863.1"
                     /transl_table=11
                     /translation="MTTETTEVLYLLGEQARIVGISGFTTRPAIARREKPKVSAFTSA
                     KIDKILDLKPDLVLGFSDLQADIAAALIKAGVEVHVFNQRSVDDILRMVTTLGGLIGV
                     PEKASALVKELQITIERVEETALYLPAKPKVYFEEWNDPLISGIRWVADLIKIAGGED
                     CFADLSMQTSAKERIIADSDQVIEHMPDIIIGSWCGKKFQPEQVMARPGWNVIPAVKN
                     GFVREIKSADILQPGPSIITHGLKQLQTIIQQWGVKQAHGKHWG"
     CDS             complement(135251..135829)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_638412.2"
                     /locus_tag="ZMTM_01230"
                     /product="hypothetical protein"
                     /protein_id="BCM23864.1"
                     /transl_table=11
                     /translation="MNSTQKNLMISYKPIAIAALIAFFMLLTRGSHVLTAVSLPDASL
                     ALFLLGGLYLKRAWWFAAFFVLATVIDFGAAALDPMQGFCLTNGYWGLIPAYGAMWLG
                     GLWLASRADAFAVKPYVLTSVITTVVAFVISTQAYYLFSGRFPNNGVLETLQYGWNYL
                     PTYVGFTLMYMAAFWLAVKAFRLIQVGKSVQA"
     CDS             complement(135904..137847)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011015947.1"
                     /locus_tag="ZMTM_01240"
                     /product="hemin receptor"
                     /protein_id="BCM23865.1"
                     /transl_table=11
                     /translation="MKKTTIAGLVGLLFTSNTFAADVDLTSDDVLVSANRFERRDTET
                     TYASEIHTAKDIQASGAATLYDYLAQQTSLNVLSSFGNKATPSINLRGYGGENGSQNV
                     VITVDGQRLNNIDGIPQLLAAIPLGNIDRIEISKGSGSVIYGDGATAGAIQIYTKNKT
                     GVTASVSGGNYGQQNHYINAGISEKYFDLSANAAHDSYDGFSQKDVTGNKDEFTSDTQ
                     NVKLKIKPLDNLRFNVEGTSSRNDIRYVNALSLAQFKTDPSQNGGVNPYTHQNLNSDQ
                     WRVGVEYDITNNIRINATHYDETKLSSYISDFPSTSNYRYQSNDISINYCDDFKSLIV
                     GFQNFDGKRSSTTDVTTKENQAFFAQGDYKIDALTLSAGARREDVTYANNPVGDTSAS
                     GDNNLNAWDIGANYRLGSTLSIFSNYNKSFESPDIDRSFVFDTATSKTIFSGFIKPQE
                     AKTFNIGLNQVLSNNKFKATAFYSWLHDEIYLDHSVGPFGVNTNIDKSHKYGIELQDS
                     LKISENLGASIIYNYTRAIIDSEVETDGTNISNKNLPGVPKHSVVANLNYKFLDHASL
                     NLNQTWRSDAYAYNDFQNNLSQKQNSYQTTNIALNYQYKNVNFFTAINNLFEHENSIQ
                     VADNFIYPIDFVRTWRVGMKADF"
     CDS             138314..138562
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01250"
                     /product="hypothetical protein"
                     /protein_id="BCM23866.1"
                     /transl_table=11
                     /translation="MTTQGFSNYSDIMETDLNVLEAKLTQLIELCQSLRAENLQLRQE
                     LAQGRDDTKQLKSQMTEASARLEALIERLPQTVVEGVL"
     CDS             138559..138864
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VUN4"
                     /locus_tag="ZMTM_01260"
                     /product="cell division protein ZapA"
                     /protein_id="BCM23867.1"
                     /transl_table=11
                     /translation="MSQPTGVDVNIMGREFRVACTEDEREGLENSVKYLDKKMRDIRD
                     TGKVIGIERIAIMAALNLAHELLTTRTGGFDVGDFKRRIDGMQEQIDSALAEQNKLF"
     CDS             complement(139156..139515)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015923332.1"
                     /locus_tag="ZMTM_01270"
                     /product="hypothetical protein"
                     /protein_id="BCM23868.1"
                     /transl_table=11
                     /translation="MARNVLGTELQACSIKPLTGFTRNGCCDTGAEDTGSHTVCAEVT
                     EEFLVYSKAQGNDLSTPRPEYNFDGLKPGDRWCLCAARWNEAAEAGYAPPVVLEATHE
                     QALKIVSLADLKYHALR"
     CDS             complement(139556..141343)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004527892.1"
                     /locus_tag="ZMTM_01280"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BCM23869.1"
                     /transl_table=11
                     /translation="MSTTSPTLEANDVSENQNHESKPRWRDTWALIKPYWVSDEKWRA
                     RGLLFAIITLTLGAVYINVLFNTWNRDFYNALETKNYIAFKEQLWRFSYLAFIFIAVA
                     IYRIYLRQALEMRWRAWMTKQYLGKWLAHQSYYRIEQTQSSDNPDQRIAEDLSQLTTG
                     TLALSLDLLSSVVSLVTFVGILWAVSGPLSFLMFGHQMVIPGYMVWFAVAYAAVGSWL
                     VWKAGKPLIQQNYNQQRYEADFRFGLVRVREYSEAIALYEGEAQEKVHLESRFERIRV
                     NWWQIMKTTKRLNVASTFYAQFAIIFPMLVGAPRYFSGAITLGGLTQISSAFGQVQDA
                     LSWFVSAFTTLATWKASVNRLASFHASIVNAENQALNASLSINRTSGSGIKLNDVSLH
                     LPTSSSAEPNLLDTVNLQLEQGQRVLLSGPSGAGKSTLFRAIAGIWPYGTGNIEIPRQ
                     ANLLFLPQRTYLPIGILRDAIAYPSAAEKFSDEAMVKYLTLFKLEHLCDKLNDAENWG
                     QRLSTGEQQRLAFIRLLLIKPDVVFLDEATSAVDEDMEELLYSLLVQELPNSSVLSIA
                     HRSSVAKFHTRSWQLKDRKLEAHAITQTS"
     CDS             141641..143014
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074243.1"
                     /locus_tag="ZMTM_01290"
                     /product="hypothetical protein"
                     /protein_id="BCM23870.1"
                     /transl_table=11
                     /translation="MLAPIALYPDALLSQVLMASTYPLEVVQAARWSRANPDLKGDQA
                     VKAAQQNNWDPSVISLTAFPQILGMLDEKLEWTERLGDAFLEQQPQVMDTVQGLRQKA
                     MAAGNLQSNDQVQVNQQAQQGQTVIVIQQAAPQVVYVPYYNPTVVYGPWWWDAYPPVY
                     WNPWPGYYRRPGYNSGFYVGVGISVGGGFFFGNFDWHQRHVNVVNVNNYYYRNYYNNH
                     PRPPVGANPRPYPDRGAWQHDPDHRRGVPYPNSALQQQFSRPGNDARPPRNNRDDFQQ
                     NRDGNHQNSGGNPTNHSPDNRNRSNPAGQPTNGNPDHSPDYRQNVNLPDGRPQGQNPG
                     RQNDDSRSPRNQPQMSNPESMSPPSGRDKGADIGSGQQARPQIERAAPQAVQQPRPET
                     APRVQQRSTEARQPRPEMQRSEPQRQQQHIEMPRAEQPRNEAPRPQQQQRHEGGGHPQ
                     GGGDKQR"
     CDS             complement(143076..143489)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011089945.1"
                     /locus_tag="ZMTM_01300"
                     /product="hypothetical protein"
                     /protein_id="BCM23871.1"
                     /transl_table=11
                     /translation="METKPPLPPFTLETAKQKVQAAEDAWNSKDPERVSLAYTVDSHW
                     RNRSEFITGRPAIKEFLKAKWAKEHEYRLKKELWCFLENRIAVRFEYEWHDDKGQWYR
                     SYGNENWEFAENGLMQFRYASINDVLINESDRKLG"
     CDS             143630..144070
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004193808.1"
                     /locus_tag="ZMTM_01310"
                     /product="EVE domain-containing protein"
                     /protein_id="BCM23872.1"
                     /transl_table=11
                     /translation="MKSEPGDVSIDDLAAMPNQTVDWYGVRNYQARNFMRDQMKVGDG
                     VLFYHSNCDVPGIAGIAEVSKLAYPDRLQFIAGHKYYDPKATPESPRWFNVDVKLVRK
                     TRLLSLKEMREIPELVSLRILQRGNRLSITPVDPREWEFILKLL"
     CDS             complement(144185..145519)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01320"
                     /product="hypothetical protein"
                     /protein_id="BCM23873.1"
                     /transl_table=11
                     /translation="MIPKPNDMQLLNQIIDKIKSVKLADFDAWRGRLIVWIAAAVAGL
                     VVVIFAQATEHVISWFFRIEIAYWWAPILLTPLGGIAIVFFTRRWFAGAAGSGIPQTI
                     AALKDETSEETISKLLSLKLAAAKIVLGLGALASGFSAGREGPSVQVAASVMYAFRRF
                     LPKNFSIHPKHLILAGGAAGISAAFNTPLAGIVFAIEELGRRFEQKTNGVVISAIVLS
                     GLVSVSLQGNYIYFGNIVVNNVDRHIFIPLLVCGLVCGVTGGLFSRTLIESSSKLDGR
                     VGNFRSMHPVRWAGFCGLMVALLGLISDGHAHGSGYIYTQNILDGSVMESWQYAPIKY
                     LATIFTYFSGVPGGIFAPSLSIGAGIGSDLLPFFGQQHIAEISTLCMAGFLAAVTQAP
                     LTSFIIVMEMVDGHQMVISLMLVALIAAIISRIFSLPLYETLAAKQSESLQS"
     CDS             complement(145736..146095)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01330"
                     /product="hypothetical protein"
                     /protein_id="BCM23874.1"
                     /transl_table=11
                     /translation="MGNKIAIVVLADTETNEGLGRVVNALAAAGECKESGDEVHIVFS
                     GTATKWLTQLVKADHPAHGLFEAVKDKIDGACGFCANAFGQTDAVQSCGIRLLADSGP
                     FMSYRQFTSENYQVLIF"
     CDS             146205..147023
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015063703.1"
                     /locus_tag="ZMTM_01340"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BCM23875.1"
                     /transl_table=11
                     /translation="MTDRLAGFFNQHQLSARMFFSGTLCKDIDFDESMGGGFLHLIQK
                     GKLTVNSSEHGSILIDQPSLLLYPRPAKHQFVFDGEVDLTCAIIDLDGGSKNVLANAL
                     PRVMLMPLDLMPSLANTLGLLFAEAEQDYCGRQAAIDRLFEYLLIQLLRYILDHHKTD
                     IGLLAGLNDARLARAISAMHDAPGNNWSLELLAEKAGMSRARFAVHFRDTVGTTPVNH
                     LTQCRLALAQTLLRKGKPVGLVANEVGYSNSAALTRLFKVQVGHSPKAWLKLNP"
     CDS             complement(147108..147878)
                     /codon_start=1
                     /gene="nhoA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195415.1"
                     /locus_tag="ZMTM_01350"
                     /product="N-hydroxyarylamine O-acetyltransferase"
                     /protein_id="BCM23876.1"
                     /transl_table=11
                     /translation="MIASNFVLADYFKRIGYTSQPKADIATVAEIMRCQLFTTPFENL
                     DVQAGKIVSLVPEDIVEKIVKHHRGGYCYEVNGIFAMALQALGIPYQFVAARPMFYPT
                     KRPRTHMAVVVNMSGERWLCDLGFGSYGLRAPIQLDVLDQAVKQDHDSFMLSKPTEHE
                     YLLQAWVDDAWAPQFAFDFSPQEWIDFAPANYMNSTHPDAIFVQKLLVVLHNPEGRKI
                     LFGTTLKTITDGKVEKQFIAKEDISNVLESQFGLSQTT"
     CDS             complement(147882..149393)
                     /codon_start=1
                     /gene="ilvA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P7U9"
                     /locus_tag="ZMTM_01360"
                     /product="L-threonine dehydratase"
                     /protein_id="BCM23877.1"
                     /transl_table=11
                     /translation="MKNAYLEKIRNARVYDVAIKTPLEFQANLSARLGNRILLKREDM
                     QPVFSFKLRGAYNKMINLPAESLKCGVITASAGNHAQGVALAAQKIGCRAVIVMPTTT
                     PMIKINAVKSRGGEVVLFGDSYSDAYAHALKLEQQEKLSFVHPFDDPDVIAGQGTIAK
                     EILDAHPEPIEAIFCCVGGGGLIAGIAAYVKAVRPEIKVIGVEATDANAMTLSLQKGE
                     RVMLDQVGLFADGAAVKQVGEETFRLSQEYVDEMILVDNDAICAAIKDVFEDTRSILE
                     PAGALATAGLKEYVKLHKMQGKTLIGIASGANMNFDRLRFVAERAEIGEKREAVLAVS
                     IPEKPGSFKTFCHLIGDRSITEFNYRYSDATAAHIYVGIAIQDPKESGELVELLKAHG
                     LPTLDLSENEVAKLHLRHLVGGHAPQAEHECVYRFEFPEKPGALMNFLDHMGHDWNIS
                     LFHYRNHGADFGRVLVGVQVPPNEQDEFKQFLENLNYPYWDESENPAYKLFLG"
     CDS             149558..150214
                     /codon_start=1
                     /gene="rpiA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87UK7"
                     /locus_tag="ZMTM_01370"
                     /product="ribose-5-phosphate isomerase A"
                     /protein_id="BCM23878.1"
                     /transl_table=11
                     /translation="MATQDELKQQVAAAAVSYVKGGIIGVGTGSTANFFIDELAKVKS
                     KIDGAVASSEATAKRLKAHGIEVFDLNSVDGMEIYVDGADEVTEHLHMLKGGGGALTR
                     EKIVAACAKKFICIADASKLVPVMGKFPLPVEVIPMARSYVARELVKLGGQPKLRDFT
                     TDNGNVILDVFGLQILNPVELEAKINQIVGVVTNGLFAARPANVLLLATAEGVKTYEK
                     "
     CDS             150349..151056
                     /codon_start=1
                     /gene="phoU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WJ18"
                     /locus_tag="ZMTM_01380"
                     /product="phosphate transport system regulatory protein
                     PhoU"
                     /protein_id="BCM23879.1"
                     /transl_table=11
                     /translation="MQFEHTYKQYDAELESVRAKVLQMGGLVEQQIVNALDALVNANS
                     NLAESVMANDSRVNDLEIQIDEDCSHIIARRQPAAGDLRMIMMMVKTITDLERIGDEA
                     TKIARVAQKISESDRMYTPRFNEIKSMVGLVREMLRTALDAFARLDVTKTVEVARQDE
                     QVDEQFRAAMRQLITFMLEDPRTISMSLEVLFVAKAIERIGDHAKNIAEYVVYMVKGK
                     DVRHISLEEMERETLQS"
     CDS             151209..152708
                     /codon_start=1
                     /gene="ppx"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192703.1"
                     /locus_tag="ZMTM_01390"
                     /product="exopolyphosphatase"
                     /protein_id="BCM23880.1"
                     /transl_table=11
                     /translation="MVLATQKPILSEIAAVDLGSNSFRLQLARVVDGQLIFHDSLREP
                     VRLGAGLGKDKRLDADAQRRAIDCLKRFGERLRGLPPQAVRAVATNTFRVAKNSAELL
                     AEAEAALGFPIEIIAGREEARMIFVGVSHSLPAATHKRLVIDIGGGSTEFIIGQGLEP
                     IEMESLYMGCVSYSLRFFPDGKITEDSLVKAQLAAASEIQNIRKNFSTLSWHEAVGSS
                     GTARSLGEIMRLQGVTDGAITHAGLLHLRDLLLKGKDSKKLQLQGLSPDRAAVLPGGL
                     CIMLAAFEALNIDHMTTASSALREGVLYELLGRMHHQDTREETVNSFMRRYHVDQDQV
                     TRVQKLALALLDQVDDNLSMNKETAEHYLIWAVKLHEIGISIAHSGYHKHSAYIVENA
                     DMPGFSKMEQLTLGLLVRAQRRSLTKITLPPLDDDRCLLIMVLRLAILFHRNRLDDSH
                     PALELMRDNTGFSLALESGWLKDNPLTEAELSNEVAYWKDVSIPLLISE"
     CDS             complement(152740..154824)
                     /codon_start=1
                     /gene="ppk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9JXS9"
                     /locus_tag="ZMTM_01400"
                     /product="polyphosphate kinase"
                     /protein_id="BCM23881.1"
                     /transl_table=11
                     /translation="MSQPKLNPDHFINRELGILAFNKRVLAQAEDARVPLLERLKFLS
                     IFSSNMDEFFEVRVAGLKEQIKYNNLHVGADGMLPKQVFARVSVEAHQLVEHQYQILN
                     DIVLPGLAEQGIRFWRRGFWNDAQREWIRGFFFRELMPILTPIGLDPSHPFPRVLNKS
                     LNFAVELEGKDAFGRNSGVAIVQAPRALPRFIKLPNDIAGCEHGFVFLSSILHAHVNE
                     LFSGMQVKGCYQFRVTRDSDLTLDDEETKDLRQALQGELSHRQYGDGVRLEVADSCPA
                     EMSAFLLGQFGLGQDDLYQVNGIVNLVRLMQIPDSVDKPTLKFPRYSPSTPKEFNKET
                     DIFKVIRKGDVLLHHPFQSFNPVIEFIQQAADDPNVLAIKQTFYRTSADSTLMKSLIE
                     AAKRGKEVTVVVELLARFDEEANINWAAQLENAGAHVIYGVVGHKTHAKMAMVVRRED
                     DKLRRYVHLSTGNYHQRTARLYTDFGLLTCHEEICEDVNDVFAQLTGLGKASKLRHLW
                     QSPFTLHSQLIKAIHHETEIAKSGKKARIIAKMNALLDADIIRALYDASTAGVEIELI
                     VRGVCALKPGMPGISENIRVRSIVGRFLEHSRIFYFYNNGQENTYLASADWMYRNFFR
                     RIEVCFPILDAKLKKRVFKDGLEPYLKDNTSAWEMLPDGTYKPRLARRGSAFNAQEFL
                     TSEHGQNLPQEI"
     CDS             complement(154904..155176)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63SJ4"
                     /locus_tag="ZMTM_01410"
                     /product="putative Fe(2+)-trafficking protein"
                     /protein_id="BCM23882.1"
                     /transl_table=11
                     /translation="MARTVHCIKLNKEADGLDFPPYPGDLGKRIFENVSKEAWAGWIK
                     QQTMLVNENRLSLADPQARKYLAQQTEAYFFGDGADSASGYVPPKP"
     CDS             complement(155274..157487)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003101985.1"
                     /locus_tag="ZMTM_01420"
                     /product="hypothetical protein"
                     /protein_id="BCM23883.1"
                     /transl_table=11
                     /translation="MFYFLSENIIMHASNIPANPLGFASKVILARKKMFIALSVMFIS
                     PGLISTSFAQDNTSDASALNLDLPAVPVTGNPLGVSSDELVVPVAVLNGRELSLQRES
                     TLGETLKSIPGVSSTYYGPGASRPIIRGLDGDRVKIMQNGIGVLDASSLSFDHAVALD
                     PLVIEQIDVVRGPAALLYGGSAVGGVVNAIDHRIPTESLDGVTGRAEARYGGADNEKN
                     GAVVVDAGNGLFAIHADVYKRDSDDLRIPGYQASDRLRAQQAAQGDPIDLRKGTLQNS
                     SSEGDGGALGASLTFDKGYAGFSYSTFNSNYGSVAEPAVRLDMESQRWDFASEFHDLG
                     PVISRVKLRLGNTNYQHQEIEDGQIGTTFKNKGLQGSLEAEHAKIGNITGVVGVQFQN
                     TNFQALGDEAFIPKTNTNSKAVYLYEELPIDTLKFSLGGRLEHAKVSSDGGGPDDPNN
                     PGTPRFGSAQTKSFDPFSAAFGTLYALNTHWSLAGNLAHTERAPSYNELFANGPHFAT
                     GQYEVGNPDLNKEKSNGIDAQLRWKTEKNSFSIGAFYTKFSNFLSLENTANTRGADGE
                     INPQDLNNDGIADISGEQIVPEAQVIGVRATFNGFESEAKFRVYEGHGDLDLKLRGDY
                     VRATNSDTGTPLPRIAPLKIGTGLNYQLNRFGARLDVLHAFSQNRTDTFELATDGYTS
                     VNAMLTYVIPAAFHLEAFAKANNLLDEDIRDHSSFLKDIAPMGGRSILVGMRGDF"
     CDS             complement(157531..157896)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01430"
                     /product="hypothetical protein"
                     /protein_id="BCM23884.1"
                     /transl_table=11
                     /translation="MFRRFLLPFSLILLFGIAQLGALTHEISHFTTDLARADIVYASE
                     TTSQISATQKTPQDNAPDTPFCAKCLSYGALAHTVHATNFTVVLFDNSFEIQQAEQHN
                     SYLKPLLLSYAARAPPVLA"
     CDS             complement(158022..158603)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CKP1"
                     /locus_tag="ZMTM_01440"
                     /product="superoxide dismutase"
                     /protein_id="BCM23885.1"
                     /transl_table=11
                     /translation="MEHTLPALPYAKDALAPVISVETIDYHYGKHHQTYVTNLNNLIK
                     GTEFENSTLEEIVLKASGGIFNNAAQVWNHTFYWNGFKPNGGGAPTGELAAAIDKAFG
                     SFDEFKKQFTQKAITTFGSGWAWLVKNKDGSLSLESTSNAATPLTSGQTPLLTIDVWE
                     HAYYVDYRNARAKYAEEFWSIVNWDFVAANFKA"
     CDS             complement(158726..159607)
                     /codon_start=1
                     /gene="xerC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3FUN7"
                     /locus_tag="ZMTM_01450"
                     /product="tyrosine recombinase XerC"
                     /protein_id="BCM23886.1"
                     /transl_table=11
                     /translation="MAELLDSYLDYLAHERGLSILTRENYARDIKTLLKLADSVALVK
                     LQPQHIRRFVATLHGQGLNGKSIARTLSAWRGFFDYLNLKSDMPSNPCIGMRAPKSAK
                     MLPQALSTDQAVKLVSIDDSEGTLAVRDHAILELFYSSGLRLAELVGLNLEDVDLKSG
                     IATVTGKGNKTRMVPVGSHAITALERWLLIRQQFQGKDPQALFVSKLGKRISGRAVQY
                     RLKEWAIKQGINSDVHPHMLRHSFATHVLQSTGDLRAVQEMLGHANISTTQVYTHLDF
                     QHLAKVYDAAHPRAKKK"
     CDS             complement(159635..160315)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01460"
                     /product="hypothetical protein"
                     /protein_id="BCM23887.1"
                     /transl_table=11
                     /translation="MEPNNQLSEDDITAFLRANPKFFERHPELLINMYLPSTHGGGTV
                     SLAERQQLAQRDKIRVLEAKMAEFLRYGEENDAISDKVHRLSLGLLAAQNFEIFTQLL
                     IHALHDDFQVPHAGLRLWAVPQDSAHSDDVIFSGVDHELKAWTESLVAPYCGSRPGLE
                     LDSWFGEDAAPKSFALIALRGEKVFGLLAMASEDEKRFYPEMGMLYLNRIGELVSAGL
                     LSYIESDA"
     CDS             complement(160375..161250)
                     /codon_start=1
                     /gene="dapF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q51564"
                     /locus_tag="ZMTM_01470"
                     /product="diaminopimelate epimerase"
                     /protein_id="BCM23888.1"
                     /transl_table=11
                     /translation="MNIKFTKMHGIGNDFVVIDAYSSVVSLSANQIRAIADRHFGIGC
                     DQLLLVEKSTLPNVDFRYRIFNADGSEVEQCGNGARCFVRFVHDKHLTEKNEIRVETM
                     RGIITLTLENNGQVTVNMGPPRFNPDQIPFIADAPAETYSLDVGGEEINISAVSMGNP
                     HAVQIVANTGSAPVALQGPLIEAHPRFPEHVNAGFMQIIDDHHIRLRVFERGSGETLA
                     CGSGACAAVVAGIKLGLLNSPVNVSMRGGELNIVWNGNNSDVMMTGPAEPVFDGELDL
                     SRIDTQTVATQTAVI"
     CDS             complement(161344..162096)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003807187.1"
                     /locus_tag="ZMTM_01480"
                     /product="acyltransferase"
                     /protein_id="BCM23889.1"
                     /transl_table=11
                     /translation="MGYLFYFGNKKFAARVKDNLSTAHIPEAEKSLNAFIRHNARESG
                     KAILETFAIWFKPLAKAQGLVKASHGWDHVEAALARGKGIIFLTPHLGCFEITALHYA
                     QFHPVTVLYRPSRQAWFEPIVSEGRNRGMMRQTPTNLTGVRTLLKCLKKGEAIGILPD
                     QVPKFGEGVWANFFDRPAYTMTLIGKLLEATGATVMLAYGERLSWGRGYVIHFEPLET
                     TGSPEEINKGIESLIRRCPTQYLWSYNRFKKL"
     CDS             162249..163406
                     /codon_start=1
                     /gene="metK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62EZ1"
                     /locus_tag="ZMTM_01490"
                     /product="S-adenosylmethionine synthase"
                     /protein_id="BCM23890.1"
                     /transl_table=11
                     /translation="MNEYLFTSESVSEGHPDKVADQVSDSILDAILEQDPTARVAAET
                     LTNTGLVVLAGEITTTANVDYIKVARETIKRIGYDNTDYGIDYRGCAVLVAYDKQSPD
                     IAQGVDNADDDPLDQGAGDQGLMFGYACDETPQLMPLPIWLAHRLMERQSQLRKDGRL
                     PWLRPDAKSQVTIKYVDGKPSAIDTVLISTQHAPEMSLENIREAVIEEIIKPILPKEL
                     IKGEIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRS
                     AAYAGRYVAKNIVAAGLASRCLVQVSYAIGVARPTSVMVETYGTGKVSNEILTQLVLE
                     HFDLRPKGIVKMLDLLRPIYTKTAAYGHFGRDEPEFTWEAVDKAALLKAAL"
     CDS             163459..164682
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113015.1"
                     /locus_tag="ZMTM_01500"
                     /product="cyclic di-GMP phosphodiesterase"
                     /protein_id="BCM23891.1"
                     /transl_table=11
                     /translation="MLKQIPLDKIRLGMFIQELQGTWMNHPFWRKSFKLDNIDDLKKI
                     VASSLSGVVIDTDKGLDVLEQAEPKPVSETAIKAEIAPDAPLSVPTTKITRVTAAEER
                     ERAAKIIKSSKSAVSSMFKEIRMGRAINTEGAMSLVEEIANSVSRNEGALISLVRLKD
                     QDDYTYMHSVAVCALMVALAKELNLSEAETRQAGLAGLVHDIGKVAVSLDILNKPGKL
                     TDEEFDKVKLHPVRGHEYLLKSVGIDEVALDVCLHHHEKVDGSGYPHKLAGDKISLFA
                     KMGAVCDVYDAITSNRPYKEGWEPGVSLQRMAQWSKTHFDDVVFKAFVKSVGIYPIGS
                     MVLMKSGRLGVVADQSPKSLLTPIVKVFFSTRSKMRIPVEILDLSKPSAHDEIIKHDD
                     PAAWGIKDINDVWTQ"
     CDS             164932..166341
                     /codon_start=1
                     /gene="acyH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0M7Y2"
                     /locus_tag="ZMTM_01510"
                     /product="adenosylhomocysteinase"
                     /protein_id="BCM23892.1"
                     /transl_table=11
                     /translation="MNTVADIKDYVIADINLAAFGRKEIAIAETEMPGLMAIREEYAA
                     IKPLKGARITGSLHMTIQTAVLIETLNDLGAEVRWASCNIFSTQDHAAAAIAAGGTPV
                     FAVKGETLEQYWDYTHRIFEWADGGYTNMILDDGGDATLLLHLGTNAEKDVSLLSNPT
                     SEEEICLFNSIKAKLAVDPTWYSTRLKHIRGVTEETTTGVHRLYQMHKEGRLAFPAIN
                     VNDSVTKSKFDNLYGCRESLVDAIKRATDVMIAGKVAVVAGYGDVGKGSAQALRALSA
                     QVWVTEVDPICALQAAMEGYRVVTMDYAAEHADIFVTATGNYHVISHEHMAKMKDQAI
                     VCNIGHFDNEIDVASLEKYEWDEIKPQVDHVIFPDGKKIILLAKGRLVNLGCGTGHPS
                     YVMSSSFANQTIAQIELFSHPEQYPVGVYTLPKHLDEKVAVLQLKKLNAQLSTLTDQQ
                     AAYIGVSKNGPFKADSYRY"
     CDS             166410..166757
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198632.1"
                     /locus_tag="ZMTM_01520"
                     /product="hypothetical protein"
                     /protein_id="BCM23893.1"
                     /transl_table=11
                     /translation="MKLLIVWLLNALALIAVTYLVPSIHVSGLTGALIAAAVIGVVNM
                     LIKPILILLTLPVTIVTLGLFILVINGLLFYFVGHILQSFEVQTLMAGIIGAILYSII
                     SWALTALILGTKD"
     CDS             166808..167647
                     /codon_start=1
                     /gene="metF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WGJ7"
                     /locus_tag="ZMTM_01530"
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="BCM23894.1"
                     /transl_table=11
                     /translation="MTQPIISFEFFPPKTVEGIAKLRETRKQLALLNPKFFSVTFGAG
                     GSTRDRTKDTVFEIQGEGYEAAPHISGISSTKAEISALLDTYRSNGIKRLVVLRGDLP
                     SGEASAGDFRYANELVQFIRQTSGDAFQIEVAAYPEFHPDARSAASDLQHFKNKVDAG
                     ANAAITQYFYNPDAYFRFMDQCQALGIDIPIVPGVMPIYNFTQLSRFSDVCGADIPRW
                     LRLRLQDYGDDLPSLRAFGVDVVAELCQELLAGGAPGLHFYTLNQAGIISQIASQLDL
                     TKL"
     CDS             complement(167659..168117)
                     /codon_start=1
                     /gene="smg"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87KD8"
                     /locus_tag="ZMTM_01540"
                     /product="protein Smg"
                     /protein_id="BCM23895.1"
                     /transl_table=11
                     /translation="MFEVLVYLFENYFEANIRPDQQTLEKELSAAGFEQEDIHGAFDW
                     FTSLESMTNDSGIASTDSSTSFRIFAEAETKKISQESLSFIMFLEQANVLNAIQRELV
                     IDRAMALAQPEVRLEETRWIVLMALWNQGKAKDYLFVEDAVFSDTKPILH"
     CDS             complement(168245..169345)
                     /codon_start=1
                     /gene="smf"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010929874.1"
                     /locus_tag="ZMTM_01550"
                     /product="DNA processing protein DprA"
                     /protein_id="BCM23896.1"
                     /transl_table=11
                     /translation="MATASTAHDDEIALWISLSLINGLGGQTLCKLLSTFGTPSSIYS
                     APISQLKEVASEAIAKLIAQGPDNQAIQSTLDWLAIEDNHLITLADKTYPKLLLEIAD
                     PPPLLYAKGNLDLLNMPSVAIVGSRNASPQGAKNAEDFACALSELGFCIVSGMALGID
                     GSAHIGALKGSGNTIAVVGTGLDIVYPAKHRDLAHQIAQRGLIISEFGLNTPSRPQNF
                     PRRNRIISGLSLGCLVVEANIQSGSLITARLATEQGREVFAIPGSIHSPVSKGCHSLI
                     KQGAKLVDHVHDIVSELQPFTGLETIDESETPPEITDNPILTHMGFDPINIETLIERS
                     GLTSEQLSAMLLVLELENKVATLPGSRYQRIA"
     CDS             complement(169368..170504)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003097294.1"
                     /locus_tag="ZMTM_01560"
                     /product="hypothetical protein"
                     /protein_id="BCM23897.1"
                     /transl_table=11
                     /translation="MFRHIITLLVFCCLTCCLITKATADEVQLQANHPERYVVVKGDT
                     LWDISAKFLKDPWQWPKVWKMNKAEIKNPNLIYPGDVVVLDMSSGQPQLSVLRETVTL
                     NPGVVEEPLEKEAIKTIAPNVIAPFLTQPLMIDQGDFQNNPRIIAGPENRVVYANGSK
                     VYTTEIKSEDGLFWHVYRPGKILVDPITSETLGIEAIYLGDARVTKFGEPTSVEIVRT
                     KEEMHKDDKLIKVDDKLLDRFVPRAPDSNIEGVVMNIYGGFGEAGLNRVISINRGTKD
                     GLEVGHVLAINRAGKYVSKDPNKKTTNEKFNMPALKPADTENKTKTATLTNDEKEKAN
                     PDLVRLPDERIGLLMIFRTFERVSYGLIMQASQPVNVLDVVKTP"
     CDS             170592..171092
                     /codon_start=1
                     /gene="def_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YR7"
                     /locus_tag="ZMTM_01570"
                     /product="peptide deformylase"
                     /protein_id="BCM23898.1"
                     /transl_table=11
                     /translation="MAILNILNYPDPRLYTVAKPVKEVDATIRRLIVDMAETMYDAPG
                     IGLAATQVDVHQQIIVIDTSQDKRDLKVFINPRIVTSCGTKDYEEGCLSVPGVYEMVT
                     RAESITVEALGRDGKPFTIEAEGLLAVCIQHEMDHLLGKVFVEYLSPLKLARIKSKLK
                     KRQRGR"
     CDS             171094..172041
                     /codon_start=1
                     /gene="fmt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YR6"
                     /locus_tag="ZMTM_01580"
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="BCM23899.1"
                     /transl_table=11
                     /translation="MAALKIIFAGTPEFAVPALAALIEAGHHIAMVLTQPDRPAGRGM
                     KLKASPVKTLALQHHIPVFQPETLKDPAVQAQIAEVHADVMIVAAYGLIIPTPVLEMP
                     KLGCFNIHASLLPRWRGAAPIQRSLLAGDAETGVTIMEVVPALDAGAMISHASLPITE
                     RDTAQTLHDGLSTLGAALMVQAMQTLAQQGKLESTPQDESLVTYAAKLQKAEADIDWS
                     ESASALSRKIRAFNPFPVAQTKLNGEVCRLWMATEAQSQTPVKALAGEVVAIGDYIVV
                     ACGEGLINIEELQMPGGKRLSAKDFIRGHAISVGQRFGD"
     CDS             172111..172953
                     /codon_start=1
                     /gene="htpX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62MT2"
                     /locus_tag="ZMTM_01590"
                     /product="protease HtpX"
                     /protein_id="BCM23900.1"
                     /transl_table=11
                     /translation="MLGNWFKTTILMAGIVVLFGAVGASLGGANGMLIALVIAGAMNI
                     YAYWFSDAAVLKMYNAMQVDENSAPQFYRMVRELAQNAQLPMPKVYIIDEPQPNAFAT
                     GRDPEHAAVAATTGIMSILSERELRGVMAHELAHVKHRDTLISTISATMAGAISSIAQ
                     FGLLFSGGHRDRNVHPLVALLIMVLAPLAAMLIQMAISRAREFEADKGGAEISRDPKS
                     LASALQKIHNYAHQIPMNTAEQHPETAQMMIINPLSGGGMQSLFSTHPQTEERVARLM
                     AMAY"
     CDS             172954..174294
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5F5P8"
                     /locus_tag="ZMTM_01600"
                     /product="ribosomal RNA small subunit methyltransferase B"
                     /protein_id="BCM23901.1"
                     /transl_table=11
                     /translation="MQVAQSLAANVVSHVLAGKNLTVALDESFRQNQEITPQQRAVTQ
                     DLSYGTLRFYGELRALLNELLETPLQDQYLRCLLLVAIYQINHDQAALHTIVDQAVNA
                     AIKARKSWAKGLVNGVLRNYLRQREALQQKITADETARYSYPQWWINKLKKQYPEDWE
                     AILMAGNQHPPMTLRVNQRKTNIIDYSNLLSQLGIEAQVLDAQALILQKPTSVERIPS
                     FATGEVSVQDFGAHQAAKLLDIKDGMHVLDACCAPGGKTGHILELATVNLLAIDSDQI
                     RLQRTQSNLTRLGLQAELKVGDAAVPDTWWDGTPFDRILADVPCTASGIVRRHVDIKW
                     LRREADIASFSKQQAQILPALWRLLAKGGKLLYVTCSIFNEENQVQIDRFLEKHADAK
                     QLPLDFASSQSATTQQNVDASETHLSEHNIKSHHGQLFPCAQHDGFFYALLQKI"
     CDS             174272..174859
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004188929.1"
                     /locus_tag="ZMTM_01610"
                     /product="hypothetical protein"
                     /protein_id="BCM23902.1"
                     /transl_table=11
                     /translation="MPFYKKYKAALILRKMALIGLFVSIAVAAWANPNTLQIISAELV
                     PVEESYAVNAQLEMNFNTEVEDALNKGIPLTFLVEFQLYIPHRYWFDDEVVTTTNQIT
                     LSYHALSRQYLINQGNHQQTFATILEAKEEFTHIHDWLVFEKALLKKDKNYRARLMVK
                     LDQSKLPKPLQVEAMSSENWKMVSERFMWTPTFAL"
     CDS             174917..177067
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015038749.1"
                     /locus_tag="ZMTM_01620"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BCM23903.1"
                     /transl_table=11
                     /translation="MRLRYIVFVSAILAVILLYLLSHASANSAASGNYYTTLLVLNIG
                     LAAALILLIGVQLTRLYKQISQKVMGSRLTLRLLSALALMAIIPGLLVYAVSVNFLTR
                     SIESWFNVKVEKALEGGLRLGQSALDIMLADIEQKSESMAINLAFQPSNTHLTVLNDL
                     REKSGIQDAVLLTLQGRILAFSSGDPSSFLPDLPSVPQLRQARQHVYGTIEPIPDKGL
                     YLRVLAPVNMPELAGETRILQLLQPVPKALSTTAESVQAVYQDYQELSLSRESLKEVF
                     SLTLTLVLMLAMLSAVSIAFVVSRRLSEPLAILAKGTEALARGDYTTVLPSHGKDELG
                     ILVQSFNTMTRQLGDATSAAERNRARVEAARGYLATILAHLSSGVLALNDRAELRTYN
                     LAASNILGVALADFAGQPLKLLAEKVPVLEDFAVSVLRHFHADELGEWQEQMEVVTTQ
                     GKRTILIRGTRLPDSADSGFLVVFDDITAMVQAQRDAAWGEVARRLAHEIKNPLTPIQ
                     LSAERLEHKLTSKLNADDAEMLRRATNTIVSQVSAMKTMVNEFSEYARAPAVNLTEVD
                     MNALIHDVIALYEPESIKLKLQLKRGAAKVLGDATMLRQVLHNLLQNAQDALTGREDA
                     QIIISTLIKNKDLILNVQDNGEGFPIDIISRVFEPYMTTKRHGTGLGLAIVKKIIEEH
                     KGSIKIENQPAGGAVVMVALPAFSPSKALKQVKS"
     CDS             177096..178379
                     /codon_start=1
                     /gene="ntrX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002224766.1"
                     /locus_tag="ZMTM_01630"
                     /product="Fis family transcriptional regulator"
                     /protein_id="BCM23904.1"
                     /transl_table=11
                     /translation="MTARQVLVVDDEIGIRELLHDILQDEGYQVKLAENAAEAREWRQ
                     HARPDLVLLDIWMPDCDGISLLKEWGTGGLLTMPVVMMSGHGTIDTAVEATRIGAFDF
                     LEKPIALQKLLKTVNAALKHGELLPKSEMSLLNLGKDTVITELKQRLSQVAQTKLPLL
                     LIGEKDSGAELCARFLHQPTTPWLVLTDHEKLAEAPIDLLEQYQDGLIFLPEVAVLNK
                     TEQKGLLLLISKAEKFGVRVVCGTAQALPQMAAEGIFDAQLLQVLSTTTLGVPRLEDH
                     REDIPDLARTLALQLAESNEAPYREFDVASLNALRNAAWPGNLVQLDSVIRNLMQTSL
                     GEKITLEDVNRVLEQFADAQLSADFVDAKQLANNLTINLDLPLREARDAFERLYFEHH
                     ISKVGRNMSRVADNVALERTHLYRKLKQLGIKIKA"
     CDS             complement(178387..179154)
                     /codon_start=1
                     /gene="xthA1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010946386.1"
                     /locus_tag="ZMTM_01640"
                     /product="exodeoxyribonuclease III"
                     /protein_id="BCM23905.1"
                     /transl_table=11
                     /translation="MLIATWNVNSLNVRLPHVLDWLNEHAVDVLCLQETKQENSKFPF
                     QALADAGYHAIHAGQKTYNGVAILSKHPIQEVSTAIPGFADEQKRVIAATINGVRIIC
                     AYIPNGQSLESDKYQYKLGWLKAFTEYLRSELALHPKLALLGDYNIAPEDRDVHDPKA
                     WEGQVLVSAPERQAFNDFLGLGLTDSFRLFEQAEASFSWWDYRMAGFRRNLGMRIDHI
                     LVSNELVANCKASWIDKAPRKLERPSDHTPVVLELEI"
     CDS             complement(179166..179708)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01650"
                     /product="hypothetical protein"
                     /protein_id="BCM23906.1"
                     /transl_table=11
                     /translation="MNLSLHSSVLTLSLCMTVLAASVSGICQAQVYKWKDAQGNMHYS
                     DTPPMDVKNIETKNVKANVVDTDAQPFATKLAAEKNPVSLYSFTGCGEPCTKAQAYLD
                     KRGIPYALKNTDEDKAALQKLTGSLQVPVLVVGSKIPKRGFLEESWASLLDEAGYPKD
                     NPLAAIKKPAKPVPAEAAPN"
     CDS             complement(179721..181769)
                     /codon_start=1
                     /gene="prlC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004191126.1"
                     /locus_tag="ZMTM_01660"
                     /product="oligopeptidase A"
                     /protein_id="BCM23907.1"
                     /transl_table=11
                     /translation="MSENQLLDNPLLDFSGLPKFDRVKAEHVTPAVDYLLSQGRELLE
                     TLSTSSIAPTWQNFAYPLEDFEEKLSRAWSQVSHMNSVVNSPELREAYNDNLSKLTAF
                     YADLSQDERLYKKFRDLKSSPEYSQLNTAQKKIIENELRDFRLGGAELPDAEKARFKV
                     IQEELSSLSAKFEENLLDTTNDFSLILKDASNLQGIPADVLQAAADAAKEEGKSGYKF
                     TLHFPSYMPVLQYADNRDLRATLYRAYATRASEFGKPEWDNTSLIKDILKLKQESAKL
                     LGFNNYAEVSLSTKMAGKPAEVTDFLDTLGKRAKPFALRDMQELKEYAANKLGLRELE
                     AWDIAYASEKLREEKYAFSDQEVKQYFPESQVLHGLFKVTETIFGVHVKKSQAPVWHA
                     DASFYEITDHQGKLVGQFYLDLYARNNKRGGAWMDEAITRRKKIDGLETPVAFLTCNF
                     SPPVGGKPALFTHDEVNTMFHEFGHGLHHLLTKVDEYGVSGIKGVEWDAVELPSQFME
                     NFCWEWEVLRHMTKHVETGAQLPRELFDKMVAAKNFQAGMQTMRQIEFSLFDIRLHGD
                     FDPNGPETALDLIEQVRDEVAVVRPPKWNRFPNNFSHIFAGGYAAGYYSYKWAEVLSA
                     DAYSLFEENGVLSQETGQRFWSEILAQGGSRPALDSFIAFRGREPSIDALLRHNGMTN
                     "
     CDS             complement(181843..182193)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037733.1"
                     /locus_tag="ZMTM_01670"
                     /product="membrane protein"
                     /protein_id="BCM23908.1"
                     /transl_table=11
                     /translation="MTDIDQSVASPTPDEKNLAVLAHIGGALFSFVPSLIIWLLKKDD
                     SAYISVASREALNFQITLLIAYAISWVLMFILVGFLVAGILWIANIVLCILAAVAASK
                     GEQYQYPFTLRLIN"
     CDS             complement(182206..183951)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63XV0"
                     /locus_tag="ZMTM_01680"
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="BCM23909.1"
                     /transl_table=11
                     /translation="MKPAFKVSFTMHGVGVSRGIAIGQAHLVSNALIEVVQYEVPNNL
                     IADEIKRLEKAFKVVKHDLETIRKELPSSGPAELSAFVSTHLMIMADHSLAETPKEII
                     KREQCNAEWALKQQMEEIVAQFDKIEDEYLRERKQDVVQVVERIIKVLLGHPSQVSIK
                     AQESAIILVAHDLSPADAIQFKQHQFAAFITDVGGATSHTAILARSMNIPSIVALQKS
                     RELIRDGELIIVDGSQGVVIVSPSSETLEEYKLRQEQWELEEQKLKRIKLNKAVTMDG
                     TAIELHANIEVPEDVVQVKAAGATGIGLYRTEFLFMNRREMPDEEEQFIAYRKVAKDM
                     KGLPVTIRTLDLGADKEMNSDVVRTCTNPALGLRAIRLCLSEPQIFMAQLRAILRASH
                     FGNIKILIPMLSSLNELRQSLQILERAKQSLRAEKLPFDEDIEVGGMIEVPAAALCAE
                     AFARELDFLSIGTNDLIQYSLAIDRTDDTVSHLYNPVHPAIMMLIEMTIRAGNKLGKP
                     VSVCGEMAGDEKLTRLLLGFGLRQFSMHPSNILSVKRQVLKSNLPDITSTARKILNNQ
                     DVDKIEPLLQKLNLQ"
     CDS             complement(183984..184256)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003686964.1"
                     /locus_tag="ZMTM_01690"
                     /product="phosphocarrier protein HPr"
                     /protein_id="BCM23910.1"
                     /transl_table=11
                     /translation="MIKQEIEIINKLGLHARASTKLTQTASQFDSCEIWIERNNRRVN
                     AKSIMGVMMLAASKGSKILLETDGKEERPAMDALVALINNRFGEPE"
     CDS             complement(184253..184657)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198014.1"
                     /locus_tag="ZMTM_01700"
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="BCM23911.1"
                     /transl_table=11
                     /translation="MIGILIISHGNLAESLIHCATHVMGKKPELLGQVGIGMHDDPAT
                     VLPDALQLVKDLDQGDGVLILSDIYGATPCNIVGKLLVPGRVEGVAGVNLPMLVRTLT
                     YRNGDLGKLVEKALSGGREGVFHFTEEACKQS"
     CDS             complement(184704..185534)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63XL1"
                     /locus_tag="ZMTM_01710"
                     /product="nucleotide-binding protein"
                     /protein_id="BCM23912.1"
                     /transl_table=11
                     /translation="MQLIIVTGLSGSGKSIVLKALEDSGYYCVDNLPATLLPEISQHL
                     GIAHHDRVAISIDTRTAALETLPENIQALKAQGIDVQLLFLDSNNETLVKRFSETRRR
                     HPLSNEEKTLAESIAHERELLSQLAELGHRMDTSNLSTNTLRSWVKDFVSMEESGLTL
                     MFASFGFKHGIPLDADFVFDVRCLPNPHYDPVLRPLTGKDEPVAKFLAEQEAVAAMYA
                     DIQGYVERWLPCFVRDNRSYLTVAIGCTGGQHRSVYFVEQLGKYFKNSYKVQIRHREL
                     "
     CDS             complement(185538..186500)
                     /codon_start=1
                     /gene="hprK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9K081"
                     /locus_tag="ZMTM_01720"
                     /product="HPr kinase/phosphorylase"
                     /protein_id="BCM23913.1"
                     /transl_table=11
                     /translation="MAEISVNQLYNDTRRNLKLTWVSGLDGGNNLLTSETVTKPSLAL
                     IGHLNFVHPNRVQVLGCAEMDYLRSLKSKELHQAIQNLFSTDLAAVVVANGEKPPKEL
                     NDASDQFQTPLFTSPLQSPGLMDVLSHYLAQAVAESTSAHGVFIEVQGFGILIKGSPA
                     IGKSELALELISRGHRLVADDIVDFFRIAPDRLEGRCPPLLQDFLEVRGLGILNIRAL
                     FGDNAVKPTKPLDLIIQLEMADLVMPEKLDRLKVKSHHEKILGVKIPKVMIPVAAGRN
                     IAVLVEVAVRNHMLLLRGINGTKQFMQRQHREINRSLRKAQATE"
     CDS             complement(186651..186977)
                     /codon_start=1
                     /gene="rpoN_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815178.1"
                     /locus_tag="ZMTM_01730"
                     /product="ribosomal subunit interface protein"
                     /protein_id="BCM23914.1"
                     /transl_table=11
                     /translation="MNLHLTGHHLEITPALRDYVQSKLARISNHFDHVIDVKVTFSVV
                     KLAQKVEATLHVPGNDLHAESSDENMYHAIDTLSDKLDRQVLKHKEKQGDHHKTNGAL
                     KHQATE"
     CDS             complement(187010..188452)
                     /codon_start=1
                     /gene="rpoN_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63XK7"
                     /locus_tag="ZMTM_01740"
                     /product="RNA polymerase sigma-54 factor"
                     /protein_id="BCM23915.1"
                     /transl_table=11
                     /translation="MKQSLQLKFSQHLALTPQLQQSIRLLQLSTQELNQELETLLQEN
                     PLLERTTNTDQPVDLEAEAFVPNNTVQETSIPATDEPARQEEYGDDYFEFSSGNRWED
                     NSAGNDDENDFSFQESVSLTLREHLISQLKLMQFSERDQTLAMLLVDTINDDGYLEQP
                     LEELLELLPDELEIDLLELQTALKHIQHLDPPGVGARSLAECLALQLQAMPEDTPHLG
                     LAINVALQHLPILASRDYAKLRKTLQCDDDVLRAVQLMVTQLNPRPGSDFTKIGSDHY
                     IQHEILVKKVKGLWIATLNDEVVPRLRINQLYAGILKRNRDSSSQYLMSQMQEAKWMI
                     KNIQQRFSTILRVSQAIVDRQRNFFEHGEVAMRPLVLREIADELGLHESTVSRVTTRK
                     YMLTPRGVYELKYFFGSHVSTESGGACSATAIRALIKQMVSEENAKKPLSDNQITDIL
                     SKQGIMVARRTIAKYRESLSIPAANQRKSI"
     CDS             complement(188476..189198)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195214.1"
                     /locus_tag="ZMTM_01750"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BCM23916.1"
                     /transl_table=11
                     /translation="MSELVVEGLRKKYKSRTVVQDISLHVNSGEVVGLLGPNGAGKTT
                     SFYMMVGLVSLDDGRILLDGKDLSRLPIHQRARLGLSYLPQEPSIFRKMTVAENIMAI
                     LELQKMSPQVMAERLEELLLELHIVHIRNNMAVSLSGGERRRVEIARCLATNPSFILL
                     DEPFAGIDPIAVLDIQKIIRFLSARNIGVLITDHNVRETLGICDRAYIVNDGRVFAAG
                     KPSEIIHNDSVREVYLGKDFRL"
     CDS             complement(189247..189789)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01760"
                     /product="hypothetical protein"
                     /protein_id="BCM23917.1"
                     /transl_table=11
                     /translation="MNKPHLSLSPTLLVASLFLLASSASFAEKADRQKPIDIEADTVT
                     VNDAKKTSTYTGNVILTQGTLEIRGDKLIVREDKDGFQHSTSTGMPSTFKQKMEGKAE
                     YMQGNGQRIEYDGRMDKVQLYTQASVKRGDDVIHGDYIMYDANAEYAEVLGGGSQVAT
                     PSAPNGRVRAVIQPKKPVTE"
     CDS             complement(189770..190570)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01770"
                     /product="hypothetical protein"
                     /protein_id="BCM23918.1"
                     /transl_table=11
                     /translation="MFGRATILFPLAVLGLLALVTFWIDRTVQPPVIKPDGSKRHDPD
                     YVLNNFNTVKTGINGSVQYILAATEMTHFPDDDSTKLERPHLTQYSSDKPYTQIESQR
                     GTVSSNGEIIEFMDNVKVLRQGYKERGDMTVTTEYLKVFPKTEIATSDKAVVIKQSPS
                     TELRGTGMIYNKKEKTLKLLKNVHVHYLRPGLADKAVADKAVLEAKQDNKVVVTKKAV
                     AKPQVKQAGTKPSTNKAKSNNNSNAQNNQAAPAQNKPRIRRQYEQATP"
     CDS             complement(190612..191139)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112742.1"
                     /locus_tag="ZMTM_01780"
                     /product="hypothetical protein"
                     /protein_id="BCM23919.1"
                     /transl_table=11
                     /translation="MNVEERAKRIKLIVFDIDGVMTNGGLMLGDDGLESKVFHSQDGL
                     GLKLLKNTGIQMGIVTGRTSQVVMKRAANIGIKPEYIYQGVEDKLEAFDDLIKKLNLS
                     YETSAFMGDDVIDLPPMRRAGLGVTVPHAMPLVKEHAHYITTREAGFGAVRELCELIM
                     KAQGTFDGQMAKFLK"
     CDS             complement(191143..192141)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195206.1"
                     /locus_tag="ZMTM_01790"
                     /product="arabinose-5-phosphate isomerase"
                     /protein_id="BCM23920.1"
                     /transl_table=11
                     /translation="METSELQKIGAVKAPVELAKEVLLIESREVEALAHRLDENFNRA
                     IALILQCRGRVVVTGMGKSGHIGNKIAATLASTGTPSFFMHPAEASHGDLGMITKEDV
                     VIAISNSGEADELLTIVPLIKRMGARLISITGNTKSTLSRASDVYLDAHVSQEACPLG
                     LSPTASTTAALALGDALAVVLLDQRGFSSDDYARSHPGGALGRRLLVLVKNVMRSGDA
                     VPSVSIQATVKDALLEMSQKGLGMTAIVDAEYKPLGVFTDGDLRRAFESGVNITECTV
                     NDVMRMKPLTILPDQLAVDAVEVMEKKKVTALLVVNAEGILVGALNMHDLLIAKVV"
     CDS             192329..194242
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195204.1"
                     /locus_tag="ZMTM_01800"
                     /product="potassium efflux system protein"
                     /protein_id="BCM23921.1"
                     /transl_table=11
                     /translation="MLAYFLVGFALGPKTFGLLPDTEANRSLAEFGIVFLMFSIGLEF
                     SLPQLYAMRKTVLGLGGTQVAITLLAVALVCNFIGLSWPAAFVIGGALAMSSTAIVSK
                     MLVEGLELNSRHGRLAIGVLLFQDLAVVPLLVLIPALANHTGTLGNILGVSLLKASVM
                     LVLLFSVGKFLINPWFNLVARQRSHELFVMNVLMVTLMLAYATKVAGLSYALGAFIAG
                     MLISETRYRYQVESDIAPFRDILLGLFFITVGMLLDLHALMSNIGWVFVVLVAFVIFK
                     ALLVAVLSRFFGAEAGVAIRTGVTLAQAGEFSFVILALGADNDVLGGQAFNVILAASL
                     LSMVIAPFIIKYNERIGEKFSRSYVKNREQQINNIEAAGKDFSDHVIICGFGRSGQYL
                     ARFLSEENIPFIALDVDPARVREAGAAGENVIYGDAGRRVVLDAAGAARAKALIISYN
                     DAPSAMKILHLVQDNYPGLPVIVRTVDDSNMEELRAAGATEVVPELLEGSLMLASHAL
                     VLLDVPLNRVVKRIRKFREERYKMFQGFFHGMSDIDQEATEKASQPRLYSVPIPASAY
                     CVGKRLKDIDFSKFTVEVKFIRRQTFKPFVPEPDFVFAEDDVVVLLGSQDSLVSAEKA
                     LLSRSRGLKSSAA"
     CDS             194251..195336
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P33642"
                     /locus_tag="ZMTM_01810"
                     /product="putative D-amino acid oxidase"
                     /protein_id="BCM23922.1"
                     /transl_table=11
                     /translation="MTSQHVVVVGGGIVGCMTAMELVARGCKVTIVERNQIASQTSGE
                     SSWAGAGILFPLLPWMYSDHVNALTMYGAHAYTEICQRLQQETGIDSHLEPSGMLLLP
                     NFDVPAALAWCDKNQLPFQPVKASAFDVQSLSGEEALWLPTVAQIRPPYLMLALRAWL
                     EQNSVTLLEHTELVPLKATSELNEWQTLNGETLKADQFIVTSGAWSFDLLKDTTEKLK
                     IKPMRGQILLYQPKKNLEQIVYREGFYMVPRRDGYLLAGSTLEDVGFDATTTEVVRDE
                     ITAKAEAIMPALKGMPIIKHWSGLRPGTPDNLPTISAHPQIKNLYLNTGHFRYGLTMA
                     PASAKLVAALVCGEKPWLDPEPFALSV"
     CDS             195968..196264
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003101499.1"
                     /locus_tag="ZMTM_01820"
                     /product="thiol reductase thioredoxin"
                     /protein_id="BCM23923.1"
                     /transl_table=11
                     /translation="MNELTIVEIEALDGATILEFGTDWCGYCKAAQPLIASALAERQD
                     VRHIKIEDGKGRRLGRLFKVKLWPTLVFLKNGQEVGRLIRPDSAVLISEALDKI"
     CDS             complement(196281..196760)
                     /codon_start=1
                     /gene="moaC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63WV5"
                     /locus_tag="ZMTM_01830"
                     /product="cyclic pyranopterin monophosphate synthase
                     accessory protein"
                     /protein_id="BCM23924.1"
                     /transl_table=11
                     /translation="MSTLTHFDSSGQAHMVDVGEKSETHRIAVAIGFIKMQPETLQLI
                     LKGDAKKGDVLGIARVAAIQGSKRTSDLIPLCHPISLTKVGVEFNIDEPNSTVKCTVT
                     AETVGRTGVEMEALTATSVALLTIYDMCKAVDRGMVITEIKLLEKQGGKSGSWKAAI"
     CDS             196849..198333
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003814201.1"
                     /locus_tag="ZMTM_01840"
                     /product="exported protein"
                     /protein_id="BCM23925.1"
                     /transl_table=11
                     /translation="MNAPHHIIYRLFLGAWLFLAPIGCLLPLAVADVSSDLPDLGDVS
                     ATVLSPLQEEKIGDQIMRSVMSSDDVVSDSEINDYVTDLGYKLVSNGPDRSQNFKFFV
                     VEDNSINAFAMPGAVIGVHTGLILAAENESQVAGVLGHEIGHVVQRHMARMLAQQKTD
                     SILNMASIAGALLLALANPQLSAGALTSATANSVQKQINFTRENEREADRVGLQIMAD
                     SGFDPHGMTDFFQILQKGTRFVEGTAPAFLRTHPLSTERIADVQGRVDQMASFRMVQD
                     NPDFYYVRVKLLANRNSPGQAVELFKNSIAEKKYNNEAAQHYGLAIALMRKNDLDGAT
                     KELTWLRANMPRHPMFETLAANILVARNQPAQAAKQYADALAMFPTHRALIYGYAEHY
                     LAINQTDNALKLIKEKQSFYPDDPYFYELMSRAYTMQGKDMLRHQTQGEAYVRRYDIP
                     KAIEQMDLASKAKDGDFYQQSIVEARLKELKLKLDEPKKSGWFS"
     CDS             198353..198796
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01850"
                     /product="hypothetical protein"
                     /protein_id="BCM23926.1"
                     /transl_table=11
                     /translation="MQRRSFIQLISLFAASLLLPIQAFAAVWNKAAFEATKAENTIQG
                     LGVPAQIPSSKDIEVIAPDRAENGAVVQIEITSRIPNTESIAIVVEHNPTPLIATFNF
                     TNGALPYVVTRIKMAETSDVQAIIKVGSQYFTAKKRVEVLENGCG"
     CDS             198783..199115
                     /codon_start=1
                     /gene="soxZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010932697.1"
                     /locus_tag="ZMTM_01860"
                     /product="thiosulfate oxidation carrier complex protein
                     SoxZ"
                     /protein_id="BCM23927.1"
                     /transl_table=11
                     /translation="MGAANMADDIKMRAQLKGDMVEVKVLIGHPMETGRRKNEAGEVI
                     SAHFVQLVTVTLNGKSVLEAQWGTGISKNPYLTFHLVGAKVGDIVAVTWHDNLGQSSS
                     QQIAVTQG"
     CDS             complement(199112..199618)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01870"
                     /product="hypothetical protein"
                     /protein_id="BCM23928.1"
                     /transl_table=11
                     /translation="MKQVSHIKHTTHPKSNIPRAKKSASGSGILLANWHLKTVYIGCL
                     WVSVSGLLWFVSHDILQAEPNDFQRWSLILHGAGSFIATMIFGSIAVQHLIMGWKMQR
                     NRISGITLISVFSALILTAFLLYYGSEEMHDYVRWTHIIIGILSFVILPLHIYLGRRS
                     RAKTVSAH"
     CDS             complement(199628..200452)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHX0"
                     /locus_tag="ZMTM_01880"
                     /product="FAD:protein FMN transferase"
                     /protein_id="BCM23929.1"
                     /transl_table=11
                     /translation="MKRVRPLLGTYVEIEASGLSEDKLQLGINAAFLAVCKVQQLMSV
                     HDQRSQLSRLNRHAFGRALQVHPWLFEVLQTAVKLHQKTRGHFDCTIAPALKRSGHLT
                     SKSLGKTRNGSSVDIDLKPFHRVRFTKHLGIDLGGIAKGFAVDKAIEILKKHGAKSAS
                     VNAGGDLRVYGEIASPIFLRKPENPAQLVKVGELQNGAIATSATYFSTRKVGQLTTSA
                     LINAKSKTQASLLTMHSYSVIAPSCMLADGLTKALAFSGHQSSAYMRKYKAHSLIL"
     CDS             complement(200449..200976)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01890"
                     /product="hypothetical protein"
                     /protein_id="BCM23930.1"
                     /transl_table=11
                     /translation="MKWSPYAFMPVAAIIAPSAYANIYLSPEQAQKAIFADSKLTPVS
                     IQLTDAQRSIMQDKSSVHEAFKTDRIWRTPDGSYFVIDEVIGKHEFIKYAVGINANGT
                     VRQVEVMEYNESYGYEVRDESWRQQFVGKTADSEIKLNKDIKNVSGATLSCKHITDGV
                     KRVMVMYDLVLKPLK"
     CDS             201101..202033
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01900"
                     /product="hypothetical protein"
                     /protein_id="BCM23931.1"
                     /transl_table=11
                     /translation="MAFLANTKVKLASLLAALLIFSTPFAYAGEGVFGWVYTLDIQPK
                     GKWEFEQKVDRSVGQASGSYALDQFRSEIEYGLTDDIQIAAYVNMFNVHANRNYINPD
                     FCPNVNPCTAGFGVPGSYNDTAQGYNSFGGVDGYSGEIIWRITNPLTSPVGVGIYFEP
                     TIGKLQDSIEARLMLQSNFLDDKLILAGNLSFEAEKEHYTPGEDEIIRQSHTDILYGA
                     SYRFAPNWSGGLEGRLHNDFYGYHLDEHIQFANFIGPNVHYAAKDFWVTAAWRYQIHG
                     VCMGAGTGDCNSVYDKVSDDHGRNQFIVRVGVPF"
     CDS             complement(202104..203732)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003402342.1"
                     /locus_tag="ZMTM_01910"
                     /product="hypothetical protein"
                     /protein_id="BCM23932.1"
                     /transl_table=11
                     /translation="MLRLTEIKLPLEHAKDIAHTPSEIKAAIFKKLGIAEEELVRFEI
                     FKRGVDARKSHAILFVYTLDIEVKNEAKVLAKFKRDPHVKPAPDIGYHFVAQAPLNIS
                     KRPVVIGFGPAGIFAALILAQSGFKPIVLERGKEVRERTKDTWGLWRKSVLNPESNVQ
                     FGEGGAGTFSDGKLYSQIKDPKHYGRKVLNEFVKAGAPEEILYVSHPHIGTFRLVGMV
                     EQMRNTITALGGEIRFQSRVDDIEVENNQVQGVVLANGERIETNHLVLAVGHSARDTF
                     EMIHKRGIYIEAKPFSIGFRIEHPQSLIDHARYGQNAANPILGAADYKLVHHAQNGRS
                     VYSFCMCPGGTVVAAASEEGRVVTNGMSQYSRNERNANAGIVVGISPEQDYPGDPLAG
                     MALQRHWESQAYKLGGSNYKAPGQLIGDFIAAKPSTEFGSVQPSYTPGVHLTDLSTVL
                     PEYAITAIREALPAFGKQIKGFDLPDGVLTGVETRTSSPIRIKRNDDDLQSVNTRGLY
                     PTGEGAGYAGGILSAAVDGIKIAEALAIDMASKS"
     CDS             complement(203733..204353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015039150.1"
                     /locus_tag="ZMTM_01920"
                     /product="DnaA regulatory inactivator Hda"
                     /protein_id="BCM23933.1"
                     /transl_table=11
                     /translation="MKQLLLDIQPPALPSLDNFVIGRNAEALHSLKAAINGGSQRFIY
                     LWGAAGSGKTHLLSSATELARVAGLNLVCADNVHQLSDEAQISLFNSYNQLRESGGLL
                     IASGIAAPTQMGLRDDLATRLAWGLTYQLHPLTDDEKAQALRTHAKERGMHLPDEVID
                     YCLRYLRRDLPNLMATLNALDVWSLTTKKPVTVPMLKKLLQLPLEI"
     CDS             complement(204394..205476)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005616381.1"
                     /locus_tag="ZMTM_01930"
                     /product="AI-2E family transporter"
                     /protein_id="BCM23934.1"
                     /transl_table=11
                     /translation="MTAKRENVLPDYRIILLVALALFIAYRLLPIISPFLIAAIFAYI
                     CNPLVDRISAFKLGKLTIGRTVATMLVMLLLLTGLIGVILVIVPMLQKELFLVIQKLP
                     NYINTLRTQLDPWLFQHFGIGLEIDSGKVQEVFTKNWKSATDYASRALLIISTHGLAF
                     IGWMVNLLLIPVVLFYLLRDWHQLIERIAVLLPRRHLAKTLEISMEIDAVLAEFLRGQ
                     LSVMILMGIFYAAGLGFAGLELAIPIGLIAGLLGFVPYLGPTTGILLAMLAAILQFNN
                     LGDLVPVAAVFAIGQAIESMLLTPWLVGDRIGLHPVVVIFALLAGGELFGFSGILLAL
                     PVGAAIAVLVRHAKKKYVASDAYLKN"
     CDS             205583..206602
                     /codon_start=1
                     /gene="purM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HE4"
                     /locus_tag="ZMTM_01940"
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="BCM23935.1"
                     /transl_table=11
                     /translation="MSYRDAGVDMEAGDALVEQIKPYAKRTMRPEVLGGIGGFGSLFE
                     VPKKFKNPVLVSGTDGVGTKLKLAFQLNKHDTVGIDLVAMSVNDILVQGAEPLFFLDY
                     FACGKLEVGTAAQVIKGIAAGCEQAGCALVGGETAEMPGMYPAGEYDLAGFAVGAVDK
                     EAIINGTTISEGDVVLGLASSGAHSNGYSLIRKLIEQSAISWDSDFHGKPFRDVVMAP
                     TRIYVKPLLKLLATLPVKGMAHITGGGITENIPRVLPEGLTAEIKKSSWQLPALFSWL
                     QAQGNVTDDEMYRTFNCGIGMAVIVSAEHAAQAQALLSAEGEQVFTIGHIRRSGAGEH
                     ATVVI"
     CDS             206665..207396
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01950"
                     /product="hypothetical protein"
                     /protein_id="BCM23936.1"
                     /transl_table=11
                     /translation="MKMPSIMRLNNSFKALIWVLISSFGLAGVAQAAPPTKISLEYMA
                     TRDGKPFANVTESYKQEDGRYKIESVTSGIGVFALLGKRVMTSEGEVTTQGLKPSHFE
                     LRQGDNPKKALISDFDWSASTLNLQIKGEASSSPLDKGAQDLASFPYQFMFSPPKADD
                     FYLAVNSGRKLGNNHYKVTERGAVIEIDGKKYKALHLVDASEDAKDGKELWLGVAQYN
                     LPIKLVLKDETGATIEQTLTSIHAE"
     CDS             207386..208447
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01960"
                     /product="hypothetical protein"
                     /protein_id="BCM23937.1"
                     /transl_table=11
                     /translation="MLSNTFAKLRRFGSWRYVVALVLSVLLHFVLIAGASWHFPVSDT
                     DDDTIEVALVPQQLVEKPAVKPVAVKPKAQSSKVPKPTPPTEAAPENKVADQVAVNAV
                     DGITKQAEPTEASDASTEALPDQIAGQPEPLNEAAAWTPKSNFLEMEYDVFRGVGGMK
                     IGVTRVNYKSGADGSYSLKSETEAKGLATLILSDNLVQVSEGLVTDKGLQPAEFSYQF
                     ARKSRQAKFDWQSALLTQQTNKEETTVPLPAGTQDILSFMFQFMFVPPLQEMELNITN
                     GRKLNHYNYGFEGEETINSKLGDIRTLHISRTGQEDAKDDLWLAIDKEYLPIKIRKTE
                     KDGSVIEQIVTRINTDITQ"
     CDS             208444..209721
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004186079.1"
                     /locus_tag="ZMTM_01970"
                     /product="SAM-dependent methyltransferase"
                     /protein_id="BCM23938.1"
                     /transl_table=11
                     /translation="MSTIKPTNVINPNLLRLASMALADVLTGTGPADAKLGWFFKQNR
                     ELGTKDRAFVAESVYGVLRRKSFLAFVSDGEDPRKLLLAWLLRVQGMSMRDLDESLNK
                     QQKEWAQEIKAKTPDPANAAMQADMPEWLWETLTKQYGEAEALVIARSMHLPAPLDLR
                     ANLVKATREDVVAKFASENTEVALTPYSPNGLRMAEKVTISRHKLFTDGKIEVQDEGS
                     QLLAQLVAPRRGEMIADFCAGAGGKSLAIGALMRNTGRIYAFDVSEKRLQNLGVRLKR
                     SGLSNLHSQLITSEQDPKLKRLNGKFDRVLVDAPCSGLGTLRRNPDLKWRQTPQDIIE
                     LTAKQTRILTRAAKLVKAGGRLIYATCSLLQEENEQIAEAFLVANVDYKLVPANEILA
                     QQQIELDTGKYLKLLPHLHQTDGFFAAVFERTA"
     CDS             complement(209731..210567)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_01980"
                     /product="hypothetical protein"
                     /protein_id="BCM23939.1"
                     /transl_table=11
                     /translation="MSSEPQKLAPHDLNTWVTFLSSAEIPVLKHTAREMDRLKLDEDN
                     LTARAIASVVNHDPMMAFRVLRHMQTHKNKHQLQDLVLVEQAIMMMGMNSFFRDLPTQ
                     PVVQDTLKHNLPALTHLLRLIHRSNRAAHYAFEWGILLRDLRVEETRIAALLHDLVEI
                     LMWCFAPDNMMKIFELQHADKTLRSAKVQEDVFGFRLAELQLLLIDSCNLPPLLSKLM
                     DDTSSKDQQVKSVSLAANLARHSANGWQDAALPDDYAELAQLLRVDVAKAKHIAITEP
                     EK"
     CDS             210756..211991
                     /codon_start=1
                     /gene="glt-4"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207754.1"
                     /locus_tag="ZMTM_01990"
                     /product="glutamate:proton symporter"
                     /protein_id="BCM23940.1"
                     /transl_table=11
                     /translation="MKFPSLNSQILLGAILGIAIGIYFHALGQDSEPAQAGLYVSGLV
                     GGVFVDLLKMVLVPLVFSSITVGIANLQKHHQAQRVWKITLAFFLFSMTVAIIVGLSA
                     ANIFKPGAGLHLGLFADAMQAFEAKQMSLGEFFAHFLHGLFVNPVSAMAQGNILPVVV
                     FALFVGVAIVVGGERYRNILNLLQELFELTMRIVSWIMLLSPFGIMALLIKLVATQDV
                     ALLGSVGKFIAVIIGTTLLHGVVILPLILYLITKMTPLTFWKGARDALITAFATSSSS
                     ATMPVTLRCVEEQLKVPREIASFVIPFGATVNMDGTALYEAAAALFIANLAGVELNLV
                     QQMIVFFTAMIAAMGAPGIPSAGMVTMVMVLQSVGLPAEAIAILLPIDRLLDTVRTAV
                     NVEGDMVGSIVVHKLVGRA"
     CDS             212040..212564
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027568.1"
                     /locus_tag="ZMTM_02000"
                     /product="N-acetyltransferase"
                     /protein_id="BCM23941.1"
                     /transl_table=11
                     /translation="MLKFTFRWAVSEEAIAVSNMINDSYRGEQSKLGWTTEAHLLDGL
                     RTTPQEILDLINRVDSIILLCHCESELVGSVHLEKHADTAYLGMFVVRPTLQAQGIGK
                     QLLQAAESEAKVQWGATKSAISVISARDELLQFYERRGYIRTGELNNFPVNPAMWQPK
                     IQNLQLALLEKQLR"
     CDS             212779..213750
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813145.1"
                     /locus_tag="ZMTM_02010"
                     /product="multidrug DMT transporter permease"
                     /protein_id="BCM23942.1"
                     /transl_table=11
                     /translation="MATKTPEQNTKNHQARHLLIGTLMVLVAAVALSSKAIIVKLAYV
                     YPVDATTLIALRLAFSAPFFVALAVWARLSESTPAISKHDAWAIVILGVVGGYAPMWL
                     DFSGLVYVTAGLERIILFLYPTMVVVISAVLFKQRIGRREIFALVASYIGVGLAVGHD
                     FTLLKSGVGDTLLGASLVFASSLVYAGYLVYSGRIIPRIGPASFTAYNMLAATVASGV
                     HFALSQDVSVLFHLPAQVYWLSLLMAVVATVLPAILLSVGIHRIGSSKASLVSSVGPV
                     STILLAYVFLGEGITWLQIAGTLLVLIGVLAITVNAKKAVEVEAEVI"
     CDS             complement(213743..214282)
                     /codon_start=1
                     /gene="ampD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004194313.1"
                     /locus_tag="ZMTM_02020"
                     /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
                     /protein_id="BCM23943.1"
                     /transl_table=11
                     /translation="MNNLQIDQDGLASNVSFIHSPNQDARPAGHDIKLIVIHNISLPP
                     NEYGSNGVIELFTNQLDPDAHPYYAEIHQLKVSSHFFIRRDGSVIQFVPCTQRAWHAG
                     ASNWQGQERCNDFSIGIELEGSDFEAFESPQYVAVNKLVTAIKQAYPIEDIVGHSDIA
                     PSRKTDPGPYFDWSQVDTK"
     CDS             214357..215358
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005816877.1"
                     /locus_tag="ZMTM_02030"
                     /product="membrane protein"
                     /protein_id="BCM23944.1"
                     /transl_table=11
                     /translation="MVFLELFFMLVVILIAAEVFTNALEHLGEKLKISEGVTGSLFAA
                     VGTALPETSVPLLALLAGTNNAHTNEEIGVGAILGAPLMLATLSISLLAFAVLKKRGF
                     KGTFIPENTGLIRDLNFFIIAFVFAAIALFIPHEIKAVRYGIGFCMVMIYFIYIMLTL
                     RASSALVEEGHATEAESPMFICRIGLPNNMAVVLLQLFLGLALLIAGAKGFISGIDEA
                     AQIIGLSALVLSLLIIPIATELPEKVNSILWIRKGKDTLAFGNITGALVFQGTLLPAI
                     GIMLTPWAPRLEVLSGVVITLLGVIWLRVMAGRGQLKVWHVWVNGLLYLTYLAIVLS"
     CDS             complement(215374..216720)
                     /codon_start=1
                     /gene="pilR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010946908.1"
                     /locus_tag="ZMTM_02040"
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="BCM23945.1"
                     /transl_table=11
                     /translation="MTIKPSCLVVDDETDLRELIVLTLQRMGIHADSASDLDDAKYLL
                     KRNSYALCLTDMRLPDGNGLDLVRHINQHYAGLPVAVITAYGSADNAVSALKAGAFDY
                     LTKPISLQQLRPLVQAALRLSKSEPSNSSELTLLGNSAKIQHIRTTIEKLSRSQAPVH
                     IKGAVGTGKALAAELIHMNSTREHAPFISLNCSAVDTDAIEALLFGCKKESEQEKTGL
                     FHEANGGTLFIDEVTEIPLVTQVKLLRAIQDKKITKLGSSDEDTIDVRLITATSQNMQ
                     AAMDNGLFRQDLYYRLNVIELIMPALTEIAEDIPLIASHLLEKRCKALNVIIPSFDSQ
                     ALQALSQYKFPGNVRELENILERALTLCTHNKISVSDLSLPKPEKSKSTGLEANPDGL
                     PDIALPDYLETIEKQAIINALEKTGQNKTAAAKLLGVSFRTLRYRLSKLGLSKDQD"
     CDS             complement(216710..218332)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003403505.1"
                     /locus_tag="ZMTM_02050"
                     /product="PAS domain-containing sensor histidine kinase"
                     /protein_id="BCM23946.1"
                     /transl_table=11
                     /translation="MMSWTLSINNPIPERSPNQMITYWRSMGLFNIYRLLIALLLIVA
                     YQVISEAFWLDNYDRKLFFEFAYGYLFVSFITIGLTTIKWPDFNLQLSLHVMTDILFI
                     VVLMFASGGIKSGLGLLLIVAIAAASLISQGRLALFYASIATIALLLEQSYQMISWTE
                     HYDDYSHAVMLSLSCFATAWLAHSLAKRANLSEALASQRGIDLENLAQINKLITQEIE
                     DGILVVDQGFKIRHRNQHAKELLGINADTWLADSLEDCAPELNQRLRLWMEKEDITDP
                     DAMKISTAGRELKLRFMPVGDDRHEGAVIFIQDWSQIEVQAQQLKLAALGRLTANIAH
                     EIRNPLSAISHANQLMQEEEQQDPATKRLLEIIADNVRRLDHIVSDVLELNRRDRTRQ
                     ETIQLDDFLQEFHDQFCQIEKIAPDYFKLEMNGISTSILFDRRHLHQILWNLCRNGWR
                     HSSQTKSCLSLTLNKKRYTKNMRLEIIDDGPGVSKEAIAHLFEPFFTTETTGTGLGLY
                     IARELCEANAASIQYQPSSPGSLFSIELKNDH"
     CDS             complement(218329..218547)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02060"
                     /product="hypothetical protein"
                     /protein_id="BCM23947.1"
                     /transl_table=11
                     /translation="MLKILFLALAVWIVISILKSYSRNVDSEVKKPVKPESMVQCSEC
                     GVHSPTSDSVSEQGKYYCSVEHSKLRKP"
     CDS             218769..219359
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204054.1"
                     /locus_tag="ZMTM_02070"
                     /product="RNA polymerase sigma factor"
                     /protein_id="BCM23948.1"
                     /transl_table=11
                     /translation="MATAEELSEFLAQVERRAFKQTAYAVRDDHVAMDIVQDSMLKLA
                     EKYAKQPASEYPMLFQRILQNTMRDYWRRQKVRNLWTTLLSSFSGGEDEGDERDPLET
                     LQSDDEQHQPQAQLESRQTITLIEQAIKTLPTRQREAFMMRYWEELDVAETAKAMGCS
                     QGSVKTHCSRAVHALAKIMESQGFSKQELGKFGGER"
     CDS             219356..219742
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02080"
                     /product="hypothetical protein"
                     /protein_id="BCM23949.1"
                     /transl_table=11
                     /translation="MNQEHDTAKQIIHLLNDNLASMDAATVNKLAQARQRAVSAHALS
                     TQSLTDLQQGGVLRLFGSYFHHPAFSAALLCCLVLLTVLTVQQFSAPSNEQDIEQSDG
                     FLLASDLPPEAYVDRGFDQWLEKTSF"
     CDS             219718..220167
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02090"
                     /product="hypothetical protein"
                     /protein_id="BCM23950.1"
                     /transl_table=11
                     /translation="MVRKNLFLAFAFSICFFSGFAHAKGNVTNDPSWNRLTEDQRKVL
                     SPLSSEWDTLRPWQREKMLDIAHDYPKMNAEQQERVQRRLNKWSRMTPYERENARKKY
                     QAMKELPPEKKEALKQKWHEYENLPEEQRDQLRQSHQDAHPPQKSAQ"
     CDS             complement(220652..221722)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004552347.1"
                     /locus_tag="ZMTM_02100"
                     /product="LPS export ABC transporter permease LptG"
                     /protein_id="BCM23951.1"
                     /transl_table=11
                     /translation="MKLINRYLSQEIISSIMLIMIALLAMFSFFDLIQELENVGKGTY
                     GISKVMLFVLLSIPGHVYEVVPVAVLVGTMYALSQLARHSELIILRVSGISLASLTFS
                     LLRIGLIFALVTFIVGELVTPYSEKTAQRLRIQATDSVVAQDFRSGLWVKDGNSFVNV
                     EDVLPDASLLNIHIYEFDPEFHLRTISTAKSGRFEDQQWSLKEVSQINFEHEKVVSNF
                     FPEARWQSLIRPELLNVLLVVPEKMSAWNLYSYIHHLSANKQKTSRHEVALWAKMVYP
                     IACLVMVVLALPFGFVQQRSGGASAKIFSGIMLGISYQVLNRVFVHLGLLNDWSALLS
                     AVVPTLIYLIAGLMMLFWVERS"
     CDS             complement(221752..222852)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192178.1"
                     /locus_tag="ZMTM_02110"
                     /product="LPS export ABC transporter permease LptF"
                     /protein_id="BCM23952.1"
                     /transl_table=11
                     /translation="MLFKRSLIQELMTTAIGAFLILVGIVIAQRIAYYIGIAAKGSLA
                     SDAINTLLGFSLLKFLPMLLSLTLFLAVLLTLTRWHRDSEMVVWFSSGVGISSWVKPV
                     LTFSLPVIIVITVLSLFVMPWATHKSQDFKDELKSRDELSSISPGVFKESGTADRVFF
                     IESFDQLGNVVKNIFVQTMQHQRLGIVVANLGHRETEANGDNFLVMQSGRRYEGKPST
                     AEFTTTEFERYAIRIEPVEVQQTPISPQAVESLELLSNRTPENNAELQWRLAIPISSF
                     LLVLLAIPLSFVDPRSGRSANLMMAILIYIIYSNLLSIMQAWLAQGKLNPTVGLWPVH
                     AVFLLLTVYLFYRRLFMLPIIPSLTIPKRWRA"
     CDS             223016..224521
                     /codon_start=1
                     /gene="pepA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63WC3"
                     /locus_tag="ZMTM_02120"
                     /product="putative cytosol aminopeptidase"
                     /protein_id="BCM23953.1"
                     /transl_table=11
                     /translation="MEFSIKNGNPEKQRSDAIVIGVFESGKLSAAATAVDEASDGYIK
                     AIVATGDMEGKLGSTLLLHKVPGTAASRVLLVGLGKEKEFKEREYRQAVRASIKGLAT
                     SGGSNVTTYIAELAVKKHGADWRVAQLVEVVQDALYKFDQTKGKADKESKAKNAKAIK
                     KLVINIPLADTKKAEQGLKQGLALASGVSFTKDLGNLAPNYCTPTYLAEQALALGKAY
                     KMQVEVLDRPELEKLGMGSFLGVAQGSVEPPKFIVLQHNKGKKGQKPVVLVGKGITFD
                     TGGISLKPGADMDEMKYDMCGAASVLGTFKAIAEMGLPLNVVGLIPTCENMPDAEAIK
                     PGDILTSMSGQTIEVLNTDAEGRLILCDALTYAERFDPAAVVDIATLTGACVIALGHH
                     ASGLFSNKDALAAELLEAGELALDRAWHMPMWDDYQSQLDSNFADIANIGGRAGGSIT
                     AACFLSRFTKKYDWAHLDIAGTAWKSGKEKGGTGRPVPLLTKFLIGRAEKA"
     CDS             224556..224999
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004193228.1"
                     /locus_tag="ZMTM_02130"
                     /product="DNA polymerase III subunit chi"
                     /protein_id="BCM23954.1"
                     /transl_table=11
                     /translation="MTRIEFFFNVEHKLQKVADFSEKAIAKGRRLMILSESADSTAAI
                     EKYLWTYSALSFLPSCRADHPLATDTPVIIDHQVVNDPSIQLLHDDVLINMQCSQPPF
                     FSRFRRLIEIVGIDEEDKAQARLRFKFYRDRGYEIRTFDASGAAL"
     CDS             224996..225451
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02140"
                     /product="hypothetical protein"
                     /protein_id="BCM23955.1"
                     /transl_table=11
                     /translation="MSNQPTQDKNTLAQVLGKINALSQKKTAAALPVVSPLEIEKPQA
                     AIPVLTEVYSGDIVHGYQAVEAIPVLSIYESDAESLSPEDFSSFSSNKKMREQLIKKI
                     MAEMQPMIDSAVKEALIHELAIAEVRLLSTLEKDLNALLRLRLESLVKP"
     CDS             complement(225485..225865)
                     /codon_start=1
                     /gene="gcvH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A1JPN4"
                     /locus_tag="ZMTM_02150"
                     /product="glycine cleavage system H protein"
                     /protein_id="BCM23956.1"
                     /transl_table=11
                     /translation="MKIPAELKYTAEHLWVKAQDDGTYLAGITDYAQDLLGDIVYVEA
                     PAVGTELSAGKPCGLVESVKTGSDLHAPVSGAVIAINEELQGTPELINENTYEAWIFK
                     LTPSSPNEINDLLDAEAYQKILGE"
     CDS             226070..227221
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02160"
                     /product="hypothetical protein"
                     /protein_id="BCM23957.1"
                     /transl_table=11
                     /translation="MLRNLVGNIIVLSTMLILALPASTFAAVTATEAGSKKASKQTAA
                     TKKVAKKTSKTNLASNTPAQQKTRQLKSNQKLSSSRIIRTIQADRKYQVQNVTYHPDS
                     THSGFSRGGIDHNSVVRESVFEDQPGSMPKLASSKALIVNQETGEILYAKNIDQQTPI
                     ASVTKLMTAMVMLDANLPMDEYLTINESDIDLLKGTSSRLRMGTVLSRAELLQLAIMS
                     SENRAASALGRNYPGGVNAFVNAMNVKAHMLGMTHSHFADPTGLNSDNYSTAEDLVRM
                     VRAAYQYPQIRQVSTTASQQVAINGLRNPMNFMNTNVLVRNSDWVIGLSKTGYISEAG
                     RCLVMQAEIGGQPMIIVLLDSEGKNSRIGDAQRIRKWIESSSGMKPRFG"
     CDS             complement(227282..229870)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02170"
                     /product="hypothetical protein"
                     /protein_id="BCM23958.1"
                     /transl_table=11
                     /translation="MSKLLIVESPSKAKTLKKYLGKDFEVLASYGHVRDLIPKTGAVD
                     TDNDYAMKYELIERNAKHVDAIAKAAKVADAIYLATDPDREGEAISWHIAEILKTKKL
                     LKDKILKRVVFHEITKSAVEHAIANPRDIAMPLVNAQQARRALDYLVGFNLSPLLWKK
                     IRRGLSAGRVQSPALRLIVERELEIEAFKSQEYWTIHLESRKHQHAFDAKLVQLDGKK
                     VEQFTITNQGQEEAVVGKLLLASAGKTTVTRVEKKQKNRSPAAPFTTSTLQQEAVRKL
                     GFTTSRAMRIAQQLYEGIDVGGGAVGLITYMRTDSFSIATEAVMQIRDYIKKNFDGEY
                     LPKAPIMYKTKAKNAQEAHEAIRPTDITRSPASLSHVLTPEQFKLYEMIWKRALACQM
                     APARFDAVSVDLAIGSEANLFRATGQTMIFPGFIAVYMESVDDAEEEGESKLPVLETG
                     EILDVNKIFGDQHFTEPPPRYSEASLVKVLEEYGIGRPSTYASIISTLQDREYVLLDK
                     KRFTPTDVGRVVNKFLTEHFTKYVDYDFTANLENELDDIAEGAREWLPVLDAFWQGFN
                     TQIVAKKDVERPGTELIDEACPKCGKPLSKQLSRYGSFIGCTGYNDTPKCDYKRSMNG
                     DGAAMGSEPVKIGVDTESGKDILLLVGPYGPYLQLGLPEEDAKKKPKRVSIPKDIALA
                     DVNLEVASKLIALPRDLGQHPETNKKIVANIGRFGPYVNHDGKFKSIPRTDSVFDIDQ
                     ARAVELLAQANTGPAPIRELGKHPTEDGDIAIYSGKFGPYVQHLKLRATLPKSVEPES
                     ITLEEALELLSAKAAKEAENPSKKTRSRAGAKKVASKSAPAKKVAAKKPTAAKKAASK
                     KIAAVA"
     CDS             230024..230422
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02180"
                     /product="hypothetical protein"
                     /protein_id="BCM23959.1"
                     /transl_table=11
                     /translation="MYKALKTPFRVVSFAAAGLTLLLSGCATPKMPDIKVWPFGDSDV
                     EVDRTTPENSTKYVCDAGRKLYVRTLNNGESVWLILTDRQFGLDKVASDTGKRYSNGN
                     SVLNINGDEATFDDGPTTAYKNCKVVEVKK"
     CDS             230453..232306
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012545101.1"
                     /locus_tag="ZMTM_02190"
                     /product="adenylate/guanylate cyclase domain-containing
                     protein"
                     /protein_id="BCM23960.1"
                     /transl_table=11
                     /translation="MLKHSAQYKYTGLALFVSLLLVIELAWLHVLQPMENRVADAMLA
                     RHALKSAPDKDIIIVDIDERSLDLMADSVGRWPWPRSLHAELVEGIEKQHPKAIVFDV
                     LFSDPDLTRPSDDAYFAETVQAQSNLYFPMLLLNPTANGIPLAQYAEALGITKTAVAE
                     PQASVSMVLPLPAMIKSTSLGTHNVLADRDGVVRSYLVYSDVAGWHIPSLPAKVATGL
                     GYGLPNTNNIVLNWHGRALSYQRVSYADIYNDLQRKTPQRASDEFKDKIVIVGATATG
                     LHDVRATPVDGFYTGVEILATAIDNLKNADALRPVCKWLIAVLGVLLIGLLGWAFTRA
                     CKLLIIGVALAGVTIALIFAAYSALNWLWLFTILTPLLFAWVYYLIAALMEYLKERKT
                     RELAIATFSRFLDPRVVQALVSRGETMESMSGKSSEITVLFSDIRGFTTLSENSTPEQ
                     VVELLNAYFSQQSAAVFAHEGTLDKYIGDAIMAFWGAPTSQPDHALKAVAGALAMSEQ
                     LEVFRQQYGALAKDIEIGIGVHSGQAVVGFIGSENRQDYTAIGDTVNLSSRIEGLTKG
                     IARVLVSQETRDLCIKQSGDAACPFAFIDCGSHAVKGRAQPVQLYEPIKKS"
     CDS             232353..232919
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02200"
                     /product="hypothetical protein"
                     /protein_id="BCM23961.1"
                     /transl_table=11
                     /translation="MKIFKLFTAALLFSSLTAYAAEDPATTLISTDLKQEPFIDAQVI
                     INLPVNTSVTVLKRQAGWVQVKSSGGAQGWLKMTSIKLGSGGASGKGDNGIMSLFNVA
                     RSGRSGNNGVVVTTGVRGLTPEELNNASPNAAEVKKMDNFPKGKKEADTFASAGKLQS
                     QQVDYLAASQPTSTPTQTSKPFVNGGHK"
     CDS             232916..233776
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02210"
                     /product="hypothetical protein"
                     /protein_id="BCM23962.1"
                     /transl_table=11
                     /translation="MNKAIQHLSLCIALSISFNAYAFDLNLNNLNVDKLISIAKKTQD
                     LKPVDEKAEFEIGSGVAANLLGAAPLVKDEKLQAYVNRLGWWLALQTERPDIPWHFGV
                     LDSDGINAFAAPGGYVFITRGLLLHLRSEAELAGVLSHEISHVLKKHHLMAIQKSAQT
                     GIMADVASMAVEGNQNSELAKKAIGAGTELYSRGLDKDDEFEADRMGVVIAARAGYDP
                     YGLPAVLQTLEAMNADDSNLALMFKTHPAPQKRLELLDAAMTGTLERYATQVEGEERF
                     VKVVGDYAKK"
     CDS             234151..234456
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02220"
                     /product="hypothetical protein"
                     /protein_id="BCM23963.1"
                     /transl_table=11
                     /translation="MSVKAHNAVLDRTVRGLYFHHFHQVLGTRVSCRVRPLISLPVEF
                     NSILNLMNLGSIGGDSLVYRYNRASDSHLDSLWVILFYKRYLVLVETRSKKGRKKSA"
     CDS             complement(234847..235767)
                     /codon_start=1
                     /gene="ttcA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E590"
                     /locus_tag="ZMTM_02230"
                     /product="tRNA 2-thiocytidine biosynthesis protein TtcA"
                     /protein_id="BCM23964.1"
                     /transl_table=11
                     /translation="MPSMIKHLPDNASGNFVRLRNSLISATGKAIGDYNMIEGGDTVL
                     VCMSGGKDSHAMLMILLALQERAPIDFKLMAMNLDQKQPGFPADILPAYLEKLGVDYR
                     IVEADTYSIVKEKIPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVETLF
                     LNMFFGAKLKAMPPKLATNDKQNIVIRPLAYCSEKDIASYARQMEFPIIPCDLCGSQE
                     NLQRQKVKDMLQGWEREQPGRINNIFRAITNVEPSHLADTELYDFKGLTQAQPEDEDP
                     LFGDIAEKESPALSLANSEGTRIEFKRNIA"
     CDS             complement(235769..236521)
                     /codon_start=1
                     /gene="ptr1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038530.1"
                     /locus_tag="ZMTM_02240"
                     /product="pteridine reductase"
                     /protein_id="BCM23965.1"
                     /transl_table=11
                     /translation="MNNNLQDKVILITGGAKRVGAAICRLLHADGANLMIHYRTSVHE
                     ARALQSELNLQRPNSVAIIQGDLLNLAVSPSLITETVSRFGKLDVLINNASTYYPTEL
                     GQIGEQEWEDLTGSNLKAPLFLSQSAAPELRKTNGCIVNITDMHVERPKKGYIVYSVA
                     KAGLVTLTKSLAHELAPEVRVNAVAPGPVLWPEDNPQFDEVYRQRVISQTLLKRIGEG
                     NDVAKAVRFLIQDAPFITGQIIAVDGGRSLNL"
     CDS             236627..237796
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189567.1"
                     /locus_tag="ZMTM_02250"
                     /product="SAM-dependent methyltransferase"
                     /protein_id="BCM23966.1"
                     /transl_table=11
                     /translation="MNTSLPQATLPEPSAEALVHSQRLTELIQSEIETAGGWIDFAHF
                     MHLALYAPSLGYYSGGSKKFGKAGDFVTAPEISPLFAQTLAKQVQQVLALTQGDVLEL
                     GAGTGKLAATLLLELQQAEQLSEHYYILEVSAYLRDLQRETLQSELPAELFERVIWLD
                     TLPETFNGLILGNEVLDALPVHIIKTHDDSIEELGVSIGADGFEWKTKVLKPDLQTVA
                     SKLSLTSDYTTEICPAATGLITSLTQLLEHGVILMLDYGFPQREYYHPQRAQGTLMCH
                     YRHYAHDNPFLYVGLQDITAHVDFTAIAEAGMTNGAELLGYANQAQFLINCGITDVLS
                     QVSPENMLEYVPLASQAQKLLSPAEMGELFKVIALGKGISEGLLGFSRGDRSHTL"
     CDS             237833..238567
                     /codon_start=1
                     /gene="trmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63RN0"
                     /locus_tag="ZMTM_02260"
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="BCM23967.1"
                     /transl_table=11
                     /translation="MQKDLTEPKQPDIEELTNNEALKNRPIRSFVLRQGRLTTGQQRA
                     LEQVMPIFGVPYQPELLDLATVFGRTESKKILEIGFGMGESTAYIASLLPEQDFLGVE
                     VHTPGVGSLLKQIDEQQLKNLRIIQHDAVEVLNHMIADASLDGVHIFFPDPWHKKRHH
                     KRRLIQAGFVKLLCSKLKAGAYLHVATDWQEYAEWVLDVLKAEPQLENTAADYAPKPA
                     YRPLTKFENRGIKLGHGVWDIVFLRV"
     CDS             complement(238526..239149)
                     /codon_start=1
                     /gene="engB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5FAC6"
                     /locus_tag="ZMTM_02270"
                     /product="putative GTP-binding protein EngB"
                     /protein_id="BCM23968.1"
                     /transl_table=11
                     /translation="MPLFQNATFYISAHHLRDLPPPAGIEVAFAGRSNAGKSSALNTL
                     ANHNRLAYVSKQPGRTQLINFFRLGGDRFLVDLPGYGYAKVPEALRQHWQLTLSNYLS
                     HRGNLHGLVLVMDCRHPLTPLDRQMLDWFLPSGRPIHVLLTKSDKLSRSAAMMTLQAV
                     KKELDANWGNCTIQLFSSLKKQGVEEAEKIIGSWLYPEEDNVPDAMA"
     CDS             239302..239910
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004557316.1"
                     /locus_tag="ZMTM_02280"
                     /product="cytochrome c"
                     /protein_id="BCM23969.1"
                     /transl_table=11
                     /translation="MSFRNVAVLVLSLAGASSAFAAGDAAKGQTIVTNVCSACHGVDG
                     NSVVAMYPKLAGQHPEYITKQLMNFKSGDRKNAIMGGMVAALSPEDMENLGAYFGSQT
                     PKTDTAKSNGPGSIGEKIYKGGIPGIGVPACASCHGPAGAGIPVQFPRLGGQHSEYIV
                     TQLKAFGSYERANDGAKMMRMIASKLSEQDMAAVADYIQGLH"
     CDS             240064..242040
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003806942.1"
                     /locus_tag="ZMTM_02290"
                     /product="cytochrome c biogenesis protein ResB"
                     /protein_id="BCM23970.1"
                     /transl_table=11
                     /translation="MTARLSNARRVYELLSSMRIAVSLLTVLGIASIIGTVLKQNEPY
                     PNYIIQFGQFWFDSFQMLGLYDVYHSVWFLLILVFLVTSTSLCIYRNSPLMLKELRAF
                     REHATEKSLRTFSHKHEYQTSIARDESKQRLFNFLGIRGFRYKIKPQDDGSELIAAKA
                     GSYQRLGYIFTHTAIVIICVGGLIDGNVPFKVQELLGYKKVETLNLPDDQVPKISRLT
                     PANLSFRANMTLSEGQSGNTAFMRMRDGYLLQEIPFTIALKDFRIEHYETGQPKSFES
                     DLVITDPEVKEPITHTISVNHPFIYKGIAIYQSDFQDGGSKLNFNVWQLFNNNPQSSE
                     INGTIFGNARLGQGDDVLKVEFEDFRKFNILNLSPDGKGKSHNVGPSVIFKVRDLEGQ
                     AREYVSYMQPLQIGGRHYFVSGMRETQQEDYRYLRLPADDDFELKGFMRLRAAMFDPA
                     MHNEIAHRFALAALGEKAKDDVIRNKFEDSIKQLLKAFSQGGYTTIAKVIEKSVPVAE
                     RDKAAQTYIKIIAGSAYEAYIISQEKAGLKPSDDDNETQLFLQDSLNAMSDLFFYGTP
                     FYLQMTNYEQREASGLQLTRSPGKNLVYSGSILLVLGIFSMIFIRERRIWLLVKPDNR
                     ILFAMSANRKNRDLDIEFDQYQQQIKRMLEDTTT"
     CDS             242071..243216
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004197914.1"
                     /locus_tag="ZMTM_02300"
                     /product="c-type cytochrome biogenesis protein CcsB"
                     /protein_id="BCM23971.1"
                     /transl_table=11
                     /translation="MNTAYMDGAPVPLLKRLHWPDWLYAALLVLGSAYAFKQYGNFMD
                     AYETTFLFGFAIAFSVLGWQWKPLRLLIAGIAIISLYSMSLYKGDLGNATQVFLLKFL
                     ISSQTAIMWMNVLFVLAMLTYWFALFSRSVFAGKVATSLTWSAVLMGFVGLMVRWYES
                     YLIAPDVGHIPISNLYEVFILFCLITSLLYLYYEGRYATRQLGGFVLLVVNAAVGFIL
                     WYTFDRQANTIQPLVPALQSYWMKIHVPANFIGYGSFSLSAMVASAYLLSMRGILTSR
                     LPKLEVLDDVMYKSIAVGFAFFTIATILGAMWAAEAWGGYWSWDPKETWALIVWLNYA
                     AWLHLRLVKGLRGEMLAWWALIGLLVTTFAFLGVNMFLSGLHSYGTL"
     CDS             complement(243287..244912)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02310"
                     /product="hypothetical protein"
                     /protein_id="BCM23972.1"
                     /transl_table=11
                     /translation="MLLSLHALLINGLGNSLQTALIICHLGFFLLWQPVLHTKDKLSI
                     RSILLLVAAGIVMVFFLSWWVIAFWLCALFALLGGRVFSTQAKSARLGYLLAASYLVG
                     VLLMWVVPKLLNTSAELEAAKFLIEYLLPLIPIGIGFTKAAEEESGQPPILDFFYTLL
                     LLMLAVILVLGSFAIQASSQAMYGEILVKTLLGLAIALAGISLLWNPRAGFSGVGQLL
                     SRYLLSVGLPFEQWIRNIAELGESTSNAGEFTNAAMKELLTLPWVTGLKWDTLDGNGE
                     LGEQEKYQANLDFYDFHLTIFSKLPLTPALTIHLKLLSQILGEFYEAKRREETLRQTV
                     YMQAIYETGSRLTHDIKNLVQSMSALCGAAEQAQEADSERLLALFRKQLPLLNQRLAR
                     TLEKLETPNKESSRFAKLSSWWNALRERYAEHYISFVTTEIAKTDVDVELLDSVLENL
                     LQNAIEKRKMDTSIAISVEITAVQGVTIEVTDTGKPMPKHVAEHLFKKQVSSENGLGV
                     GLYHAGKQAQQSGYELSLIDNRQGTVRFRLNKA"
     CDS             245211..245876
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011387873.1"
                     /locus_tag="ZMTM_02320"
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="BCM23973.1"
                     /transl_table=11
                     /translation="MKKQSGFTLIELAIVLVIIGLLLGGVLKGQELINSAKVKNMASD
                     FKNIQVYIYGYQDKYKALPGDDASANAHLGSACTTAPVTTCAAANGTHGNGVIEGNWN
                     DAAAADSEAFRFWQQVRVAGLAPGATNNADANYIPRNADGGQIGVESVSQLTTITGMT
                     GAFAICSDAILGKFAKQLDVTLDDGETSTGSVRAVVSNTSGAGVTTALINDSLTYTVC
                     MSF"
     CDS             245987..246793
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199931.1"
                     /locus_tag="ZMTM_02330"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BCM23974.1"
                     /transl_table=11
                     /translation="MSDNIVEIDNLSFGYKNRLLHKGINMSFPRGKVVAIMGGSGSGK
                     TTLLRLIGGQLKPTHGEVRVDGLVVHKQDRHGLFQLRRKMGMLFQFGALFTDLSVYEN
                     VAFPIREHTNLPETIVRDLVMMKLNAVGLRGARDLMPTELSGGMARRVSLARAIALDP
                     SIIMYDEPFTGLDPISMSVTCNLIRKLNDALGATSIMVTHDVKEAFLIADYVYIVANG
                     VVEAEGSPDDLRKSDLPFVHQFVHGEIDGPVPFHYPAPDYRRDMLRGHDV"
     CDS             246786..247574
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010931637.1"
                     /locus_tag="ZMTM_02340"
                     /product="membrane protein"
                     /protein_id="BCM23975.1"
                     /transl_table=11
                     /translation="MFNKLTGILRGIGHRIVDRVWRLGSGARFLFYILIYSTESFRRL
                     HLTIREIYFTGVLSLVIILVSAFFIGMVLALQGYNTLQKYGSSESIGVLVALSLVREL
                     GPVMTALLFAGRAGTAITAEIGLMKATEQLSAMEMMAVSPIARVVAPRFWAGVISMPL
                     LSSMFTMVGILGGYMVAVPLIGVDNGAFWSQMQANVDFQNDILNGLLKSFVFGVACTL
                     IALFEGFDAPPTAEGVSRATTRTVVNSSLAVLGLDFVMTSFMIL"
     CDS             247647..248162
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199927.1"
                     /locus_tag="ZMTM_02350"
                     /product="outer membrane lipid asymmetry maintenance
                     protein MlaD"
                     /protein_id="BCM23976.1"
                     /transl_table=11
                     /translation="MGYIPSDIKATGDNMERTTIDLWVGIFAAAGAAAILGLALKVGN
                     LTSSTIGDTYSVTAAFENIGGLKPRAPVKSAGVVVGRINSIQFDSKSYEAIVTINVDK
                     RYAFPKDTFANIYTAGLLGEQYIGLEAGGDPDNLKDGDKITHTQDAVVLEKMISQFLY
                     NKASDSNTDKK"
     CDS             248173..248802
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003687105.1"
                     /locus_tag="ZMTM_02360"
                     /product="periplasmic transporter"
                     /protein_id="BCM23977.1"
                     /transl_table=11
                     /translation="MKSLINGFAKSILALGFVAFAGAAFAEVGPDTLVKTTAEDVLTI
                     IKNDKDIQAGNQTKIFALAEEKILPNFNFDRVSRIVLGKNWNGATKEQQDAFQKEFKT
                     LLIRTYASALSKYKNQTIEYKPLRAQPTDTEVSVKTQINQPGGQPIEVDYSLAKEADG
                     WKVFDIVIEGVSLVTNYRGQFNNEIRQSGMDGLIQKLVEKNKSNASSKS"
     CDS             248838..249146
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02370"
                     /product="hypothetical protein"
                     /protein_id="BCM23978.1"
                     /transl_table=11
                     /translation="MANITQQENRWLITGAMTMPHICALLDESTQLSMNKSFEIDLAE
                     VTDVDTATISLLFEWLRSAHVHKSKLTFANFPENLVSLATLYGVLELLPQAAHSQVTH
                     "
     CDS             249180..250088
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205265.1"
                     /locus_tag="ZMTM_02380"
                     /product="ABC transporter ATP-binding subunit"
                     /protein_id="BCM23979.1"
                     /transl_table=11
                     /translation="MTPAIHIESVHKRFGAFNALNGIDLSIGQGEFFGLLGPNGAGKS
                     TLINIMAGLLKPTSGSLKVLGYDVHSQYRQARQLLGVVPQELVFDPFFTVREMLRFQA
                     GYFGCGPENDAWVDEIIESLGLADKANTNMRKLSGGMKRRALIAQALAHRPPVIVLDE
                     PTAGVDVESRQMMWEFIKRLNRDGHTIILTTHYLEEAEVLCNRVAMMKQGKVVALDST
                     ANLLNSLPGKNLRLKLSSEAMPAVLQALLKSQDQNSFTFALTEVSQIEYVLSELKKAN
                     IIVEDFQLLEADLEDVFIDLVGRDHA"
     CDS             250081..250875
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q82"
                     /locus_tag="ZMTM_02390"
                     /product="transport permease protein"
                     /protein_id="BCM23980.1"
                     /transl_table=11
                     /translation="MLDHDINLKRGTNLRGPWTLFKKESLRFWRVGMQTVAAPVMTAL
                     LYLLVFSHVLSSSVEVYPGVTYTAFLIPGLIMMSVLQNAFANSSSSLVQAKVMGNIIF
                     ILLTPLSYLEVFLSLLAACIIRGVVVGVCIYLVAIIFIDLPLMHPWIILLFAVLGSAL
                     MGTFGIIAGIWAEKFDQMASFQNFIIMPLSFLSGVFYSIHSLPPFWQKVSHLNPFFYM
                     IDGFRYGFFGAGDISTVVSFSVVSVSVLLLSWLTLVMLKSGYKLRG"
     CDS             250894..251142
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199917.1"
                     /locus_tag="ZMTM_02400"
                     /product="BolA family transcriptional regulator"
                     /protein_id="BCM23981.1"
                     /transl_table=11
                     /translation="MVSAEDVKGYIEQGLACQHVQVLGDDGQHFEAIIVSNLFAGKNM
                     VQQHQMVYQALGDRMRQEIHALSMRTFTPEAWAQFSVR"
     CDS             251228..251545
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MAT1"
                     /locus_tag="ZMTM_02410"
                     /product="glutaredoxin"
                     /protein_id="BCM23982.1"
                     /transl_table=11
                     /translation="MDTQEIIRNQVTANPVVLYMKGSPKFPQCGFSGLAIQILQACGV
                     KNLVTVDVLADPAIREGIKVFSNWPTVPQLYINGEFIGGSDIMRDLYSQGELQSLLEK
                     ATA"
     CDS             251546..252811
                     /codon_start=1
                     /gene="murA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GD7"
                     /locus_tag="ZMTM_02420"
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="BCM23983.1"
                     /transl_table=11
                     /translation="MEKLVIEGGFPLNGEINISGAKNAALPILCAALLAETPLKLCRV
                     PVLRDVGTTQQLLAHMGVVVTDHGDNCVTLDASNITSHEAPYEMVKTMRASILVLGPL
                     LARFGHARVSLPGGCAIGSRPVDLHIKGLQAMGAEIHIEHGYIEATTAHLPNKRLQGA
                     RIFMDIVTVTGTENLMMAAALADGTTYLENAAREPEVIDLAECLIKMGAKIEGAGTDV
                     ITVHGVERLQGTQHDIVCDRIEAGTYLVAAAMAGGSITLNNARADLLDAVIEKLREAG
                     AKIEHTDNTISIQSDGKLKSVSVRTAPHPAFPTDMQAQFMALNTIATGAATVIETIFE
                     NRFMHVQEMQRLGAEIEVEGNTAIVRGVEYLDGATVMATDLRASASLVLAGLVARGET
                     TIERIYHIDRGYERIEEKLTKLGARIKRI"
     CDS             252891..253547
                     /codon_start=1
                     /gene="hisG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GD8"
                     /locus_tag="ZMTM_02430"
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="BCM23984.1"
                     /transl_table=11
                     /translation="MITIALSKGRIFDETVPLLAAAGITPLEDPESSRKLILGTNRDD
                     VRLIIVRATDVPTYVQYGAADLGIAGKDVLNEHGGDGLYQPLDLKIARCKMMVAVRED
                     FDYFGSIRRGARLKVVTKYVKTAREHFADKGMHVDLIKLYGSMELGPLVGLADAIVDL
                     VSTGGTLRANNLKAVEEITDISSRLVVNQASLKLKRELLQPIMDSFAQAVAQNETNLG
                     "
     CDS             253551..254849
                     /codon_start=1
                     /gene="hisD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MPE0"
                     /locus_tag="ZMTM_02440"
                     /product="histidinol dehydrogenase"
                     /protein_id="BCM23985.1"
                     /transl_table=11
                     /translation="MNIKRLSTADAGFDQQLKDLLAFETAQDDQIDLVVANILRDVKN
                     RGDVAVLEYTKKFDHLDVSGLSQLEIPKPELQAALDNLPPAQRDALKQAAERVRVYHE
                     KQLMSSWSYTENDGTLLGQQVTSLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVQELI
                     MVVPTPNGEKNQLVMAAAAVCGVDRVFCIGGAQAVAALAYGTETVPQVDKIVGPGNAY
                     VAAAKRRVFGVVGIDMVAGPSEILVICDGKTNPDWIAMDLFSQAEHDELAQAILLSPD
                     ADFLDKVAASANRLVEEMPRKEIIRTSLESRGALIKVKDLEEAARIANYIAPEHLELS
                     IDDPLAFSKKIKHAGAIFMGRDTCEALGDYCAGPNHVLPTSRTARFSSPLGVYDFQKR
                     SSLIMVSPEGAQTLGKVAATLAYGEGLQAHAHSAEYRLKP"
     CDS             254849..255913
                     /codon_start=1
                     /gene="hisC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZNW0"
                     /locus_tag="ZMTM_02450"
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="BCM23986.1"
                     /transl_table=11
                     /translation="MSKFWSKIVHELTPYTPGEQPKLNNLIKLNTNENPYGPSPKVIE
                     ALQAEAADSLRLYPDPNSDRLKEAVANFYGIKPTQVFAGNGSDEILAHVFQALLKHDQ
                     PLLFPDISYSFYPVYCGLYQIQYKTVALTDTFEIDVNDYMQPNGGIIFPNPNAPTGRL
                     LSLQEIERLLIANKESVVVIDEAYVDFGGQSAIGLMDRYPQLLVTQTLSKARSLAGLR
                     AGFAVGHPDLIDALHRIKDSFNSYPLDRFAIAGAVAAMNDREYFEMTRQKVIASRERL
                     VEKLNALDFEVLPSGANFIFAKHATHDGAELTAKLRERSIIVRHFKNPARISPFLRIT
                     IGTDQECELLVSALIEILKA"
     CDS             256106..256795
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000776031.1"
                     /locus_tag="ZMTM_02460"
                     /product="3-hexulose-6-phosphate synthase"
                     /protein_id="BCM23987.1"
                     /transl_table=11
                     /translation="MAKPLVQMALDSLDFDATVALATKVAPHVDILEIGTPCIKHNGI
                     ELLKVLRAKFPNNKILVDLKTADAGYYEAEPFFKAGADIVTVLGISDIGTIKGVVDVA
                     NKYGKEAQVDLISVPNKAEVVKAVAAVGAHIIGVHTGLDQQAAGQTPFSDLALVAGLN
                     TGLKISVAGGVKAATVKQVVDAGATIVVAGAAIYGAADPAAAAAEITALARGESASSG
                     GLFGWLKGLFS"
     CDS             256980..257567
                     /codon_start=1
                     /gene="hisB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HU41"
                     /locus_tag="ZMTM_02470"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="BCM23988.1"
                     /transl_table=11
                     /translation="MRSAEVSRQTLETQIIVSINLDGTGVSKFATGLGFLDHMLDQIA
                     RHGMLDISVEAKGDLHIDAHHTVEDIGITLGQAFAKAVGDKKGIRRYGHAYIPLDEAL
                     SRVVLDLSGRPGLEYGVNFTRAQIGDFDVDLIHEFFQGFVNHALVTLHIDNLKGVNAH
                     HQAETIFKAFGRALRMALELDARMAGIMPSTKGAL"
     CDS             257627..258271
                     /codon_start=1
                     /gene="hisH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0ML54"
                     /locus_tag="ZMTM_02480"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="BCM23989.1"
                     /transl_table=11
                     /translation="MIDIAVVDYGMGNLRSVSKALEHVATDKKVVVTSNPQDIAEAER
                     VVFPGQGAMPDCVRELDSRGLREAVIAAAASKPFLGICIGLQLLFDHSEEGNADGLGI
                     FAGQVKRFSAVDMHDVQGHKLKVPHMGWNEVYQSQSHPLWAGIENGERFYYVHSYYVA
                     PQETALVAGYSEYPKRFTSVVAKDNIFAVQFHPEKSQHAGLKLLSNFVQWNGHS"
     CDS             258299..259039
                     /codon_start=1
                     /gene="hisA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MPK3"
                     /locus_tag="ZMTM_02490"
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino] imidazole-4-carboxamide isomerase"
                     /protein_id="BCM23990.1"
                     /transl_table=11
                     /translation="MLIIPAIDLKDGHCVRLKQGLMEESTVFSEDPGAMARNWVDQGA
                     KRLHLVDLNGAFAGKPVNEAAIKAIVQAVGGQIPIQLGGGIRDLETIERYLDDGIDYV
                     IIGTAAVKNPGFLHEACYAFPGQIIVGLDAKDGKVAVDGWSKLTGHDVIDLAKKFEGY
                     GVEAIVYTDIGRDGMLSGVNIEATVALAQALMIPVIASGGITNLDDVRKLCAVESEGI
                     IGAITGRAIYEGTLDFTAAQALADELNG"
     CDS             259050..259808
                     /codon_start=1
                     /gene="hisF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q92"
                     /locus_tag="ZMTM_02500"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="BCM23991.1"
                     /transl_table=11
                     /translation="MALAKRIIPCLDVTAGRVVKGINFLELRDAGDPVEIARRYDEQG
                     ADELTFLDITASSDNRGLILNIIEQVASQVFIPLTVGGGVREVEDVRRLLNAGADKVS
                     INTSAVLNPQLVADASGHFGSQCIVVAIDAKQVGDHWEVFTHGGRNATGIDAIEWAKK
                     MVALGAGELLVTSMDRDGTKVGFNLALNRAISDAVDVPIIASGGAGNLVHLVEGVQEG
                     GADAVLAASIFHYGEYTVRQAKEYMRECGIEVRL"
     CDS             259821..260210
                     /codon_start=1
                     /gene="hisI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HUB7"
                     /locus_tag="ZMTM_02510"
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="BCM23992.1"
                     /transl_table=11
                     /translation="MSDYLDKVNWTSEGLVPVIAQEHSTGKVLMFAWMNREALKLTVE
                     TGQAVYWSRSRNKLWHKGEESGHVQKVHDIRLDCDEDVILIIVEQIGGIACHTGRHNC
                     FFKKLENDDWVVDQPVIKDTNEIYHHE"
     CDS             260203..260520
                     /codon_start=1
                     /gene="hisE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HUB6"
                     /locus_tag="ZMTM_02520"
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="BCM23993.1"
                     /transl_table=11
                     /translation="MSDVLNRLAELLEQRKTASPDSSYVAKLYAKGTDSILKKVGEES
                     AELIIAGKGGDQQEIIYETADLWFHSLVLLAHAGLNPQQVLDELARREGLSGLEEKAQ
                     RKG"
     CDS             260522..260860
                     /codon_start=1
                     /gene="hitA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003022010.1"
                     /locus_tag="ZMTM_02530"
                     /product="histidine triad nucleotide-binding protein"
                     /protein_id="BCM23994.1"
                     /transl_table=11
                     /translation="MSTDCIFCKIVAGEIPATKVYEDEDVIAFNDIHPIAPVHFMIVP
                     KEHIESLASAEEKHQALLGKILLLAPKLAKQQGLKGFRTMINTGREGGQEVFHLHVHV
                     FGGGASLPKT"
     CDS             260896..261111
                     /codon_start=1
                     /gene="tatA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9R4"
                     /locus_tag="ZMTM_02540"
                     /product="Sec-independent protein translocase protein
                     TatA"
                     /protein_id="BCM23995.1"
                     /transl_table=11
                     /translation="MGSFSIWHWLIVLLIVVLVFGTKKLRNIGSDVGGAVKNFKDAMK
                     EESSKPKLDEPEPGHTVEGEVTQKTKQ"
     CDS             261118..261552
                     /codon_start=1
                     /gene="tatB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VSY1"
                     /locus_tag="ZMTM_02550"
                     /product="Sec-independent protein translocase protein
                     TatB"
                     /protein_id="BCM23996.1"
                     /transl_table=11
                     /translation="MFDIAFSELVVIGVVALIVIGPEKLPKVARTVGLLVGRLQRYVA
                     NVKDDISREMQLEDLKKLQQQMQENGQKIQTELMLSKDAVSKHLDEVRETLLEAQKPS
                     ADTTVPESASISTSQASAVEPHSESGIEPSPVLPPDTKERQK"
     CDS             261559..262302
                     /codon_start=1
                     /gene="tatC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3FMC2"
                     /locus_tag="ZMTM_02560"
                     /product="Sec-independent protein translocase protein
                     TatC"
                     /protein_id="BCM23997.1"
                     /transl_table=11
                     /translation="MNTTETFISHLIELRDRLLRSVIGLVLVFIALFPFANKIYHLLA
                     EPMLSKLPAGGQMIATAVTTPFFVPMKVAMLAAFVISLPHTLYQIWSFVAPGLYAHER
                     KFMAPLVVASTLLFFTGMAFAYYLVFPVVFGFITHAAPEGVAVMTDIGNYLDFVMTMF
                     IAFGLAFEVPIAVVMLVRFNIVKIQTLKDIRSYVIVGAFVVGAIFTPPDVISQMMLAV
                     PLWLLYEAGIIFARFTMPHVADEKAISDN"
     CDS             complement(262299..263459)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004521939.1"
                     /locus_tag="ZMTM_02570"
                     /product="DegQ protease"
                     /protein_id="BCM23998.1"
                     /transl_table=11
                     /translation="MRKLWLIFAQTVTVSLAVLFVVQTFHPNLLNSVDKTLVIKEAAS
                     TAKIGSAESYSVAAKKAMPSVVNVFTSKKAAPNPHRQFMDDPLFRHFFGDQPDDQTQR
                     ENSLGSGVIVSSDGLIVTNHHVVESADEIEIALADGRTVPAKIVGTDPETDLAVVKVD
                     VKDLPAITFADAEQSSVGDVVLAIGNPFGVGQTVTQGIISALGRSHLGINTFENFIQT
                     DAPINPGNSGGALIDTQGNLVGVNSAIYSRSGGSMGIGFAIPISLVKQVMEQIISQGS
                     VTRGWIGIEAQDITPELAESFKLKQVRGSLIAGILRGSPAERAGLRPGDILLEINGNQ
                     VIDSSSMLNLISGLAPNKQATLVVARDEKEIKVPITIGKRPKPLSAKNDLKD"
     CDS             263499..264245
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7W078"
                     /locus_tag="ZMTM_02580"
                     /product="GTP cyclohydrolase 1 type 2"
                     /protein_id="BCM23999.1"
                     /transl_table=11
                     /translation="MKLKELTHYTGEILQVERFRDYCPNGLQVEGKQEVSKIVAGVTA
                     SMDLLEAAHAAGADLILVHHGYFWRNEDARVIGMKRARIKFLLEHEINLLAYHLPLDA
                     HAEYGNNVQLAKKLGFQLEGWAGEQNIIAYGTIAVPVSLQQLGAHINQQLNREPLLIG
                     EQNKLVKRIAWCTGAAQDYIEQAIDLGVDVFISGEISERTVHLARESGVAYIAAGHHA
                     TERYGVQALGEHLATHFNLGYEWIDIDNPV"
     CDS             264431..265012
                     /codon_start=1
                     /gene="petA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7DD50"
                     /locus_tag="ZMTM_02590"
                     /product="ubiquinol-cytochrome c reductase iron-sulfur
                     subunit"
                     /protein_id="BCM24000.1"
                     /transl_table=11
                     /translation="MANQPVDQHKRRFLIAATTAVGGVAVAAVAVPFVASMLPSARAK
                     AAGAPVEVDVSKIEAGAMITVEWRGKPVWIINRSQAMLDALSNHDDRLTDPKLEVNQQ
                     PEDCKNADRSIKPNLMVLVGVCTHLGCSPSPRLQSGADMGADWPGGFFCPCHGSKYDL
                     AGRVFKGSPAPINLLVPDYKYVSDSVVRIGNET"
     CDS             265027..266310
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5F599"
                     /locus_tag="ZMTM_02600"
                     /product="cytochrome b"
                     /protein_id="BCM24001.1"
                     /transl_table=11
                     /translation="MNKLVTGLLGWVDERFPLTANYKAHLSEYYAPKNFNFWYFFGAL
                     SLLVLVLQIVTGIFLTMNYKPDADLAFASVEYIMRDVSWGWLIRYMHSTGASMFFVVV
                     YLHMFRGIIYGSYRTPRELIWLFGVGIFLALMGEAFFGYLLPWGQMSYWGAQVIINLF
                     SSIPFIGPDISEWLRGDYVVSDATLNRFFAFHVIALPLVLLGLVAAHIIALHEVGSNN
                     PDGVEIKKLKDPETHIPLDGIPFHPYYTVKDIMGVSVFLIVFSAIIFFAPEMGGYFLE
                     ANNFIPADSLKTPPHISPVWYFTPYYSILRAVPPVMNSSFPGVVGMGLSVMVFALLPW
                     LDRGAVKSIRYRGSLYKKWLAAFVVSFLVLGYLGTEPSNVWGQFDAGVFFLGGADRAT
                     VVARIFTVIYFLFFILMPWYTKIDKTKPVPERVTG"
     CDS             266307..267050
                     /codon_start=1
                     /gene="petC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199892.1"
                     /locus_tag="ZMTM_02610"
                     /product="cytochrome c"
                     /protein_id="BCM24002.1"
                     /transl_table=11
                     /translation="MSASIMKKLLIALTLSASFSVSASEGPKLERAPIDPDNQASLQR
                     GAKIFVNYCLNCHSAAYMRYNRLQDIGLTQEQIKENLLFAGDKVGETMKVAMPKKDSK
                     EWFGVTPPDLTVEARARGADWLYAYLRSFYRDDTRPTGWNNVVYEKVAMPHVLWQLQG
                     DQILKTEETTEANGEKSEQHKLVLIKPGKLSPAEYDATIADLVNYLVYMSEPAKSTRL
                     RLGLIVLLFLGGLFIVSYYLKKEFWKDVH"
     CDS             267131..267730
                     /codon_start=1
                     /gene="sspA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004185176.1"
                     /locus_tag="ZMTM_02620"
                     /product="stringent starvation protein A"
                     /protein_id="BCM24003.1"
                     /transl_table=11
                     /translation="MMTLYSGTTDPYSHRCRIVLFEKGMDFQVIDVDLANKPEDLAII
                     NPHNAVPVLVERDLVLQQANIINEYIDERFPHPQLMPADPVMRARARLFLYNFEQELF
                     AHIGDIESGNTKLADKARITIRDNLTQIVPLFSKQEYILGDEFSMLDVAIAPLLWRLG
                     HYGIELPKQAAPLLKYAERIFSRPAYIEAMTPSEKAMRK"
     CDS             267736..268176
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_02630"
                     /product="hypothetical protein"
                     /protein_id="BCM24004.1"
                     /transl_table=11
                     /translation="MAEQISTKPYFIRALHEWCTDNSFTPHLLVGVDAQTKVPMGYVK
                     DGEIVLNLNYAATKDLHIGNEAITFSARFGGVSNNLYVPIDAVRGIFARENGQGMSFQ
                     AEPQSEITSDQSAVSKEIEGVVNDLPLVEGKSKEVKKPTLKLVK"
     tRNA            268216..268291
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00070"
                     /product="tRNA-Thr"
     tRNA            268370..268454
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00080"
                     /product="tRNA-Tyr"
     tRNA            268534..268609
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00090"
                     /product="tRNA-Gly"
     tRNA            268671..268745
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00100"
                     /product="tRNA-Thr"
     CDS             268873..270063
                     /codon_start=1
                     /gene="tuf_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_104181.1"
                     /locus_tag="ZMTM_02640"
                     /product="elongation factor Tu"
                     /protein_id="BCM24005.1"
                     /transl_table=11
                     /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKKFGGEA
                     KAYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDAELLELVEMEVRELLDK
                     YEFPGDDTPIIHGSAKLALEGDQSEIGEPAILKLAEALDTYIPTPERAIDGTFLMPVE
                     DVFSISGRGTVVTGRIERGIVKVGDEIEIVGIKPTLKTTCTGVEMFRKLLDQGQAGDN
                     VGVLLRGTKREEVERGQVLAKSGSIKPHTKFAAEIYVLGKDEGGRHTPFFNGYRPQFY
                     FRTTDVTGAVELPAGTEMVMPGDNVSITVALIAPIAMEDGLRFAIREGGRTVGAGVVA
                     KIIE"
     tRNA            270132..270207
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00110"
                     /product="tRNA-Trp"
     CDS             270294..270641
                     /codon_start=1
                     /gene="secE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MBB5"
                     /locus_tag="ZMTM_02650"
                     /product="protein translocase subunit SecE"
                     /protein_id="BCM24006.1"
                     /transl_table=11
                     /translation="MINKIKLVVALLLVAAGIAGYYAIADQALVLRILVVCAGIVAAV
                     VLTWTTPLGKEGLGFIQDSVAEAKRVVWPSRKEAIQTTVAVFVLVIVMAIFLAIVDAG
                     FLKMVQWLMGRSA"
     CDS             270641..271180
                     /codon_start=1
                     /gene="nusG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P65592"
                     /locus_tag="ZMTM_02660"
                     /product="transcription termination/antitermination
                     protein NusG"
                     /protein_id="BCM24007.1"
                     /transl_table=11
                     /translation="MSMRWYAVQAFSGYEKTVQRGLEERIARSPIAKDFFGQILVPVE
                     EVVEMKSGQKTITERKLYPGYVLVQMEMNDDSWHLVKSTPRVTAFIGGTALKPTPIKD
                     KEVEIILQRMDDSKSNPTQKLTFEKGESVRVIDGPFKDFSGNVEDINYEKSKLRVTVT
                     IFGRATPVELDFSQIEKEV"
     CDS             271300..271731
                     /codon_start=1
                     /gene="rplK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GJ3"
                     /locus_tag="ZMTM_02670"
                     /product="50S ribosomal protein L11"
                     /protein_id="BCM24008.1"
                     /transl_table=11
                     /translation="MAKKVIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNA
                     ATQSLEPGLPIPVVITAFADKSFTFVMKTPPATILIKKAAKIDKGSPRPHTDKVGKIT
                     RAQAEEIAKTKAPDLTAADLDAAVRTIAGSARSMGIVVEGV"
     CDS             271733..272425
                     /codon_start=1
                     /gene="rplA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7W0S2"
                     /locus_tag="ZMTM_02680"
                     /product="50S ribosomal protein L1"
                     /protein_id="BCM24009.1"
                     /transl_table=11
                     /translation="MTTISKRVAAIKAKVDRNKVYAVAEALTLVKETATAKFDESVDA
                     VINLGIDARKSDQLVRGALVLPNGTGKSKRVAVFAQGAQADAARAAGAEVVGFEDLAE
                     QVKAGVIDFDVAIATPDAMRIVGQLGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQ
                     VQYRTDKGGIVHCTIGRASFTVEALHGNLAALVDALNKAKPSSTKGVYLKKVSVSSTM
                     GAGIRVDQSNIA"
     CDS             272797..273318
                     /codon_start=1
                     /gene="rplJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MA40"
                     /locus_tag="ZMTM_02690"
                     /product="50S ribosomal protein L10"
                     /protein_id="BCM24010.1"
                     /transl_table=11
                     /translation="MSLNLEEKKAVVAEVSEQVSKAQSIILAEYRGLQVGEITKLRAE
                     ARKSGIYLRVLKNTLVRRAVDGTPFSALASEMVGPLVFGISTDPVAAAKVLNDFAKAN
                     DKFVIKGGALPNQVMDAKGIQALATLPSREELLSKLLGTMQAPIAKFVRTLNEVPSGF
                     VRGLAAVRDQKAA"
     CDS             273364..273744
                     /codon_start=1
                     /gene="rplL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P742"
                     /locus_tag="ZMTM_02700"
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="BCM24011.1"
                     /transl_table=11
                     /translation="MALSKADILDAIAGLTVLELSELIKDLEEKFGVSAAAVAAPAAA
                     GAAAPAAAAAEEKTEFDVVLLAAGDNKVNVIKAVRELTALGLKEAKDLVDGAPKAIKE
                     GVSKADADAALKKLEEAGAKAEIK"
     CDS             273926..278098
                     /codon_start=1
                     /gene="rpoB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q03"
                     /locus_tag="ZMTM_02710"
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="BCM24012.1"
                     /transl_table=11
                     /translation="MSYSFTEKKRIRKSFAKRESVQEVPYLLAMQLESYAAFLQANVS
                     VDKRENAGLQATFASVFPIVSHSGNARLDYVSYHLGQEPFDVKECQQRGLTYAAPLRV
                     KVRLTIMDKEASKPTVKEVKEQEVYMGELPLMTENGSFVINGTERVIVSQLHRSPGVF
                     FEHDRGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDYLYFRVDRRRKMPVTILLKALG
                     YTPEQILETFYDLDTFHISAKGIQFELVPERLRGEVAKFDIVSKDGTVVVAKDKRITV
                     KHIRDMEKAGISKITVPEEFLLGRALSTAIVDKETGEVVANANDEITESVVEKLREAS
                     VSKINTLYANDLDHGDYISQTLRIDEIPDQYSAKVAIYRMMRPGEPPTEDAVNALFEG
                     LFFNEDRYDLSVVGRMKFNRRAFPERIEDRTAAWLRRFYEKSGARGAEGSGILSNQDI
                     LAVVAVLLELRNGRGEIDDIDHLGNRRIRSVGELAENQFRAGLVRVERAVKERLSQAE
                     SDNLMPHDLINAKPVSSAIREFFGSSQLSQFMDQTNPLSEITHKRRVSALGPGGLTRE
                     RAGFEVRDVHTTHYGRVCPIETPEGPNIGLINSLALFSRTNKYGFLETPYRRVENNKV
                     SEKIDFLSAIEESQYMIAQANTELDSKGQFQEELVSARYHNEFTMAQPDRVQYMDVAP
                     SQIVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRAEKAVVGTGIERTVAIDSGTI
                     VQARRGGIVDYVDSSRIVIRVHDAEALAGEVGVDIYNLTKYTRSNQNTNINQRPLVNV
                     GDVLARGDVIADGASTDMGELALGQNMLVAFMPWNGYNFEDSILISERVVSDDRYTSI
                     HIEELSVVARDTKLGAEEITRDISNLSERMLGRLDDSGIIYIGAEVEAGDVLVGKVTP
                     KGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGMSGTVIDVQVFTREGIDRDPRAQQ
                     IIDDQLGHYKQDLADQMRIVEDDAFGRIRRLLEGKVATGGPKKLKKGDTLNAEYLEDI
                     GRYDWFDIRLSDEDAARQLEQLKDSLAQARVTFDSKFEEKKRKLTQGDELPPGVQKMV
                     KVYLAVKRRIQPGDKMAGRHGNKGVVSKIVPVEDMPHMADGTPMDIVLNPLGVPSRMN
                     IGQILETHLGWAAKGLGMRIGEMLRSQTKVSEVRKFIDQIYNNSTGKKEDIKSLTDTE
                     VLDLAKNLERGVPFATPVFDGAAESDIKAMLDLAFPDDDPRTKQLEFAAGKTQVKLID
                     GRTGETFERPVTVGYMHVLKLHHLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRFGE
                     MEVWALEAYGAAYTLQEMLTVKSDDVSGRTKVYENIVKGEHKIDAGMPESFNVLVKEI
                     RSLAIDIDLDRN"
     CDS             278108..282343
                     /codon_start=1
                     /gene="rpoC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0M7U6"
                     /locus_tag="ZMTM_02720"
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="BCM24013.1"
                     /transl_table=11
                     /translation="MKALLDLFKQVTQEEEFDAIKIALASPEKIRSWSYGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLSKVRRERM
                     AHIELASPVAHIWFLKSLPSRLGMVLDIALRDIERVLYFEAYIVIDPGMTPLTRGQLL
                     TEDDYLAKVEEYGDEFNAVMGAEAVRELLRTMDVHSEIERQRREITETGSEAKIKKIS
                     KRLKVLEAFQKSGIKPEWMILEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLELKAPEIIVRNEKRMLQEAVDSLLDNGRRGKVMTGANKRPLKSLADMIKGK
                     GGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKKMALELFKPFIFHKLEVLGLAT
                     TIKAAKKKVEEEGPEVWDILEDVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAFNADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLSPANGEPIIVPSQDIVL
                     GLYYMTREKVNARGEGMRFANVNEVQRVYDAGLIDLHAKVTVRIKEYEVDLNGDKHEK
                     INRYETTVGRALLSEILPAGLPFSTIDRALKKKEISKLINAGFRKVGIRETVILADKL
                     MTMGYTYATRAGISISINDMLVPPEKEQLIASAEAEVKEIENQYVSGLVTQGERYNKV
                     VDIWGRAGDKVADAMMKQLREEPVLDADGNVTKDASGKVIKQESFNAIYMMADSGARG
                     SAAQVRQLAGMRGLMAKPDGSIIETPITANFRDGLNVLQYFISTHGARKGLADTALKT
                     ANSGYLTRRLVDVTQDLVVTEHDCGTIDGLVTKALVKGGEVIEPLHDRILGRVTAIDL
                     VNPETQEVVYPAGTLLTEDEVENIDALGIDEVKVRTALTCDTRYGICAKCYGRDLGRG
                     RLINMGEAVGVIAAQSIGEPGTQLTMRTFHIGGAVSRAASISQVEGKSNGVVRFTSTM
                     RYVTNARNEQVVISRNGEAMIQDENGRERERHKVPYGATLQLLDGKTVKAGQALATWD
                     PHTRPIITEYAGKIKFENVEEGITVAKQIDDVTGLSSLVVIDPKQRAGQSKGLRPQVK
                     LLDANGVEVKVSGGETPVNITFQLGCIITVKDGQEVGVGEVLARIPQESSKTRDITGG
                     LPRVAELFEARSPKDAGLLAEVTGTVSFGKDTKGKQRLVFTDLDGITHEYLIPKDKHV
                     TAHDGQVVTKGESIVDGPADPQDILRLQGREALARYIIDEVQDVYRLQGVKINDKHIE
                     VIVRQMLRRVRVSDAGETNFILGEQVERADLLAENERVTAINKRPASFEYVLLGITKA
                     SLSTDSFISAASFQETTRVLTEAAILGKRDELRGLKENVIVGRLIPAGTGLAYHETRR
                     RQAAGTDAAPSVIEAAEPEVAPVIETTGDAEVA"
     CDS             282455..282832
                     /codon_start=1
                     /gene="rpsL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P66375"
                     /locus_tag="ZMTM_02730"
                     /product="30S ribosomal protein S12"
                     /protein_id="BCM24014.1"
                     /transl_table=11
                     /translation="MPTTNQLVRKPRQKVVTKSKVPALESSPQKRGVCTRVYTTTPKK
                     PNSALRKVAKVRLTNGYEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSL
                     DTAGVKDRKQSRSKYGAKRPKAA"
     CDS             282868..283338
                     /codon_start=1
                     /gene="rpsG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5F5S2"
                     /locus_tag="ZMTM_02740"
                     /product="30S ribosomal protein S7"
                     /protein_id="BCM24015.1"
                     /transl_table=11
                     /translation="MPRRREVPKRDILPDPKFGSQEVSKFINVLMTGGKKSVAERILY
                     GAFDQVSTKSGKDALEVFTLAISNLRPVVEVKSRRVGGANYQVPVEVRPSRRSALAMR
                     WLRDAARKRGEKSMGLRLAAELVEASEGRGSAMKKREEVHRMAEANKAFSHFRF"
     CDS             283366..285456
                     /codon_start=1
                     /gene="fusA2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q08"
                     /locus_tag="ZMTM_02750"
                     /product="elongation factor G 2"
                     /protein_id="BCM24016.1"
                     /transl_table=11
                     /translation="MARITPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTCFWKGMAGQFEQHRINIIDTPGHVDFTIEVERS
                     MRVLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRAGANFLKVYDQMRT
                     RLKANPIPLQLPIGAEEKFEGVVDLIKMKAVYWDDSSQGMKFDYREIPEEMKAECDKW
                     RENMIEAAAEANEELMNKYLEEGNLSEEEILAGLRQRTIAFEIVPMMCGSAFKNKGVQ
                     AMLDKVIELMPAPTDIPPTKAQNGKGEEIRLKAADDEKFAALAFKIMTDPFVGQLIFF
                     RVYSGVVKAGDSVYNAIKGKKERIGRIVQMHANTREPLEEVRAGDIAAAVGLKDVTTG
                     DTLCGLNEEIILERMIFPEPVIHVAVEPKTKADQEKMGVALNRLAQEDPSFRVKTDEE
                     TNQTIISGMGELHLEILVDRMKREFGVEANVGAPQVAYREAIKKKVEVEGKFVKQSGG
                     KGQYGHVWLMMEPNEPGKGFEFIDQIKGGTVPREFIPAVEKGLRETIPSGILAGFPVV
                     DVKVTLFDGSYHDVDSNENAFKMAASIGFKDGMRKADPILLEPMMAVEVETPEDYMGD
                     VMGDLSSRRGMIQGMDDNATGKVIRAEVPLAEMFGYSTVVRSLSQGRASYSMEFKHYS
                     EAPRNVAEAIINKK"
     CDS             285511..286701
                     /codon_start=1
                     /gene="tuf_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_104181.1"
                     /locus_tag="ZMTM_02760"
                     /product="elongation factor Tu"
                     /protein_id="BCM24017.1"
                     /transl_table=11
                     /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKKFGGEA
                     KAYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDAELLELVEMEVRELLDK
                     YEFPGDDTPIIHGSAKLALEGDQSEIGEPAILKLAEALDTYIPTPERAIDGTFLMPVE
                     DVFSISGRGTVVTGRIERGIVKVGDEIEIVGIKPTLKTTCTGVEMFRKLLDQGQAGDN
                     VGVLLRGTKREEVERGQVLAKSGSIKPHTKFAAEIYVLGKDEGGRHTPFFNGYRPQFY
                     FRTTDVTGAVELPAGTEMVMPGDNVSITVALIAPIAMEDGLRFAIREGGRTVGAGVVA
                     KIIE"
     CDS             286783..287091
                     /codon_start=1
                     /gene="rpsJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q10"
                     /locus_tag="ZMTM_02770"
                     /product="30S ribosomal protein S10"
                     /protein_id="BCM24018.1"
                     /transl_table=11
                     /translation="MAAQKIRIRLKAFDYRLIDQSALEIVETAKRTGAVVKGPIPLPT
                     RIERFDILRSPHVNKTSRDQFEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL
                     "
     CDS             287213..287869
                     /codon_start=1
                     /gene="rplC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6PB20"
                     /locus_tag="ZMTM_02780"
                     /product="50S ribosomal protein L3"
                     /protein_id="BCM24019.1"
                     /transl_table=11
                     /translation="MSLGLIGRKVGMTRIFTDEGESIPVTVLEVVPNRVTQVKTLATD
                     GYSGLQLAHGTRRASRVTKALAGHYAKAGAVAGSGIQEFPVSEGEAVNYAAGAQLTVE
                     LFQEGQIVDVTGTSIGKGFAGAIKRHNFSSNRASHGNSKSHNVPGSIGMAQDPGRVFP
                     GKRMPGHLGAIKTTVQNLQIIRVDVERNLLLIKGAIPGSKGGDVVVRPAVKVRVKAGA
                     "
     CDS             287869..288495
                     /codon_start=1
                     /gene="rplD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GK6"
                     /locus_tag="ZMTM_02790"
                     /product="50S ribosomal protein L4"
                     /protein_id="BCM24020.1"
                     /transl_table=11
                     /translation="MELKLIDQNGKPAKSGLEVSEITFGREFNEALVHQVVVAYQANA
                     RTATRAQLGRGNVSHTTHKPWNQKGTGRARAGMSSSPIWRGGGRAFPNSPDENFSHKV
                     NRKVYRAGLRSILSELVRQERLSVVAEFSVESPKTKLLVEKIKGFGYTDGVLVLVDGF
                     DENLYLSSRNLTNVLVIEAQYVDPVSLVRFPNVIATTGAVKKLEELLA"
     CDS             288492..288803
                     /codon_start=1
                     /gene="rplW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P9M0"
                     /locus_tag="ZMTM_02800"
                     /product="50S ribosomal protein L23"
                     /protein_id="BCM24021.1"
                     /transl_table=11
                     /translation="MSALTASQDRLLQVILAPQITEKATRIADKNQQIAFKVRTDATK
                     PEIKAAVELVFKVEVEAVTVANVKGKVKRAGRVLGRRKDWKKAYVSLKPGQEINFAAG
                     E"
     CDS             288812..289645
                     /codon_start=1
                     /gene="rplB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GK8"
                     /locus_tag="ZMTM_02810"
                     /product="50S ribosomal protein L2"
                     /protein_id="BCM24022.1"
                     /transl_table=11
                     /translation="MALVKVKPTSPGRRAVVKVVTPDLYKGKPHAPLLEKQSKKAGRN
                     HNGHITIRHQGGGHKQHYRLVDFRRNKDGIPAKVEHIEYDPNRSAHIALLVYADGERR
                     YIIAPRGVAAGAQLVSGSDAPIKAGNALPLRNIPVGSTIHCIELQPGKGAQVARSAGT
                     SVQLLAREGSYAQLRLRSGEVRRVHVDCKATIGEVGNEEHSLRSIGKAGAMRWRGVRP
                     TVRGVVMNPVDHPHGGGEGKTAAGMNPVSPWGTPTKGYRTRRNKRTDNMRVARRPANK
                     R"
     CDS             289651..289926
                     /codon_start=1
                     /gene="rpsS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q15"
                     /locus_tag="ZMTM_02820"
                     /product="30S ribosomal protein S19"
                     /protein_id="BCM24023.1"
                     /transl_table=11
                     /translation="MARSVKKGPFIDGHLAKKVEVAAAARDRKPIKTWSRRSTILPDF
                     IGLTIAIHNGKQHIPVLISENMVGHKLGEFALTRTFKGHAADKKAKK"
     CDS             289937..290266
                     /codon_start=1
                     /gene="rplV"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5F5T2"
                     /locus_tag="ZMTM_02830"
                     /product="50S ribosomal protein L22"
                     /protein_id="BCM24024.1"
                     /transl_table=11
                     /translation="MKVSAVLKGVHLSPQKARLVADLVRGKKVDYALNILNFSPTKGA
                     EIIKKVVESAIANAEHNEGADIDELKVLSIYVDKGVVLKRIRARAKGRAGKIIKPTSH
                     ITVTVGN"
     CDS             290277..290990
                     /codon_start=1
                     /gene="rpsC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q17"
                     /locus_tag="ZMTM_02840"
                     /product="30S ribosomal protein S3"
                     /protein_id="BCM24025.1"
                     /transl_table=11
                     /translation="MGQKIHPFGFRLSVQKNWSSRWYANSKNFPAMLNGDIKVREFLK
                     KKLSHAAVSKIIIERPAKNAKITIYSARPGIVIGKKGEDIESLRSTLQGLMGVPVHLN
                     IEEVRKPEIDATLIAESIAQQLEKRVMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGI
                     EIARTEWYREGRVPLHTLRADIDYGVAEAKTTYGIIGIKVWVFKGEVFGNKAELPAVA
                     AAEPEKKVRKPGAKNAAAS"
     CDS             290974..291390
                     /codon_start=1
                     /gene="rplP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GL2"
                     /locus_tag="ZMTM_02850"
                     /product="50S ribosomal protein L16"
                     /protein_id="BCM24026.1"
                     /transl_table=11
                     /translation="MLQPARQKYRKMQKGRNKGIATTGNKVSFGEYGLKAIGRGRLTA
                     RQIEAARRVMTRHIKRGGRIWIRIFPDQPISKKPAEVRMGNGKGSTEYYVAQIQPGKM
                     LYEMDGVSEELAREAFRLAAAKLPIETTFTTRHIGS"
     CDS             291393..291593
                     /codon_start=1
                     /gene="rpmC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P66169"
                     /locus_tag="ZMTM_02860"
                     /product="50S ribosomal protein L29"
                     /protein_id="BCM24027.1"
                     /transl_table=11
                     /translation="MKATELRNKSVDELNGELIELRRAQFSLRMQLATQQLNKVDQVK
                     KTRRDIARVRTVLAEKSKEQAK"
     CDS             291590..291862
                     /codon_start=1
                     /gene="rpsQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7DDT3"
                     /locus_tag="ZMTM_02870"
                     /product="30S ribosomal protein S17"
                     /protein_id="BCM24028.1"
                     /transl_table=11
                     /translation="MSENQTAKVVRSLSGRVVSDKMDKTVTVLVERKVKHPLIGKVVR
                     RSNKFHAHDETNECKEGDLVVIEESRPLSKTKTWRVSKIVEKARVI"
     CDS             292046..292414
                     /codon_start=1
                     /gene="rplN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GL5"
                     /locus_tag="ZMTM_02880"
                     /product="50S ribosomal protein L14"
                     /protein_id="BCM24029.1"
                     /transl_table=11
                     /translation="MIQMQSRLDVADNTGARSVMCIKVLGGSKRRYAGIGDVIKVTIK
                     DAAPRGRVKKGEVYSAVVVRTVKGVRRPDGSLVKFDGNAAVLLNNKLEPIGTRIFGPV
                     TRELRGERFMKIVSLAPEVL"
     CDS             292425..292742
                     /codon_start=1
                     /gene="rplX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q889W0"
                     /locus_tag="ZMTM_02890"
                     /product="50S ribosomal protein L24"
                     /protein_id="BCM24030.1"
                     /transl_table=11
                     /translation="MSKIRKGDEVVLNTGKDKGKRGTVLRVLETGHVLVEGVNVVKKH
                     AKPNPMKGVTGGIINKEMPVDVSNVALFNRATQKGDRVGFKTLDDGRKVRVFKSSDEV
                     VDA"
     CDS             292752..293291
                     /codon_start=1
                     /gene="rplE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9K1I4"
                     /locus_tag="ZMTM_02900"
                     /product="50S ribosomal protein L5"
                     /protein_id="BCM24031.1"
                     /transl_table=11
                     /translation="MARLKDFYNETVVKNLTEQFGYTSVMQVPRIEKITLNMGVGEAV
                     ADKKVMENAVGDMEKIAGQKAIVTKAKKSIAAFKIRDDYPVGCKVTLRRERMYEFLDR
                     LVTVAIPRIRDFRGISAKSFDGRGNYNMGVKEQIIFPEIEYDKIDVLRGMNITITTTA
                     KTDEEARALLAAFSFPFRN"
     CDS             293299..293604
                     /codon_start=1
                     /gene="rpsN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P66408"
                     /locus_tag="ZMTM_02910"
                     /product="30S ribosomal protein S14"
                     /protein_id="BCM24032.1"
                     /transl_table=11
                     /translation="MAKLCLIEREQKRRDTVKKYAAKRLALTAIVNDVNASSEDRRDA
                     RSKLQSLPRNSSPVRLRNRCALTGRPRGVFSKFGIARSKLRELMMRGEVPGVTKASW"
     CDS             293619..294014
                     /codon_start=1
                     /gene="rpsH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GL9"
                     /locus_tag="ZMTM_02920"
                     /product="30S ribosomal protein S8"
                     /protein_id="BCM24033.1"
                     /transl_table=11
                     /translation="MSMSDPIADMLTRIRNAQSTNKPAVSMPASKVKLAIAAVLKDEG
                     YIDDFAVQDVEGKPQLNISLKYYAGRPVIEKIERISRPGLRVYRGNQDIPKVMNGLGV
                     TIVSTSKGVMTDRKAQAAGVGGELLCVVA"
     CDS             294024..294557
                     /codon_start=1
                     /gene="rplF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0M9N3"
                     /locus_tag="ZMTM_02930"
                     /product="50S ribosomal protein L6"
                     /protein_id="BCM24034.1"
                     /transl_table=11
                     /translation="MSRVAKNPVAIPAKVEVVLNAGNISVSGPLGKLTHPLTGVVKLA
                     REGETITFVAENDSQHSRAMSGTLRALVANMVHGVSQGFSRKLTLVGVGYKAQAQGTT
                     LNLELGYSHPINHKMPEGVTVQTPTQTEVLLTGVDKQVIGQVAAQIRSYRAPEPYKGK
                     GVRYSDEVVIIKETKKK"
     CDS             294566..294931
                     /codon_start=1
                     /gene="rplR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7DDT0"
                     /locus_tag="ZMTM_02940"
                     /product="50S ribosomal protein L18"
                     /protein_id="BCM24035.1"
                     /transl_table=11
                     /translation="MTNNVNNVNPRLRRARKTRAKIAELKVTRLSVHRSNGHIYAQII
                     AETGDKVLASASTVEVEVRKDIKNGGNIAAAAAIGKRIAEKAKAAGITQVAFDRSGYK
                     YHGRIKALADAARENGLTF"
     CDS             294960..295469
                     /codon_start=1
                     /gene="rpsE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MBF9"
                     /locus_tag="ZMTM_02950"
                     /product="30S ribosomal protein S5"
                     /protein_id="BCM24036.1"
                     /transl_table=11
                     /translation="MMAKEIEQQQTDGLREKMIAVNRVTKVVKGGRIMSFAALSVVGD
                     GDGAVGMGKGKAREVPVAVQKAMDEARRGMVKVNLNNGTLHHAVTGVHGAAKVFIQPA
                     SEGTGIIAGGAMRAIFEVMGITNVLAKCIGSTNPYNVVRATLNGLQSMNTPSEVAAKR
                     GKTIEEIRG"
     CDS             295472..295678
                     /codon_start=1
                     /gene="rpmD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HWF3"
                     /locus_tag="ZMTM_02960"
                     /product="50S ribosomal protein L30"
                     /protein_id="BCM24037.1"
                     /transl_table=11
                     /translation="MAKAKKEVEAVGTVKVTLVKSTIGRIASHKASVAGLGLRRMHHT
                     VEVKDTPENRGMINAVNYLLKVEA"
     CDS             295678..296112
                     /codon_start=1
                     /gene="rplO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q30"
                     /locus_tag="ZMTM_02970"
                     /product="50S ribosomal protein L15"
                     /protein_id="BCM24038.1"
                     /transl_table=11
                     /translation="MKLNSIKPAEGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRTGG
                     FHKVGFEGGQMPLQRRLPKRGFVSLTKADTAHVRTSELLQVTSDVIDLLALKEAKVVP
                     ASAKSVKVYLSGDLTRAVSVQGLLLSKGARAAVEAAGGKIVE"
     CDS             296117..297439
                     /codon_start=1
                     /gene="secY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P9K3"
                     /locus_tag="ZMTM_02980"
                     /product="protein translocase subunit SecY"
                     /protein_id="BCM24039.1"
                     /transl_table=11
                     /translation="MANDSIFGAFGKMSELKGRLLFVLGALVVYRLGAHIPVPGIDPD
                     ILAKLFESNNNGILGMFNMFSGGALSRFTVFALGIMPYISASIIMQLLTVVSPKMEQL
                     KKEGEAGRRQITKYTRYGTVFLATFQALGIAIALEGQAGLVIDPGLMFRFTAVITLVS
                     GTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPHAVFGTLELARTGAFSIPLVLGLF
                     VATVGVVYFVVFVERGQRKITVNYAKRQVGRKVFGGQTSHLPLKLNMAGVIPPIFASS
                     IILFPATLAGWFGSNEHMTWLKDIGSTLSPGQPLYIILFATAIIFFCFFYTALVFNPK
                     ETADNLKKSGAFVPGIRPGEQTAKYIDKITGRLTMIGAIYITLVCLLPEFLILKFNVP
                     FYFGGTSLLIIVVVTMDFMTQVQAHLMSSQYEGLLKKANFKGSAVSTR"
     CDS             297451..297669
                     /codon_start=1
                     /gene="infA2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q32"
                     /locus_tag="ZMTM_02990"
                     /product="translation initiation factor IF-1 2"
                     /protein_id="BCM24040.1"
                     /transl_table=11
                     /translation="MAKEDSIEMQGVVLENLPNATFRVKLENDYVVLGHISGKMRKNY
                     IRILPGDKVTVEMTPYDLSRARIIFRVK"
     CDS             297973..298335
                     /codon_start=1
                     /gene="rpsM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GM8"
                     /locus_tag="ZMTM_03000"
                     /product="30S ribosomal protein S13"
                     /protein_id="BCM24041.1"
                     /transl_table=11
                     /translation="MARIAGVNIPNHKHTEIALTSIYGVGRNTAKQICLAAGVLSTTK
                     IKDLNDAEVEKLRDEIAKLKVEGDLRREVTMNIKRLMDLGCYRGVRHRRGLPVRGQRT
                     KTNARTRKGPIKPIKSSK"
     CDS             298362..298751
                     /codon_start=1
                     /gene="rpsK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P66355"
                     /locus_tag="ZMTM_03010"
                     /product="30S ribosomal protein S11"
                     /protein_id="BCM24042.1"
                     /transl_table=11
                     /translation="MAKANVRVRKKVKKNIAEGIAHVHASFNNTIITITDRQGNALSW
                     ATSGGAGFKGSRKSTPFAAQVAAEAAGKAAQECGVKNLEVRIKGPGPGRESAVRALNA
                     LGLKITSISDVTPVPHNGCRPPKKRRI"
     CDS             298811..299794
                     /codon_start=1
                     /gene="rpoA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P66704"
                     /locus_tag="ZMTM_03020"
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="BCM24043.1"
                     /transl_table=11
                     /translation="MQNSPTEYLKPRVVDVEVISPVRARVTLEPMERGFGYTLGNALR
                     RVLLSSIPGFAITEVKIDGVVHEYSTIDGVQEDVVDILLNLKGVALKLNSKSETTLIL
                     NKSVEGVVTAADFETGHDAEIANPNHVIAHLTKGGKLNLEVKVQMGRGYQPVPARLKS
                     DEDRVLGFIQVDASFSPISKVSYHVESARVEQRTDLDKLVMDVETNGVVEPEQAIRDA
                     ARILMGQLAVFADLEGAPTEIEVKNAPQVDPILLRPVDDLELTVRSANCLKAENIYYI
                     GDLIQRGENELLKAPNLGRKSLNEIKDVLASKGLTLGMKLENWPPVGLEKI"
     CDS             299895..300227
                     /codon_start=1
                     /gene="rplQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P715"
                     /locus_tag="ZMTM_03030"
                     /product="50S ribosomal protein L17"
                     /protein_id="BCM24044.1"
                     /transl_table=11
                     /translation="MFRNMATSLLRHEIIKTTLPKAKELRRVAEPLITLGKTPTLANR
                     RLAFARLRDRDIVGKLFAELGPRYQTRNGGYLRILKCGFRLGDNAPMALIELVDRPDL
                     TAEPVVAE"
     CDS             complement(300293..300532)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003119787.1"
                     /locus_tag="ZMTM_03040"
                     /product="glutaredoxin family protein"
                     /protein_id="BCM24045.1"
                     /transl_table=11
                     /translation="MINLILYGTSGCHLCEEAEALLGRLEDEYPITLQLVDIADDESL
                     VEAYGIRIPVLINTDKSELSWPFNENDLRVWLKEN"
     CDS             300724..302208
                     /codon_start=1
                     /gene="mgtE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I544"
                     /locus_tag="ZMTM_03050"
                     /product="magnesium transporter MgtE"
                     /protein_id="BCM24046.1"
                     /transl_table=11
                     /translation="MTTDHKKTIAKDDISEESAFQEAKESLQESLQQVITLLNKHKLV
                     ENLVHKQDMAKHQLVETLVHKQNLVELQKKLDALHPADVAYILEALPLEQRLDVWELV
                     KAERDGEILLEVSDAVRQTLIADMDSEELLAAAEQLDTDELADLAPDLPKDVLQDLLE
                     SLDIQNRERLQSALGYDEDDVGALMDFDIVTIREDITLEVALRYLRRIGSLPDHTDKL
                     FVVDRNNILLGVLPLKRMVVNDLDAEVLDIMAEDTVTFHPDDKADEAAKAFERYDLVT
                     APVVDENNKLVGRLTVDTVMDFIRDEAESDMLSMAGLREEEDLFSSVWKSVQNRWTWL
                     AVNLVTAFVASRVIGLFEGSIEKIVALAALMPIVAGIGGNSGNQTTTMIVRGLALGQI
                     ASHNMKSLLIKELGVALLNGIIWGGVLGIASYLLYKNVTLGLVMTSAMTLNLLLAAIM
                     GVLIPLVMTKAGRDPAVGSSVLITAMTDSGGFFIFLGLATIFLV"
     CDS             302220..303512
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004522601.1"
                     /locus_tag="ZMTM_03060"
                     /product="mechanosensitive ion channel protein"
                     /protein_id="BCM24047.1"
                     /transl_table=11
                     /translation="MNEEISLLMQDLFTDTASPVILWQLGVIVVALGLAWSINGLLKN
                     YIMQHAPETWKVGIGGIKRVLFPLSSLLIVYAGQLALKQWQHVSMLKLAATLLIAMAV
                     IRLVVYALRYIFAPGGWVRALESVIASVVWLILALHLTGLLPDLLQTLEDVNFKVGKT
                     NANLLIVLQGAFTIIITLFIALWLSRLLENRLMQAQQINMNMRVVLTKLLRILLSLIA
                     VLVGLSAVGLDITLLSVFGGAIGIGLGFGLQKITSNYVSGFIILMDKSMQIGDVVTIE
                     THYGIVGDLRSRYLVLNKLDGTQVIIPNETLITSMVINHSLTDRKSRVQLPIQISYDS
                     DLEKAMNIMRDIAVKHPRVIQDPAPSAYILAFGESGIDLNLNCWIIDPEEGSSNLKSA
                     IYLEIWRAFQASGIVIPYPQREVRVLGEVAMNNKNSAT"
     CDS             303539..304729
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004186237.1"
                     /locus_tag="ZMTM_03070"
                     /product="aminotransferase"
                     /protein_id="BCM24048.1"
                     /transl_table=11
                     /translation="MNNNLWLIDLPWWGYIVVALAFTHITIAAVTIYLHRCQAHRALE
                     LHPIVSHFFRFWLWMSSGMVTKEWAAIHRKHHAKCETEDDPHSPQVLGIQKVLREGAE
                     LYRAEAKNLETLEKYGSGTPDDWMERNVYTKHSGVGLRMMLIINVVLFGPLGLTIWAV
                     QMAWIPITAAGVINGIGHYWGYRNFAADDASTNIIPWGILIGGEELHNNHHSYASSAK
                     LSSKWYEFDIGWMYIRLMQMVSLAKVKKIAPKVHFDWAKTRCDLDTLQAVITHRFDVM
                     GKYGAMLKTAYKQELDKIHHAYEQRSHERVSIERIKHWLHLDAIHLQDKEKQELHNAL
                     QHTHQLQKIYDLKQELMAIWSRSTVTQEQLLKSLEDWCHRAEASGIEALEEFSRRLRC
                     YKMA"
     CDS             complement(304806..304961)
                     /codon_start=1
                     /gene="rpmG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P66226"
                     /locus_tag="ZMTM_03080"
                     /product="50S ribosomal protein L33"
                     /protein_id="BCM24049.1"
                     /transl_table=11
                     /translation="MREKIKLESSAGTGHFYTTTKNKRTMPEKMEIKKFDPVARKHVL
                     YKETKLK"
     CDS             complement(304971..305207)
                     /codon_start=1
                     /gene="rpmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VWY1"
                     /locus_tag="ZMTM_03090"
                     /product="50S ribosomal protein L28"
                     /protein_id="BCM24050.1"
                     /transl_table=11
                     /translation="MARVCQVTGKKPMVGNNVSHANNKTKRRFLPNLQNRKFWVESEN
                     RWVSMRITNAALRTIDKNGIDAVLAGMRASGEKI"
     CDS             complement(305303..305755)
                     /codon_start=1
                     /gene="dut"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HL1"
                     /locus_tag="ZMTM_03100"
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="BCM24051.1"
                     /transl_table=11
                     /translation="MSLKVELKILDERLRNHLPSYATPGSAGLDLRACLEHTQTLNPG
                     ETTLIPTGMAIYLRDPNYAAMILPRSGLGHKHGIVLGNLVGLIDSDYQGQLLVSCWNR
                     GREPFMLNPMERIAQLIIVPVIQADFSVVDEFAASERGEGGFGSTGKH"
     CDS             complement(305779..307017)
                     /codon_start=1
                     /gene="coaBC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004186216.1"
                     /locus_tag="ZMTM_03110"
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /protein_id="BCM24052.1"
                     /transl_table=11
                     /translation="MPVAFHVKSTDIKPLIIMTYSPIKKLVLGITGGIAAYKAAELVR
                     LLVKQGIDVQVVMTKSACEFITPITLQALSGKPVFSEMWDGSIANGMPHIELSRSADA
                     ILIAPASANFLSKLVHGSADDLLSTLCLARDCPLIVAPAMNKQMWENPATQRNIQQLQ
                     ADDIKVIGPDAGEQACGEVGLGRMLEPAEIAEWLSTAFLPKIFKGKRILVTAGPTLES
                     IDPVRALTNFSSGKMGYSIARVAQAMGAEVTLVSGPTSLTTPLVSHFESVTSAEEMYQ
                     AVMYAIAQQDIFIGVAAVADYRPAEYSAKKIKKSGQPLTLELIPNRDIIAEVAAMPNA
                     PFCVGFAAESDDLLKHAEEKRQRKKLPLVVANIASDTMGKDDASIVLLDDEGTHTFSY
                     APKAELAATLLQHIANIMNI"
     CDS             307016..307690
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HTN5"
                     /locus_tag="ZMTM_03120"
                     /product="UPF0758 protein"
                     /protein_id="BCM24053.1"
                     /transl_table=11
                     /translation="MAITDWPEGERPREKLLANGVAVLSDAELLAIFLRVGVTGKSAV
                     DLARDLLNAFGSLNGIFSASLAEITAINGMGDSKFAQLQAIFEMSRRALQEDMQSRDV
                     LSSPKQVRDYLCLKLGSLNREVFLVLFLDAQNRVLAQESMFEGTLTQTSVYPREIVKR
                     ALHHNAASVIFAHNHPSGIAQQSRADEMLTKALKDALALVDVRVLDHFVVAGNQTLSF
                     AERGLL"
     CDS             complement(307763..308050)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03130"
                     /product="hypothetical protein"
                     /protein_id="BCM24054.1"
                     /transl_table=11
                     /translation="MLFAASLSMSYAAAEDAGSDIEAVTASGDKVILQPNGRWKFVEK
                     EKAVVAEKISKQYVENQGCPNGTQGGFFGLGVGRCIKPGDKDFNRGTLNPK"
     CDS             308306..308527
                     /codon_start=1
                     /gene="osmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P0ADA9"
                     /locus_tag="ZMTM_03140"
                     /product="osmotically-inducible lipoprotein B"
                     /protein_id="BCM24055.1"
                     /transl_table=11
                     /translation="MNRASKFFTVSLLTFTLLSLSACSGMTKRDKNTAVGAGVGAVAG
                     AVLTGGSAIGTVGGAAVGGVIGNQVGKHK"
     CDS             308744..310798
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011110509.1"
                     /locus_tag="ZMTM_03150"
                     /product="carbon starvation protein A"
                     /protein_id="BCM24056.1"
                     /transl_table=11
                     /translation="MNHVFKKIGWILVALLGATAVSAIATHRGESINALWFITAALCI
                     YAIAYRFYAAWIIAKVLTVDETRATPAERMDNGRDFVPTNKWVVFGHHFAAIAGPGPL
                     VGPTLAAQFGYLPGTLWILIGAVLGGCVQDTVTLFLSTRRNGKSLGQMARDELGPIGG
                     SAALIGTFAIMIILIAVLGLVVVNAMKHSPWATSTVAATIPIAMIVGLYMRHFRPGQV
                     LEASALGVALLLLAVFMGGFVDHHPTLRVIFDHDGLTLAWWVIAYGLAAAVLPVWLLL
                     APRDYLSTFMKLGTVIVLALAIFIWRPDVQMPALTKFIDGTGPIFGGSLFPFVFITIA
                     CGAVSGFHALIASGTTPKLIANERDIRMIAYGGMLLESFVAIMAMVAATVLEPGVFFA
                     INSPAGVVGKEAADAVAMISSWGFPVTVEQMQSLATDMGESTLFARTGGAPSLAVGMA
                     TIFGKAFGQGLLALWYHFAIMFEAIFILTTLDAGTRVGRFMLQDMLSNIWPKMGQTSW
                     YPSVILTSGLVVAGWGYFLYIGVIDPNGGVNILWPMFGIANQMLAAIALSVGTGILIK
                     NGKLKYAWVTGLPLVWLVTLTTSAAWEKITSPDVRVGFFAAANDLASKLAAGLLPPEK
                     AAVAPQLILNQRLDAWLTLFFVVMLWIVVLDMLRVCVRYLAGKSVRPNTETPYVATQL
                     VN"
     CDS             310828..311013
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03160"
                     /product="hypothetical protein"
                     /protein_id="BCM24057.1"
                     /transl_table=11
                     /translation="MIKRLKAFWRLVRRLSGDDAYEQYLAHFAAHHDAVDELPLSKEA
                     FFKQWQNNKWTGIKRCC"
     CDS             complement(311035..311223)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03170"
                     /product="hypothetical protein"
                     /protein_id="BCM24058.1"
                     /transl_table=11
                     /translation="MISLIQSMFDKNTGTKADSSLPLQANEKPRDELKIAPSSSNNHG
                     IEVQELSFEDVARIMGGK"
     CDS             complement(311425..312213)
                     /codon_start=1
                     /gene="umpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P8N5"
                     /locus_tag="ZMTM_03180"
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="BCM24059.1"
                     /transl_table=11
                     /translation="MLIHPEFDPVAIHLGPLGIHWYGLMYLFGFMSLLFLGKWRARKY
                     PERGWTETDLDDILFYGAMGVIFGGRLGYVVFYQPTYFISHPLEIFFLWQGGMSFHGG
                     FLGVLTAMFFFARKTGKQWLSIMDFVAPLVPIGLAAGRMGNFINGELWGRATNLPWGM
                     VFPRVDNVPRHPSQLYEFGLEGILLFIILWTYSAKPRPVGAISGLFLIGYGTFRFLVE
                     FTRQPDSFLGFLALGMSMGQWLSLPMVLVGIWMLRSALANKFTR"
     CDS             312328..314178
                     /codon_start=1
                     /gene="ilvD1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7W069"
                     /locus_tag="ZMTM_03190"
                     /product="dihydroxy-acid dehydratase 1"
                     /protein_id="BCM24060.1"
                     /transl_table=11
                     /translation="MPEYRSRTTTHGRNMAGARALWRATGMKDGDFDKPIIAISNSFT
                     QFVPGHVHLKDLGQLVAREIERAGGVAKEFNTIAVDDGIAMGHAGMLYSLPSRDLIAD
                     SVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVNWQGKEH
                     KLDLVDAMVAAADSRVSDAESDAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGN
                     GSTLATHGARKELFLKAGRTIVELAKRYYEQDDDSVLPRSIANMQAFENAMSLDVAMG
                     GSTNTVLHLLAAAHEAGIDFTMADIDRISRGVPCICKVAPATAKYHMEDVHHAGGVMG
                     ILSELSRGGLIHRDTPTVHSPTMGDALDKWDITTTQDEDVKKFFRAAPGGIATTIAFS
                     QSMLFPTLDDDRAEGCIRDIEHAYSKDGGLAVLYGNIALDGCIVKTAGVDDSILKFTG
                     RARIFESQDAAVEAILADTVVAGDVVVIRYEGPRGGPGMQEMLYPTSYLKSKDLGKVC
                     ALLTDGRFSGGTSGLSIGHASPEAAEGGAIGLVEEGDTIEIDIPNRTIHLAISDEIMA
                     HRRATMEAKGKAAWKPLNRNRVVSPALRAYAAMSTSAARGAVRDVSQIEK"
     CDS             314226..315161
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011269392.1"
                     /locus_tag="ZMTM_03200"
                     /product="D-hexose-6-phosphate mutarotase"
                     /protein_id="BCM24061.1"
                     /transl_table=11
                     /translation="MDTSQSATKEYESKYPSSHVAEDQVRFTKDEAGLDYIEIENRHA
                     TAKLALQGAHLMHWHPKHTAQPVLWMSEQSRFEPGRSIRGGIPLCWPWFGAHPTDSSL
                     CMHGFARVTPFSVIDIGQMYNGNTRVILQMKQTENSQRQLSYPYTLTMTIEIGATLSI
                     KLSTTNRATQPFFMGEAFHTYFNVSDVEKVSVSGLDNTEYADKLLDYWRGTQEGDLTF
                     NQEFDRVYVSTKTAVKIHDPAFNRDIVINKKGSSTTVVWTPWQKKAHQMADMAKDDSW
                     RKMLCVETANAMENLVMINPGYTHILAVEYSVESV"
     CDS             315189..315515
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03210"
                     /product="hypothetical protein"
                     /protein_id="BCM24062.1"
                     /transl_table=11
                     /translation="MKALFILAAAASSLLLAGQAAAVDAGAAEALAQKSGCLACHSVA
                     NKIVGPAYKDVAAKYRGDKTAEAKLIAKVKAGGSGVWGPIPMPANSPHVKDEDIKTIV
                     QWVLTL"
     CDS             complement(315598..316995)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010945788.1"
                     /locus_tag="ZMTM_03220"
                     /product="amino acid permease"
                     /protein_id="BCM24063.1"
                     /transl_table=11
                     /translation="MLAQLFRTKAIATETHSGLKKCLSAFDLALLGIGGAIGTGIFVL
                     TGLAAATQAGPAVIISFIIAGVASAFAALSYAELSASVGGSGSAYGYSYVAFGEFFAW
                     VIGWILLLEYGVGAAAVANGWAGYFIRTLTNFGLSMPELYTKAPSMGGIINLPAFSII
                     WVLTLLLISGVKQSAQVNNIMVAIKLSTIAIFLVLAGMNLHSENWHPFMPFGWFDTLD
                     NGKTIGVLAGASLVFFAYFGFDAVSTAADEAKNPQRDLPIGLIASVTFCTIIYILVSG
                     FLTGIVSYTELNTSSPVAFALTKIGYTWASTLVATGVLAGLITVLLVLLYGLTRILYA
                     MSRDGLISPFFSAINPERQTPVRIILLCGFVISIIAGFIPLGELAETVNIGTLASFIM
                     VCVGVIVLRIRQPNLKRPFKNPWNPLIPVLGIITCGALTAFLPAETWHRFFIWIAVGV
                     VIYFAYSMHHSKLKS"
     CDS             complement(317052..317981)
                     /codon_start=1
                     /gene="hemF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VWE7"
                     /locus_tag="ZMTM_03230"
                     /product="oxygen-dependent coproporphyrinogen-III oxidase"
                     /protein_id="BCM24064.1"
                     /transl_table=11
                     /translation="MSTEINANAVFDYLSGLQSRIIEAIEMVDGKTFLHDSWQRPEGG
                     GGTSCMLEEGNVFERAGVGFSHVLGNKLPPAATIAHPEAAGRSWEAMGVSLVFHPRNP
                     YIPTVHMNVRFFVAKAPKHEDTPDIWWFGGGMDLTPYYGFDEDVIHFHRTCRDALAPF
                     GDSLYPRFKKHCDDYFFLKHRNEPRGIGGIFFDDFNELGFVDSFAMLKAVGEAFLQAY
                     LPIAQRRKDTPYGDQQRDFQAYRRGRYVEFNLVYDRGTLFGLQSNGRTESILLSMPPI
                     VKWRYDWKPADGSEEAKLYSQFLKHRDWLPPAN"
     CDS             complement(317988..318539)
                     /codon_start=1
                     /gene="tsaC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEX6"
                     /locus_tag="ZMTM_03240"
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="BCM24065.1"
                     /transl_table=11
                     /translation="MTQARGLRSYLRSGGVIAYPTESIFGLGCDPDNRLAVQRILRIK
                     QRPKHKGLILLADRFSAFQRYIAPLTASQIASMQHSWLGKAPHTWLVPAAKDCPKWLS
                     GKHKTIAIRVTQHAFSKRLCKQLGMALVSTSANKSGHQPAKTSRQCYKLFSGQTRILP
                     GMTAGAKKPSTIQDLLTGKILRK"
     CDS             complement(318550..319818)
                     /codon_start=1
                     /gene="purD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MED4"
                     /locus_tag="ZMTM_03250"
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="BCM24066.1"
                     /transl_table=11
                     /translation="MKVLVIGSGGREHALAWQIAKNQNISRVYVAPGNAGTALNPDMI
                     NVPITGVPELVEFALNEKIALTVVGPEAPLSQGVVDAFRAAGLKVFGPTKAAAQLESS
                     KDFAKALMIRHSIPTAAYATFTDAAAAHDYVTQQGAPIVIKADGLAAGKGVVVAMDEA
                     EAHEAIDSMLSDNKLGSAGARVVIEEFLTGEEASFIVMVDGKNILALATSQDHKRLLD
                     GDLGPNTGGMGAYSPAPVVTPDIHAKVMREIIKPTVEGMAKDGIPYTGFLYAGLMISP
                     DGTVKTLEFNCRMGDPETQPIMLRLKTDFVSLLEHAVEGTLDQVTVDWDRRYALGVVM
                     ASANYPDTPRTGDQITGLPKDLQEAHVFHAGTTLTDGKVLTSGGRVLCVTALGETVKY
                     AQLRAYQIAEEIKFDGSQMRTDIGYKALKH"
     CDS             complement(319834..321429)
                     /codon_start=1
                     /gene="purH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HA6"
                     /locus_tag="ZMTM_03260"
                     /product="bifunctional purine biosynthesis protein PurH"
                     /protein_id="BCM24067.1"
                     /transl_table=11
                     /translation="MAIKRALISVSDKQGILEFAKDLSSFGVEILSTGGTAKLFRDNN
                     IPVIEVSDYTGFPEMLDGRVKTLHPKVHGGILGRRDLPEHVTAMNEAAIPNIDMVVVN
                     LYPFEATVAKADCTLEDAIENIDIGGPAMVRSAAKNWKDVAVVTDASQYAGVIAEMKS
                     TGGATSQATRFALSVAAFNRISNYDGAISDYLSSFNADGTRNDFPAQTNGRFVKLQDL
                     RYGENPHQQAAFYRDLYPAPGSLVTAEQLQGKELSYNNIADADAAWECVKSFDSSLNT
                     AACVIVKHANPCGVAVGINALEAYSKAFKTDPTSAFGGIIAFNATVDAAAAEAVAKQF
                     VEVLIAPDFTADALAIFKAKANVRVLKIALPAGGETAWQKGRNSHDTKRVGSGLLIQT
                     ADNHQISMSDLKIVTKKQPTPEQLQDLLFAWRVAKYVKSNAIVFCGDGMTLGVGAGQM
                     SRVDSTKIAAIKAQNAGLSLKNSAVASDAFFPFRDGVDVLAKAGAACVIQPGGSIRDD
                     EVIAAADEHGLAMILTGIRHFRH"
     CDS             complement(321478..321711)
                     /codon_start=1
                     /gene="fis"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004194052.1"
                     /locus_tag="ZMTM_03270"
                     /product="Fis family transcriptional regulator"
                     /protein_id="BCM24068.1"
                     /transl_table=11
                     /translation="MSNQQIGDCVRAALDEYFKDLDGQPPHAVYDMVLQCVEKPLLEY
                     VLNRAGGNQSKTAEILGLNRNTLRKKLQQYKIQ"
     CDS             complement(321744..322775)
                     /codon_start=1
                     /gene="dusB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WL87"
                     /locus_tag="ZMTM_03280"
                     /product="tRNA-dihydrouridine synthase B"
                     /protein_id="BCM24069.1"
                     /transl_table=11
                     /translation="MQIGPYKLKNNLVVAPMAGVTDRPFRILCKKLGAGLAVSEMVTS
                     NSLLYGSTKTLRRANHEGEVDPISVQIAGADPKMMAEAAKYNVDNGAQIIDINMGCPA
                     KKICNVMAGSALLKDEPLVSQILKAVVNAVEVPVTLKIRTGWDKQNRNAIAVARMAED
                     IGIQALAMHGRTRACLYMGDAEYDTIAAVKQAIKIPLIANGDITTPEKAKYVLEYTGA
                     DAVMIGRAAQGRPWIFREIAHYLATGEHMLPPEVSEIHSVMLEHVNDLYGFYGELAGM
                     RVARKHISWYTKGLKDSANFRHMMNQLQTIDEQQAAINTFFEQLKQQNQHLQYADDTD
                     EALAEALAA"
     CDS             323246..325333
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03290"
                     /product="hypothetical protein"
                     /protein_id="BCM24070.1"
                     /transl_table=11
                     /translation="MLGIASYFVGQLLWDVQQYFHWNAFPAPADVFYLLLGPFCLIGL
                     LQVLNAKLEGAKKIAAWIDLSTISISVIGLVLALYLSNDTDRRLPQMLAVISYPIGLL
                     SAASVALLINLFLRLKPCWPNYLFFLAFMIEGSIWMQWNLDVLDTQIEQGQLLKNMFS
                     VADILIGLSAMGWRAEVSDSLKQIAISRFIQRLIPVASMFISVLTIIVIFFDTVVPIA
                     KFVALISALLIIVLAMMRQSLLLVDSERLLEADRLINEANLRYEYLANHDVLTGLPNR
                     RLFQDRLTHAIAMANRHHYELALLFIDIDRFKDVNDSLGHIQGDMLLVELVSRLKGRL
                     REQDTFARIGGDEFVVLMENIESKNQAAVIAQTIIDLLEAPFTLKNNQQVVVGASIGI
                     SLFPYDAENDVQLIRNADSAMYRAKESGRNNHQFYTAELTKIAHARFTLDTQLRQGIE
                     AKQFVLFYQPIVEYDKDTKLTKVVGVEALIRWYRNGNELVMPNDFIPFAEDTGLIVPI
                     GKWVLQQACKQLVEWDALGLSDLKLAVNISPRQFHDANFINSIESVLNESGLSANRLT
                     LEITEGAIMEQEDMAVEILLALKALGLRIAIDDFGTGHSSLSKLRFLPLDELKIDRAF
                     VRNIPENSDDMHIATTILAMAKGLRLHVVAEGIETEEQLAFFAHSGCEQYQGYKFSRP
                     LPAADLPAFIQNI"
     CDS             complement(325361..326101)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192990.1"
                     /locus_tag="ZMTM_03300"
                     /product="damage-inducible protein"
                     /protein_id="BCM24071.1"
                     /transl_table=11
                     /translation="MQNFGIYIIGDEILSGKRQDAHLTKAISLLKARGLSLAWANYLG
                     DIPEQITTSLKASMARGDIVFSFGGIGATPDDFTRVCAAEAAGVSIERHAGAVAELEA
                     RFGEATYPKRILMADFPKGAELVPNPVNRVAGFSINQHYFLPGFPEMAHPMMEWALDT
                     HYSHLFNQQVTIEASILVMDAGESQLLDLMNQIVSNHPETKLFSLPKLDTRRTIELGV
                     KGSASQVEAAISDIKQAITALGFPWSPI"
     CDS             complement(326110..326451)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011020160.1"
                     /locus_tag="ZMTM_03310"
                     /product="DUF86 domain-containing protein"
                     /protein_id="BCM24072.1"
                     /transl_table=11
                     /translation="MSDKPAREWRFYITDMVTFAENVISYTDGFELDRFVNSGITYDA
                     TLRNLELIGEAATRIPQEVREQYADIPWRLVIATRNKLIHGYLGIDNDTLWSIIQSDI
                     PELLSQLQLIK"
     CDS             complement(326444..326734)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011020161.1"
                     /locus_tag="ZMTM_03320"
                     /product="nucleotidyltransferase"
                     /protein_id="BCM24073.1"
                     /transl_table=11
                     /translation="MKKQQAIQSLTNSKAELVRRFGVTRLALFGSTARDNATDKSDID
                     ILVNFDGIATSQRYFGVQFYLEDLLGCSVDLVTEKALRTELRPYIEREAINV"
     CDS             complement(326812..327858)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03330"
                     /product="hypothetical protein"
                     /protein_id="BCM24074.1"
                     /transl_table=11
                     /translation="MILKEKQPGNSRDPRLRAGEDAEKQMAFYLQRAFAKKNDCFVLN
                     DLRVTHSGDTAQVDHLIVTQFGLFIIESKSVHGKITINEFNEWSRTFNKVAEGMPSPV
                     LQAEAQGSVLKELLKAHKEQLLGKVIFGKVQKGFLNCPVFVYVAISDSGIIDRKKEVP
                     ELFKADQISKQILTELESLKKKNNPLSLSLSLPWEMELSEVKIVAEFLLSQHQPKPTN
                     KSLPAKQEVAEYKTASKNETAKGFVPKAGAICPECGNHKLIRKSVTRSDNTETDFLAC
                     AAYPKECKAIFALVAVAKTLNKPEKLETEKEEHKEHDTCPRCKNGTLVGRKAKTEFLG
                     CSQYPKCKFTSYRN"
     CDS             complement(327885..330641)
                     /codon_start=1
                     /gene="polA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004540200.1"
                     /locus_tag="ZMTM_03340"
                     /product="DNA polymerase I"
                     /protein_id="BCM24075.1"
                     /transl_table=11
                     /translation="MKTLLLVDGSSYLYRAFHAMPDLRNKANEPTGAIQGVLNMLRRL
                     HKDYPADYSACIFDAKGKTFRDDIYPEYKANRAAMPDDLRPQIAPLHEAIRAMGWPLI
                     VEDGVEADDVIGALAKQAEREGVRVIISTGDKDISQLVNEHVTVVNTMRDAFRKTDEV
                     LDVAGVENKFGIPPSLMIDYLVLIGDTSDNVPGVEKVGPKTAVKWLKQYGSLDNIVAH
                     ADEITGVVGENLRKALSWLPTARELITIRCDVGIQENLADLAPQPQDRAKLAELFDRF
                     DFKTWRRELDLPAAPANMPTATPAPASTHASGDLFAAAAVHSRHYETILTEQDLSKWL
                     DKISQAELVCFDTETTSLDPMTAKLVGMSFATIAGEAAYLPLKHDYPGAPDQLPFEAT
                     LARIKPLLENAAIKKVGQNLKYDKHVLANLNIELNGITHDTLLQSYVLESHRSHGMDD
                     LAMRHLGVQTITYAEIAGKGAKSVGFSQVALEQASEYAAEDADITLQLHESLYPQIKP
                     DAKLDFIYSQIEMPSMEILFAIERNGVLIDSNMLNKQSNEIGLKLMELERQAYELAGQ
                     PFNLGSPKQLQEILFDKLGIKSTKKTPSGAPSTDEDVLQELALDHPLPKVLLEYRGLA
                     KLKSTYTDKLPKMINAQTGRVHTSYNQAVAITGRLASSDPNLQNIPVRSTEGRRIREA
                     FIAPAGSVIVSADYSQIELRIMAHLSQDEGMLQAFANNEDIHRATAAEIFGVEREAVS
                     NEQRRYAKVINFGLIYGMSAFGLAQNLNIERSAAATYIERYFARYPGVRQYMQNTREI
                     AKQNGYVETYFGRRLWVPEINSPNGMRRAGAERAAINAPMQGTAADLIKLAMIAVQNW
                     LVSGKLATKLIMQVHDELVLEVPENELALIKEKLPELMQNVAKLDVPLLAEVGVGSNW
                     EAAH"
     CDS             330661..331395
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WCD0"
                     /locus_tag="ZMTM_03350"
                     /product="cytokinin riboside 5'-monophosphate
                     phosphoribohydrolase"
                     /protein_id="BCM24076.1"
                     /transl_table=11
                     /translation="MSIFTTKKLPKITDQAVPESESTSHESWHAFEIMAEFVDATERL
                     KQITPAVSIFGSARTKPDSPYYQLTEEIARQLSDAGFSVISGGGPGIMEAANKGAFAG
                     KSPSIGLNIELPFEQKGNAFQDIGINFQHFFMRKVMFVKYASAYVVMPGGFGTLDELM
                     EAMTLVQTGKTRKIPIILVCEPFWRGLVDWFKNTLVAEGVVSAGDIDLVQMIDDPKDI
                     VEAIFKHYEARGFELSAAEKQVQLYL"
     CDS             331445..331831
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03360"
                     /product="hypothetical protein"
                     /protein_id="BCM24077.1"
                     /transl_table=11
                     /translation="MRFLLELAYIFKPEVTMRLFRYCLLLILLLPVLAKAAGQPDNLQ
                     PLPDALPPPPGVTDANEEPEITITKKGENTVEEYRIHGELYMQKITPAHGVPYYLMKE
                     DQEGGWSRSDGPTAPLAVPKWILFRF"
     CDS             331889..332839
                     /codon_start=1
                     /gene="thrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4W557"
                     /locus_tag="ZMTM_03370"
                     /product="homoserine kinase"
                     /protein_id="BCM24078.1"
                     /transl_table=11
                     /translation="MSVFTTVTPQQLSEWLKAYPLGELLDLQGIASGITNTNYFVTTS
                     TGRYVLTLFEANTAEELPYFLDLMAHLAQHQVLCPSPVRNIAGNSLGELNGKPAALVS
                     CLKGRSLEVPSAVHCAEVGRVLAAMHIAGESFTANMENPRGANWRLTTGNKLIDLLTA
                     QDRALLESALSAEANQSLDGLPQGVIHADLFRDNVLFDGEQMGGVIDFYYACNDVLLY
                     DVAIAVNDWCTNEDGSLNAELTVALLKAYHAVRPLTELEHQAWPNQLMSAALRFWLSR
                     LYDFHFPNVGELTHAKDPAHFQKILQKRINEQASLATLWV"
     CDS             332876..333673
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03380"
                     /product="hypothetical protein"
                     /protein_id="BCM24079.1"
                     /transl_table=11
                     /translation="MFKDSMKEGLLWIKDSVALFRKKPAMCMLVALSYVFLFIVTPAI
                     QGMPTLLKLMIMLAWPAYMVLVITFFLELDKSQPFKLETLIKYIQPYIAKLVLLGAIC
                     LLYGVLVSGFTSGDLNTLNAMIKAGDQNEAIATKVLPLMLKILLLLAPLLMATWFAPM
                     LIVHHNFSVFRAIKSSIAGSLYSALSLGFAWLFLTLAFSVAMMLIGVVVGIVAAISQP
                     FALVLASLTLLNCFLVATAMMLAFQYVSYRDVFAKKFANVAKIDTTA"
     CDS             complement(333701..335911)
                     /codon_start=1
                     /gene="uvrD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VRY2"
                     /locus_tag="ZMTM_03390"
                     /product="DNA helicase"
                     /protein_id="BCM24080.1"
                     /transl_table=11
                     /translation="MTDQTTAPHTYATSSDSLLAGLNNKQLEAVTLPNQSALILAGAG
                     SGKTRVLTTRIAWLIQTGQISPNGLLAVTFTNKAAKEMLTRLTTMLPINTRGMWVGTF
                     HGLCNRLLRAHHREALLPATFQILDTADQLSAIKRVMKLMNVDDEKFPPKQVQGYINS
                     CKDEGMRAHSVDAYDPHSQKLREIFEEYDKQCQREGVADFAELLLRCYELLERDANIR
                     QHYQNRFKYVLVDEFQDTNRLQYQWLKLLAGHAQGNQRNCIFAVGDDDQSIYAFRGAR
                     VGNMRDFEQDFAIENIVKLEQNYRSHSNILDAANAIITHNRNRLGKNLWTSAGAGEPV
                     RVYQAYNDIDEANFIVEEIQSLHRDGVDLSDIAMLYRSNAQSRVIEHALFSVGLPYRV
                     YGGLRFFERAEIKHALAYMRLMANPNDDTALLRVINFPTRGIGARSLEQLQEVARQND
                     TSLWEAALLNTGKIGSFVTLIKQMQEESIGISLPEVAELATTLSGLKTFYQGEKEGED
                     RIANLEELVSAATAFMNQDLGLRIEQSDVDENGEIVQSLLTQFLGHASLEAGEHQADV
                     GRDALQLMTVHAAKGLEFKAVFISGLEEGLCPHEQSLYEANGLEEERRLMYVAVTRAR
                     ERLYLSHAQSRMLHGQVRYGIPSRFLDEIPEELLKRLNAKPVAKPFFQTASSSSEQKS
                     AMPWKIGQQVGHGKFGQGVVVSYEGNADDLRIQINFGKEGMKWLALEYAKLEAL"
     CDS             complement(336192..336698)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03400"
                     /product="hypothetical protein"
                     /protein_id="BCM24081.1"
                     /transl_table=11
                     /translation="MRSIKPIIIMLGLLLASSYAHAGITKWTDADGKVHYSDQPAPKN
                     VKATNITIEDPIPVAPDAQKKLQSYQNVIEEGRKKRQLEQQQQDEKAAKEAADKKAAA
                     AAAKLAAKEAAKKAENDAAQGNANAGLTLDPKDPGYLKPDAAGYTGYGNYSGYTPLAA
                     PAAPAATP"
     CDS             complement(336942..338585)
                     /codon_start=1
                     /gene="cpn60"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P7S6"
                     /locus_tag="ZMTM_03410"
                     /product="60 kDa chaperonin"
                     /protein_id="BCM24082.1"
                     /transl_table=11
                     /translation="MSAKQVIFGDEARAKIVNGVNILANAVKVTLGPKGRNVVLERSF
                     GAPTVTKDGVSVAKEIELKDRLENMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVRE
                     GFKYVAAGFNPADLKRGIDKAVIAIVEEIKKISKPTTTSKEIAQVGSISANSDFHIGQ
                     IIADAMDKVGKEGVITVEDGSGLENELDVVEGMQFDRGYLSPYFINNPERQIALLENP
                     FVLLFDKKISNIRDLLPTLEQVAKSGRPLLIIAEDIEGEALATLVVNNIRGILKTVAV
                     KAPGFGDRRKAMLEDIAILTGGTVIAEELGLKLENVKLEDLGQAKRIEVNKDNTIIID
                     GAGVENNIKVRIDQIKKQIEEASSDYDREKLQERVAKLAGGVAVIKVGAATEIEMKEK
                     KARVEDALHATRAAVEEGIVPGGGVALLRARSAIKELKGDNPDQDAGIKIVLRAIEEP
                     LRQIVANAGDEPSVVVNKVLEGTGNYGYNAANGTYGDLVELGVLDPAKVTRSALQNAA
                     SVASLILTTDALVAELPKDDAPSMGGGDMGGMSGMGGMM"
     CDS             complement(338647..338937)
                     /codon_start=1
                     /gene="groS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63RH4"
                     /locus_tag="ZMTM_03420"
                     /product="10 kDa chaperonin"
                     /protein_id="BCM24083.1"
                     /transl_table=11
                     /translation="MAIRPLHDRVIVKRLEEERTTASGIVIPDTATEKPDQGEILAVG
                     PGKKDDNGKPIALDVKVGDKVLFGKYAGQSVKVNGEEVLVLREEDILGVVEA"
     CDS             complement(339062..339637)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03430"
                     /product="hypothetical protein"
                     /protein_id="BCM24084.1"
                     /transl_table=11
                     /translation="MENFNFSGIERLPKSGEVEQLFILMHGVGGSPANLMPLVNKLRD
                     VYSSAAFLLPEGTYPFDGGGSGRQWFSIKEVTEENRYTRVENALPALHELVVAAQERF
                     KVNQQNTVLGGFSQGAIMSLEYSVAHDDMVGNILAFSGRFTKLPTKAPAFTQLHLFHG
                     QEDNVMPVSHSLAALENCLLGLENSGCCPYY"
     CDS             complement(339733..340068)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03440"
                     /product="hypothetical protein"
                     /protein_id="BCM24085.1"
                     /transl_table=11
                     /translation="MPKNIKSIVIFFVLACSIFYMFMQLGHYVGKKKLETQYPLVSSL
                     IGEPADWDSEEKELMAYLLPKCKAENESGNAERMKSCWEGRAAAITDGGKSTKILNAL
                     LDKKLINKK"
     CDS             340373..341599
                     /codon_start=1
                     /gene="bioA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004525973.1"
                     /locus_tag="ZMTM_03450"
                     /product="adenosylmethionine--8-amino-7-oxononanoate
                     aminotransferase BioA"
                     /protein_id="BCM24086.1"
                     /transl_table=11
                     /translation="MPIARGEGTWLYDVDGKRYLDAVSSWWVNLFGHNNPKIKDAIKQ
                     QLDTLEHVILAGFTHEPVVELSERLSKLTGLGHCFYASDGASATEIALKMSFHYWRNV
                     GKAGKTKFISLQNSYHGETLGALSVTDVAIFKDTYAPLLIQSTQMPSPDWRLSEAGES
                     AEAYALRCAAELEVYISEHHAELAALIVEPLIQCAAGMGMYHAIYLQRAREICTKYEV
                     HLIADEIAVGFGRTGTMFAMEQAEVLPDFMCLSKGITGGYLPLSVTLTTDLIYQAFYD
                     DSIARGFLHSHSYTGNPLACSAALATLDIFEQEQVLQSNRLKAQYLNTQLGKFVDLPI
                     KHMRHRGMVWAFDTDYAPEKQVLFRQHFYTQALQSGLLLRPIGNTVYWMPPYTISEEE
                     IDYMLTHTQAALQNFV"
     CDS             341592..343034
                     /codon_start=1
                     /gene="dacB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004201777.1"
                     /locus_tag="ZMTM_03460"
                     /product="peptidase"
                     /protein_id="BCM24087.1"
                     /transl_table=11
                     /translation="MFNQSAPRFAYLETIMRIFTLFLLFAAISAQAALPDSVADALQK
                     AGVPQDHVSVIVQRVDMTAPLISNQADQPLNPASTMKLLTTYAGLSLLGPAYRWHTDV
                     YMDGTLSNGVLQGNLILKGYGDPAFMAEDLWRLLNNLRQMGIKDIRGDLLLDASYFSP
                     NIANSADFDGEAYRAYNALPNGLLLNLKASSFKFQTISLGSNPQVLITMEPNLPEVKV
                     VNRVQLKPGDCGEWKNKVSYQIEKTTVTFSGSYASSCGEKYMELSLLDDAHYTFGLFR
                     AIWQQLGGKIQGDVKQITVPVTANKIAQADSPALADVIRRINKYSNNLMARQLFLTLG
                     AEQQGAPAEAAKSDKTIRDWLATKSLVFNELVLENGAGLSRNERITARHMAALLLDAY
                     ASPVMPELMSSLPILSVDGTVAKRLKDSPAVGRAHLKTGSLNGVGAISGYVLDSKGRY
                     WVLVFMANDMQAAASKAAQDALIDWVYQQQ"
     CDS             343244..343603
                     /codon_start=1
                     /gene="fkpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P8Z0"
                     /locus_tag="ZMTM_03470"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BCM24088.1"
                     /transl_table=11
                     /translation="MSTNITELTKIDQVVGEGREAEAGLNVTVHYTGWLYDPAQPEGK
                     GKKFDSSVDRGDPFNFFLGGGQVIRGWDEGVVGMKIGGKRTLLIPSEYGYGARGAGGV
                     IPPNATLVFDVELLGVK"
     CDS             343631..344056
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003085219.1"
                     /locus_tag="ZMTM_03480"
                     /product="hypothetical protein"
                     /protein_id="BCM24089.1"
                     /transl_table=11
                     /translation="MKARIKWVENVCFVGESETGHAVVLDGAPDSGGRNLGMRPMEML
                     LIGMGACTSFDVVTILKKSRQPITDCVAEMHADRADEIPKVFTNIHVHFIVTGNGLNP
                     MQVERAVKLSAEKYCSASIMLSKSVNITHDFEIVETSAT"
     CDS             344056..344469
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011124399.1"
                     /locus_tag="ZMTM_03490"
                     /product="lactoylglutathione lyase"
                     /protein_id="BCM24090.1"
                     /transl_table=11
                     /translation="MVSQAITNPPKGMIGIRHVALFIKELEVAVDFYVNVMGMQIEWQ
                     PDPDNVYLTNQGDVFALHRVDYVASGTQRLDHIGFVLKTPEDVDQWHAYFVEHGIKIT
                     ESPKTHRDGSRGFYCLDPVGHLLELIYHPPISDQK"
     CDS             complement(344480..344833)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198082.1"
                     /locus_tag="ZMTM_03500"
                     /product="hypothetical protein"
                     /protein_id="BCM24091.1"
                     /transl_table=11
                     /translation="MSKESSIKPFSEQLAALPAAEHVQKIELIALDGETTAVIENKPG
                     SQGSIKVYHHLYKKYGEISVEAANEGLGIYAEHTEDAKLNAGKHPNIDRLLALIENNS
                     SLAVKLYDHAGLLRA"
     CDS             complement(344830..345450)
                     /codon_start=1
                     /gene="coq7"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F0KHR2"
                     /locus_tag="ZMTM_03510"
                     /product="2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
                     hydroxylase"
                     /protein_id="BCM24092.1"
                     /transl_table=11
                     /translation="MLDRLIIEFDKGLRTLLAEAHSARQHPDHDFAEATLESAEKKHA
                     AALMRVNHSGEVCAQALYSGQSLTAKNPATVEALKQAAKEETEHLAWCEERIKSLGGR
                     TSALNPLWYAGSFTMGAIAGALGDKWNLGFLAETELQVEKHLKSHLDSLPEQDTKSRV
                     IVEQMQTDEAKHAATAYEHGAAELPKPIKSGMQLISKLMTKTSYYL"
     CDS             complement(345456..346892)
                     /codon_start=1
                     /gene="ctpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010929911.1"
                     /locus_tag="ZMTM_03520"
                     /product="peptidase S41"
                     /protein_id="BCM24093.1"
                     /transl_table=11
                     /translation="MRAQLNKFGLIVVSIAMGFMLSLTYSAIADKSTDKDAKSQPQLP
                     LDELRTFAEVFGKIKTDYVEPVDDKKLITEAIKGMVSGLDPHSDYLDADGFKDLQAGT
                     QGEFGGLGIEVGMEDGFVKVVSPIEDTPAYKAGIKSGDLIIKLDDTAVKGLTLSDAVK
                     MMRGKPDTPITLTILRKGEPKPLVITLKRAAIKTQSVKYKLVEPGYAYVRITQFQEHT
                     GEDLAKALQTLRDQNKEPFKGLILDLRNNPGGLLNAAVGVVAAFIPKGDLVVYTEGRT
                     EDAKMNLTANPENYVRGSADYLRNASPELKTVPMAVIVNGGSASASEIVAGALQDQKR
                     AVIMGTQSFGKGSVQTILPMNNGTAIKLTTARYFTPNGRSIQAKGIVPDITVEDATLS
                     SSDSSGLNLREADLSNHLSNPKDASANTPATPVKTPDAATPAPVDKDKAPADKTSDKA
                     PPEPGSKSDYQFNQALNLLKGAQILQRK"
     CDS             347054..347344
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529114.1"
                     /locus_tag="ZMTM_03530"
                     /product="hypothetical protein"
                     /protein_id="BCM24094.1"
                     /transl_table=11
                     /translation="MNQKNLTDIEIEYCTQCRWLLRAAWMAQELLVTFEYDITRVSLV
                     PGTGGIFEVRLNGQVLFSRKEKGRFPESKELKQLIRDVIDPDRPLGHSDKVE"
     CDS             347474..347944
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003018151.1"
                     /locus_tag="ZMTM_03540"
                     /product="bacterioferritin"
                     /protein_id="BCM24095.1"
                     /transl_table=11
                     /translation="MAKKPKHDEHNSPVIKALNLILEMELAGVVRYTHYALMVYGYTR
                     IPIVSWLRGQATESLDHANKAGELITHLGGHPSLSIGPLLETHNHDIGDILRESLEHE
                     NASLNCYRKLLKLVEGDSVMLEEYAREMIYAEELHIGEVDKMLRKPGDVGVFYK"
     CDS             complement(348016..348663)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03550"
                     /product="hypothetical protein"
                     /protein_id="BCM24096.1"
                     /transl_table=11
                     /translation="MNKNKGLQIVLNAFRMHFMLIRPTLLAILLSLSLQAHAADRTMV
                     PNGMAANNSDSVNNDQNGQASASRWSDTVQEVMMNALSLTGIRYTYGGKNPDTGFDCS
                     GFVRYVFQQAASLTLPHSARAISQLGQSVSIDELQPGDLVFFNTLKTAFSHVGIYIGG
                     HRFIHAPSTGGGISVVDMDDSYWVKRFNGAKRLDEKLISPKDAAAISAASNQMSE"
     CDS             348766..349134
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03560"
                     /product="hypothetical protein"
                     /protein_id="BCM24097.1"
                     /transl_table=11
                     /translation="MRKHQSLTGLNLRVNASKAVHAVLNKVIHQADHGHETLAEHAQQ
                     IGTSAKHRMRLVAKGFAQEIHSSIMHVRDTSKQMTGQMTSKAKRKIALLASRKLNEIA
                     NKIEQKANAIHLSATKSASR"
     CDS             349168..350847
                     /codon_start=1
                     /gene="aarF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P9X3"
                     /locus_tag="ZMTM_03570"
                     /product="putative protein kinase UbiB"
                     /protein_id="BCM24098.1"
                     /transl_table=11
                     /translation="MIRQTISVFRDLGRIREITGVLMRYGWDDIAKRLGKRSFIGWAG
                     KALSADVPPEIMNLPPEVRVRLAIQDLGPTFVKLGQVLATRPDIFPPHWITEFSKLQD
                     QVPPVPFEELLPELEKAFGKSPFEVFKDFQEVPIAGASIAQVHRAKLQDGTDVVVKIR
                     RPNVQESIDADLRLLSHLGRLIESEVEEVRRFQPGKIIAQFSKSLKRELDLGLEGRST
                     ERFARNFATDENVKFAQIYWDYCADGVLVMEHINGISGHAIEEAKIAGLDLKLLAELG
                     AKTVLKMVLIDGFFHADPHPGNLFYLPGNRIAIIDCGMVGRITLDRRGEIADLLAALV
                     SRDIDALRDILIVWSGDANVDEAKLGADVDEFICNYDNAPLKHVRFSALLNDLTTIMR
                     ENHLAVPPDLTMLFKALITLEGLGRQLDPDFQIVSFLTPFVKKIIIDRYMPSALFKRG
                     KRGASSLFDSITGLPGDVSMLLREAGRGRLKINLDLKRLDHFGHQLDHSTNRLTMAMI
                     VAALIIGSSIVMTVKGGPTILGLPAFGFIGFFFAFCIGFLLVISIWRSGRD"
     CDS             351007..352431
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391137.1"
                     /locus_tag="ZMTM_03580"
                     /product="hypothetical protein"
                     /protein_id="BCM24099.1"
                     /transl_table=11
                     /translation="MDTANKRPFDEMQLANDTVRDIYALYAEWLRDVPLAQLESKRLE
                     AELLFRRVGITFNVYGETAGAERLIPFDVVPRILAADEWSKLSDGAIQRVKALNMFLH
                     DIYHDQEIIKAGIVPASVLTNSQYRPEMQGIDVPNNIYAHIAGIDIVRTGENDFYVLE
                     DNLRTPSGVSYMLEDRKMMMRLFPDLFRRYSIAPVEHYPQVLLNNLRAVAQPGVTDPV
                     VALMTPGAYNSAYFEHAFLAQQMGIELVEGQDLFVRENAVYMRTTEGPKKVDVIYRRI
                     DDDFIDPLAFKADSMLGVPGLLSVYQNGGVTLANAVGTGVADDKAIYIYVPEMIRYYL
                     GEEPILANVPTYQLSKEDDLKYVLAHLPELVVKEVQGSGGYGMLVGPAATKAEIKEFT
                     LRIVSNPSNYIAQPTLALSTCPTLVESGLAPRHVDLRPFVLSGKAVTLVPGALCRVAL
                     RDGSLVVNSSQGGGTKDTWVLNHA"
     CDS             352461..353408
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391136.1"
                     /locus_tag="ZMTM_03590"
                     /product="hypothetical protein"
                     /protein_id="BCM24100.1"
                     /transl_table=11
                     /translation="MLSRTADHLYWMARYIERAENMARVLDVTANMSLITNPADQTEA
                     ALWRPALQICGDVVAYEEAYGECTAANVIKFLTMDDNNPSSIYSTLRSARENARAVRV
                     AMTSETWESINTLWLEFSQFIGADFSKNGLHEFCEWVKARSHLFRGVSFGTMLRDDSF
                     RFLRLGSFIERADNTARILDVKYHILQPIDEETGGVDYYAWSAVLRSVSSFQAYQKVF
                     RDTIDPQKVAEMMVLRSDMPRSLHACYEEIVSIVQQLSDRRPTECKRLSGQLLSSLRY
                     GKMETIFEQGLHEFLADFLRSNNRLGGEIQRTFFNAAEV"
     CDS             353708..354940
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010947366.1"
                     /locus_tag="ZMTM_03600"
                     /product="hypothetical protein"
                     /protein_id="BCM24101.1"
                     /transl_table=11
                     /translation="MNATAIDSLRFTRHGDKQNSAFFEEYLVHILKERDLLGLTALIH
                     EIDALMITVDPGHSIQYIAELSLMTSYHYLVTLESESHWTHILRIDLNSPDILLREVK
                     DPNLRGIFRSLNEVYPVGAKKPNSRYMGEIIRVSNLHDVVKLQQAREFRFFSQDEVRK
                     MEFPGNIAVSKPSPYTHNIVGYLERKPNELRVYALGMSVINPEVQAAYETSKNLQKKL
                     HIDELLLPIDHLATRVYSQNREVAILEYLSLTSYHFWGAYNIFDQNSSTNVTKSVHGI
                     PESKSPAKVFTANNTPYFVSHIEKLPSPTETFVRNYGPRLHHMAIAVKDGESGGLENI
                     EFVVNAISEQGQGFLLDVIGSKEEGLKQIFSNASEHSSLIIEYVQRFGDFDGFFTQDN
                     VAKLTEAAGHEESLNYAV"
     CDS             354962..355699
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005174271.1"
                     /locus_tag="ZMTM_03610"
                     /product="peptidase"
                     /protein_id="BCM24102.1"
                     /transl_table=11
                     /translation="MTYCVAILLPEGLVLASDTRTNAGVDQVAVFPKMHVFEVPGERV
                     ITLLTSGNLAITQSVVNRLREAVRTGADKTLETAASMFEAATLVGDEIRAAFERDASH
                     LKNQNSEFSANILLSGQIKGEAPRLFHIYSAGNFIESSDETPYFQIGETKYGKPIIDR
                     VVNHKSDMMDAVKCVLISFDSTIRSNLSVAAPIDLMLYHTDSFNADSRQRITEKDEYY
                     TTIRQGWSDGLKKVFSALPNPTWTFDK"
     CDS             complement(355797..356654)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011963694.1"
                     /locus_tag="ZMTM_03620"
                     /product="ATP/GTP-binding protein"
                     /protein_id="BCM24103.1"
                     /transl_table=11
                     /translation="MNWKNLLLAATLAPIISSAFAADAALKKIDGFKTPESVLVFKDG
                     RMFVSEINGFGKDGDGQISEITKDGKVKVFATGLDDPKGMALIGKDIYVADKTRILKI
                     TSDGKWSVFTAAEEFPVIPLFLNDLASDDEGNLYVSETGDTEKGSGGAIYRINPQGKV
                     TFTLNASDDPRVLGPNGIIVNDDGKSLLYVDFFSGVLYSVDLNTKALTEQAEGFGGGD
                     GLVRTKSGVIYVSDWKNGKVFEVRHGKTTLIKSGFKASADIGLTPDEKSLLVPDMKAG
                     ELVWLPLKK"
     CDS             complement(356748..358079)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005766669.1"
                     /locus_tag="ZMTM_03630"
                     /product="sorbosone dehydrogenase"
                     /protein_id="BCM24104.1"
                     /transl_table=11
                     /translation="MRISHYVLPSLIAMTLAACGDKATLQVSDGIGAKPNLPPPNKSL
                     ITTVNTAKAVGWLAGAKPTVASGLAVNDFAEGLDHPRWLYELPNGDVLVAETNSPPKP
                     EDGKGIRGWIMGKVMANAGAGVATANRITLLRDTNGDGVADERKVFLQGLNSPFGMAL
                     IGNDFYVANTDAVVRFHYETGQTEITGTGTNVVDLPGGAINHHWTKNIIANQDGSKLY
                     VTVGSNSNVAERGMDNESGRAAIWEVDPKTGEHRIFASGLRNPNGMAWEPSSGTLWTA
                     VNERDEIGSDLVPDYITSVKDGAFYGWPYSYYGQHVDKRVDPQNPDLVASAIAPDYAL
                     GPHTASLGLASSKGNTLPNEYKTGMFIGQHGSWNRNPRSGYKVIFVPFNGDKPAGQPV
                     DVLTDFLNSKGEAQGRPVGVMIDKQGALLVADDVGNKIWRVTAEKPLVKSN"
     CDS             complement(358314..358649)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03640"
                     /product="hypothetical protein"
                     /protein_id="BCM24105.1"
                     /transl_table=11
                     /translation="MLKNIKSIVIFFVLACSIFYMFMQLGQYVGKKKLESQYPLVSSL
                     IGEPATWDSKEKELMAYLLPKCKAENESGNTERMKSCWEGRAAAIPDGGNSAKTLNAL
                     LDKQLQNKK"
     CDS             complement(358732..359646)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011461868.1"
                     /locus_tag="ZMTM_03650"
                     /product="hypothetical protein"
                     /protein_id="BCM24106.1"
                     /transl_table=11
                     /translation="MNRYSDGKGGINFLALLRDVIIVGAMLILFAWVNPFQTVPTGSR
                     GVVTQFGAIKGIEAEGMVILPPWQSLTIFNIRAEEAQVDEADGSTSDTQPVKVSLTVR
                     YSISPDKVSEVYEKYSHDGNLSSYVQTATQEVFKAVTAKYTAPDLIAQRQTVSNDINA
                     ALKKKLEIYGANVINIDMRNFSFGESYMQAINQKVTQEQLRLVAENKLKTVEAEQKQK
                     VAIAQAEADATRAQADGEAYANLKIATAQADALKVQNAALAQSKEVLELRRIEVEKIK
                     AEKWDGKLPQNIYASAPIPFLNIGGGSK"
     CDS             complement(359790..360671)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112287.1"
                     /locus_tag="ZMTM_03660"
                     /product="hypothetical protein"
                     /protein_id="BCM24107.1"
                     /transl_table=11
                     /translation="MRYRVLHNTHYYYEGPVMLSQQLLHMSPRDFYAQTCLTHTLEIT
                     PPPSESLKKHDYFGNITDYFAMATPHRELAVNSSFEVQLMPRLKLEDLHQSPSWEPVR
                     DNLRMLNGQNQEAQTFLFGSPYVACSDALADYARLSFTPNKPLLQAAFDLTQRIYNEF
                     DFDPDATHIDTPLSEVLENKHGVCQDFSHLMIGCLRSLGLSCRYVSGYILTHRAPGQE
                     DMVGADASHAWVSVYCPFYGWIDFDPTNNCLVQNEHITVAWGRDFSDVSPMHGIVLGG
                     GSHTLDVEVSVIKISSQ"
     CDS             complement(360687..363296)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112286.1"
                     /locus_tag="ZMTM_03670"
                     /product="hypothetical protein"
                     /protein_id="BCM24108.1"
                     /transl_table=11
                     /translation="MLESILNSYPSHQDRHDELLESSGKPRPHWQELISTLEQVSPAQ
                     MRERVESIQRQVRENGVTYNVYADTKGLQRPWGLDVLPFILPHEEWAGIEAAVIQRAT
                     LLNALLNDVYSDQNLLKEGILPPALIHGHAGFLRPCHGIKYPDNYSLHTYAVDLARSP
                     DGRWWVVADRTQAPSGAGYALENRLIISSAFPELFRDLNVQRLSGFFATMRDSLAYWG
                     RVCAANQSRSNPKIKALGEGEQPLTVLLTPGPYNETYHEQSYLAGYLGFPLVQGNDLT
                     VRNGVVWLKTLSGLKPVHTILRRLDDDFCDPLELNSISVLGIAGLTEVARRGNVLIAN
                     SLGSNLLQTGALLGFLPSLCRRLLGESLLMPSVATWWCGEPHALETVIENLHTLVIKP
                     AFPQINEQPIFGEDLNHTERDALIAKLCANPQNYVAQEQVKISQAPVWNAETGKDEPA
                     LGSLAVGLRVYACATPQGYVVMPGGLTRVASGQDERVITMQNGGTSKDTWVTAPYVTS
                     YRSLLRKTSSSRDLVKGNANLSSRMVENLFWFGRYAVRNHHFSRLLRTAIHCFMEFTT
                     EHRAMEWPTIQGLCNWYGLMSADNEENPRIKSSEALGSLAEPELSDELIESLLVSGIF
                     SSDSPSLASHIQGFQTLAFNLRERLSSDCWRNINQMAQRFTDSPESATLSEGLLILDE
                     TTASLVTLSGFTLDGMTRDQGWRFMSIGRRIERLQFLCTLLSRALKMPAESNLDWVLE
                     LTDSIVTYRYRYSSQAEWLPMLDLILMDENNPNAMVFQLKGLIKYLAQITATYGSGGE
                     GQFIGRLAALRLFDPDVVFRQGNAELIAWLDETYNASIALSDSLSHRFFSYSGQLQEL
                     SAQEISQQEIFNF"
     CDS             complement(363457..366753)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011390311.1"
                     /locus_tag="ZMTM_03680"
                     /product="IMP dehydrogenase"
                     /protein_id="BCM24109.1"
                     /transl_table=11
                     /translation="MAIRVALHHKTSYQFDRLVSLSPHEVRLKPAAHARTPILSYSLS
                     VIPEKHFINWQQDPYGNYIARFVFPEKVRELEFTVDLVADMTVINPFDFFVEKYAETY
                     PFKYTEQLEHELSPYLKADPIGPLLQNWLNAAEQKFATQNLGIGDFLVALNQMVQGDI
                     GYLVRMEPGVQTPEETLNNRTGSCRDSAWLLVQIMRHFGLAARFVSGYLIQLAADIKS
                     LDGPSGTAVDFTDLHAWAEVYIPGAGWIGLDATSGLMAGEGHIPLACTATPSSAAPVT
                     GMTDRAEVIFTHEMSVTRIHEDPRVTKPYTEEDWLKIDKLGQKVDVDLKKQDVRLTQG
                     GEPTFVSIDDMEGAEWNVAAHGAKKREMAGELSLKLKQHFAPGGLLHYGQGKWYPGEP
                     LPRWAINIYWRVDGKPIWQDFSLFSDEKISDNYTAEHAEQFSAKLASNLGLPTACLIP
                     AYEDVLQQSVMELRLPENVDPLKANLKDSEERRRLAKLLEVGLNEIVGYVMPIKPEET
                     RKKNVSNWLTSKWPLKREHLYLLAGDSPMGLRLPLASLPELLPEDIDPAFPVDPFAEL
                     AELPDASALGIVAKRTLKEKPLPREVVFTALCVQVRDGRLHVFMPPVVRIEDYLALIA
                     TVEQTAAELNLKLWIEGYTPPRDARIKVLSVTPDPGVIEVNIHPSSTWRELVDKMTIL
                     YEEARQTRLGTEKFMLDGRHTGTGGGNHATLGGATAADSPMLRRPDVLKSLITYWQNH
                     PALSYLFSGTFIGPTSQSPRVDEARDDNLYELAIAFQQMDKVLPDTAESERPWLVDRL
                     LRNLLVDLTGNTHRAEFSIDKLYSPDGPTGRLGLVEFRAFEMPPHARMSLLQMLLLRA
                     LVARFWHEPYQGKLIHWGTELHDRWMLPHFIAQDMADVVKDLNRSGYKFEKRWFDPFI
                     EFRFPRYGTVAYEGVELELRQAIEPWNVLGEEMAGGGTARYVDSSVERMQLRVRGLTD
                     TRHIVTCNGRPLPLQPTGVAGEYVTGVRFRAWDPWSALHPTIKPHTPLVFDLVDTWSG
                     RAIGGCTYHVSHPGGRNYATFPVNALEAEARRFTRFWGHGHTPGPRQIEEEQRNPRFP
                     FTLDLRWQDV"
     CDS             366938..368881
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192700.1"
                     /locus_tag="ZMTM_03690"
                     /product="helicase"
                     /protein_id="BCM24110.1"
                     /transl_table=11
                     /translation="MNSSNLDHIFSEQGPLAETIPGYRIRRQQLEMAQAIEAAIKGNQ
                     QLVAEAGTGTGKTFAYLIPALLSGGKVIISTGTKTLQDQLFNRDLPAVRDALKVPITV
                     AMLKGRANYVCHFHLERAMNEGRFISREDANYVHKIKAFAENSSTGDKSELTDVPENA
                     TIWPAVTSTRDNCMGQDCAYYKDCFVMDARKRALAADVIVVNHHLFFADVMLRDEGVA
                     ELLPSANTVIFDEAHQLPEVAGLFFGDDVSTSQLMELARDAHAEFITTAKDCLALPDA
                     TAGLEKAVRDFRLIFTYEGSRMPVQKALGLTNFLPAYALMQEKLKALSDVLESQAERD
                     PAIENCWQRGLALQQKLNTWQAADNANLVRWVEVFTQSVQLHATPLSVAEGFGKQLNA
                     QPRSWIFTSATLAVKSDFSHYLSQMGLEQATTGYWNSPFDYDQQALLYVPQGMPEPSS
                     SIYTASVAAAALPVIQASGGRAFVLCTSLRAMREVHSLLKDAFETNGLEYPLLMQGDN
                     SRTELLERFRKLGNAVLVGSQSFWEGVDVRGEALSAVIIDKLPFAPPDDPVLAARIDK
                     MNSEGKNAFMEYQLPYAVITLKQGAGRLIRDEADRGVLMICDPRLISKHYGKRIWQSL
                     PPFKRTRELADVESFFERNVLAE"
     CDS             368927..369823
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011730867.1"
                     /locus_tag="ZMTM_03700"
                     /product="3-hydroxyisobutyrate dehydrogenase"
                     /protein_id="BCM24111.1"
                     /transl_table=11
                     /translation="MATIGFIGLGAMGEGMASNLLAAGYAVQVYNRSAEKIAPLLSKG
                     ANATATPKLAATGADFVITMLSNDAVLESVTLGDDGLLAGMKEGAIHLSMSTVSPDIS
                     RQLSEIHARHKTHYVTSPVFGRPEMAATKKLWICTSGNPAALAKAKPVQEAMSQGIFE
                     FGEDAGAANIVKLSGNFMIASCMEVLGEVATLAEKNGISPEAVLGMLSSTIFACPMYQ
                     RYSDIVLKQDFEPGFKMELAFKDMNLAQTVALKSATPMPFLSIVQQRMLSGIAEGRAQ
                     NDWSALSLSARRDAGLPLSRFA"
     CDS             369836..370525
                     /codon_start=1
                     /gene="yeaZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262263.1"
                     /locus_tag="ZMTM_03710"
                     /product="tRNA (adenosine(37)-N6)-
                     threonylcarbamoyltransferase complex dimerization subunit
                     type 1 TsaB"
                     /protein_id="BCM24112.1"
                     /transl_table=11
                     /translation="MKILALDTSTEYLSLALSIDGNIFVRELLAGQSHSQRILPLLRE
                     LLDEAGVELTELDGIAFGAGPGSFTGLRIGCGVAQGLAFGANLPVVGVSTLLALAQAS
                     GADHVIACLDARMGEVYHAVYVREGHGWQTLNEPGLYKPEAVPDVEGDDWVGVGSGWV
                     AYQPALTKCYAYQFKDISGDMFPHAKAIAELAIPMFVAGLGLPAAEAAPVYIRNKVAL
                     KTAERLAAKIQ"
     CDS             370527..371000
                     /codon_start=1
                     /gene="rimI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8PCS0"
                     /locus_tag="ZMTM_03720"
                     /product="ribosomal-protein-alanine acetyltransferase"
                     /protein_id="BCM24113.1"
                     /transl_table=11
                     /translation="MVVMTKSDTLSRLAFRPMQMADVDAIMAIEPTIFPYPWSRGNFT
                     DSLNSGYSCWVTEHDGKIMGYAVLMMVLDEAHILNISIAKPYQGQGFGRDLLMHMIDI
                     ARQRNALNMFLEVRPSNQSAIGLYESIGFNEMAIRRNYYPAANGREDAVLMGLAL"
     CDS             371011..371859
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03730"
                     /product="hypothetical protein"
                     /protein_id="BCM24114.1"
                     /transl_table=11
                     /translation="MSLTRDDMLRELELLPAWQLRQPVTKSAPHEVIEMPKLSAIAEP
                     EVKAIPAQFEELPAAEQIEAVSIPEAVETSLPALDVTLGQGRREAIMQLEWQGVQDCV
                     ANCQACDLAKTRTQTVFGVGDPNADWLIVGEAPGSEEDRKGEPFVGQAGKLLDNMLAA
                     IKLKRGQNVFIANVLKCRPPENRNPHADEVAMCDPFLKRQVELIKPKLIIALGKFAAQ
                     SLLGSEDTISSMRGKLHDFHGVPVVVTYHPAYLLRSLPEKAKAWEDLCFANKTMAGLT
                     TSAKQP"
     CDS             371946..373673
                     /codon_start=1
                     /gene="proS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63QM5"
                     /locus_tag="ZMTM_03740"
                     /product="proline--tRNA ligase"
                     /protein_id="BCM24115.1"
                     /transl_table=11
                     /translation="MRASQFFLNTQKEAPQEAELISHRLMLRAGLIKRLGSGLYTWMP
                     LGLRVLRKVEAIVREEMNNAGALELLMPAVQPKELWEETGRWAVFGPQMLKIKDRHDR
                     DFCFGPTHEEVITDLVRREIKSYKQLPLNFYQIQTKFRDEIRPRFGVMRAREFMMKDA
                     YSFHTDLASLEQTYEAMYQAYSNVFTRLGLKFRAVRADTGAIGGDGSHEFHVLADSGE
                     DALAYCPTSDYAANVELAEGLPPIEPRQAPSMEMVKIATPHVKTISEISEFFGISKSK
                     VVKSIAVMRKQQPSTNPELEQFCLVLIRGDHELNEIKLEKAIGSFRFANEAEIERHIN
                     SSSGYIGPVNLHPSVAVISDYSVKNMSDFVCGANELGQHLKGVNFSRDLSEPAMIEDI
                     RNVVEGDPSPDGKGTLTLCRGIEVGHIFQLRTKYAQAMDATYLDENGKKQVLEMGCYG
                     IGVSRIVGAAIEQGNDERGIIFPASMAPFQVAIAPIGWEKSEEVKTAALNLYEALQAA
                     GVDVLLDDRGERPGVMFADMELVGIPHRVVIGDRGLKEGNVEYQGRTDASAQTVALKD
                     IVSKLQTLL"
     CDS             373673..374278
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003688215.1"
                     /locus_tag="ZMTM_03750"
                     /product="transglycosylase"
                     /protein_id="BCM24116.1"
                     /transl_table=11
                     /translation="MRRFSNFFLVLAALVFTHAAFAGGQKEEPLSNSVKALMQKSISD
                     QATPKTIFASEVEGQIWLKEMSNRLKIRMPDQDMREDFLRTVYYEATRAGLDPQLVLG
                     LIQVESGFKKYAVSSVGARGYMQVMPFWVNSIGAPDHNLFHLKLNLRYGCTILRHYID
                     MENGDLYRALGRYNGSLGQPEYPTMVVGAWKKNWSYGSLTF"
     CDS             374462..374983
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03760"
                     /product="hypothetical protein"
                     /protein_id="BCM24117.1"
                     /transl_table=11
                     /translation="MSKLSALSLSIALLGGVWAYLALGPLSGFVLVWAGFIAWGCYFH
                     TGADNAALQKTIAGTIYGAVLAWVALLLVVHNPTGLPAPLWPAIVVAVTVFFLVIVAS
                     INLLSVVPANVYGYAATVAYSLQTPTADGVGPLASLTVVNFANPLILLSVSFVVGAIF
                     GLASGKLSGVLAK"
     CDS             complement(375049..375933)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03770"
                     /product="hypothetical protein"
                     /protein_id="BCM24118.1"
                     /transl_table=11
                     /translation="MRFTNIIASATMSLWLLHIPLANAQVLPEAVLAIKMPLVSEPTS
                     RPMTVAYIAQYNRYYVADGGLGPVPGEDDTNSKSQVHVYSADGVHLQTSSPGYNNRSL
                     YFNPNSNQLETITYNISSDAGFAPNTGIFSLDLDDKGNLLGSSKDVFAYNPAFGDAAT
                     MPTYDTANKLYYAKQERSNVVRIVDLKSREKVGELKLDLSAAGAKPDDISDHYVAYTG
                     LAGEELAVLDVDHKAILVFDKNGQFVGKSTLPTDLKLRAKNHYNGLGYANGLMFVYYE
                     TLGEFGTYYGFKFSDQVK"
     CDS             complement(376028..377059)
                     /codon_start=1
                     /gene="queA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MLW3"
                     /locus_tag="ZMTM_03780"
                     /product="S-adenosylmethionine:tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="BCM24119.1"
                     /transl_table=11
                     /translation="MRTTDFDFDLPDALIAQFPTQERSGSRLLRLDSSNGNIHDQLFR
                     DLPNFLQAGDLLVFNDTRVIKARLHGHKQSGGAVEAMIERVIDQHHALAHVRASRSPK
                     PGSRLLLAEEIEVEIIERQDDLFLLKFLSETPLLDLLEQYGALPLPPYISHDADNTDE
                     ERYQTVYAKHLGAVAAPTAGLHFDDVMLALLKQQGIQFAYVTLHVGAGTFQPVRVENI
                     AEHKMHSELYSVPEETVKLIKQTQAAGRKVTAIGTTAMRALESAARSGELVAGMGETD
                     IFITPGYKFKVVEQLLTNFHLPKSTLLMLVSAFAGFNNIRQAYAHAISEKYSFFSYGD
                     AMLLNRLDE"
     tRNA            377094..377180
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00120"
                     /product="tRNA-Leu"
     CDS             complement(377267..380338)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011390677.1"
                     /locus_tag="ZMTM_03790"
                     /product="ABC transporter permease"
                     /protein_id="BCM24120.1"
                     /transl_table=11
                     /translation="MSIGISSWAIKRPLAPFMVFAGLLVMGIMAYYKLPVNNMPNVDI
                     PIINVSVVIPGAAPSEIETQVTSRIEAAVAGVGDIKHLSSTITDGVSSTQIEFQLGTN
                     TNLALSKIRDQIIAIRASFPRGAEEPLIQRVDADALPILTYTLNAPKRSLQEASWFVD
                     DQVMRSLLAIKGIAKIQRQGGVERQILVQLDPARMQAYGVTASLINEQLRQIALNWPA
                     GRVDSNTQETLIRTMGAPVDVESLANLYIPLGNGRVARLKDLGSVQDGSNQPRQLARL
                     NQQPVTGFAIYRTKSASEISVERDVQKALRGLKVSNPDIDFVQIQSLVDFSKESYHSA
                     LWSFIEGALLAAAVVFLFLRSWRATFISAVVIPLSVIPTFFVMQLLGFSLNMVSLLAL
                     SLVSGILVDDAIVEIENIMRHMKTEASPYRASMLAADQIGLAVLATTLVIVAVFIPVS
                     FMGGVVGQYFIQFGLTVAVATIFSLLVARFITPVMAAYLLKPLHHQSNTSGGWLIYYS
                     KLLNSALHYRKTMLLIGGAVVFGSIAIGTQLPTDFMPAEDKSASSLQVELPPGSNLNK
                     TDQVVSTITNMLLKRPEVKTAYAIVGAPDSDTNIEGEVRRALVNIQLIPRKERKLDVN
                     AFEQSMLKALADIPNVRTSFLNENGSKAVTFSLTSDNPELLQKTASQIETEMRGLVQL
                     SNVSSTAPLARTELVITPRQEQAAKLGVSTENIADTLRIATLGDLGANLARIKIGQRE
                     IPIRVMMDASTRNNTAAIGALLVATEDGHTVPLSSVADFSLNAGPTSIDRYDRQRQIT
                     LEANLNGTARLGDALSAIEALPAIKHLPEGVKRYDTGDAELLTEMFSSFSVAMVTGVL
                     LVFAVLVLLFRTIVQPITIMAALPLSIGGALLALLISHATLSLPAVIGMLMLMGIVGK
                     NGILLVDAIIEQRRQGLARLDAIMQASQQRAKPILMTTVAMIAGMMPVMLGIGAGTAF
                     RVPMATTVIGGLITSTALSLIFVPVIYVFLDDFETWIKPKMQRLLGINKIE"
     CDS             complement(380335..381627)
                     /codon_start=1
                     /gene="czcB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037294.1"
                     /locus_tag="ZMTM_03800"
                     /product="MexH family multidrug efflux RND transporter
                     periplasmic adaptor subunit"
                     /protein_id="BCM24121.1"
                     /transl_table=11
                     /translation="MQFFKKTRPVASVPTTARNRFALFGVFIIAGLFSSLGWLARSEA
                     ESVAVNDTGAVTVSVINAEKKSIPRSLALSGVVIGREEVAVYADLPQGRISKVLVDEG
                     QYVKAGQILAVTDDAGVRVQQTQQNAVLQRANAALAQQEARVQEAEAQHAQAKNETKR
                     SKAVNSPDVTESDKAALIEQRTSAEHIAEIQVKAAKSELEMAKADVQLANAQIAETTL
                     HLNQSNVIAPVSGLIVKRNAQIGLSLSQQTEPLFVLIRDGTLELLVSVASDDTEKLKN
                     GMPVTIQGINSQQNYTGKVRRAALSINLQDQTANVRVSFDKTSPDKTPSLIPGQSTKV
                     SINLPAKSGIYLPDSALFFEGNAAFVFIVRNNQAVRVPVKVGERLSGQAEILEGVTEG
                     MPVVDGFAAYLHDGDAVKVAPMRGSDAGTSHKENGPQA"
     CDS             381828..382112
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03810"
                     /product="hypothetical protein"
                     /protein_id="BCM24122.1"
                     /transl_table=11
                     /translation="MIADQSTWESGEYLQAIRYHASDALIDAEGSLYQILNTANGEVS
                     LQRLNKKASLQAVIEMVRAHAAELGACCVAKFSATSIQEAISSIANSADV"
     CDS             382105..382365
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03820"
                     /product="hypothetical protein"
                     /protein_id="BCM24123.1"
                     /transl_table=11
                     /translation="MSEELKSEWCLYLLECKNGSYYSGITNNLEARYATHLAGKGAKY
                     TRANPPVRVLASKAYPDRSTASMAEAVLKKLPRAEKLGFFTE"
     CDS             complement(382392..382892)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000140066.1"
                     /locus_tag="ZMTM_03830"
                     /product="protein-tyrosine-phosphatase"
                     /protein_id="BCM24124.1"
                     /transl_table=11
                     /translation="MEQKIYNVLFLCTGNSARSILAEKLMGHWGKGKFKTYSAGSHPN
                     GKVNPFALKLLEARGLSIESLRSKSWDEFAVEGAPFLDFVFTVCDNAAGEVCPYWPGQ
                     PMTAHWGVEDPAAVEGTDEEKLAAFRKIAGYLENRIKLFAALPIEKLDNMKIKEEIDS
                     IGKIKD"
     CDS             complement(382893..383246)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198701.1"
                     /locus_tag="ZMTM_03840"
                     /product="transcriptional regulator"
                     /protein_id="BCM24125.1"
                     /transl_table=11
                     /translation="MEKLIAVAALDALAQETRLDIFRLLVQAGAAGMAAGAVGEKLGV
                     PNATLSFHLQQLRHADLATTERKGTTILYKANYNMMNGLIGYLTENCCQNSSDDCVTQ
                     KLCCPPAANQTQESA"
     CDS             383347..384417
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011389203.1"
                     /locus_tag="ZMTM_03850"
                     /product="arsenical-resistance protein"
                     /protein_id="BCM24126.1"
                     /transl_table=11
                     /translation="MSAQCEVIVKGASNQNIGFFERYLTVWVFICIAVGIALGHYMPK
                     AFVVLGEMKVAEVNLPVAVLIWLMIIPMLLKIDFHALSGVKQHWKGIGVTLFINWAVK
                     PFSMAFLGWLFIRVIFHDWLPVEQIDSYIAGLILLAAAPCTAMVFVWSNLTDGEPHFT
                     LSQVALNDLIMVFAFAPIVALLLGLSSITVPWETLFLSVLLYIVIPIVMSQLLRALLI
                     SQGNEDALKPLLKVLQPLSLSALLATLVLLFGFQGKQIIGQPAVIAMLAVPILIQVYF
                     NSGLAYWLNRKFGVAHCVAGPSALIGASNFFELAVAAAVSLFGLNSGAALATVVGVLI
                     EVPVMLSVVKIVNQSKGWYEKA"
     CDS             complement(384495..384851)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03860"
                     /product="hypothetical protein"
                     /protein_id="BCM24127.1"
                     /transl_table=11
                     /translation="MKLSNPEYLDKIKTLSEEEKERLLSRMGGKLPRRLEKDKVSVDL
                     ALAIQLEIEDGNLQEWRKKMHAIKEKDSAGKKAKGKKVEDKPAAKTPAIKKTAEVKVE
                     VVSATKAKPKTAKAKS"
     CDS             complement(384993..385385)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03870"
                     /product="hypothetical protein"
                     /protein_id="BCM24128.1"
                     /transl_table=11
                     /translation="MFFQRNCIGDTTAEYSLDTKGEIDVTNRCRTKDGFDQAKGKTWQ
                     ASPISTSQLKVSFFWPFRADYWVIGLDEDYQWAVVANPNRKYLWILSRTPDLNKTELE
                     RAMAVAKTQGYDLKQLKFTKHGSAVNKE"
     CDS             complement(385670..385873)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002217533.1"
                     /locus_tag="ZMTM_03880"
                     /product="cold-shock protein"
                     /protein_id="BCM24129.1"
                     /transl_table=11
                     /translation="MATGIVKWFNDSKGFGFITPDGGGDDLFAHFSAIVDSGYKSLKE
                     NERVTFDVTEGAKGKQASNIQKA"
     CDS             386211..386468
                     /codon_start=1
                     /gene="infA1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VZA3"
                     /locus_tag="ZMTM_03890"
                     /product="translation initiation factor IF-1 1"
                     /protein_id="BCM24130.1"
                     /transl_table=11
                     /translation="MAKEELIEMNGVVMEVLPDSRFRVTLDNGHNLVAYTGGKMRKNH
                     IRILAGDKVTLELSPYDINNGRITFRHIESKAAFTPRRRTY"
     CDS             complement(386583..387095)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03900"
                     /product="hypothetical protein"
                     /protein_id="BCM24131.1"
                     /transl_table=11
                     /translation="MYKTSIAAIIAGLFVINPAFAAEKFTGKLETAMKAALAKYPGDV
                     ISLEAELDNGKAIYEFDIKGADGKEWEVEVDAKTGKILEINLEVVDASDPAFKAKAKI
                     TVEEAKKIALALHAGEVVESEFKIEADGDPSYEFDIKTKDGKEWEVEVDAVTGKVVGN
                     QEEVYQIGLD"
     CDS             387518..388093
                     /codon_start=1
                     /gene="nasT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037167.1"
                     /locus_tag="ZMTM_03910"
                     /product="histidine kinase"
                     /protein_id="BCM24132.1"
                     /transl_table=11
                     /translation="MLRVLLVDNHAERAAPLTQLLSDAGYNVIGRLSDTANLHDAVSA
                     LQPDVVIIDTESPSRDTLEHLIVMNSNAPRPIVMFTHDGDRDKIREATKAGVSAYVVG
                     GLAGDRLRPIMDAAIARFEEFKSLRLELNEANSKLSERKVVEKAKGLLMKQRGISEDE
                     AYGMLRNMAMKQNIRLATLAEQVVQAAKLLF"
     CDS             388313..389614
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015705089.1"
                     /locus_tag="ZMTM_03920"
                     /product="nitrate transporter component"
                     /protein_id="BCM24133.1"
                     /transl_table=11
                     /translation="MSTNEKDVAQKSFATEKVVTPDNSRRNFFRASAGALGASVLMGM
                     VPEQVRNNAWAAGTDAPEIKEVKIGFIPLTDCAPIVVAAEMGFDQKYGIKIVPSKEAS
                     WAGVRDKVVNGELHAAHVLYGLVYGVQMGIGGMQKDMAVLMSLNNNGQGITLANQIKD
                     KGVVDGPTLKRLLDNENRDFTFAQTFPTGTHAMWLYYWLAANGINAIKDVKTIVVPPP
                     QMVANMRIGNMDGYCVGEPWGARAIYDKVGFTVATSQDIWVDHPEKVLGTTAEFVAKN
                     PNTTRAMMLAVLEACRYIEATANRPAVAKLIAGKSYVNAPEEVIEGRFLGHYDNGNGK
                     KWEDSNFMKFFNDGKVNFPYLSDGMWFLTQHKRWGLLKDDPDYLAIAKKVNQIDLYTQ
                     VASQLGISVPKDPMRSSKLMDGVVWDGKNPKAYAAGFKIKA"
     CDS             389642..390559
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013096249.1"
                     /locus_tag="ZMTM_03930"
                     /product="nitrate ABC transporter, permease protein"
                     /protein_id="BCM24134.1"
                     /transl_table=11
                     /translation="MTTISLNQESVATLMQADDAKLESVIQASVKAEVKTPVPTTPKK
                     PGMLALKSREFFQWIIPPMFGIGLLLVVWTVIAHQSPNLPGPVSTWHSAVQLFSHPFY
                     DNGPNDKGIGWNIVASLERVGLGFGLAALVGIPMGFILGRFEFMSRMAAPIIGLLRPV
                     SPLAWLPIGLLVFKMANPAAIWVIFISAIWPMIINTAVGVSKVPQDYMNVAKVLNLSE
                     WKIVTKILFPFVLPYMMTGVRLSIGVAWLVIVAAEMLTGGVGIGFWVWDEWNNLNVEH
                     IIIAIFVVGIVGFMLEFLLLSIAKRFSYE"
     CDS             390570..391406
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015367094.1"
                     /locus_tag="ZMTM_03940"
                     /product="nitrate ABC transporter ATP-binding protein"
                     /protein_id="BCM24135.1"
                     /transl_table=11
                     /translation="MENKTQDTPVTTKPVAERYVQLENVNMTFVTKKGTFEALRNVDF
                     SIQEGEFISIIGHSGCGKSTVLNLIAGLLNPTDGNIFCAGREVAGPGPERAVVFQNHS
                     LLPWLSCFENVYLAVERVFGATEKKEALTARTKAVLELVGLTHAIDKRPNEISGGMKQ
                     RVGIARALAMEPKVLLLDEPFGALDALTRAHLQDELMGIMAKSGCTAVMVTHDVDEAV
                     LLSDRIVMMTNGPAATVGEILSVDLARPRKRLELAEDRDYNHLRSEVLKFLYERHAKK
                     AA"
     CDS             391512..392909
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_03950"
                     /product="hypothetical protein"
                     /protein_id="BCM24136.1"
                     /transl_table=11
                     /translation="MQANMRFTLRQVTLSLLIGTAVVSASVHAEESAPLPEYTFMDAI
                     KTGKNLTSFRLRYENVQQDGNAPAPFATRPLEDANAFTLRSLIGWQTAPYHNFSFAAQ
                     IINVAKLDDDFNDSTNGTLINAASNQPNKAQYAKVVDPDITDINQLYVDWTGIRNNRV
                     RAGRQQIILDNSRFIGDIGFRQDMQVFDGVSVLSKSIPDTEVYVAHLESVRQINTKTR
                     TDGALEVANVRYRISPTEFLIGYGYFSSFDDLGMGNAWFGAGALNNAGKPNIAANQSN
                     KVLGVRLDGIHPFNPNLRALYTAEYAKQDNYSGGDSRIDADYYKLGGGVGIDNFSIRL
                     DQELLSSNNGLYAFQTPFGTNHLFQGWVDKFLATPKEGIKDTFITGTYKYGDFLFFAD
                     YHVFNSDVDFVKATGGKGDRYGTEWNAAATYNYSKNIMTKLEYGEYSEDDQYLATASR
                     IRDTKKLWLTAMYTF"
     CDS             392941..393705
                     /codon_start=1
                     /gene="cobA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005765713.1"
                     /locus_tag="ZMTM_03960"
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="BCM24137.1"
                     /transl_table=11
                     /translation="MNKGKVYLIGAGPGDTELITIKAVNALALAQVVLIDDLVNRALL
                     AYAPNARVIEVGKRGGCKSTPQHFINRMMIALAEQGQVVARLKGGDPFLFGRGGEEML
                     ALQGAGIAVEIVPGITSGIAVPASIGIPVTHREYTHGVTFVTGHTQDEESPNWSALAA
                     TGTTLVIYMGIKHLPEIVSDLLKAGMPANTPVAAIQHGTLPEQQHIVSTLDMLPMAVK
                     QAGLASPAIIVVGDVVRLAKANHQEIETQFAEHLAA"
     CDS             393754..396201
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004530942.1"
                     /locus_tag="ZMTM_03970"
                     /product="nitrite reductase large subunit"
                     /protein_id="BCM24138.1"
                     /transl_table=11
                     /translation="MQKMKLVVVGNGMAGMRVVEELLKIAPDLYDITVFGDEPYPNYN
                     RIMLSPVLANEQTIDDIILNTREWYAEHNITLHTNARVDRIYRESRVVYAEDGTSAPY
                     DRLLIATGSKPFMLPIPGAELTGVIGYRDIKDTNDMIATAKKHKHAVIIGGGLLGLEA
                     ANGLKIQGMEVTVIHKNDWLLERQLDKTAGKMLQLSLEAKGLKFVLNANTKQLIGHES
                     GEDQGRVKAVQLDDGTELSADLVVMAVGIRPNYALAESAGIYCNRGIVVNDTMQTYDP
                     RVYAVGECVSHRGTSYGLVAPLFEMAKVCATHLANFGIGLYKGSVTSTKLKVTGIDLF
                     SAGDFSGGEDTEEIVLHDAVGGVYKKLIIKDDKIIGSVLYGDTADGAWYFQMLRDRKP
                     IHEIRDMLMFGEDSLGNTGHSGQDKAAAMTDEMEVCGCNGVCKGTIVKAIKEKGLFTI
                     DDVKKQTKAASSCGSCTGLVEQILASTLGGGYAPPSTSKVVCGCTDKNHEEVRAEIRQ
                     HKYLNIPDAMKGMSWRTPNGCATCRPALNYYLLSTWPHEAVDDPQSRFINERVHANIQ
                     KDGTYSVIPRMYGGVTTPDQLRKIADVADKYAVPMVKVTGGQRIDLLGVKKEDLTSMW
                     ADLDMPSGYAYAKGLRTVKTCVGSEFCRFGTQDSTKLGIEIEKAFDHMWAPHKVKFAV
                     SGCPRNCAESGIKDVGIIGVDSGWELYVGGNGGIKTEVAQFLCKVKTAEEVIEYSGAF
                     IQIYREEARYLDRTVHWIHRVGLDYVKQRVLDDAEGRKAAFERLLYALQGATNPWAER
                     VEKRSEHKEFDIISVTA"
     CDS             396242..396550
                     /codon_start=1
                     /gene="nirD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003087853.1"
                     /locus_tag="ZMTM_03980"
                     /product="assimilatory nitrite reductase small subunit"
                     /protein_id="BCM24139.1"
                     /transl_table=11
                     /translation="MSSWIKIVPLGDIPKLGSRVVRSSKGDIAVFRTEDDKVFALHDK
                     CPHKGGPLSQGIVYGDKVACPLHSWQIHLADGHAVEPDEGQTACFAVKVEDGSVYLEI
                     "
     CDS             396566..399301
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113578.1"
                     /locus_tag="ZMTM_03990"
                     /product="assimilatory nitrate reductase"
                     /protein_id="BCM24140.1"
                     /transl_table=11
                     /translation="MSAIPIQAKEVKSTCCYCGVGCGVLIQTEQGRITGVRGDPDHPA
                     NFGRLCTKGSTLHLSTRPEARLLYPELRRNRTDVRQRASWDESLDYVAERFAAIIREH
                     GPDAVAFYISGQLLTEDYYVFNKLAKGLIGTNNVDTNSRLCMSSAVSGYKATLGADAP
                     PACYEDIDHAACLFIAGSNTAYAHPILYRRIEDAKAKNPEMKIIVVDPRLTDTAQSAD
                     LHLAILPGTDVALFNGMLHVMLWEGLLDMAYINAHTEGFEALKNTVREYTPKMVADIC
                     GIKEADIITASKWFGAGPTLSMYCQGLNQSTSGTDKNAALINLHLATGQIGKPGAGPF
                     SLTGQPNAMGGREVGGMANLLSGHRDLANPEHRAEVAKLWGIESVPEQPGKTAVEIFK
                     AIGDGSIKAVWIACTNPAQSMPDLSSVLAALDKAELVVLQEAFQGTETTSYADVILPA
                     SSWGEKEGTVTNSERRITHLNPAVTPPVEARHDWEIATDFALRLGRLLDTTKDAAKLF
                     PYTRPEHIFNEHRETTRGRDLDITGISYGLLDESGPQLWPFPEGSDTGVKRLYTDGIF
                     QKENGKAQFVNTIYKSTAEKTDARHPLHLTTGRLRDQWHGMSRTGTVAQLFNHAEEPI
                     ISMNLGDMKRRSIEAGSLVKVSNKRGSLILRAQPSDEMMPAQTFIPMHWGSQFMNCLG
                     SNALMPSAFDKTSKQPELKHAAIKIEKVELPWQMMVMRVCHDLHLLQNIRTLLKHFDY
                     ASCGLYGRGDGMVILRASHNVTPDDGIIQQLDEMLGMTEGMPMLNYNDSKRGISKRIL
                     VENKQVTGVRLIGEILAAEWLREVMTQGEFTEQLHLWALAPLSTPPTGNGSRGKIICN
                     CVDVAENTIVDNIARGADLITLKNKLKCGTECGSCVPELNRLIKLHAPAISKFND"
     CDS             complement(399291..400208)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003686949.1"
                     /locus_tag="ZMTM_04000"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BCM24141.1"
                     /transl_table=11
                     /translation="MIDIRQLKSLKAIAETGKLGTAAARVHLTQSALSHQIRAVEEDY
                     QIKLFLRTAHGLRFTPAGERLLKLADLVLEATAQAERDLERLKASQSGELRIVLECHT
                     CFDWLTPVMDSFRRAWPEIEIDLVAGFHSDPWRLLHEAKADFVIGGLPQNMQELHHAP
                     LFEFEIMAVLAPDHPLHAKPYLQAKDFANETLITYPVPEERIDVIRHVLKPAEIAFKR
                     RTSELTVAIMQLVASHRGIAALPSWGIQSYVEHEYVIEKAITKKGLWSRLYAVGKQET
                     ITQPYAQDLVKIIRETCLAKLAGIKLFNH"
     CDS             400295..402577
                     /codon_start=1
                     /gene="metE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9JZQ2"
                     /locus_tag="ZMTM_04010"
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="BCM24142.1"
                     /transl_table=11
                     /translation="MDRIMAIAHILGYPRIGEKRELKFTLESFWKNESSELVLHQTGC
                     ELRKTNWQKQQDAGLEFISAGDFSYYDHVLDHSVLFSATPTRFGFKGKALTQQDYFAL
                     ARGNADQPAQEMTKWFDTNYHYLVPEFGPETEFLINAHEFLSQIDEAIATGAKVKPNL
                     LGPVSFLYLGKSRAADFDRLSLLPALCAEYAVLLNELTYRGIEWVQIDEPALGLDLDQ
                     QWLDAYKDAYARIRNNRPKLLLTTYFESVARYAPNITALPVDGIHIDLVRAPEQLGVW
                     LAVLPSHWVLSAGVIDGRNIWRNDLENTLETLIPVEKKLADRLWIAPSCSLVHVPVTL
                     THEQNLDAEIKPWLAFSDEKLQELNVLQQALTHGKESVKESLAASSNAILSRRLSTRV
                     HDKKVSERLSKINTISPERTSSFVQRSTLQKQRLNLPLLPTTTIGSFPQTTDIRASRS
                     AFRRSEISASDYQAIIQKNIRNAIEQQLQLDIDVLVHGEAERNDMVEYFGEQLAGYTF
                     SQNGWVQSYGSRCVKPPIIYGDVYRPAAMTVEEARYAQSLTTRPVKGMLTGPVTMLQW
                     SFVRDDQPRDQTALQLALAIRDEVDDLQKAGIAIIQIDEPALREGLPLQAGKWADYLA
                     WAVRAFKLSASVADDSTQIHTHMCYAEFNDILPSIANMDADVITIETSRSAMELLDGF
                     GEFKYPNEIGPGVYDIHSPRVPSVEAMEKLMERALQVIPADRLWVNPDCGLKTRGWPE
                     TIEALKNMVQTAKNLRLKLV"
     CDS             complement(402593..402916)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04020"
                     /product="hypothetical protein"
                     /protein_id="BCM24143.1"
                     /transl_table=11
                     /translation="MISSISNTSSTSSGGGSASQIAELQKQLAEAQKQLAAAVKSQDA
                     KVATTQAQIIQARIASLEAQIAQLSQPKNSSSTKPAADNTESNPSTQKSSSDSNLGNN
                     VDIYA"
     CDS             complement(404050..404439)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04030"
                     /product="hypothetical protein"
                     /protein_id="BCM24144.1"
                     /transl_table=11
                     /translation="MKNIIVPLLPTGLLVLAGLLSACSQQQLIQKNASYIRGGYAEEV
                     MMQMGDDTVSQCTIDLSNIQTSLISRSYDAKLVDGRLVSGKVVERWNVHNCEKQNIQY
                     IVTVKGNNSGMDDVSVMRQPTHLAANN"
     CDS             complement(404724..404984)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04040"
                     /product="hypothetical protein"
                     /protein_id="BCM24145.1"
                     /transl_table=11
                     /translation="MKTILEYLNKNGEKMDIDIAAATGLSLAAVKSKLRDLSLSGAVI
                     SCNVTRFVEGVKIEGISSRVSGSIPQPSPGRKPKTETAIESS"
     CDS             405212..406249
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528459.1"
                     /locus_tag="ZMTM_04050"
                     /product="alkane 1-monooxygenase"
                     /protein_id="BCM24146.1"
                     /transl_table=11
                     /translation="MTNTKNSLAPRFSVLDLSPIAEGSTATQSFKNTLDLAQHAERWG
                     YHRFWLAEHHGMPGIASAATSILIGHVAAGTTTIRVGAGGIMLPNHSPLVIAEQFGTL
                     ESLFPGRIDLGLGRAPGSDQITAQALRRNLASDSDAFPHDVMELLDYFSPNPKGQVKA
                     VPGTGLNVPIWILGSSLYGAQLAAAMGLPYAFASHFAPAQMMQAIEVYRETFRPSQYL
                     AKPHVMLGFNVFAADTDDEAEFLASSMQQAFINLRTGRPSKLPPPISNFWNQIGGAER
                     ALLNQVLSCSAIGAKEKVLDEIAAFVNRTEADELMITSQIFDHAARLHSYEITAKVAT
                     EMSGQGNSVKV"
     CDS             406397..408184
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04060"
                     /product="hypothetical protein"
                     /protein_id="BCM24147.1"
                     /transl_table=11
                     /translation="MHLFHLSRTRYAFAMLIFGMCLQSGYAVSSTNSPPDFGSNVVIL
                     DPSMSASAVQSKVDSIFSQQQSNQFGSNRYAILFKPGTYNNSVNVGFYTQLLGLGQTP
                     DAVTINGGVQVDAAWFDRDATQNFWRGAENLAVIPSSGTMKWAVAQASPLRRVHVRGS
                     MVLDDNGWSSGGFISDSLIDNEINSGMQQQWLSRNSRWGGWKGSNWNIVFVGDDNAPS
                     GFNWPNQSYTVIEHTPVAREKPFLTIDKKGKYSVFVPKLTNGSQGITWGNGAAAGQSI
                     PINKFYIAKAGLDTATTINRALAKGKHLLLTPGVYKLNDTLRVTTANTIVLGLGIATL
                     QPISGLSAMEVGDVDGVKLAGILFDAGVINSSVLLQVGPTGSSASHSENPTSLHDVFF
                     RVGGAGVGNATVSLRINSNNVIGDDLWLWRADHGDGIGWSTNTTTNGLEVNGDNVTIY
                     GLAVEHYHQYQTVWNGNGGAVYFYQSEAPYDVPDQASWMNGSVNGYASYKVADKVTSH
                     QAWGVGVYCFFDTNPEVKLHSAIEVPNSNVELNGIVFHDVTTVSLGGTGEITHVIGGL
                     GEAANPTYQVIRVGGFINDATSGIISSPK"
     CDS             408349..409494
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04070"
                     /product="hypothetical protein"
                     /protein_id="BCM24148.1"
                     /transl_table=11
                     /translation="MVAASSEQINVEDIADIEIPVAQYVRMSTEHQRYSTENQQLAIA
                     DYAAIHGMRIVKTYADSGKSGLNIGGRLELQQLLADVQKPDVEFRAILVYDVSRWGRF
                     PDPDEAAMYEQTCKKRGIQVIYCAEQFSNDGSLQSTIIKNIKRSMAAEYARELSVKVF
                     AGQKTLIKKGYRQGGTPGYGLRRQLIDEHHNIKGILKRGEHKSIQTDRVLLIPGPPDE
                     IATVNLIYQLFLKDGMLERGIANVLNDKRIESETGRPWTRGLVHQILTNEKYIGNNVF
                     NRTSFKLKIKHQRNDPADWVRKDGAFEAIVSVDLFMQARAIIENRSRHLDEDQMLELL
                     KQILTRRGILSGIIIDEEDGAPSSSVYRSRFGRGLYADRTQFALYPL"
     CDS             409633..410556
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04080"
                     /product="hypothetical protein"
                     /protein_id="BCM24149.1"
                     /transl_table=11
                     /translation="MQIKPSLLKALANELARLPQPVITSYQLGRLIFDAYLTNSIGEE
                     KLSLKKNIPEKTQYNNVLNSMLGTGVLSKVSGLPGNFFKILGKPEVDADEVICSIDPF
                     CYISHLSAMEYHGITDRLPRIVFVSTPPPSNWRGYAMEQMHKDLKENLNIYIEQRFPL
                     LTRPHPKKISGKLVEYKNNSHMGAYKIVHGRSLRVSTIGRTFLDMLREPELCGGIQHV
                     IDVYKEHSKQYLRLILDELDLHGKDIEKVRAGYILEDQVGISNPRIDAWQGSVQRGGS
                     RKLDPNNEYSSFFSERWALSLNLPSVISNAD"
     CDS             410690..411409
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04090"
                     /product="hypothetical protein"
                     /protein_id="BCM24150.1"
                     /transl_table=11
                     /translation="MALCYDSSRYTKDIDFSQTVKYEAGDEGKLLAELESAIQDTVQD
                     MDYGLDCRIQSSELKPRNLLNPTFPVLNLKIGYAYNHDTRQHRRLLEGQVPTVVEIDF
                     SFNETTKSVEEFQIAEGKTLLRYSLIDLVAEKFRALLQQEVRNRYRRQDLYDLHLLIN
                     QIPEQLNPLRSEILSALQESCKSKELEISQNSMNGEVIRTRTHEAYELLAAEVEEGTL
                     VEFDLAYEKVMSFYKSLPWYS"
     CDS             complement(411468..412655)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000085739.1"
                     /locus_tag="ZMTM_04100"
                     /product="ATP-binding protein"
                     /protein_id="BCM24151.1"
                     /transl_table=11
                     /translation="MQNIPEHQGFPRELLQNTVEARQAYFFDKTIGHPRLTKARDDIL
                     TLIEQASGPDIIIVTGPTGVGKTTLAGKIENNILEHYSDRMATDRSFMPVIKVDAVPP
                     DEKHKFDWKDFHTRLLQQFNEPCIAQKQLFQDYIYMEQPISQHYAMNTPAALKRASEK
                     TMRMRQTSVMIIDEANHMLLLDSRYLRQQFETIKSLSQHCNTTIILIGTYDLLQILQQ
                     SAQLVRRSRVVHMSRYNDYIADDKKAFRSALNTFRLHMPFEVTPDIMVHFDKFYLRSA
                     GCIGILKKWLDIAVQYGLESGKNTLSWEDIEPHALPNKDVKTILEEATNGETKLKDIS
                     TADLRKLLKDHHKIQTGQSTESSETESKSTKAASGKGVQKQVGKRNPKRDPVGGMQSG
                     LGF"
     CDS             complement(412658..415312)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002195918.1"
                     /locus_tag="ZMTM_04110"
                     /product="transposase"
                     /protein_id="BCM24152.1"
                     /transl_table=11
                     /translation="MLNQSELEAYFENEHLSEEARLVIANVRQSDPSRRTSSGPRSTA
                     IRHPSKKMGVIIQAESSSGELAAVYLWDHDLETHEFYDQPPRIKLEYRRVSDNRLISS
                     LHTPDYFILADGYTGWIECKSEEHLIRLAESHPERYTKDEQGNWRCPPGEAYASSLGL
                     GYKLRSSEENDWTLLRNLIFLSDYMDADCPRPTELQQNIAQALFKQKPWMLLLDLLHA
                     DKQLNADAIYKLIVDGDLHFPMYSGPISGPEYAMVYRDDISAEFYKKESTSVSAFNGV
                     NLTSIIDLTPGQKLVWDGSPWKIENVGKKSLFLRNHDGHGSDLSLIDFDNYFREGKIT
                     GLPTDLQQEMQDRTYEKICQAGPETMKVALHRFQYIDADSADSNCPISKRSLKDYRRK
                     FRQAEFLYGNGLIGLFPEIHKRGNRNRKIDDTVLELIQAVIDEKYLVATKPKLNGVYG
                     ELRNRCKDSGFLPPSIKALSAEIRKRSPYDVVLARSGKRAAYVHEEFYWRLSMEIPRH
                     GERPFDIAHIDHTQVDIQLTDRLTGLTYERPWLSIMLDAYTRKVLAFWISFDEPSYRS
                     CMMVIKNCVREHGRVPRVIVVDGGSEFDGEYFETLVAYLKIQKKSRAKSKARYGSVME
                     RFFGTTNDQLIHNLAGNTQATRTARLCTATHDPRVHSVWTLESFTDLFAKWIQDVYES
                     NPHKTLGISPADAFAIGLLDSGAREHKRISYSEGFKLLCMPTTRKKTVKIDIVKGVTV
                     NYLTYWCAEFRDPQLQGKDVPVRYDPDDASVVYLYINGRWMECISPLAAIFSRRSVKQ
                     IDLITKQMRSKDRMMGRKQSITAERIAHFIQYAEAEGKAQRQMWRDQEQLGANPSEPI
                     LVGDDSEGTVIENEVEADAADLQVYEDF"
     CDS             complement(416013..416612)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005842205.1"
                     /locus_tag="ZMTM_04120"
                     /product="peptidase"
                     /protein_id="BCM24153.1"
                     /transl_table=11
                     /translation="MGFFSPTRWRNLKGNHAHEISLNPTYFLSKNLIEIFQTLVHEQC
                     HLWQFEHGQPSRFGYHNQEWARKMKSVGLIPSDTGQPNGNVVGQKMADYPEKNGIFMS
                     ACLELIDTGYLINWIDRQPAKKLDEGFIARTYIATTSEEFLYTPLSKIFTNFEYQIKP
                     KKSKVKYHCIQCGMNVWGKSGLNIQCIDCKVILLYCISD"
     CDS             416820..418064
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04130"
                     /product="hypothetical protein"
                     /protein_id="BCM24154.1"
                     /transl_table=11
                     /translation="MNFKRFIKNPRRLAGNNQFNYVSLFSGAGLGDYGLKLAGGNCLA
                     AVEIDPNRAAVHKFNIKARMWGNIRSEKDTLIQELEGQDIDLVVATPPCQSFSTANAK
                     RGSREDPEHASRDARNHLFFEALYVIRGLKPKVVLFENVPNFLSRKVKSSNGSVTGSV
                     HDFISASLSDYQQWANVLCFSTLGVPQRRKRSLAIFVRKDVANESGSFPDLLKPESWP
                     NYPTNPPSNILQALADSEPLDSETETKSLSNSDFLHQVPTHSSFHYNWIKAIPPNSGK
                     SAWHNPCHVCNDDSAPFGSIQCEKCGAVMINRPHIFDTKGPRAIKGFTTSYKRMLPNE
                     IAPTITTASGAFSSDLKLHPVENRVLSVRECAKLQTIPYSFKWPAELNHKKGSLFREM
                     IGEAVPPLVTYRFGCALSSLLR"
     CDS             complement(418050..420149)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04140"
                     /product="hypothetical protein"
                     /protein_id="BCM24155.1"
                     /transl_table=11
                     /translation="MSNTNESASSQQPKYVLRFSHNIIEHLGLKLYQNKPTNVIAELV
                     SNSWDADANNIWINLITNTDGSPKSIIVADDGRGMDQTALVQKYLVVGKAKRAKGNPN
                     ETSIDGRMLMGRKGIGKLAPFGVAQIVELITVQNNKATWLKFDYQKMTAADHEGASLA
                     EYEPEVIADNKEIASLLSEASLAEIIKPLLNNIAGTGRGTIIWAHHLTLRRPISPSAM
                     LESLGRRFTVTLARPDFKVKVNDTEVTEKHVFPEWEIRIPDSGSLKATVETPIGNKEI
                     SYWVGFVKEATWSHDQAGVGIYAHGKIAQDRPFFFGNKGNEIFTRYLYAVVEADWIDE
                     LENDAISTDRTSIDWDNDDFTKLHEWGSLNIRGWIQVYTAHRKAVAKTENIEIVTQVL
                     KKNENLGLRESEKDHLADLLAEVTPRLGKEEANKEKLVEATVKAWVHEPARKLIKKLW
                     EEAAEFDADKFSIIVGKLSEQLIPESLSLAVVFSQRVYALTQLHNHIMLGKETQLQAL
                     IEQFPWILKNDYEKYIPRNSLKTICDEAEASGIFPRRTTHPLDGAATQPDFVFFEDAN
                     QNNMVIVELKGPEITASYGQDEQLNSYVRYLQSRFPGSNVNGILVSGNFDEVLYKTAS
                     VAVEYVRWEDVLKRSRRDHMELLAALLAGSETDKQDARVQQICQLGGKPVEEFLIAMS
                     QHTPQLALIMDKLSPQK"
     CDS             complement(420378..421241)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04150"
                     /product="hypothetical protein"
                     /protein_id="BCM24156.1"
                     /transl_table=11
                     /translation="MIAIVYGLVFFKKRNVAKRRNPITRDLLRSPGESLRIELDDVSV
                     DLMLNMAVTPLIPLILYSGYLSNVVFGNIKWGDLFSIVFYTLVGLGATLYSGRKMYQL
                     ANKKNKLSLGLDAELAVAQELNLLAHHSYWVFHDIPAEGFNIDHVLVGPSGIYAIETK
                     GRAKPIMKDGKADWNVNYDGKTLNFPGWQETKPIEQAQRQAKWLQQYLSGAVGESVSV
                     IPGLALPGWFIKRTGRNGITVFNGKNAAQILFKTNSNLLPDKLIKQIAHQLDHRCRTV
                     KPLALSPTAKQ"
     tRNA            complement(421517..421593)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00130"
                     /product="tRNA-Arg"
     CDS             421707..422672
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004552489.1"
                     /locus_tag="ZMTM_04160"
                     /product="cytochrome"
                     /protein_id="BCM24157.1"
                     /transl_table=11
                     /translation="MSDSDHDFPKTTAKQVILATLGGLIPPLLVIFLVVKLLMGIQAS
                     HIPDADPAIESALVAERIKPVATIDLAVVESGPHVDKTGEAVVGAVCSACHAVGALGS
                     PKIGDAAAWGPRIKQGYETLISHAINGIRQMPARGGNPDLTDNEIANAVAYMANKGGA
                     SFKAPEAGGAVGGASAPAAAATPAPVAEAPVAQAKPATPAEPKKVAAAPAAKPEATEK
                     PAAPPAASEVVATKEAAPAGKSGEQVYNSVCTMCHSVGLMGAPKFGDKDAWAPRIAQG
                     YDTLVQHALKGIRMMPAKGGNPALSDTEVAGAVAYMANNGGANFK"
     CDS             422714..423547
                     /codon_start=1
                     /gene="apaH_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I5U7"
                     /locus_tag="ZMTM_04170"
                     /product="bis(5'-nucleosyl)-tetraphosphatase, symmetrical"
                     /protein_id="BCM24158.1"
                     /transl_table=11
                     /translation="MATYAIGDIQGCHFSFQHLLSEIQFNPSRDRLWLVGDIVNRGAG
                     SLEVLRWVYQHRAVINLVLGNHDLHAITVAEGFAKAHRGDTLQAILDAPDRDVLLGWL
                     RCQPLIHDGGEYVMVHAGLLPQWTIQAATSLAAEVSQALCSDDYRDFLAQMYGNQPAT
                     WSDELEGMDRLRVITNAFTRLRICNDAGEMDFKFKGELSDIPQGYQPWFDIAGRQSKD
                     ATIIFGHWSALGLQQRDKLFALDTGCLWGGQLTALRLEDRALFQVPCSLEDAPQLITP
                     D"
     CDS             complement(423562..424359)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004186297.1"
                     /locus_tag="ZMTM_04180"
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="BCM24159.1"
                     /transl_table=11
                     /translation="MSSITLGSFAPTILPQHSSLVTRIYRSIRLIIHTLYGVVVASTV
                     LPRVSARNRELIISRWSRKLLGVLNIKIVVTGKVPANDVTNVMFIANHISWVDIHALN
                     SVRTVRFVAKSEIRHWPLIGWFAMKVNTLFTERERKQDAGRMVKVATESLKSNDCLCY
                     FPEGTTTDGTEIKPFKSSLIQAAINANSQVWPFAISYPLPDGKPNLEMAYWGDISFFE
                     SMKMIIAQRTPVVVMDFLTPINPQEHDRRDLANLTRQEIAEKLNLAA"
     CDS             complement(424377..425126)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004266561.1"
                     /locus_tag="ZMTM_04190"
                     /product="hypothetical protein"
                     /protein_id="BCM24160.1"
                     /transl_table=11
                     /translation="MLEKHSGRVLQQEPQNLTVSFARNASDIEEAQRLRYKIFAEEMG
                     ANLASKDGLDRDGFDDFCEHLLVRDNNTGKVVGTYRILSPMMVSEAGGYYSAGEFDLS
                     RLSHLSDRTVEVGRACVHPDFRSGATITMLWAGLAKYMQANRYEFMIGCGSVGMADGG
                     HVAASLYHKLQNDYLSPPEYRVFPRCPLPMETLKKDIEVQTPALIKGYLRLGAYICGE
                     PAWDPDFNTADMLVMLPLSRINRRYAAHFFK"
     CDS             complement(425147..425374)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04200"
                     /product="hypothetical protein"
                     /protein_id="BCM24161.1"
                     /transl_table=11
                     /translation="MKRFNLAKEYAWLKAAAPLALATKPDLCVTKFRFHNKRWMSKTH
                     PALYFLMSPDSHNLKYSVTVLSSKIRKFLIV"
     CDS             complement(425304..425756)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003381490.1"
                     /locus_tag="ZMTM_04210"
                     /product="membrane protein"
                     /protein_id="BCM24162.1"
                     /transl_table=11
                     /translation="MRSVKILAVLMISVLLAACASSNSGDVYSRDEARKVQTIKMGVV
                     ESVRQVKLEGTKSPVGTVGGAVVGGVAGSTIGGGKGSAIAAVIGAIAGGVAGSALEEG
                     VTRKNGLEITVKLDSGALVAIVQEADEAFQPGERVRLVESGSTTRVSH"
     CDS             complement(425790..426731)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038567.1"
                     /locus_tag="ZMTM_04220"
                     /product="sugar kinase"
                     /protein_id="BCM24163.1"
                     /transl_table=11
                     /translation="MHTLISGSLAYDTIMVFPDHFKNHILPDKIHMLNVAFLVPEMRR
                     EFGGTAGNIAYNLQLLGGNPLIMATVGVDFASYRTWLDSNEIKQTHIKPISNSFTAQA
                     FITTDMSDNQITAFHPGAMNHSHENSVNHTKDVSVAIIAPDGRDGMFQHARECHEAGI
                     PYLFDPGQGLPMFNGEELLYFIEMADYVAVNDYEGQLLQEKTGLSLEDIALKVKALIV
                     TKGADGSVIMVDGQRIEIPCVKATEILDPTGCGDAYRAGLLYGINQGWGWKESGQLAA
                     VMGAIKIASRGGQNHKPSKSAIADLYQDAFGSSIQLN"
     CDS             complement(426796..427359)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003109619.1"
                     /locus_tag="ZMTM_04230"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BCM24164.1"
                     /transl_table=11
                     /translation="MSALRAKILHVATELFQTRGINSTGVDMIVAVAGTTKMTLYKYF
                     HSKEELILEVLQKGHHDFQSWLTEKLDASSKKPHEKLQKLFDLIEEWMTAPDFRGMAF
                     IKASAEFPNEENPIHRLSAEQSRQFKQYLSDLAAEAGVKDAEGLSLQLSLLIEGAMQA
                     EQMKRGSGAIKYAKKAAKQLIDISLKA"
     CDS             complement(427584..428363)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04240"
                     /product="hypothetical protein"
                     /protein_id="BCM24165.1"
                     /transl_table=11
                     /translation="MSMIDTSWFLNKLKANENKPEQSLLAVFEVLSEMQAQADFVENS
                     EAENALSARTELLAYLNQQAKKAGLQAPELFAQQIYHMANNALIQQQANPASNALGHA
                     KQVASALMQVQRKPDWLQTTQHYLNVKPFQYGLAASVFVLLGAGVLLGYQAKHANAAN
                     QIVAITEAQAGTTQNANIDTSMASPGDTAEMYSAIEKMRDGRCRYIEALQLPTAQQEV
                     YLQNVIAGQVSNKASDQKTARELMGKVDCDYTPMLMKNSRG"
     CDS             complement(428382..428795)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010958512.1"
                     /locus_tag="ZMTM_04250"
                     /product="membrane protein"
                     /protein_id="BCM24166.1"
                     /transl_table=11
                     /translation="MLWIKAWHIIFMVTWFAGLFYLPRLFVYHSMSEDAASIARFKIM
                     ERKLFFGIMTPGAVLTIFFGMWLWLGYGASGAWIHAKVTLVALLVIYHIYCGKLLLDF
                     KHDRNKHSHVYYRWFNEIPVIALIAIVILVVVQPF"
     CDS             complement(428805..429341)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198028.1"
                     /locus_tag="ZMTM_04260"
                     /product="hypothetical protein"
                     /protein_id="BCM24167.1"
                     /transl_table=11
                     /translation="MNSTTTTFNSRLKKFIVPVAIIILIGALAFSLTQKAKMPDISFT
                     TIDGKKMNTAALDGKIVLVNFWATDCPGCIAEMPELIKTHEKYQAQGFEVLAVSMPYD
                     PIDQVKNYSKKNNLPFIITHDDSGALSSKFQDVRVTPTSFILDQQGRVISKIVGEINF
                     AALHQLLDAQLANSAKGS"
     CDS             429624..433466
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204849.1"
                     /locus_tag="ZMTM_04270"
                     /product="oxidoreductase"
                     /protein_id="BCM24168.1"
                     /transl_table=11
                     /translation="MIAQPMTLETATPRLREIPYNYTSFSDREIVIRFLGEEVWHVLN
                     ELRGERKTGRSARMLFEVLGDLWVVSRNPYLQDDLLQNKKRRKALIDALYHRIKAIEE
                     RSSGNPKVLKMVIAARQAVNEFENDFRLTENLRKKALTKLGKYTRKDNIQFDGLARVS
                     HVTDATDWRVEYPFVVINPDTEQEIAALVRICIELGLTIIPRGGGTGYTGGAIPLTKL
                     SAVINTEKLDRYSEVEMTALPGLEKKVPTIHCGAGVVTRRVMEAATSAGLEFAVDPTS
                     ADASCIGGNVAMNAGGKKAVLWGTALDNLASWRMVTPDATWLEVERLDHNLGKIHDIA
                     MARFRITRYEEDGKTLQGEPEILEIPGPSFRTVGLGKDVTDKFLSGLPGIQKEGCDGL
                     ITSARFILHRMPKHVRTVCLEFFGHVALAVPAIVEVKDYLDGNPKVILAGLEHMDERY
                     VKAVGYATKANRSERPKMVLIADIASDDENAVGDAASQIVRLCNARGGEGFTAVSSEA
                     RKKFWLDRGRTAAIAKHTNAFKINEDVVIPLPRLGDYSDGIERINIELSIDNKLKLVD
                     ALNAFISGNLPLLEDDDTQADPEMLLNKQKMAMELLNEKHRFWTSVLENLDAPIASIG
                     AEYADLAAENVFRAVQSHQVRISWKRDIKKALHQIFTGREYTKILERCDEIHKQVLKG
                     RVFVALHMHAGDGNVHTNIPVNSDDYVMMQAAHTAVARIMKLAVGLGGVISGEHGIGI
                     TKMEFLEDKAIETFAKYKQKVDPEGRFNKGKLMAGGDLRHAYTPSFSLMEAESIIMEQ
                     SAIGEIADSISDCLRCGKCKPVCTTHVPRANLLYSPRNKILGTSLLIEAFLYEEQTRR
                     GISLKHFDEFNDVADHCTVCHKCLNPCPVDIDFGDVSVAMRNFLREQGKKHFNPGTAA
                     SMAFLNAKDPATIKMLRTGMLQFGFKAQRFAHQIAKKLGLLASFKKHPPATVGKPEVK
                     AQVIHFLNRPMPKALPTKTSRALLGVEDDTMIPVIRNPQKTTEDSDAVFYFPGCGSER
                     LFSNVGLATQAMLYEIGAITVLPPGYLCCGYPQTSSGNHDKGQEIITDNRVQFHRIAN
                     TLNYLDIKTVIVSCGTCMDQLQKYEFEKIFPGCRLLDIHEYLMEKGLKLEGVSGTRYM
                     YHDPCHSPMKTYAPLKVTNALMGQDVALNDRCCGESGTFAVARPDIATQVKMRKQEEL
                     EKGMRKLGLTPGKPEQDVKILTSCPSCLQGLSRYGEDTGITADYIVVEMAKHLLGEGW
                     MEDYVEKANNGGIEKVLL"
     CDS             434330..434758
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04280"
                     /product="hypothetical protein"
                     /protein_id="BCM24169.1"
                     /transl_table=11
                     /translation="MRTLFILMGCLVSLSAWADDDAGLGYSSGLSGDVPNTATVLPAP
                     GSRPSVPNGVRIYVPPKNLEPRTLVVPLPNEKSPVVIYRSDSVETVPSLYPPLPQNSV
                     AKPEPKKKKGSKLKAEDAETEAPANPYILKTKPLEPIISQ"
     CDS             complement(434760..436082)
                     /codon_start=1
                     /gene="phoR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P23621"
                     /locus_tag="ZMTM_04290"
                     /product="phosphate regulon sensor protein PhoR"
                     /protein_id="BCM24170.1"
                     /transl_table=11
                     /translation="MLDIRWRAFWLFFSLLLISLIIWAFENFTLALGIFTLGTLAYLA
                     SHLYWLYRLSEWYKKPDLASIPAGSGTWEDIFATIYHEQRRHNRSQSQLSSVLDRFQH
                     AASALPDAVVLLDARDIIEWCNPSAEKLLGLALKSDSGQPINYLMRHTEFIEYLQLKD
                     YADPIKLISWRDPSVTLELQLVPFGDNQKLLIGRDVSQLEKLEHMRRDFIANVSHELR
                     TPLTVVGGFLETLMDMEGAVPESTRGYFGMMQEQTGRMRRLIEDLLTLSQLESGQNIP
                     PDTEIDVNSLLNMVMHEAQSLSNGKHHITLEADASLGLTGAAEELHSAFGNLVSNAVR
                     YTPEGGEIHMVWKMRGTDAAFSVHDSGIGIEQKHIDRLTERFYRVDRSRSRETGGTGL
                     GLSIIKHILTRHQARLEIESELGNGSTFSAVFPKSRLTRKTPALANNQ"
     CDS             complement(436121..436807)
                     /codon_start=1
                     /gene="phoB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192125.1"
                     /locus_tag="ZMTM_04300"
                     /product="DNA-binding response regulator"
                     /protein_id="BCM24171.1"
                     /transl_table=11
                     /translation="MPANILIVEDEPAIQELLALNLTQAGHNPLRALSVEQAQLLIRE
                     ALPDLIILDWMLPGMSGIEFARKLKSDELTKTIPIIMLTARGEEIDKVRGLEIGADDY
                     VTKPFSPRELNARIKAVLRRRAPQMTDDPIEVKGLRLDPVTHRVTGNGDVLDLGPTEF
                     RLLHYFMSNPERVHSRTQVLDRVWGDRVFVEDRTVDVHIRRLRLALANSGHEDLVQTV
                     RGVGYRFSAH"
     CDS             437050..438708
                     /codon_start=1
                     /gene="yhjX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037499.1"
                     /locus_tag="ZMTM_04310"
                     /product="MFS transporter"
                     /protein_id="BCM24172.1"
                     /transl_table=11
                     /translation="MASFLSKERITASPNFNRWLIPPAALALHLCIGMAYGFSVFWKP
                     LGNVLLGADGKALATCAAGASTFGDKLAGTLRALTATDCNWTQFDLGWMYTLFFVVLG
                     CSAALWGGWLERAGPRKAGLVSTLCWCGGLLISAYGIYVHQLWMMWLGSGVIGGIGLG
                     LGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMIGSPLATKLMAHFAAPGSAGIWQT
                     FVSLAVIYTVFMLLGSLSYRVPPSGWKPANWTPPATSSNSMIAQNHVHLKNAHRTPQF
                     WLLWLVLCMNVSASIGIIGAAAPMLQETFGGALINQPDVGFADIKKDEGMTAAAAAVG
                     AGFVGLISLFNIFGRIAWASSSDKLGRKQTYFIFFVLGAVLYTALAFAAGAKSLALFG
                     ACICIIASMYGGGFATIPAYLADLFGTQFVGAIHGRLLTAWSTAGVLGPVVVNYMHDV
                     RLEKGVPFDQVYSSVFYVLAGMLVVGFIANLLVKPVAAKYFMSAQELAEEKKIAHEKV
                     VVAGEAGASTGGGKSVAVIMWLLVLIPISFGIWSTLQKAWILFH"
     CDS             438709..439275
                     /codon_start=1
                     /gene="tag"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010957540.1"
                     /locus_tag="ZMTM_04320"
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="BCM24173.1"
                     /transl_table=11
                     /translation="MTTRCAWPKSPLDIVYHDTEWGVPVHDDRKLFEFLILEGAQAGL
                     SWSTILKKREHYRLVFDDFEPAVVAQYTDDKSQALLTDAGIVRNRLKIASTINNAQKF
                     LQIQAEFGSFDAYLWRFLDGKPIQSHWQAHTQLPARTVISDQLSKDLLKRGFKFVGTT
                     ICYAFMQAVGMVNDHSVDCFRYKELMPI"
     CDS             439410..439859
                     /codon_start=1
                     /gene="ribH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HV4"
                     /locus_tag="ZMTM_04330"
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="BCM24174.1"
                     /transl_table=11
                     /translation="MREIPQDLNGSGLRIGIVLSRFNSEIGEGLLAACEAELIKLGVA
                     EEDITLVTVPGALETPLALQQLADTEDYDGLIALGAIIRGETYHFEVVSNESARGISE
                     VQLNTGVPVANAILTTQNDEQAIERMAVKGAEAATVAIEMVNLLKQL"
     CDS             439856..440341
                     /codon_start=1
                     /gene="nusB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HWX6"
                     /locus_tag="ZMTM_04340"
                     /product="N utilization substance protein B"
                     /protein_id="BCM24175.1"
                     /transl_table=11
                     /translation="MSELDKKAADAKPAKPKQASKSRRKSRELALKGLYRSFLNQTPI
                     RHVFLDLADDPDLAKADEAYFHQLLEGVTEKLAELDHRVSEFLDRPLVELSPVEHAVL
                     CISGYELIFDPSIPYRVAINEGVELAKMYGGTDGHKYVNGVLDKLAAAARPDEFRHNG
                     R"
     CDS             440556..443081
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04350"
                     /product="hypothetical protein"
                     /protein_id="BCM24176.1"
                     /transl_table=11
                     /translation="MKKTFWKSDWFAGLVISLLFLFAGGTAILQSLERKAYDLGVEAS
                     SRNPGDKIAIIAIDDQSIANIGRWPWSREVHAKMIDLLAGAHAKVIGNTVFFIEPQID
                     PGLSYINKLAEVVANAPEISALPQSAELNSILKDAQANLNTDATLAASIKAADSVVIA
                     MPFVVGEPRGNPDKPLPDYVLKNGLSKIIDKVGAEESGLLPLPTINALSPVAIIGESA
                     AAIGHLNANPDVDGAIRSEPLVLAYYDQFYPSLSLQIAAKYLNLKDTDIQVKLGEGIK
                     LGKLNIATDGFLQMNTFFYANHDGHTAFPIDSFYDVISGKIPVEKYKDKIVLIGATAG
                     GIGDSQVTPISSSMTPIETLAHSVASILNEDFFVAPSWAFWVEKTAWLLISLYLILLL
                     PRLKAGMAAGITAALFALLVATHFYLMTQQALWLQLMIPATLLVVGHALLTTKRFLMT
                     ERGKEKSEADSAESNRNLALMFQSQGQLDMAFDRLRKCPMEESVMDALYSLALDFERK
                     RQFNKAENVFAYMAEYNPKYKDLEQRLSRSRAMAETVILGGTGGGRTNTSILQDGSVE
                     KPMLGRYQIEKELGKGAMGVVYLGKDPKIGRVVAIKTMALAEEFEPDELEEVKERFFR
                     EAETAGRLNHPNIVTMYDAGEEHDLAFIAMEFLKGKDLAPYTKPDNLLPLLKVMDIVA
                     KTADALDYAHTQNVVHRDIKPANIMYELETSSVKVTDFGIARITDSSKTKTGMVLGTP
                     SYMSPEQLAGKKVDGRSDLFSLGVMLYQMATGQLPFKGDSMAALMYKIANEPHESVKT
                     LNPELPQCLSDIIDKMLDKDMDKRYPRGAEIAAEIRQCMNEAG"
     CDS             443085..443909
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002354922.1"
                     /locus_tag="ZMTM_04360"
                     /product="protein phosphatase"
                     /protein_id="BCM24177.1"
                     /transl_table=11
                     /translation="MNMTEFLEIVRLTDVGQRRDHNEDTIASDIELGLVVLADGMGGY
                     KAGEVASEIATLTIVAELKESMLSLEPGLVDAVSEMQAESQLVIDAVAKANESIYSVS
                     QSQPQCAGMGTTLVVGLFTNNKLLAGHIGDSRMYRLRQGELVQITEDHSLLQEQLNSG
                     LITPEQAKFSNNKNLVTRALGIDPEVELELHEHDVLPDDIYLLCSDGLSDLVPDEEIS
                     ETLGTLSANLELAANQLIQMANDNGGKDNISVILVKVLKPFPVERTWYNNFFNWLK"
     CDS             443921..444637
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04370"
                     /product="hypothetical protein"
                     /protein_id="BCM24178.1"
                     /transl_table=11
                     /translation="MAKLIFSLDGAFLGEFPLDKDKITVGRRATNDIHIDNLAVSGEH
                     ATIVTIGNDSFLEDLGSTNGTLVNGKTIKKHVLQHADLIEFGKYQLKYINESAIPTGL
                     GGSDDFEKTMIIRPMKAAALQEAAKPQAAPAAPAPAAPIVPPPVAEPTIVGRVQVLNG
                     PSQGKELVLNKALTTLGKPGVQVAVITKRPQGYFITHVEGATHPVVNGQSVGAQAHSL
                     SDHDVIEIASVKMEFYLGAA"
     CDS             444748..446379
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000836895.1"
                     /locus_tag="ZMTM_04380"
                     /product="HD family phosphohydrolase"
                     /protein_id="BCM24179.1"
                     /transl_table=11
                     /translation="MTEQQELLKRLERLNAIGIALSAERNNKRLLEMILLGAKEITNA
                     DGGTLYTVTDDRRLKFEIMRTMTLGIVMGGTTGNDIPFPPLPLYLEDGIPNLNMVAAY
                     TVLNDRTVNIEDAYEADGFDFSGTRKFDQSMGYRSKSFLTIPMKNHENEIIGVLQLIN
                     AIDPVTSEIVPFSAENQQLVESLASQAAVALTNHNLIEGLKNLFESFIELIADAIDEK
                     SPYTGGHCQRVPELTMMLANAACKTQVGPLREFNLTEKEIYELRIAAWLHDCGKVTTP
                     ESVMDKPTKLSCIFDRINLVDQRFELLKKQAETEMLRKQLALLKAGAAADFDILESEL
                     NAFKKSLDEDKEFLHNANLGGEFMTPEDQQRVINIGAYELYSAEGERIPFLNEDEIYN
                     LNIARGTLTNEERTVINNHIDVTINMLESLPYPKDLQRVPEYAGGHHERMDGKGYPRG
                     LKREQMSVPARIMGIADIFEALTSRDRPYKKIKTLSESLFILGKMKLDNHIDPDLFDL
                     FIRDKIYLQYAQQFLEPDQIDEVNEQTIPGYAVPA"
     CDS             446413..446985
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04390"
                     /product="hypothetical protein"
                     /protein_id="BCM24180.1"
                     /transl_table=11
                     /translation="MSKTQKILVALSAINLVIVFLFPPYDDHSVSSHGASIFAGFLFA
                     LSHKTLNLVVNDNLLYLEVTVVLVNLGVLWLLTLENERRNAKKKFSFRKAAMILVVVN
                     LLGVFLFPPFEYISNMTNAVIPTFEGFYCIFSPPPYRAIVTPILYLEVMFILMNGGLM
                     LLAFKQPKDETYSAEQTIAYMAKQQSARRR"
     CDS             complement(447003..447287)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04400"
                     /product="hypothetical protein"
                     /protein_id="BCM24181.1"
                     /transl_table=11
                     /translation="MALDKKVIVCIKHRTSAHQPSCAAKGSEALAKQIEQMIIAKGLM
                     LSVERFKCLGCCDQGINIKLVPEGPFLHGLTLENLDELAIALENFANPAH"
     CDS             complement(447306..448058)
                     /codon_start=1
                     /gene="lpxH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q32JL2"
                     /locus_tag="ZMTM_04410"
                     /product="UDP-2,3-diacylglucosamine hydrolase"
                     /protein_id="BCM24182.1"
                     /transl_table=11
                     /translation="MNIIGDEADFSLFISDLHLCHTRPAITALFIEFLQSQATQAKSL
                     YILGDLFEYWAGDDDIDDPHHQQVIGAIKVLAATTPVYFIHGNRDFLISHGFANASNI
                     TLLADPTLLEVYGKRLLISHGDELCTDDLAYQAFRTQVRNPAWQQQFMAQPLSSRKSQ
                     IEALRMRSETEKSQKSEAIMDVNDGAVQALFKAYAYPDLLIHGHTHRPAKHVLEIDSH
                     HCERWVLGDWYDQGSCLRLDAAGCSNVILHLQ"
     CDS             complement(448074..448565)
                     /codon_start=1
                     /gene="ppiB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I2U9"
                     /locus_tag="ZMTM_04420"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BCM24183.1"
                     /transl_table=11
                     /translation="MVKLHTNYGEITLELDAEKAPITVANFLEYVESGFYSNTIFHRV
                     IDGFMIQGGGFEPNMSQKPTNAVIKNEANNGLLNKKYTVAMARTPSPDSASSQFFINI
                     ADNDFLNFTAPTSQGWGYAVFGKVSAGIEVVDQIRKVKTGSKNGHQDVPVEPVIIERA
                     EVV"
     CDS             complement(448558..449244)
                     /codon_start=1
                     /gene="ppiA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q747E8"
                     /locus_tag="ZMTM_04430"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BCM24184.1"
                     /transl_table=11
                     /translation="MLSSRLLIRSFLFSAFISAMLFASVASAEEVISGKPQVEFQTNR
                     GIFVVELYPDKAPASVANFLKYIELGFYDGTIFHRTIKNFVVQGGGLTADMLQKSTYS
                     PIVNESNNGLKNEPGTIAMARAFDPDSATSQFFINLTDNKYLNFYKPDPHYIGYAVFG
                     KVIKGLDVLQAISATPTQVIGLNKNVPIDPVIVEHTRLLDMPVMPESQSSKPTPTEIT
                     KPKAKGKKRG"
     CDS             complement(449311..450531)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010880067.1"
                     /locus_tag="ZMTM_04440"
                     /product="hypothetical protein"
                     /protein_id="BCM24185.1"
                     /transl_table=11
                     /translation="MQILKVLSVSLLIGSALLPWNATAIDHLEQVKFNGNNNFAANYT
                     ESLLVRSLLQITQGQLQQASQTIDQVIQTAPNFKLAYLVRGDLLMARAQQLQSFGSAP
                     ESNPDKVSDFRAEARMRLEHYLAKQAPSSIPEPLWQIDASQQYVIVVDADKSRLYLYR
                     NVNNQPQYVADYYVTVGRNGSEKSSEGDKRTPVGVYYADSQLIKKLPDFYGNAAYPLN
                     YPNEWDRHQGKNGHGIWLHGTPSDTYSRPPRASDGCVVLSNPDLKAIGPIMQKGKTLF
                     IVANNMQWVSPDQAATQKMGLTKAVEDWRKDWESQDTEAYLSHYSNQFFTQSTNLDGW
                     SKEKRRIQAYKMHVEIQLSNVSMFRYPNSQQQMAVVNFDQDYKSDNLDSKMRKRQYWI
                     FENQRWKILYEGAA"
     CDS             complement(450553..451686)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04450"
                     /product="hypothetical protein"
                     /protein_id="BCM24186.1"
                     /transl_table=11
                     /translation="MPVLRVVLTALLLSLPLSAAFSTSASAAPADDLKEITQLANQGQ
                     QAAALTKVNSYLSDNPKDVQALFIKGVLLAELNKRDDAIKTFTDITAKYPNLPEPYNN
                     LAVLYADQGQYDKARIALETAIKTHPSYATAHENLGDIYARMASEAYDKALQLDNSNA
                     RAQNKLSLIKELFSTTGKPTMLADNSKPADNTKPVVKPADVAKPVESVKPVEPIKPTE
                     PVKPAEPVKPIEVKPAEIIKPAEPAKPVVVEKPNAEIAKPAEKDGNDENNVMNAVKLW
                     AKAWSNKNVDQYLASYADSFQTPAGQSRKEWEASRRGIIGKAAAINVEVLNPRVSFES
                     ANKAKVSFKQNYRAGAVTKRTSKTLVLQKVRNTWLIQQELTDR"
     CDS             451878..453266
                     /codon_start=1
                     /gene="cysS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5F5D6"
                     /locus_tag="ZMTM_04460"
                     /product="cysteine--tRNA ligase"
                     /protein_id="BCM24187.1"
                     /transl_table=11
                     /translation="MLKIYNTLAREKQLFVPIVAGKVSMYVCGMTVYDYCHLGHGRVM
                     VVFDMVNRWLRASGFDVTYVRNITDIDDKIIKRANENNETIGELTARFITAMDEDAAK
                     LGVMRPDIEPRATDYIGGMVSMIVALIANGNAYAADNGDVFYSVNSFANYGKLSGKSL
                     EDLRAGERVEIDAFKRDPMDFVLWKSAKPNEPSWDSPWGKGRPGWHIECSVMGEHHLG
                     KHFDIHGGGQDLQFPHHENEIAQSEAAHHCTFVNYWMHNGFIRVVNEKDGLDEKMSKS
                     LGNFFTIRDVLKKYDAETVRFFILRAQYRSPLNYSSVHLDDAKAALSRLYTSLRGLDV
                     ADIEIDWHQPAAATFKTAMDDDFNTPEAIAVLFDLANQVNKAGSLKEAGLLKKLASIL
                     GLLQRNPESYLQGEVEVGGISQELIWMLINQRLDAKKNKDFALADSIRKELLEAGIVL
                     EDHSSGTSWRRV"
     CDS             453368..453658
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04470"
                     /product="hypothetical protein"
                     /protein_id="BCM24188.1"
                     /transl_table=11
                     /translation="MLLKKSFVVLLSLVLYFSLLAQQTHQTYAEDFDVPTLMDIPHVE
                     ADSKVDSNEPMLFSQSLTPSKSIPRNADSLFHTQYHQPEFALILRPPKAISI"
     CDS             453921..455138
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010941495.1"
                     /locus_tag="ZMTM_04480"
                     /product="RND transporter"
                     /protein_id="BCM24189.1"
                     /transl_table=11
                     /translation="MLSVFALSVSPAQAAPVFTLQQVLDSAMQQNPAIAIIRAQEDAA
                     QATVTTAKSFANPEIDAGMGPTRFRTTNQSDSRNWGVGLSQPLEFSDVRTARREIAES
                     NVKAVGFNSELTRIELRSRVKSVFYEVLQRQAVLKLVEDDRNSLKQIRERVKLRTDVG
                     ESPRYELIKADTEALAAERDYQSAIVRVTEAKAYLRGLIGNSMPADYELAGELPLVDT
                     LPDLITLRDKIDQSPLLQQIRAQKETAEAKLRLEESLRNPGLTLKAGIDQDPDLTSLR
                     FGLAIPLPLWNQRQGQIAEASANVMQAQAHVSDRELALQRDIESSYQRYLIAQGQVAA
                     FENGLLSQAESVLKVAESAYRFGERGILDYLDAQRTYRSVRKDYLAARYDYINAMLEI
                     ERLLGTELLEVKS"
     CDS             455138..456322
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010942781.1"
                     /locus_tag="ZMTM_04490"
                     /product="RND transporter"
                     /protein_id="BCM24190.1"
                     /transl_table=11
                     /translation="MAVYLNTNNMMLNKSNVIKPLLISLLIAFCLVGCKAKEEAKPKQ
                     EAVDPNIVQLTPLLENEVKLVTASMSDVREVLRIPGSIQVEDRRMARIGASVTGRITD
                     IDVVLGQEVKQGQVLATLNSTELGQNQLVYIKAQQQISLQSRAVDRAKLLLESDVIGA
                     AELQRREAELSAAQADLNAAGDQLEVLGMSKTAIAQLAKSSQIHSFSSVSARLAGTVI
                     ERKVNLGQVVQPAEQLFTVADLSHVWAVAEVPEQQAELIQEGEEVNIEIPALSNKQFT
                     GKLIYVADVVNPQTRTVTVRTDMENHERAIKPEMLVSMLVQSKPVPKLTVPMQSIVRE
                     DNKDHVFVQIAPRKFRLREVTLGSEYEGMVTIESGVSEGEILVGEGAFHVNNERKRKE
                     LE"
     CDS             456326..459427
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010942780.1"
                     /locus_tag="ZMTM_04500"
                     /product="cytochrome-c peroxidase"
                     /protein_id="BCM24191.1"
                     /transl_table=11
                     /translation="MIESLIRAALKQRLIVVVLAIALMAAGLFAVKKLSVDAFPDVTN
                     VQVLIATQATGKSPEEVERFITVPLEISMTGLPGLTEMRSLNKNGLSLITLVFTDDTD
                     VFFSRQLVMERLMEVMDRMPAGVTPILGPVSTGLGEVYQYTLDKPTDGSSELSQADLT
                     ERRSIQDWVVRPMLRGIPGVAEINSQGGYVKQYQALVNPDRMNHYGLKLQDVYTALAR
                     NNANSGGGVLPHYAEQYLIRGVGLIQNVEDIRAIVLKEQNGVPVYMRDVAEVQIGNEV
                     RVGTVVKNGYTESVGGVVIMMRGGNAKEVVSRVKERVQEINDKGMLPEKLQIIPYYDR
                     SELVDAALHTVVKVLIEGIILVVIILFLFLGDVRSSLIVVTTLVLTPLITFIAMNYLG
                     ISANLMSLGGLAIAIGLMVDGSVVVVENTFHQLGHRPGESKIRVVLEAASEVGTPVLF
                     GVGIIVLVFLPLMTLEGMEGKMFAPLAMTIAIALLVSLVLSLTLSPVLCSYMLKGGSG
                     EDTRMIQAIKRPYLSMLNWALNNDKKTIGLATAVFVVSVMIVPLLGTSFIPEMKEGSI
                     VPGINRVPNISLEESTKMEMKAMKLIMEQVPGVKSAVSGVGRGESPADPQSQNESTPI
                     ISLKPRSEWPKGWTQDDIAAKMSQVLEDGLPGIQVVMAQPISDRVDELLTGVRSDVAV
                     KIFGDDMGLLKAKADEIAKIAGTVRGAVDLRVEKVSGQQYLNIVIDRQAIARQGINAS
                     DIHDIIETAVGGKVATDIYEGQRRFSAAVRYPESFRDNVTAIGNILVTSPNGSRVALH
                     DLAKIEIRDGPAQISRELAKRRIVIGVNVKDRDLGGFVAELKQVLDKQLKLPDGYYLE
                     YGGQFQNMERALGHLMVIIPITIAAIFFLLFLLFNSVRYATMIIMVLPFASIGGIFGL
                     FVTGEYLSVPASVGFIALWGIAVLNGVVLVSYIRTLRDEGMSQAEAIIHGCKQRFRPV
                     MMTATVAMLALVPFLFATGPGSEIQRPLAIVVIGGLITSTLLTLVVVPTLYRKFEESR
                     IEA"
     CDS             459473..459808
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010942779.1"
                     /locus_tag="ZMTM_04510"
                     /product="nitrogen regulatory protein P-II 1"
                     /protein_id="BCM24192.1"
                     /transl_table=11
                     /translation="MKEIKAVVQPHRLAKIRSALRNIKGFPGMTVSKVDGCGHHLAKP
                     SHGIREELTDYSPKVHIEMVAPDDLVEGILQILVEVGHTGQAGDGIVWVTPVERMIRL
                     SEQITVLDC"
     CDS             459998..461179
                     /codon_start=1
                     /gene="gtrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036173.1"
                     /locus_tag="ZMTM_04520"
                     /product="glycosyl transferase"
                     /protein_id="BCM24193.1"
                     /transl_table=11
                     /translation="MALVTETWPPEINGVAMTLQRLIHGMLAKGWQVQVVRPRQKSDG
                     RKSDVHVELQHGIRHVLVPGLPIPGYNGLRFGMPMLAKLREQWKRNRPDVVHIATEGP
                     LGWAALKVAKNLGIPVTSSFHTNFHSYCKYYRMGWLRGMVMRHLRVFHNQSSLTMVPN
                     AILSDMLLEENYRNVVVLGRGVDSGLFSAHRRSAALRAEWGVEDDALAVIYVGRMAAE
                     KNLHVVVKAFTAIQQNNPKARMIWVGDGPALKKLLKKHPDHIFCGAQLGESLAEHYAS
                     GDLFLFPSMTETFGNVVTEAMASGLAVVAYDYAAAEIFIKHNKNGLIMPFGDQTGFIQ
                     AAIDIANDIPQLKKLGQSAHLAVADYSWDKIFNHFDAYLKHAVAQKSAIEPSELITEE
                     V"
     CDS             461233..462249
                     /codon_start=1
                     /gene="pyrD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62K45"
                     /locus_tag="ZMTM_04530"
                     /product="dihydroorotate dehydrogenase (quinone)"
                     /protein_id="BCM24194.1"
                     /transl_table=11
                     /translation="MDIYQLAKPLLFKLDAEKAHDLTLKSLNLAEKSGLLGLLPKPPA
                     CQPRTVMGVTFPNPVGLAAGLDKNAAYIDGLAALGFGFIEVGTVTPRPQPGNPKPRLF
                     RVTEAEGIINRFGFNNAGVDALVEKVQAAKLKGVLGINIGKNFDTPNERAVNDYLYCM
                     AKVYAHATYITVNISSPNTKNLRQLQEKEALSALLGTLKQEQLRLAEQHGRYVPIALK
                     IAPDLEAEQVKEIADLLLAHKIDGVIATNTTLARDPVVGLKNAEETGGLSGAPVRDKS
                     TLVIKQLAQRLQGQIPIIGVGGILSGQDALDKIKAGASLVQVYSGLIYRGTGLVRDIC
                     YRLG"
     CDS             complement(462266..462931)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004194213.1"
                     /locus_tag="ZMTM_04540"
                     /product="haloacid dehalogenase"
                     /protein_id="BCM24195.1"
                     /transl_table=11
                     /translation="MQLALFDLDNTLLAGDSDYQWGQFLIEIGVLDRAIQQTVNDQFY
                     QDYKDGKLDIYAFLEFQLKVLSLHSREQLDTWHAQYMQKKILPMMTKKSKALVEKHRQ
                     NGDLLMIITATNSFVTKPIATAFGIDNLIGTTPEEIDGKFTGKATGIPSFQEGKVTRL
                     HAWLAEQGKTLADFETTWFYSDSHNDLPLMKLVDKPIAVDPDPVLEDYAKTQGWPIIS
                     LRS"
     CDS             463013..463681
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000417707.1"
                     /locus_tag="ZMTM_04550"
                     /product="membrane protein"
                     /protein_id="BCM24196.1"
                     /transl_table=11
                     /translation="MNFPDGLLPATLLWTANILAVFILYLAVRTADWRLLKNETWQHV
                     FLGSSATLILLWSIKAGIKPALDFHMLGATLLSLMFGWQFALMALSLVLLGITVFGMA
                     GWESLGLNFMLMGIIPALFSYNFFRWVDRKLPNHFFIYVYVTSFASAALAITLCGIAA
                     ILVLSLFGVYTDHYLTQNYLPYFILMAWSEALLTGMAVTMMAVYRPEWLVTFSDKRYL
                     DNED"
     CDS             complement(463734..465284)
                     /codon_start=1
                     /gene="leuA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9JZG1"
                     /locus_tag="ZMTM_04560"
                     /product="2-isopropylmalate synthase"
                     /protein_id="BCM24197.1"
                     /transl_table=11
                     /translation="MNTATKNNQLIIFDTTLRDGEQSPGASMTKEEKIRIARQLEKLG
                     VNVIEAGFAAASPGDFDAIHSIAEVITNSTVCSLARANENDIRRAGEAIKPAKKGRIH
                     TFIATSPIHMENKLRMTPDQVLERAVQAVKWALEYTDDVEFSAEDAVRSDMDFLVRIY
                     DAVIQAGATTLNVPDTVGYSIPAHWGERMKQLIERVPNSDKVVWATHCHNDLGMAVAN
                     SLAAVMNGARQVECTINGLGERAGNASLEEIVMSVKTRRDIFQLETSIDTTQIVATSK
                     LVSSITGYPVQPNKAIVGANAFSHESGIHQDGVLKHRETYEIMRAEDVGWGANKLTLG
                     KLSGRNAFRTRLTEIGITLDSEDALNAAFARFKTLADKKSEIFDEDLQALVSDEVLNE
                     ATENYKLAYLQVCSQTGETPHAIITILDNGVEKRAESDGGGPVDASFKAIENIVSSGT
                     ELLLYSVNNITSGTDAQGEVTVRLAKGGRIVNGQGADTDIVIASAKAYLNGLNKLHTK
                     ERAHPQLV"
     CDS             complement(465603..466406)
                     /codon_start=1
                     /gene="pssA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004186682.1"
                     /locus_tag="ZMTM_04570"
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="BCM24198.1"
                     /transl_table=11
                     /translation="MAEATPRPRRKKPLIQSGLRERSIYLLPNLFTTAALFAGFYAIV
                     QAMSGEFERSAIAIFIAMVMDGLDGRVARLTNTQSAFGAEYDSLSDMVSFGVAPALIL
                     YVWALKPMGKLGWIAAFIYCACAALRLARFNTKLDESDKRYFQGLPSPAAAALLAGLV
                     WVSFDNGIVGDEIFFGWIKMKWLAWGITVFAGLSMVSDLRYYSGKDINLRSSVPFVVI
                     LLIVLGFVLISYSPPEVLFMVSVAYGLSAYALWSIGRLGKKAASASQEV"
     CDS             466586..467695
                     /codon_start=1
                     /gene="tgt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5NFU8"
                     /locus_tag="ZMTM_04580"
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="BCM24199.1"
                     /transl_table=11
                     /translation="MKFNLIKQDGAARRGLVSLAHGDVQTPAFMPVGTYGSVKSLSPI
                     EVKEIGAHILLGNTFHLWLRPGLDVIEAHGGLHQFMGWDGPILTDSGGFQVWSLGALR
                     KISEEGVKFRSPINGDSCFLTPEESMRIQRVLNSDIVMVFDECTPYPATHQEANDSMQ
                     LSLRWAKRSKAAHEGNANALFGIIQGGMHEDLRNESLAGLEEIGFDGYAIGGLSVGEP
                     KEDMLRILTHTAPQMPKNKPRYLMGVGTPEDLVAAVSQGIDMFDCVMPTRNARNGWLF
                     TRHGDIKLKNARYKLDTSPLDAECTCYTCRNFSRAYLHHLHRLGEILGSRLNTIHNLH
                     YYQELMAGMRKAIEEGNFASFKEEFARNRAIHVKA"
     CDS             467779..468093
                     /codon_start=1
                     /gene="yajC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004194088.1"
                     /locus_tag="ZMTM_04590"
                     /product="preprotein translocase subunit YajC"
                     /protein_id="BCM24200.1"
                     /transl_table=11
                     /translation="MFISNAYAATGGAPEYTQFLFPIAIVVLFYFMLIRPQMKQAKEQ
                     RKMIEALQKGDEVSTSGGIIGTVSKVGDSFVAIEIAAGVIINVQKPTIQTLLPKGTIK
                     SI"
     CDS             468171..470000
                     /codon_start=1
                     /gene="secD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VZ84"
                     /locus_tag="ZMTM_04600"
                     /product="protein translocase subunit SecD"
                     /protein_id="BCM24201.1"
                     /transl_table=11
                     /translation="MNRYPLWKNLLVIFALVFGIVYSLPNIFGESPAVQISPNKNTVK
                     IEPALLDQVENALKAQNIKFDHLTLEPSGIKVRFDDTDTQLKAKDVLQKSLGDDYVVA
                     LNLLTRSPSWLASIGALPMYLGLDLRGGVHFLLQVDMKAALDKATDRYVGDFRSSLRN
                     ERVAYLGISREGQSVQIRFSQSAELEKARKIIAKDSPDLTLKDSDTGTEKLLIATLNP
                     QAQKRIQDFALKQNIQTLHNRINELGVAEPIIQQQGSDRVVVQLPGVQDTAKAKEILG
                     RTATLEIRLVDEEKSDASTLDAASKGQVPFGDEYYVGRNGQPILVKKSVVLTGEYITD
                     AGPGLDSQNGESVVHVTFDGRGARIFKQVTKDNVGKRMAILLVEKGKAEVITAPVIRE
                     EIGGGRVQISGMASVQEATDVSLLLRAGALAAPMEIVEERTVGPSMGEENIKRGVHST
                     LWGFLAIAVFMAIYYMAFGTVSVLALAINLLFLLALLSILQATLTLPGLAAIALTLGM
                     AIDANVLINERIREELRNGNTPQASIHAGYDRAFDTILDSNVTTFIVGLMLFSFGSGP
                     IKGFAVVHMLGILTSMFSAVVVSRAIVNLLYGYRRKVTKLAIG"
     CDS             470078..471013
                     /codon_start=1
                     /gene="secF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7DDM5"
                     /locus_tag="ZMTM_04610"
                     /product="protein-export membrane protein SecF"
                     /protein_id="BCM24202.1"
                     /transl_table=11
                     /translation="MEIFKIKKDIPFMSYGRLTTAISLITFILAIFFLAHRGLNLGVD
                     FTGGTIIEVSYPETADLGKIREVVDTLGHKEATVQNFGSSHDVLIRLPLKEGVTKAQL
                     SEQVLAALTEKTPGVEMRRVELVGSQVGQELYENGALALLLVSVGIVAYLALRFEWRF
                     AVAAIVANMHDVVIILGFFAFFQWEFNLTVLAAILAVLGYSVNESVVVFDRVRENFRK
                     MRKASVPDVINNAITATMSRTVITHAMTQTMVCSMLLFGGEVLHNFALALTIGILFGI
                     YSSVLVASPVAMWLGVSRANLMGNTEKKSDVEAMP"
     CDS             471092..472330
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005462557.1"
                     /locus_tag="ZMTM_04620"
                     /product="hemolysin"
                     /protein_id="BCM24203.1"
                     /transl_table=11
                     /translation="MQYGVLAILLMISGLFSIAETSLMSLNRYRLRKLVDEGHRGARL
                     ATKLLNKTDKLLGVILLGNNFANACSVTLVAVISVELYGEDKSALMVGTILITVATLI
                     FSEMLPRVFAARFPERIAFASSYVLTPLLKLLYPIVWLINALVNVIARLFGIKVNFTE
                     NGHALSMDELRHIVLDAGSYIPKKHRAILLNLFDLEKSTVDDVMTAHTNIEVIDFDEP
                     IEEIIKQLSSSQHTRLPVRQGANEEIVGILHIRKVMNHLRDGELDLEILREIISDPYF
                     IPSGTPLYMQMQQFQENKQRIALVVDEYGELKGLVTLEDILEEIIGDFTTQSPSLSGA
                     YHQDEDGSWLVDGISPLRDLNKKLALSLPLDGPRTLNGLVLEHFEDIPEPGTSFKIAG
                     HTLEIVQTQDKVVKSVRIFP"
     CDS             472449..472760
                     /codon_start=1
                     /gene="clpS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HH7"
                     /locus_tag="ZMTM_04630"
                     /product="ATP-dependent Clp protease adapter protein ClpS"
                     /protein_id="BCM24204.1"
                     /transl_table=11
                     /translation="MASIKNQENTVLEKKAVKTKPPAMYKVLLLNDDYTPMEFVVDVI
                     QRFFSKSREQATQIMLKVHTEGAGVCGVYPHGIAETKVNQVLEYAREHQHPLQCAMEE
                     V"
     CDS             472774..475065
                     /codon_start=1
                     /gene="clpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004196461.1"
                     /locus_tag="ZMTM_04640"
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpA"
                     /protein_id="BCM24205.1"
                     /transl_table=11
                     /translation="MIAQELEVSLHMAFMDARQKRHELITVEHLLLAMIDNPTAAEVL
                     RSCGANLDNLRSELNHYIEEHTPTVEGDEEVDTQPTLGFQRVIQRAILHVQSSGKKEV
                     TGANVLVAIYGEKDSHAVFFLHQQSVTRLDVVNFISHGVAKVADGANKRAETEQEAET
                     EAAPAGALENYTLNLNQQVLAGKIDPLIGRDSEIERVIQTLCRRRKNNPLLVGEAGVG
                     KTAIAEGLARRIVEGNVPEVLSKAVIYSLDMGALLAGTKYRGDFEQRLKAVMKKLAES
                     PNSVLFVDEIHTLIGAGAASGGTLDASNLLKPALSNGSLKCIGATTYQEYRGIFEKDH
                     ALSRRFQKVDVSEPSVSETIEILKGLKSRFEQHHGVKYSASALSTAAELSAKYINDRH
                     LPDKAIDVIDEAGAAQRILPKSKQKKVISNKEIEDIIAKIARIPPKNISSDDRNALKT
                     LDRDLKATVFGQDKAIESLSAAIKMARSGLGSQDKPIGSFLFSGPTGVGKTEVAKQLA
                     YTLGIELIRFDMSEYMERHAVSRLIGAPPGYVGFEQGGLMTEAITKHPYCVLLLDEIE
                     KAHPDIFNILLQVMDHGTLTDNNGRKADFRNVTIIMTTNAGAEAISKTGIGFNLPSKV
                     NDDLAEIKRMFSPEFRNRLDATVSFAPLTQEIIMRVVDKFLMQLEDQLHEKKVEVSFS
                     DELKAYLGKNGFDPLMGARPMSRLIQDTIRRALADELLFGRLANGGSVKVDIDDKDQV
                     KLVFDEEPTSKPSKPSKLEVDLA"
     CDS             complement(475127..475732)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262281.1"
                     /locus_tag="ZMTM_04650"
                     /product="glutathione S-transferase"
                     /protein_id="BCM24206.1"
                     /transl_table=11
                     /translation="MSIPILYSYRRCPYAMRARMALRYSDITVEIIEISLRDKPQHLL
                     EVSPKATVPVLALPDGKVIEQSLEIMQWALLQQDKDDWLSNSASELAIDANRLISEND
                     GTFKQALDRYKYAVRFPEHSQEEYRQQCEVFVSKLEALLVQHHYLLGSNCSIADIAIF
                     PFVRQFAGVDEPWFSQAPYPKVRAWLNEWVNSPLFISIMQK"
     CDS             complement(475762..476568)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010929606.1"
                     /locus_tag="ZMTM_04660"
                     /product="membrane protein"
                     /protein_id="BCM24207.1"
                     /transl_table=11
                     /translation="MIEFAPYFITALIYALVAADFWLDASAKPSLKISRWHPHLIAVG
                     LILHACLLYKSLFTGGLNLGLSNALSAIFWLTVLIYWLTDLKHHLNSLQAFVLPPAAF
                     FVLLQYLLPEAHLLPYAKQPLFMTHLVISMLAYSLFTFAALHALLMMAAERSLHQKPT
                     LIKLPDFPPLMVMETLLFRMIGLGFILLTLTLISGMLFSEAMFHQALRFNHKNIFTIV
                     SWLVFGGLLLGRFQYGWRGRKAIRWTLSGFALLFLAYIGSKFVLEILLHR"
     CDS             476667..478055
                     /codon_start=1
                     /gene="ffh"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7W0M3"
                     /locus_tag="ZMTM_04670"
                     /product="signal recognition particle protein"
                     /protein_id="BCM24208.1"
                     /transl_table=11
                     /translation="MVIGLSNAGKYKMFENLSGRLQGVIKNLRGQARLTEDNIADALR
                     EVRMALLEADVALPVVKDFIAQVKERAQGREVLQSLTPGQAVIQVVHEELTKLMGTDN
                     AALNLAAVPPAIILMAGLQGSGKTTTSAKLARLLKAQKKKVLLTSADIYRPAAIEQLR
                     TLAKSLDVDFFESDISQKPETIATNVLDHAKRHFYDVVIFDTAGRLGIDEAMMAEIKA
                     LHTLLNPIETLFVVDAMQGQDAINTARAFGETLPLTGVVLTKLDGDARGGAALSVRHI
                     TGKPIKFIGVSEKVDGLEPFHPERMASRILGMGDVLSLIEHAQKNVDLDEAKKLADKV
                     KSGKNFDLEDYKSQIQQMRNMGGMGALMDKLPAQMAGMAGQMSGEAGDKAVRRMEGII
                     NSMTPLERRKPELIKATRKRRIALGAGVQVQEVNRLLNQFEDVQKMMKMFAKGGMTKM
                     MRAMQGRFPGLK"
     tRNA            478175..478250
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="ZMTM_t00140"
                     /product="tRNA-Lys"
     CDS             478386..478607
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04680"
                     /product="hypothetical protein"
                     /protein_id="BCM24209.1"
                     /transl_table=11
                     /translation="MEIYNDIGSDSGVVSFQTAADSISIKFKKSDQVYKYTYASAGAK
                     NIEAMKLRAISGDGLNSYILRNVQNKFVK"
     CDS             complement(478728..480038)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04690"
                     /product="hypothetical protein"
                     /protein_id="BCM24210.1"
                     /transl_table=11
                     /translation="MSNLPPVLELLNSVNFIDKDIKGILKSAKKLIPDITQQAEWTLS
                     NHTYVDNQPNDLTKFNVSPVSGMNPFGDFGKCSGFDCRISMALNFSRTIGLYSEVIYL
                     PDPFTTKFIDDGNKDLSWTDDQVLELIKEATVLQVLRPLIEAGIIQFTSPVRSYCAGC
                     LEKLYDNVDNFTDEAIQEFWHGVSHHKSNDHLVLDTNNLHVPSLMLSKFIDPALKNRK
                     TMKTMARQMFGEIIWEEIHELLFTMNTTESMNSTIFSNSRIGLKTLKKLEGNDRNVYN
                     HLNWENSRDTNLPWIKDLTPQQVVELRNSADKALPQFRELMLKSLTQENLSMSDNESK
                     SSELLTEMRTQAEEVRAELSSIDINSEKNFHNMGGILGMTISIYSAATGNPALGLTTL
                     MATLGLIHTNLKKDHSEVNKAISKPGYVLVKAKDILQHANKSSK"
     CDS             complement(480084..480455)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04700"
                     /product="hypothetical protein"
                     /protein_id="BCM24211.1"
                     /transl_table=11
                     /translation="MPKSVRYALIAIFAELSVGLVLTIIDWSTGKIPSRQFAIELIIY
                     IVLAILPYKLYRRSNPSRYTWLALSSLSLLSFFWSPPTTKRYVDIASWVTIFLPALEI
                     YWLLTRESNIWFGKKEIIYEA"
     CDS             complement(480530..483151)
                     /codon_start=1
                     /gene="pepN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267176.1"
                     /locus_tag="ZMTM_04710"
                     /product="aminopeptidase N"
                     /protein_id="BCM24212.1"
                     /transl_table=11
                     /translation="MSPDTEVGSNIIKPKTIYLKDYAPAPYKASHINLVFELFEDKTI
                     VRSEVLYIKNPDGNSSTLILNGQDQTILSVEIDGVAFTGYMLADNQITINEAGEKFTL
                     TITSEIHPETNTALEGLYKSQGTYCTQCEAEGFRRITYFQDRPDVLSIFSVRIEADKS
                     KYPVLLSNGNLVESGELANGRHFTAWNDPFPKPCYLFALVAGDLVRIEDTFKTMSGRN
                     VDLHIYVRSGDEGQCDHAMQSLKKSMQWDEEKYGREYELDLFNIVAVSDFNMGAMENT
                     SLNIFNTKLVLAHQETATDTDFMSVEGVIAHEYFHNWTGNRVTCRDWFQLSLKEGLTV
                     FRDHEFSADMNSRSVQRIDDVDHLRRFQFSEDASPLAHAVQPDNFIEISNFYTMTVYE
                     KGSELIRMQQTLLGEDTYRKATDLYFDRYDGHAVTCDDFVQCMADASGRDMSQFFLWY
                     KQAGTPSLIASSQYDEEQKQFTLTLKQSQADTPGQTNKKPLLIPVAVGLLNEQGIETH
                     PTQVLEMTEREQSFTFDNVKTRPVPSILRGFSAPVKLTTDLSDDNLRLLQLSDTDGFN
                     KWEAGQTIALRTIERVMADSEVDISQFIDDIGIMIQQGLNNKGDKALLARALSLPAIA
                     VIAQTQDVIDPAAIDSARTHILKAIKRTHKDALLRLYKDNLSMGEFSISPEAMGRRSL
                     KNTVLELLTVTNGSGCAALAKAHYDHADNMTDRVAALACLSDSTQPEREEVFTDFYHR
                     FKDYQLVVDKWFSLQAIANRDEIFDDFAKLRNHAEFNIKNPNRVRSLYSAFAINNPVK
                     FHDPSGQGYAILRDAIIELNAINPQIAARQVTPFREWKRYTPELQAKMKDALQAIMDS
                     GNLSSDVFEVVSKSLNG"
     CDS             483421..484092
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04720"
                     /product="hypothetical protein"
                     /protein_id="BCM24213.1"
                     /transl_table=11
                     /translation="MNFVNIFKKTALVASLTMLVSFSASANTLLWNTGVTDSGKGAEG
                     SVDQHYTLGGGAASYVGIGVNGAWLADSASNASAWITPTANANDGSLDPFTNGTYTFS
                     QTFDLSGYDASKTSFSAMWAADNNASVYLNGSLLSSITGGTYSNFNSFSSFSANSGFV
                     SGLNTLSFVVTNLAQNGGNPSGLRVEFSNVNVAAVPEPKTNAMLLSGLALMGLVVRRR
                     KALES"
     CDS             484413..484937
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_009562223.1"
                     /locus_tag="ZMTM_04730"
                     /product="peroxiredoxin"
                     /protein_id="BCM24214.1"
                     /transl_table=11
                     /translation="MVTTVPNIVFKTRVRDESVGGENPFRWQDVTTADIFKGKKIVIV
                     ALPGAFTPTCSSTHLPGFDAKYQEFIAQGIDEIYCLSVNDAFTMFQWGKNLGVKHVKM
                     LPDGNGDFTRMMGMLVKKENLGFGDRSWRYSMLVDDQKIVKIFEEPGKADNFGADPFE
                     VSDADTILNFIKQK"
     CDS             485036..486388
                     /codon_start=1
                     /gene="gor"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003812173.1"
                     /locus_tag="ZMTM_04740"
                     /product="glutathione-disulfide reductase"
                     /protein_id="BCM24215.1"
                     /transl_table=11
                     /translation="MTTYDYDLFVIGAGSGGVRAARMAAGLGVRVAIAEDRYFGGTCV
                     NVGCVPKKLYVYASQFSESFTGSVGFGWKGQTPDFDWPTLVANKSKEIDRLQGVYDRL
                     LQESGVSIFNGRAELQDAHTVVVNGKSYTAERILVATGGWPYVPEVIGKEFIVTSNEI
                     FNLPALPKRLLIVGGGYIAVEFAGIMHGLGVEVSILERGNKVLKGFDEDIRDFLIEQM
                     TNKGIKFYFNTSVDRIKQHEGAYAVHTMDGNLIDADLVMYATGRVPNTKDIGLEALGV
                     ELDGVGAIKVNDDYQTNVASIYALGDVTNRVNLTPVATAEGMALVNKLYANKTGKVDY
                     DNIPTAVFSQPNIATVGLTEAQAREKYPDIDIYKSVFKPMKNTLSGINERTLMKMIVV
                     RSSDKVVGMHMVGPDAGEIIQGMAVAIRAGATKAIFDSTIGIHPTAAEEFVTMRKPVA
                     "
     CDS             complement(486709..487632)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003807733.1"
                     /locus_tag="ZMTM_04750"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BCM24216.1"
                     /transl_table=11
                     /translation="MDRFDTMLAFTRVVELASFTKAAHSLNLPKTTVSAQVVALEKRL
                     AVKLLNRTTRHVSVTTDGAAYYERAIRLLNELDDTEASVRQFTTKPKGRLRIDLPASL
                     GRQVVMPAIKEFFDRYPEIELEIGCSDRPVDLLQEGVDCVIRGGELLDQSMVARRIGS
                     IRIVSCATPDYLRKAGIPQTPEDIERHSTINYMSSKTGKIYEFDYSKDGITSLVTGQR
                     SIAINDTDASLAAGLAGVGIMQTASFLVQDLIATGKLEIVLGEYLSEDVPIFVMYPQN
                     RHLSSKVRAFVDWVAELFANSDLLQSRTTLR"
     CDS             487808..488563
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011090604.1"
                     /locus_tag="ZMTM_04760"
                     /product="oxidoreductase"
                     /protein_id="BCM24217.1"
                     /transl_table=11
                     /translation="MAKKLEGKVAVVTGASKGIGASIAKHYAAEGASVVVNYSSSKEG
                     AEKVVVEIVAAGGKAVAVHANVAKQADIERLFAETLKAYGKLDILVNNAGIYEFSPLE
                     SITEEHFHKQFNLNVLGLILTTQEGVKHFGAEGGSIINLSSIVSSTFAPANAAVYSAT
                     KGAVDALTHSLSKELGPRNIRVNAINPGMVETEGVHTAGMAESDMRKFIEAQTPLGRI
                     GQPQDIAPAAVFLASADSSWISGETLFIAGGLR"
     CDS             488600..489235
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011144329.1"
                     /locus_tag="ZMTM_04770"
                     /product="glutathione S-transferase"
                     /protein_id="BCM24218.1"
                     /transl_table=11
                     /translation="MINLYTWATPNGRKVAIMLEELGVPYAVHPVNLRKNEQFSAEFL
                     AISPNNKIPAIVDDEAEGGPLTIFESGAILTYLAEKSGQFLAVSGHERYKALEWLHWQ
                     IGGLGPMFGQLSYFAIRAEQKCPEAIERFKQESERLLGVLERRLTATPYLAGEHYSIA
                     DMAAYPWTVSATSFMKDVLGEYLSTTPAIHDWLKRIAARPGVQRGMAVPNI"
     CDS             489254..490048
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04780"
                     /product="hypothetical protein"
                     /protein_id="BCM24219.1"
                     /transl_table=11
                     /translation="MSTLNTNHHFQEASFHSEASAGDIALRVYDKRATSSATPLVLYF
                     HGGLFNCGKMDDADAIASVLAENTVVVCVDYPLAPKLHFPTTVEVAFEALLWAGKHAT
                     KYGAQASKLIVAGDQAGGNLAAAVAMMARDRGLAGKAKLIAQVLINPMLDPNQSTLSM
                     QLAEDCPCRKAWADYLPVSSDAMHPYAAPLLSRRLQSLASALIITADQDPLRDEAEQY
                     AAKLITSGVPVQMRRLRAAKTSLANPACVSFQEAAGIVSQFITDFS"
     CDS             490102..491346
                     /codon_start=1
                     /gene="mdtA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207233.1"
                     /locus_tag="ZMTM_04790"
                     /product="MexE family multidrug efflux RND transporter
                     periplasmic adaptor subunit"
                     /protein_id="BCM24220.1"
                     /transl_table=11
                     /translation="MKTASQIFSRKFILIALGIGLIGGGVISHNSQVKAAAVAAMPPA
                     AVTVESVIEKPVIEWDDFSGRVEAVEYVEIRPRVSGTIDVIHFSEGQLVKKGDLLFTI
                     DPRPFQAEVARADAQKSAAAAAVELAKTELERTRHLLEDHAVAQRELDERNNTYLNAN
                     AQLKAAEAALMTAQLNLQYTAITAPVSGRVSRAEITVGNLVGVGTNTPALTTLVSVSP
                     VYVNFELDEQTYGRYLANGAAGNTNVDHIPVSIGLTSEEGYPHQGYIKSFDNRMDTAS
                     GTIRVRAVFDNKDNSLTPGMYAKVRTGGGGMKPALLIDDKAVGTDQDKKFVMVVGADN
                     KATYRVIVLGPMVDGMRIVRSGLEKGEQIIVDGLQRVRPNDVVAPSVVANPAEATSAT
                     ERTEKTASNIQQNLKYHKKTVI"
     CDS             491382..494588
                     /codon_start=1
                     /gene="mexF1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010968567.1"
                     /locus_tag="ZMTM_04800"
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="BCM24221.1"
                     /transl_table=11
                     /translation="MNISKFFVDRPIFAGVLSVIIFIGGLISMFNLPISEYPEVVPPS
                     VIVKAQFPGANPQTIAETVATPIEEQINGVEGMLYMASQATSDGLMTLTITFKLGTPP
                     DLAQQLVQNRVNQALPRLPEEVQRLGVTTVKSSPDLTMVVHLLSPNGRYDMTYLRNYA
                     LLNVKDRLARIEGVGQVELFGAGDYSMRIWLDPRKVAERKLTANDVVTAIRQQNVDVA
                     AGVIGSSPSVPGTDYQISVNARGRLVSVEEFENVVIRTSSDGVVTRLKDVARVELGAS
                     EYALRSLLDNKSAVAIPIFQAPGSNALQISDNVRKTMAELQKDMPEGLEYHIVYDPTQ
                     FVKSSIHAVIHTLLIAVLLVVLVVIVFLQTWRASIIPLLAVPVSVIGTFAVMMGLGFS
                     INTLSLFGLVLAIGIVVDDAIVVVENVERNIENGLTPKEATYKAMREVSGPIVAIALT
                     LSAVFVPLAFVSGLTGEFFKQFALTIAISTVISAFNSLTLSPALASILLKSHGAKKDI
                     FQRTIDRLFGWFFKRFNQVFRRGSNSYGAGVTGVLKRKSLMLVIYAVLIAAIVALIHI
                     VPSGFIPGQDKQYLVSFAQLPDAASLDRTEGVIREMSDIALKHPGVESAVAFPGLSIN
                     GFTNSPNSGIVFVTLKPFEERTGKDQTGFAIAQQLNQKYGSIKGAFIAVFPPPPVQGL
                     GTIGGFKFQIQDRAALGNVALNDALQAFMAKARAAPELAGMFSSYQINVPQLYADVDR
                     THAQQLGVSIPDVFDTLQIYLGSLYVNDFNKFGRTYQVRVQADAQFRAHAEDIGLLKT
                     RNNKGDMVPLSSMLKMTQSYGPDRAMRYNGFPAADVNGGAAPGYSTGEAQAAVERIAA
                     ETLPRGIGYEWTELTYQEKIAGNTLFIILPLSVLLVFLVLAAQYESLTLPLAVLLIVP
                     MGLMSALAGVWLTGGDNNIFTQVSLVVLIGLACKNAILIVEFARELEFEGRKIYEAAI
                     EAARMRLRPILMTSIAFIAGVVPLVLSTGAGSEMRHAMGIAVFAGMIGVTIFGLFLTP
                     VFYVLIRTMASKFGNSVLKDHAHPGTAAHAAPEIKEGI"
     CDS             494591..495994
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010925807.1"
                     /locus_tag="ZMTM_04810"
                     /product="RND transporter"
                     /protein_id="BCM24222.1"
                     /transl_table=11
                     /translation="MKTLNLSLTTLAAAMLLVGCSTTKPPERVDLQLPSQYREAASLD
                     GAWQVAKPSDDADRGQWWKVFNEPELSNLIDAATDNSPNLAIALARVKEARANAGVVD
                     AARKFQLNGGFGPTRQRDNNTELNTQWRAQVNASYEVDLIGRLSDQSRAARLDAQAQE
                     AAYRSVLLALQADVAQQYFTIRSLDSEQEILQKTIALRKDELRLVQHRYDVGDTSELD
                     LAKARTELSVVQAEEEGVKRSRAQQDHALAILLGKAPAEFTLAPAPLRATTVIVPAGL
                     PSDLLERRPDIAQAQRQLAAASARVGAAKAAFFPKLVLTGTAGYQSNQLEDLFKWSSR
                     SWLLGPLVGTALTLPIFDGGLNKSNLARADAGYELQVANYRQQVLVGFQEVENNLSAL
                     RTLDSQIGFLNAGIDSSKVAEHLADVRYKNGSASYFEVIDAQRTRLSAERSQIQSAGE
                     RSVASVGLIRALGGGWQ"
     CDS             496218..496460
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04820"
                     /product="hypothetical protein"
                     /protein_id="BCM24223.1"
                     /transl_table=11
                     /translation="MRLLQTIALTSSLLFLLAGCSGHYHPLALDKKVKLVAELIDHAP
                     ECQAFKDRLADPSIDDDGVDAVFAEATKAHCIQKHV"
     CDS             496651..497316
                     /codon_start=1
                     /gene="cheD1_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EF62"
                     /locus_tag="ZMTM_04830"
                     /product="putative chemoreceptor glutamine deamidase CheD
                     1"
                     /protein_id="BCM24224.1"
                     /transl_table=11
                     /translation="MTAHANKDITRPNVYFDSRFGLDAAKILPGQYYATQRNMLLVTV
                     TGACITACIRDKVSGIGGMNNYMLPDEDTVNFKSEVYGIKAMDTLINDLIQMGAAPEN
                     LEAKVFGASNMLNDAQSIAAAARNTQFVFDYLKTRNIQVVATDVQDVYPRKIYFFVNT
                     GKVMVKKLRNMHNETIINRESEYTQRFALAQFNRAEHLLAHTPSQHEVFDIQFDTIDA
                     EVM"
     CDS             497429..499699
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707409.1"
                     /locus_tag="ZMTM_04840"
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="BCM24225.1"
                     /transl_table=11
                     /translation="MKFPDIPSNEVERLAALKRMDILDSASEVGFDLLTEMAAELLQL
                     PIALVTIVDSKRNWFKSRVGIEGSEAPRDVSFCAHAILQTSPMIIEDALLDERFSDNP
                     SVTAAPHVRFYAGFPLASVEGHNVGTFCVVDNHPRTLSASELRQMVRLAQLAQVALQT
                     RELASKNLALNTSILETFSLFENTFNLAAVGLIHTAPTGQLLRVNPKACEILGYDSDT
                     LTHINFQDITHPDDLDKDLELFERTLNGEIPGYHMEKRYLHAAGHYLWASLSVRLNRD
                     ASGEPLYFVASIEDISHVKRLEARIIEERDALQDEVKIQIKGLQEANRQLVQDAKLLT
                     AAKELIDLSEQRIKLIIDNVPARIGFWDKKLINQFANKVYEDWFNLPAPDIYGKHLRD
                     FMDEDTYKQRQPYIKAVLKGKPQHFDDATPGRDGNLLYSEISYIPALEKGEVTGFFLF
                     GQDVTARKRAEEAMRQSEQHYRQLFQNMLGGYAYCQMLFEDGKPVDFVYININDKFEP
                     LTGLKDVVGRKVSELVPGIRESSPEIFETYGRVIKTKVAERFDVYIDAMDMWFSVSVH
                     STEGDYFVTVFENITERKILDEKLRHQANVDYLTNIANRRAFIRQGEVEVARALRYGN
                     PLSVAMLDIDYFKKVNDTYGHKTGDLVLQELSRICVETLRETDMVARMGGEEFAILFP
                     ETDAQHAFEVAERLRDKIEKNELSLESGMPLTFTISIGVITLTKKNVNIDMLLHLADK
                     ALYEAKNTGRNKVCTL"
     CDS             complement(499739..500266)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04850"
                     /product="hypothetical protein"
                     /protein_id="BCM24226.1"
                     /transl_table=11
                     /translation="MKRSDYASLSKYPEKLQVLFLQYWKLILPVLLIIIGLLVTFTEA
                     GHWLISKGDYSNALFTLLVIDSVILVGVLAKLLLNYLGDDTPKWMSYLTDEFHGARWT
                     WKYQEAFDQITDLQPHCVNCKHDLKVVDGEYPEKMVTCPSCKSMVSRFFGSYENYLQT
                     IRDLIKQKIRKNYLE"
     CDS             500669..503044
                     /codon_start=1
                     /gene="ppsA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9K0I2"
                     /locus_tag="ZMTM_04860"
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="BCM24227.1"
                     /transl_table=11
                     /translation="MNEEDMSDYVIAFEKLRIDDVPAVGGKNASLGEMISQLTAKGVR
                     VPTGFATTAHAYREFLAQDGLDDRINAELDRLDVEDVTALAVCGNKIREWIMTANFPK
                     ALLDGIAEHYQTLTTQMGDSVSFAVRSSATAEDLPDASFAGQQESFLNIRGLDNILHA
                     IKEVFASLYNDRAISYRVHKGFIHADVALSAGVQRMVRSDIGSSGVMFTMDTESGFDE
                     VVFITSAYGLGETVVQGAVNPDEFYVHKPLLAEGFPAIIRRSLGSKMIKMVFTDANQA
                     GKSTITVPVDTVQSTQFSLTNEEILELARYAMIIEKHYERPMDIEWGKDGVDGKLYIL
                     QARPETVKSQAGNSVEKFQLIGTGTPLVTGRAVTQKIGVGPVRIVKDASEMHTVQPGD
                     VLVADMTDPNWEPVMKRASALVTNRGGRTCHAAIIARELGIPAIVGCVNATELLKEGD
                     IVTVSCAEGETGHVYAGALDYKQTTETATALKMAPVKIMMNVGNPDMAFSFAQIPNHG
                     VGLARLEFVINNMIGIHPKAILNFDKVPADMQAEITRRANGYASPRQFYIDKLAEGVA
                     TIAASFWGKPVIVRLSDFKSNEYKKLVGGDIYEPDEENPMLGFRGAARYIAKDFRDCF
                     ELECLAMRKVREELGLTNVELMIPFVRTLEEARQVEEILAEYGLKRGVNGLRLIMMCE
                     IPSNALLAEEFLKYFDGFSIGSNDLTQLTLGMDRDSGLMAHGFDERDAAVKVLLKMAI
                     DTCNRLNKYVGICGQGPSDHPDFAEWLVEKGIQSVSLNPDTVVSTWQRLTK"
     CDS             503172..503984
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62JE0"
                     /locus_tag="ZMTM_04870"
                     /product="putative phosphoenolpyruvate synthase
                     regulatory protein"
                     /protein_id="BCM24228.1"
                     /transl_table=11
                     /translation="MQQRTVFFVSDSTGITAESLGHLLAHFPEVKFRQFRYPFIDSIQ
                     KIEGVLQRIAQAREEDGVRPVIMMTLVDPDYRALVKQADALCLDMFGAIIDPLSAELN
                     MQPSLGVGISHGVLGHSYHERMDAINFSLGHDDGQTNHGLDEAQVILIGVSRCGKTPT
                     SLYLAMQFGIKAANYPLIPEDFERMTLPSILDKYPEKLYGLTIQPERLHSVRSERRPD
                     SFYASLANCKEEVRLAESLMERAHVPWIDSTSRSIEELSTTILQKIKVKQYA"
     CDS             complement(504028..504408)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04880"
                     /product="hypothetical protein"
                     /protein_id="BCM24229.1"
                     /transl_table=11
                     /translation="MPIKASRYRAVAIQQLALICLVVMLLGIFIGGEASGAGSLFPSP
                     WDKLVHFIAYGSIGIFLGMILKSKPLALILILVVLIGAADEFHQIYIPGRHAGLDDLS
                     ADLIGGLAALPIISKLRSALYPMV"
     CDS             complement(504398..505774)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005478391.1"
                     /locus_tag="ZMTM_04890"
                     /product="undecaprenyl-phosphate glucose
                     phosphotransferase"
                     /protein_id="BCM24230.1"
                     /transl_table=11
                     /translation="MGISIARDNILFIIEAFLQPVTIVLALWGLYYHFYGELTPLCLT
                     LSLILFLLNFPAHSNIHDPDLESISNVLISWFSIAGFILVFGWFTEYIGLFSVKAIVC
                     WLLVTPVFQLFAILLLRLAAPIIIKLQGPAKRSVIVGINEQGLALAASIAKDQYSTTK
                     LIGFFEDRELDRVPKLPSNTSHLGAISSVASYVKENRIDSIYLCLPVADQSRMVKLLN
                     KLKDTTVSVYFVPDIFQTELIQGSIGEMNGIPLVALIETPFTGFNGMIKRVADILFSL
                     VTLILISPVLACIAIAIKSTSPGPVIFKQRRYGLYGDEITVYKFRSMTVCEDGTEVKQ
                     ATKTDSRITPLGAFLRKTSLDELPQFINVLQGRMSIVGPRPHAVVHNEMYRKMITGYM
                     IRHKVKPGITGWAQVNGLRGETETLDKMKERIDYDIDYLRNWSPKLDMYIVVKTILVV
                     LKKESGAY"
     CDS             complement(506309..506776)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04900"
                     /product="hypothetical protein"
                     /protein_id="BCM24231.1"
                     /transl_table=11
                     /translation="MKIKMFLLAFVLSICSMASFADTTDPVIVKGSFTDLSLGTISIS
                     SLSDITGSILYGTGSATLFNKVYSLVPATFSGGSFGSSTFSGDTFSFKNVVAGDYELL
                     ISGITSKVGNKFGTALIGAEYTVSAVPEPKTSGMFLAGLGIIGFIASRRKSLI"
     CDS             complement(506894..508306)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005478391.1"
                     /locus_tag="ZMTM_04910"
                     /product="undecaprenyl-phosphate glucose
                     phosphotransferase"
                     /protein_id="BCM24232.1"
                     /transl_table=11
                     /translation="MKELIGNTIGRKVTGITFARDNILYLIEAFLDPLLIIVSLLAVC
                     YFNEGDIDSIYIIVCVILFSVTFPSSPKLGFSTLKIITNVIVSWLVLISLLLTFVITT
                     DFISAFNEKTLYLWVMITPIVLILSTLGLRFLSDLIIKIQGPTKIAVIAGMNSQGLAI
                     ADRLINSNYHSMNLLGFFEDRQIERLEGQKEYPILGKLSELTNFVQENDVNTIYLSLP
                     MARQPRIVALLDDLKDTTASIYFVPDIFITDLIQGRMNAVDGIPVVAVRESPFTGYDG
                     IIKRAADFLFAMFALVFISPLLILIAIAVKLSTPGPIIFKQRRYGLDGKEILVYKFRS
                     MSVCEDGHDLTQAKLGDQRITKLGAFLRRTSLDELPQFINVLQGRMSVVGPRPHAISH
                     NEMYRKLIKGYMIRHKVKPGITGWAQVNGFRGETDTLEKMQARIDYDIDYLRNYSPKL
                     DMYIVIKTISVIFKGQNSAY"
     CDS             complement(508303..509091)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04920"
                     /product="hypothetical protein"
                     /protein_id="BCM24233.1"
                     /transl_table=11
                     /translation="MSLNSNLDKNDLAHFVELIHESLRVKTHFEFFMWFQGNLQRFIP
                     HDIMIAAWGDFSLGLIYFDVVSAIPGVRTTKIPNSNLTPLLKRLFSYWLQHGKGPFTL
                     NIQEGIFKEDNIELSDVSKSFDKMKSALVHAIKDYRGHHDCLYVFLSESTSTQKSSRK
                     MLESVLPYIDFSLRQLEHLPAQLKEPAPIEEEMPEEFTGSLSEREIEIMKWVRSGKTN
                     QEIAMILDISFFTVKNHLQRIFKKLDVLNRAQAVTNFKEMYPNK"
     CDS             509498..510004
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04930"
                     /product="hypothetical protein"
                     /protein_id="BCM24234.1"
                     /transl_table=11
                     /translation="MYENITNLGKAEAFVDEILEIIDHIKLLDHFSVDEIKILCHYMQ
                     CFAAPRDYTLIQEGDKGDFLILVLSGAVDVQKDIPKIGIKKIAEVGAGVTLGEMSLID
                     SQTRFASCVTSAPTDFAVFTRESLNEVLIEMPRLGNKFLLVLLQLMAQRLRDTCDRFL
                     PSVFGVPI"
     CDS             510027..511253
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04940"
                     /product="hypothetical protein"
                     /protein_id="BCM24235.1"
                     /transl_table=11
                     /translation="MVNTKKKLFQTIRFGFAVVLTFLNASVACADDEDVFNLVVGTNY
                     YYDSNLFKLPSGTTPILSTGKSNRSDILTSTDALLSIDKHYSLQEFSLTYQLTSNKYQ
                     TFNFLDFVSNEYKLNWLWAISPDLTGTLYTEKKETLASFVDFRALGKQNIITVETKNF
                     DFDYSPYMNWHLIGGYSKVTSQNSQVFIQQTSFESDRFNAGLKYVFNSLSSLSFIARD
                     STGTYLNQPLDAVNLLDTGFNDKSEELRGIWLISGKSKLDLKIGYLERQSNNFSQRSF
                     SGNTGTLVYQWDALPKTSLIFKLSRRLDGYTDSTSSYAVLDSFDFEPTWTISPKLMVK
                     GNAEISRRSFLGDGPQIASSRREDQSSSYGVSATWTPRDSIKTIIQIGHENRNSTNNS
                     FDYVSDSASISAQLDF"
     CDS             511459..512250
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04950"
                     /product="hypothetical protein"
                     /protein_id="BCM24236.1"
                     /transl_table=11
                     /translation="MAARVNGAEISIHQVNQFLKNSPGITADNLSAARKQILDKLIDE
                     QLAVEQAGKDNIDRTPDVQMQIEAAKRQIIASAYIKKVTLESVKISDEDTKTYYQEHP
                     ALFSDRKIYTLQDIGVQRSDDINSILTDDFIKQKSKQDLEDWLKSHHANFSIESYVRP
                     AEQVPLDMLTKLAKLNAGDVTILDLNDIKHVIFVINTKQAPVAYSDSAALIKTFLFNT
                     KAKPAAIDNLKKLREQSNIQYFGEFDPKSASDSKLDISKGVAGLK"
     CDS             512294..513094
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04960"
                     /product="hypothetical protein"
                     /protein_id="BCM24237.1"
                     /transl_table=11
                     /translation="MPVFRFKFLLMIYFLIHACISFAEDKNDFVLGAGDSIHITVFQN
                     PDLTLDTRMPESGNITYPLIGLVNIGGLTIADAERKIARALKDGGFFQQPQVNIVLVT
                     PGNQISILGQVSRPGRYALDTPKMRISDALALAGGASPTGSDTAVVIGTRENKPFRKV
                     IDIASIFLDDKQDDNIQVIAGDEIYVHRPPVFYIYGEVQRPGSYRVERSMTVIQALAE
                     GGGPTTRGTQRSIKLYRRNSAGEVVESTPSITQPIQADDVLYVRESLF"
     CDS             513119..514528
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04970"
                     /product="hypothetical protein"
                     /protein_id="BCM24238.1"
                     /transl_table=11
                     /translation="MNFSQFLIILKVRIKIFIIAIFVTVLTATVVSFLLPKTYTATAT
                     LVLNYKGTDPVTGVVVPGQLMPGYLATQVDIVQSENVALKVVDMLKLAESEDAKQNFY
                     NATAGRGDIHDWLAALLLKKLAVTPSKESSVLEITFKGQEPNFVAAVANAFAEAYQQT
                     SIQLRVEPAQKGAIYFGQQTKIFRDRLEEAQAKVSKFQQENAITNADGQLDVETNRLN
                     ELTTQLVSVQSQAIESNSRQQNTLGSAENSPDVALNPVIQSLKVDASRSEAKLADIAQ
                     RVGKNHPDYQSGLAELNKINAQIQNETRRTALSVGGTASINRQREAELRTEVASQKLK
                     VLQLNHLRDQLALLKQDVDTAGRDLGVVTQRFSETNIDAQSNQSDIAILNLAKPPISP
                     AGPKILLNILLSIFVGGMVGVGCSLMAEILDRRIRSSEDIMNILDTKVLAVISPKYGN
                     KKSKPVIGVAGTFNRLLKD"
     CDS             514530..515411
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04980"
                     /product="hypothetical protein"
                     /protein_id="BCM24239.1"
                     /transl_table=11
                     /translation="MQNSPINPGSQPISHDAKLEPSIGKLLLDLGKLNPDQAEKVLRL
                     QKLESIRFGDAAIKLGFITDADVQQALSVQFDYPYLQPNQGNFRKDLVSAYEPFSAQV
                     EALRALRSQLILRWFNEGNKALALVAANSGEGCSYLASNLAIVFSQLGEQTLLVDANL
                     RNPVQHKNFNLTETRGLSDILIGRAGVEIITKVDSFMDLSILGAGTVPPNPQELLSKL
                     SFVELMNDLTHQYDVVIIDTAPASQTFDAQSVAGLCGGALVISRLNETSHKDIQNLKE
                     QLNGVGAQIVGAVINDF"
     CDS             516394..517107
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_04990"
                     /product="hypothetical protein"
                     /protein_id="BCM24240.1"
                     /transl_table=11
                     /translation="METIFNGFPRISLIRSCIILGLFILAFTTALLLTPKLQSNDSAP
                     EFDQTIPSEFGGWKAIPDPFIQVSLTTDKNYSVNLLYDQVLMRTYVNQEGGRIMLAIA
                     YAREQRQDVKIHRPEVCYVAQGFQLISHNDKVLNLPSSKKPVMAHQLLMQNDSRYEAI
                     SYWIRIGDEYPSNGIQARLKIFKDGLHGKVLDGVLVRVSTSLNDQSSLTEAYQKQEKF
                     ILDLTSALNKPTEALLVAH"
     CDS             518040..518570
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05000"
                     /product="hypothetical protein"
                     /protein_id="BCM24241.1"
                     /transl_table=11
                     /translation="MTGLFIMRYEFIDFSLGSRWTLVATLLGILAPVGFMQAIGGATG
                     PVFMAQGKTSLLLKFGIFSTVIYVLAFILGSSWGVVGVAIGYLIACVFVTIPTIYLAQ
                     KSLGLAYLATYKSIFPSVLWALLAAAFVSLIKEYFLLSKVMFIDLTLQTLIGGSVYLI
                     AMFYLAKPYFINIMKR"
     CDS             518577..519887
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05010"
                     /product="hypothetical protein"
                     /protein_id="BCM24242.1"
                     /transl_table=11
                     /translation="MRTNVLYFVITEVFSPFFLNISRALEQNYAYKPYLVSFLPTDHA
                     FLKKNSQHIYPKSLDEIENQVIDDHIYSDTEILEMCSFIKNKFGGDLKDWRIRLLKIT
                     AYVIRLIEEKEINLIVMWNGQDFVARTISEIARKRNIKCIYMENGYFPGTLQADTEGV
                     NSAASVAKLDFDEIKEIQNTAASAVSNDLKVELIRSTPLTKSELVPNSLRRILNPNFY
                     KTYPELRGSSLLWGKFLNERRKRIPFDQIELPQQFAFIPLQVHDDTQILLNSPLFDNP
                     KDFIIHCYTAIREALGSDYPIVVKEHPEDIFRYSYDDIRQKFPDIIWIKNFPIDDIVS
                     KSTFIMVVNSSVGLQAIKLLKPTIVFGESIYSKPEICYYISDKSETKEKILKAVSRMD
                     DEMESNIKLYINFIENKFFFRGSWKLLSHDNLVSCINKIHNLSL"
     CDS             519937..520776
                     /codon_start=1
                     /gene="kdsA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KMZ4"
                     /locus_tag="ZMTM_05020"
                     /product="2-dehydro-3-deoxyphosphooctonate aldolase"
                     /protein_id="BCM24243.1"
                     /transl_table=11
                     /translation="MNIYKGIDLDNQKSFVLFGGINVLEDLDSTLRACEEYVKVTTKL
                     KIPFVFKASFDKANRSSIHSHRGPGLEEGLRLFEKVKAAFGVPLITDVHEPWQAAPVA
                     EVIDILQLPAFLARQTDLVVALAKTGKPVNVKKPQFLSPHQMLNIVDKFKEAGNDRAI
                     LCERGSSFGYDNLVVDMLGFGVMKKVCKGVPIIFDVTHALQQREALGAASGGRREQVV
                     DLARAGMAVGLAGLFLESHPNPKEAKCDGPSALPLDQLEPFLTQIKAIDDLVKSFSPL
                     EIA"
     CDS             520787..522070
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05030"
                     /product="hypothetical protein"
                     /protein_id="BCM24244.1"
                     /transl_table=11
                     /translation="MARVVIVIPARYASTRLPGKPLLDIVGKPMIQHVVERALEVKGV
                     DAVVVATDDQRVADVVKAFGGKALMTSPDHQSGTDRLVEVMHQFPADIYLNLQGDEPL
                     VRPEDLSALVEAMKDKSTQVSTLCHKIDIHEATNPNCVKVILDSKQQAIYFSRSPIPY
                     PRESSAAKYFKHIGVYAYAREVLEKYSELPRPMIEISESLEQLRLLNADIAIKVIEVE
                     PTGPGVDTPADLELVRAILGGINIPPALTETELLANIKLVITDVDGVLTDGGIYYDAT
                     GECLKRFHVRDGLGIKMLEECGVRVAILSGRDSPTLRKRVSDLGVTLSSFGVKDKAAA
                     CKAIMAEVNVSPEQTACIGDDSIDLPAFEVCGLAYAVADAADYVKQQAYKTLSLPGGS
                     GAFRELSDAILKAQGNAAVLDSAKGFSSVMDRMVQ"
     CDS             523242..524261
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05040"
                     /product="hypothetical protein"
                     /protein_id="BCM24245.1"
                     /transl_table=11
                     /translation="MRNIFLRIFLVISLASPIIDALADDNFLIGDTHVAYWKDNKSAA
                     FLLMFDDSWPSHWQVVAPELLKRGMIATFYINPGKGEYQKFSDEWENKLWRQGMVYGD
                     HTMTHTGVKDMQNAEWEIGECARIIRQISPGKENRLVSYGQPGGTGNWHISQDQLDAL
                     LQEHHLINRPTFDKHGAVYFFKTTEDMLALADKAIAQKGMEYLIIHGVERIGPNVTYQ
                     DMWALKQDIFLPLLDGLKARSDKGNLWITDHISEHQYQTERDNAEVRKLSVDQNLIRL
                     ELAAHVDANLYDYPLTLMTNVPASWSTALVTQGDILKVSPVKNGIIQFDAIPNAGLIN
                     IREAQ"
     CDS             complement(524314..525264)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P45313"
                     /locus_tag="ZMTM_05050"
                     /product="putative arabinose 5-phosphate isomerase"
                     /protein_id="BCM24246.1"
                     /transl_table=11
                     /translation="MPDRGEILTIAKQVITSEISSLLSMSERLDNEFLKAIAIVQNNE
                     GRVVMIGMGKSGIIGRKIAATLASTGTPAFFVHPGEAFHGDLGMIEPKDVALLISNSG
                     ETEEIIRIIPFLHWQKNKIIAMTGNLNSSLAKHADAVLDISVDREACNNNLAPTNSTT
                     AALVMGDAFAISLSTLKDFQPEDFARFHPGGSLGKKLLTRVHEVMQTKNLPFCEPESN
                     FREVVSTMNTGRLGLALVIDEDQLQGIITDGDLRRALNAHQNPTTLQAYEFMTKSPKT
                     IDQNEMFATAEAQMLASRINSMVVLGEERKVVGILQIYNS"
     CDS             525600..527021
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05060"
                     /product="hypothetical protein"
                     /protein_id="BCM24247.1"
                     /transl_table=11
                     /translation="MNLKLMLYGLGLIGVSFIAGLFAVVYSSLAGEKILLLAGLPALL
                     ALGVFLALDKTKLFILILFFRSAADIIFATASFGSFGIGGLINLLVIVIALMFVLERP
                     SGFTKLMASIWLPLLFIAILSISYTPDIGGALKTLNALLTYFSVFVIAFYLVKDKSDY
                     KYFINLILLSSILPVLYAFVDIGLHFGHMGNGDNRLKSTFGHANIFAFYLVLVISLLF
                     YKIKSTAMELSQFIKIGFFFYMLVLMGLLLLTQTRSAWGACLFTFAIYGLIFERRYLV
                     YLMLSGFFALLIPSVRDRVLDLGAGNEYVQYAKLNSFAWRKLLWQSALDWMEPVRYVF
                     GYGLESFKYRCTDFFPGGISFGAHSIFIQWFFETGIVGILTAVWMYFKMIFTLKDGLK
                     SDRVGTVITLLIIAGYMMEAYSDNILVYLSFNWYFWFFMGASCALVISERNKIAPTND
                     DSGVSDSAAPEKKNRFSTRGLAR"
     CDS             527018..527542
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05070"
                     /product="hypothetical protein"
                     /protein_id="BCM24248.1"
                     /transl_table=11
                     /translation="MIQDMDWEADLARYSSSKPFSHEQSIWAIWVYRFGRRTGELQPG
                     LRQRCYTKIYWLLFRIVETITGISLPKSCKIGPGLRIWHFGNIFIHPESVIGANCTLR
                     QGVTIGNRVENGAAPVIGNNVDFGAYAQILGGITIGNNCKIGAMSVVLCDVPDGATAV
                     GAPARIIHAKSESI"
     CDS             527672..528826
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011338703.1"
                     /locus_tag="ZMTM_05080"
                     /product="colanic acid biosynthesis glycosyltransferase
                     WcaL"
                     /protein_id="BCM24249.1"
                     /transl_table=11
                     /translation="MALEKQGFNILRISLRGWDTEVVDPEDKLERERTKYVLQSGLLG
                     LIVPVIRTFFQHPFKFISTLKLAIKMGLHADRAWPFHLIYFAEACKLLPWLQDFNAKH
                     VHVHFGSNSTEVIMLAHELGGPPYSFTVHGPEEFDKPEFLKLGEKIKRSVFVVAITSY
                     CRSQLYRWADYKDWYKVKVVHCGLEEAFYNVSAPLIPEAPRLVCVGRLCEQKGQLLLI
                     DACRLIADKGIDFELVLAGDGEMRKEIEALIAKYDLQSKVRITGWISSNQVRDEILAA
                     RALILPSFAEGLPVVIMEAMALKRPVLTTYVAGIPELVIADDTGWLFPAGDVDGLVTV
                     LEDFLNTSKERLAAMGEAGYKRVLERHSVDVEAGKLAKYFKALPTHDSNK"
     CDS             529059..530012
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012061719.1"
                     /locus_tag="ZMTM_05090"
                     /product="glycosyl transferase"
                     /protein_id="BCM24250.1"
                     /transl_table=11
                     /translation="MLVVADNCDDDTAEIAKANGVEVIQRTSENQRGKGYALDFGVRY
                     LEADPPDIVIIVDADCIVHDDALNRLAFECISLGRPIQALYLMNSPGNDGLKTKVAEF
                     AWVVKNWVRPLGFLRLNLPCQLMGTGMAFPWLLLKEADLSSGHIVEDMKLGIDFARLS
                     KAPHFCPDALVTSTFPINAEGVKSQRTRWEHGHLGMIVKEGPALLRESLVKANLEQLF
                     MTLDMCVPPLAMLIILIFAMSLLGAVLALFNHQLYPWLYVWSLLVTMAISVILAWLKY
                     GRNILSISHLIYIPFYVLSKIPLYVKFVVKRQVEWVRSRRD"
     CDS             530500..531057
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05100"
                     /product="hypothetical protein"
                     /protein_id="BCM24251.1"
                     /transl_table=11
                     /translation="MIPILCVLFTLLRVFYGMHHSVISHFRVDEILVGGILALIFNNQ
                     FINTDISNYLKTFLSKINLLLILIMFLISCHPAIGWMEYVRPYLAALLVGSTLFNLDS
                     GLKKLLNHRVLGYIATISFALYVLHPLLASTWLGSGDLIEKYAKRPLLLAAVLIAAHV
                     STFYYEKRWINFGKYISELISHRTQ"
     CDS             531111..532553
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05110"
                     /product="hypothetical protein"
                     /protein_id="BCM24252.1"
                     /transl_table=11
                     /translation="MRANPRIYIVVFLLLLSTESAYSADFHCVDGSGQEIYISDSSLC
                     GNKKNKKVVSPSPLTGNNSNYGTYLKPFSARSPWNSRPHIYTLGGDVIPPDAYEAAIA
                     SGSFSTSFFTASASDAPVTIYGVYDQDSEMVRDLVLPHWPDNVSSANGSDGHIDVLDT
                     TTGIIHSFWIARLNDGKWSAKLYAWSRIDDSGFGDPAHYYKGARAAAVPTSAGIIRVN
                     EIDDGKDQYDHALAMSLTYSALSPVPPGYIYPATSADSSYQANRGTIPEGALMMLPSN
                     FDLSKIASSAIRKIAKTLMSYGAYVVDRNTGTPFVIYQEIGTAPIAQWRQSADTRLIR
                     TALRQATVSEYLDANGIPYAPTTKQNILSMRGIYQLQMGKVKSTYDTYNQKRTWSKTS
                     EVSREFIYPFSKVEWSKPVAGDTYEVVANTEGGAKLELQVKGDQNFDSGPLKDGESKT
                     FQWPEEGHMVIIIYSGIAESSSVSGTLIKK"
     CDS             532641..533678
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05120"
                     /product="hypothetical protein"
                     /protein_id="BCM24253.1"
                     /transl_table=11
                     /translation="MRWIVLSPFTHSEDPKWIFEYIDPKLHTVEAVPSTYYHDRSRKS
                     SSASDWLDYFVHGFKGFLASFGRSNSTGIITAFPQLALVIALLKKLSGRKSLPLIAWC
                     FNLGRPYQGIKGKVARFCLSSVDIFVVHSTAEIEIYSKWLNLPSSRFFFVHLSAEPPK
                     SEPWLEEGEPYVVALGTANRDYSLLTEALVQLGYKAVIVSGKYAIEHLNAPEAISFKS
                     DLSLDECHRLAIHSRINVIPIADIDSPSGQVTVIESMMLGVPLIATECAGTTDYIEND
                     VDGILVKPKDVESMRNALEKLWNDKALRLNLALNAKKTATEKFTFKAASKSLLIVMNQ
                     LEIIYMKSNTK"
     CDS             533906..534673
                     /codon_start=1
                     /gene="tagA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010965614.1"
                     /locus_tag="ZMTM_05130"
                     /product="acetyl-mannosamine transferase"
                     /protein_id="BCM24254.1"
                     /transl_table=11
                     /translation="MKNKRVKLFGILIDALDMHDTVGVLKDWLISDSRQCRYVVTPNV
                     DHLVKLDKNEIFRVAYQNASLVVADGRPVVAVASMFGDPLPGTVPGSDLVPEIFERFQ
                     KEKTPLKVFLLGAMPGVADSAAKLIESKWPMVSIVGTLSPVFGFEKDVDACIKICQSI
                     NASNAELLVLGLGAPKQELWVYQYASQLSVKVALCVGATIDFLAGEKPRAPAWMRKFA
                     IEWLHRMASEPKRLAGRYFNDALVFPRLIIKEWLSRR"
     CDS             534704..536128
                     /codon_start=1
                     /gene="xanB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P0C7J3"
                     /locus_tag="ZMTM_05140"
                     /product="xanthan biosynthesis protein XanB"
                     /protein_id="BCM24255.1"
                     /transl_table=11
                     /translation="MTSIIPVVLSGGSGTRLWPLSRALLPKQLLPLVSEKSMLQETLA
                     RLSSWTAVEVLSPIIVCGNDHRFLVAEQLREMDIKPRSIMLEPVGRNTAPAIAAAANS
                     LSDMNGALILVLPADHVIRDINAFEAAVKTAAIAAEAGRLVTFGIRPDSPETGYGYIK
                     LGDTLSLADGCFEVGEFVEKPDLATAKSYLESDDYFWNSGMFLFKAAVYLDELKKFKP
                     EIAEQVRLSFDGSYKDLDFCRLEENSFAASPSDSIDYAVMEQTTLAAMVPVNMGWNDV
                     GSWTALWDVQSKDADGNVVRGDTYIHDVSNSLIRSESRLVAVVGVENLLVIETSDAVL
                     VTHKDRAQDVKKIVDHLKSEKRKEHEVHARAYRPWGWYEGIDAGERFQVKRIMVKPGE
                     KLSLQMHHHRAEHWVVVSGSAMITVDDKTNLFSENESAYIPIGSTHRLENPGKLPLHL
                     IEVQSGSYLGEDDIVRFNDSYGRT"
     CDS             536173..537240
                     /codon_start=1
                     /gene="rmlB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HU24"
                     /locus_tag="ZMTM_05150"
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="BCM24256.1"
                     /transl_table=11
                     /translation="MLSNVILVTGGAGFIGSNFVLDWVQGGFGKVINLDALTYAGNLE
                     NLAAIENDANHVFVKGDIGDRALVAKLLMEYQPDAILNFAAESHVDRSIHSPGDFIQT
                     NVVGTFHLLEEVRSYWSNLADEEKLKFRFLHVSTDEVYGTLSLTDPAFTENNPYAPNS
                     PYSASKAASDHLVRAYRHTYGLPVLTTNCSNNYGPYHFPEKLIPLCLLNAIAAKPLPI
                     YGDGQQIRDWLYVKDHCSAIRRVLEAGQLGETYNVGGWNEKSNLDVVNILCEILDELK
                     PRTDSASYKTQITFVKDRPGHDRRYAIDATKLGRELGWKPKETFETGIRKTVQWYLEN
                     QVWVKNVTSGEYRNWVTKQYT"
     CDS             537262..538155
                     /codon_start=1
                     /gene="rmlD_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112614.1"
                     /locus_tag="ZMTM_05160"
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="BCM24257.1"
                     /transl_table=11
                     /translation="MKKILLIGKDGQVGWELQRALILLGEIKAVDVADCDLTNPDQLK
                     SLIRTYNPNVIVNAAAYTAVDKAESDEQVANAVNAIAPQIMAEEAALSGALLIHYSTD
                     YVFDGTKAGFYAEDDVTHPLSVYGATKLAGEIAIQKSGCEHLIFRTSWVFAARGANFA
                     KTMLKLAKQREELKVVGDQFGAPTSAELLADVTALCIRQKLQAPSESPDGVYHLVANG
                     ETTWHAYARYVIKTAIDIGQDLKCLPENVISIPASDYPVPAKRPQNSKLNTSKIRITF
                     GINLPDWQYHAHRMLSEILAN"
     CDS             538189..539088
                     /codon_start=1
                     /gene="rfbA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KMA9"
                     /locus_tag="ZMTM_05170"
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="BCM24258.1"
                     /transl_table=11
                     /translation="MTYSPEIKRKGIILAGGSGTRLYPVTQVVSKQLLPVYDKPMVYY
                     PLSTLMLAGITEILLISTPQDIPRFEQLLGDGHQWGLSISYAVQPSPDGLAQAFIIGK
                     DFIGNDPSALVLGDNIFYGHDLTAGLDQASAENGGATVFAYPVNDPERYGVVEFDDTG
                     RAISLEEKPENPKSRYAVTGLYFYDNQVLDIAKNLKPSPRGELEITDVNKFYLEQGNL
                     HVEVMGRGHAWLDTGTHESLLEASLFIQTIEKRQGLKIACPEEIAYRKGYITAEQLRI
                     FSKKYAKNGYGQYLKQILEERIF"
     CDS             539088..539633
                     /codon_start=1
                     /gene="rmlC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HU21"
                     /locus_tag="ZMTM_05180"
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="BCM24259.1"
                     /transl_table=11
                     /translation="MNIIKTDIPDVLIFEPKVFGDARGFFFESFNENVFAEAIGSRPR
                     FVQDNHSKSSKNVLRGLHYQIKQPQGKLVRVTAGEVFDVAVDLRKSSPTFGQWVGEFL
                     SVENRRILWVPPGFGHGFVTLSETAEFLYKTTDFYAPEHERCVMWNDPDLNVDWHIQD
                     EPALSAKDKLGLLLKDADLFD"
     CDS             complement(539660..540637)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010876270.1"
                     /locus_tag="ZMTM_05190"
                     /product="UDP-glucose 4-epimerase GalE"
                     /protein_id="BCM24260.1"
                     /transl_table=11
                     /translation="MKILVVGGAGYIGSHMVKMLIDSGHDAITFDNLSSGYQDAVLGG
                     EFILGDLADIAAIDMALTKYQPDAVMHFASYIQVGESVKHPDKYYLNNFTNTMNLLNS
                     MIRCDVKNFIFSSTAAVFGEPVYIPIDEAHPRIPLNPYGRSKWMVEEVLLDYERAYGL
                     QSICLRYFNAAGADPSGLLGERHYPETHLIPLVLQAISGRKKDITVFGRNYDTPDGTC
                     IRDYIHIVDLCSAHLLALNKLLKDKQSMRFNLGNGAGFSVQEVISVAEQVTKKKVTVI
                     EGPKREGDPARLVADASLAKQYLAWSPKYVDLETIMTHAWQWELKQINT"
     CDS             540792..542279
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001103638.1"
                     /locus_tag="ZMTM_05200"
                     /product="phosphomannomutase"
                     /protein_id="BCM24261.1"
                     /transl_table=11
                     /translation="MCGLVTENEIYLNRINEVKLNTLKHYVEKSGVGFGTSGARGLVT
                     ALTEEICVAYTSAFLKIVAKLFDFERVAIGVDLRPSSIDIAGSCAKAIQNMGYQVDFC
                     GDVSTPTLALYAQQKSMPAIMVTGSHIPFDRNGLKFYRPDGEITKADELAMLAAEIEP
                     LNDIDYLGLPSVNPDAVLAYEQRYLEFFPKDVLQGLNLGLYEHSSVARDSLKRILERL
                     GAQVTSLGRTDIFVPIDTEAVSAEDVVRGQNWSRQYGFDSIISTDGDGDRPLMSDEFG
                     NWLRGDIVGLLTARYLGAKNLAVPVSCNTAIELSGAFDQVVRTRIGSPYVIAAMQKLE
                     NETNDIAGFEANGGFLLGSKLIMNHRAISALPTRDCVLPILAVLAASRQSENKISYLV
                     RDIPQRYTASDRIQEFSTETSRLFIGKWAKNPALFMAEVLDDYGLPVNQDETDGLRFT
                     FANGLVIHLRPSGNAPELRCYCESSTAQEVESVTQIVLLKIKELQ"
     CDS             542355..543530
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000704802.1"
                     /locus_tag="ZMTM_05210"
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="BCM24262.1"
                     /transl_table=11
                     /translation="MNKKKMGVAGTGYVGLSLSVLLAGKHEVVALDIVPEKVEMLNKR
                     QSPIADHEIEEYLATKELNFRATLDKHDAYKDADFVVIATPTDYDVQTNYFNTRSVEA
                     VIQDVIAINPNATMVIKSTVPVGFTQSVREKYQTENIMFSPEFLREGKALYDNLYPSR
                     IVVGEKSERAQAFADLLKEGAIKQDIPVLLTDSTEAEAIKLFSNTYLAMRVAYFNELD
                     TYSASHGLDTRQIIDGVCLDPRIGQHYNNPSFGYGGYCLPKDTKQLLANYENVPQTLI
                     RAIVDANSTRKDFIAQDVVKHNPTVVGIYRLIMKAGSDNFRASSIQGIMKRIKAKGIQ
                     VIVYEPEIKEADFFKSPVVNDLAEFKKRSEIIIANRITEDLSDVLDKIYTRDLFSKD"
     CDS             543906..544847
                     /codon_start=1
                     /gene="galU-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WKA0"
                     /locus_tag="ZMTM_05220"
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="BCM24263.1"
                     /transl_table=11
                     /translation="MRKVTKAVFPVAGLGTRFLPATKANPKEMLPIVDKPLIQYAVEE
                     AVAAGITDLIFITGRNKRSISDHFDMAYELENELERKGNKALLALVQNIVPKHVNCIY
                     IRQTSALGLGHAILLAKPVINDDAFAVLLADDLLDGDVPIMKQMVDAYDYYRCSLLGV
                     QEVPRAQTKSYGIVATRPVSESIEQVSAIVEKPKPEDAPSTLGVVGRYILTPRIFHHL
                     QNIKPGSGGEIQLTDGISQLLSEEQVLAYRFNGVRYDCGSKAGYLEATVKLGLKHQEC
                     GAEFRALLESMFAQPAIKVEERLLEKHPELVVVGAKK"
     CDS             complement(544876..545766)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003101866.1"
                     /locus_tag="ZMTM_05230"
                     /product="hypothetical protein"
                     /protein_id="BCM24264.1"
                     /transl_table=11
                     /translation="MNSDHPFKGIGLICCAVFLFAGSDALSKYLTQFYPVVMVLWVRY
                     VVHSGLMMTAFVPKSGFSLIKTKRLDLQIIRGICMVSTNLLFISALHFIPLAEGTAII
                     YIAPLVVTALSWPFLGERVSQAQWIAVWIGFVGVLIIVRPGGVLFTPVALLALGAALS
                     FSLYQLVTRKLSGVDSSTTSNFISGVISSLVTTAILPFYWKMPADLWHGILMVGLGIS
                     ALASHLFMTRAYDYAQPSTLAPFTYGQLIFAGLIGYLLFGHIPDRYALLGITIICISG
                     LIMAWSQRKNAHKPLLSDPL"
     CDS             545904..547109
                     /codon_start=1
                     /gene="cypA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001240954.1"
                     /locus_tag="ZMTM_05240"
                     /product="cytochrome P450"
                     /protein_id="BCM24265.1"
                     /transl_table=11
                     /translation="MNIQPHQLTPHFHSQAFQENLYTNYRQYLEFTPVFRSAENVIYL
                     TRYEDCIKLLSSENFKRIAPSGGSNPLNQLSNEQTPLEMMITSWMLFMDPPRHDLVRK
                     AFSPPFLVGALKQLEPFIREQLQSLFASMPRSGEVEILDALAFPLPVIVITEILGVPK
                     SDIEMFRLWSLELTKALDSGNDLEIRNGTAAALQLKAYFTDLLKRPKFLLGHGLINTI
                     LNSNEYSLTVDELLYGAIFILWAGHETTKNLISSGFHTLSQYPEVVRDLQAHPVLIEA
                     AIEEMLRYETPVQKISRWAHSHEQFGEYVVPKSTLVTALLGAANRDGAIFEQPDVFDL
                     RRKKNRHIAFGTGIHHCLGALLARMEGRIVFGELIPQLVKLEPVSHEWRIYSAFRSLD
                     SLRLDVKFK"
     CDS             547730..548503
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05250"
                     /product="hypothetical protein"
                     /protein_id="BCM24266.1"
                     /transl_table=11
                     /translation="MAEQIDWLIHEKPDYLISLPSNLIALVQYAKEHEIVLPKVKEIR
                     TVGETVTSASRNFIETYWQTKVVDIYTCEEAGYLALQCPETGNYHVQSESIFLEIVNK
                     DGNPCAVGEVGQVLITTLHNFVTPLIRYEVGDMAEFGELCSCGRGLSVIRKIHGRKRN
                     RLMLPDGQSLFPYLGEHGDIARLTGVKVRQFQCIQHTLEDIELKLVVERDLNSKEQAA
                     VTKKMQNNLGYPFNIRFSFHDDIPRGPTGKFEEFMSNIS"
     CDS             complement(548507..549154)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05260"
                     /product="hypothetical protein"
                     /protein_id="BCM24267.1"
                     /transl_table=11
                     /translation="MISIRQATEDDLAGILQVEQSWPEGGRASEDKFIARLKKFPQGF
                     FLACIPNESGIERIIATVTAMPLHYNPSAMMEFKSWDAVTQNGYIPTFNLNDCNAIYI
                     VSGVIDSEYRGGNIFSPMILSEVALAESLGKRYVLAGAVIPGYKKFYDAITEISAFDY
                     CRRRRGKHLVDPLLSMYEAIGFSVPDESHVIAEYYPDDASRNFAALVVRDLLKPL"
     CDS             549462..550085
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05270"
                     /product="hypothetical protein"
                     /protein_id="BCM24268.1"
                     /transl_table=11
                     /translation="MAWVDRSTPSFDPTPRDPLALKLALSDPIKNAVYLARPCQYVIG
                     ADQQNCGQKYWTDSRFAPEVIAASNQAISQLKSRYQAKHIRLVGYSGGAAVATLVAAQ
                     RDDIEMLVTVAGNLDTAFWTEANHLSPLTGSLNPADAWQSLQVIKQRHYVGGQDKVIG
                     VSVARSYTDRFDSGHQPPITVIADFDHHCCWVDRWPQIVKSNFSDAH"
     CDS             complement(550116..551678)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010930845.1"
                     /locus_tag="ZMTM_05280"
                     /product="multidrug resistance protein"
                     /protein_id="BCM24269.1"
                     /transl_table=11
                     /translation="MAQDSNLATSQPAPLKGGQLALGTLVLSLATFMNVLDTSIANVS
                     LPAIAGNLGVSPNQATWVITSFAVANAISIPLTGWLTMRFGAVKLFTWSVLLFSLASL
                     LCGFAPSIGMLIFFRIIQGAVAGPMIPLSQSLLLSSYPSSKSGTALAMWSLTTLVAPI
                     MGPLLGGYITDNFSWPWIFYINIPIGIASAWVTWIIYRKRETPIRKLPVDFVGLSLLV
                     IWVGSLQVALDKGKELDWFTSPLIIGLSATAVVGFILFLIWELTDKHPVVNLRLFQKR
                     NFSIGVITLSLGYGVFFGNVVLLPLWLQQYMGYTATWAGLVTAPVGILAIVFSPIVGK
                     SVGKVDPRILASVAFLVFALVFWMRSNFTTQTDVYAMLTPTIIQGIAMAFFFIPLVSL
                     TLSGLRPDQIPAASGLSNFVRITAGAFGTSIATTVWDNRATLHHAQLIEHITPYDAVA
                     TDTINKMQQSGLSFEQAKTQINQLINQQAFTFSADDIFYVSSFICLVMIGILWLARPE
                     KIISSSKDVVAH"
     CDS             complement(551697..552968)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813154.1"
                     /locus_tag="ZMTM_05290"
                     /product="multidrug resistance protein"
                     /protein_id="BCM24270.1"
                     /transl_table=11
                     /translation="MSESNQTIPSETNGNGKRKLMLIVVAIIALVAVTIWGFYWYLVA
                     SHYQSTDDAYVAGNVIQITPQVNGTVVEINADDTDYVTAGKVLLRLDPNDAEVALKQS
                     EAELAQAVRQARTLYANNAIVSASLNERKADLARTKTDVDKAREDLQRRQAVVSTGAV
                     SKEEVEHAQTTLNNALSAMSSAQSSLIGAQEQLTSSHAQTEGTTVETHPNVEAAAAHV
                     REAYLARERCDITAPAAGQLAKRSVQIGQHIQTGSPLMAIIPLDQLWVDANFKEGQLK
                     GMRIGQPVEVYADIYGSKVEYTGHIAGLGAGTGAAFSLLPAQNATGNWIKIVQRIPVR
                     IELDKDQLKTHPLRIGLSIDAKVDTSDSSGKLLADVSRTTPVSTTVQMNAQVAAADAL
                     VKNIISKNSGNASETGAIEKSVSRTHHGTKS"
     CDS             complement(553023..554486)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004191557.1"
                     /locus_tag="ZMTM_05300"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BCM24271.1"
                     /transl_table=11
                     /translation="MPTNIHTYKQYGLSRKILASALILSVMTGCISTQGIQHDQSQRE
                     AKTLGAQGKFNQWPVTEWWQSFNDPMLNQLIEQALRDNPNVVIAAKRMESASAYANAA
                     RSAIYPQVNGSVDISRQRLSENSFYPPPYGGSYQNIANGSLNASWDLDFWGKNRSALQ
                     SALSQTEAAQAEIAAAKLMISTAVAQTYYQLAQQVEQQKLAIQTLKQREQELSLVNAR
                     IKTGLDTNVELQQGKGNLASARVDVQTATESVELSRNALAALTLQAPQTLNTLEPALP
                     AITLQAFPDDIPIDLIARRPDLAAANARVNAATADIAVTHADFYPNVSLSAMIGLSSF
                     GLSKFLESGSTVLGVGPAIHLPIFDAGKLRAQLQIKNTDLDIAIASYNQVLVEAIHDI
                     ADQMTSIQNIRLQSADQQAALNATESAYKLSTIRYEAGLTNYLTVLTAEDALIRERSR
                     SVNLQARTLNLNIALIRSLGGGYSKPNTVTTDSNHPS"
     CDS             complement(554493..555029)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813149.1"
                     /locus_tag="ZMTM_05310"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BCM24272.1"
                     /transl_table=11
                     /translation="MMINKTTPFDSDLNSSDVEVNDAGLAAVGPLEFYNGHNYVIEES
                     IGYLIKHAQLALNRTIDTKMAGIDLTALQWAPLLLIAHGKGRTAAELSRCSGVDTSTM
                     TRMLDRLESKGLICRNRCEKDRRIIYLELTDTGKEFAAKVPYVIAESFNHHLRGFTNE
                     EVNTLKSLLRRIKANEES"
     CDS             555261..558467
                     /codon_start=1
                     /gene="ragC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011085718.1"
                     /locus_tag="ZMTM_05320"
                     /product="RND transporter"
                     /protein_id="BCM24273.1"
                     /transl_table=11
                     /translation="MIGIVSIALKRPYTFVVMALLMLIVGVLSALRTPVDIFPEIRIP
                     VIAVVWQYTGLPPDEMAGRITTLYERVLTTTVNDIEHIEANSYTGFGIVKIYFQPGVN
                     IATANAQVTAVSQVVTRQMPTGTTPPLILNYSASTVPILQIALSGKGLSEQALGDLGL
                     NTIRTRLVTVPGAAVPYPFGGKTRQVQIDLNPQAMQARGLSAQDISSALAAQNLILPV
                     GTQKIGSYEYSMRLNNSAKDIEQLNNLPIKTVNGATIYMRDVATVRDGNPPQTNIVHV
                     DGGRSVLMSVLKNGATSTLDIVSGIKAKLDEIKPTLPEALVVSPINDQSLFVRAAITG
                     VGVEGVIAAALTSLMILLFLGSWRSTVIIAISIPLSILGAIIGLSMIGETLNIMTLGG
                     LALAVGILVDDATVTIESIEWHLEHGKEVETAIMDGAAQIVTPAFVSLLCICIVFVPM
                     FFLDGIARFLFVPMAEAVMFAMVTSFILSRTLVPTMAKYLLKKHDQSHGDGEKAASSN
                     PFVNFQRGFERHFEHVRAGYRELLEMAIDHRRIFVFLFMAFVLLSSALIPFLGRNFFP
                     AVDSGQILMHARVPVGTRVEETASRFAAIQDAIKQVIPADQITTMVDNIGMPVSGINM
                     TYNNTGLIGSQDGDIQIALKEGHRPTAEYVKELRERLPREFPGTTFSFPPADIVSQIL
                     NFGSPAPIDLQIRGGKLDADFDYANKLIGKIRLVPGVADVRIQQSRKSPLFEINVDRT
                     RAQQVGVSTRDVTNNLVVNLAGSSQVSPTFWLNPTNGVSYPIVIQTPQYRMDTLSALS
                     SLPISGTNASGDDISSPQTLGGIASFKRGITNAVVSQYDIQSMVQINATTQGRDLGAV
                     AKDIRQIIDDTADQVPKGAKVELLGQVKTMNSAFSGLLFGLLGAIVLIYLLIVVNFQS
                     WSDPFVIITALPAALAGIVWMLFITYTPLSVPALTGAIMCMGVATANSVLVISFAREK
                     LDELGDATKAALEAGFVRFRPVLMTALAMMIGMGPMALGLGDGGEQNAPLGRAVIGGL
                     LFATIATLIFVPVVFSIVHRNYKKPIATPNTLGEPHAI"
     CDS             558457..559629
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011085719.1"
                     /locus_tag="ZMTM_05330"
                     /product="RND transporter MFP subunit"
                     /protein_id="BCM24274.1"
                     /transl_table=11
                     /translation="MPSNQTHLSPHRTLRISAIVAVLVAAGLVAFGIASRANSDEKLK
                     QWTNERAVPSVSLVSPDNQGALSTLDLPGRFVAYAHAPIYARVSGYLKSWNVDIGGQV
                     KAGQLLAEIETPDLDQQLLQARADLASAEANVALARTTAKRWQGMLESDSVSRQEVDD
                     RTGDLASKEAMLKASQANLDRLIATKRFARIVAPFNGTVTARTTDNGALITEGGSGSA
                     LFEVSDTHKLRLYVNVPQNFVNNIKPGTKADINVPERPDKTYTAIVESTSGAVDVASG
                     ATLVQLVVDNTAGELLPGGYANVSLHQAGSTATFSIPASALIFDQSGLRVATVNADNK
                     ASLKTVTIARDLGKVIQLASGVEATDRVIESPPDGIADGDVVNVVETPAKPTDKKS"
     CDS             559712..561070
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010927123.1"
                     /locus_tag="ZMTM_05340"
                     /product="RND transporter"
                     /protein_id="BCM24275.1"
                     /transl_table=11
                     /translation="MKTPEVPVAANYKETPAWMVGTDGMVAKPADELPRGAWWKVYGD
                     AELDALEERLIANNPDLAAAVAHYAQAEAFSRQLRSSLFPSLDGTANAQRLRQSENRP
                     LRSATSPNEYNDYSIGVQASYEVDLWGRVSNLVKSGKATAQAEKADLESTRLSLQAQL
                     AQNYIALRGIDQQVALLGDTVAAYRKALDLTKVRHDNGIAPGLDVARAETQYQTAQSQ
                     VEQSLAQRALAEHAIAALVGASVSEFSIASRVDEIAVPAIPLGVPSTLLQRRPDIASA
                     QRRVESANASVGVAKAAFFPSLTLGAGLGLESASASNWLTAPSTFWAIGPSVLLNLFD
                     AGKRKAQVVQAQAVLDETGANYRGVVIGAFQQVEDNLALLNHYTKAAESQQSAAAAAK
                     QSEDFSISRYRQGAASYLEVTASQTAALQTQRDLLDLNTRRLQASVQLIRALGGGWAD
                     PS"
     CDS             complement(561286..562161)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073708.1"
                     /locus_tag="ZMTM_05350"
                     /product="serine/threonine protein kinase"
                     /protein_id="BCM24276.1"
                     /transl_table=11
                     /translation="MKTPKRIQPLVEEGLVDEVIRQLMSGKEATVYVVRCGDQVRCAK
                     VYKEANQRNFRNAVVYQEGRKVKNSRQARAMEKGSRYGRKMQEEVWQTAEADALFRLA
                     RAGVRVPQAYGCYEGVLLMDLVTDVNGDVAPRLQEVEWDEKLALEYHAFLLHQVVLML
                     CAGMIHGDLSEYNILVDEHGPVIIDLPQAVDAAGNNSAQVMLERDVDNLTTFFSTFAP
                     QLADTQYGKEIWNLYKAGQLTPETPLTGKIEVDNRPADVRTVMREIERVRREEEARQL
                     YLKDLKNPPAKPDNF"
     CDS             562337..565330
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05360"
                     /product="hypothetical protein"
                     /protein_id="BCM24277.1"
                     /transl_table=11
                     /translation="MKNDEVDHSEVAKYLKPVISEQARLDALYRYRVLDTAPEKSFDH
                     ITLLATQLFKLPIALISFVDQSRIWFKSKQGVDFDQIAIDASFCATAIHSDEPYILND
                     ARYDVRSKSNHLVTSEYGLRFYAGIPLKTADGQNIGVLSIVDFEPREFSQRDINLLQA
                     LAKIVMDQLELNLSIVILNEVHQADNKFRLTFEKLADPMLLLDPNSGHFVDWNPAAIK
                     MLAFPNKHDLQILRPADISPPLQPDGRSSEEKANEMMAIALANGSHRFEWVHCSEYRK
                     PFPVEVLLTLIQINERPMFIASWRDITKQKQAQEELLESELRLKFALEGAGDGVWDWD
                     IAHSKVSFSLAWKSMLGYEEEDIEDSFDEWSRRVHPDDIEKALCDIEKHLHGLTSSYV
                     SQYRLLCKDGSYKWILDRGKSVSFDETGKPVRAVGIHTDITDHKNALEALKAAEQNNN
                     ALLSAMVDGVFVAQRQCFIFANEAMAAMLGYTHAEFIGLHFDKVVAPDFLDIWTTRYK
                     QRLDPSKQPARQYEVRFLKKGGTEALWVEVIASRVVYKGESSVLGIIRNITEKKRAEK
                     MIWSQANFDFLTGLPNRHFFLDKLDVEVKKSNRLKAKMAVMFIDLDHFKEINDSLGHD
                     AGDAVLKEASVRLQRCVRDTDMVSRLGGDEFTIILTDLDESNVSDQRAQSILKAMEEP
                     FNFNNELVYISASIGITVYPDDTQQAEHLLKFADQAMYHAKKLGRNRFSYYAPSMQEA
                     AVSKMHMISDMHQAIKNKEFYLLYQPIIDLESGKAHKAESLIRWNHPKLGIISPADFI
                     PLAEETGLINEIGQWVLKESVRCAQHLRAEFDKTFQISVNTSPVQYRNEDRAYPPFEK
                     LIQPMNADGSLIVIEITESMLMDAEDSINTKLYALRDAGIQVALDDFGTGYSSLSYLK
                     RFDIDYLKIDQSFVRGMKGGSSDHALCEAIIVMAHKLGMKVIAEGVETEEQKALLVAA
                     GCDYGQGYLFAKPLSMADLENFIHH"
     CDS             565554..567719
                     /codon_start=1
                     /gene="prc"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038548.1"
                     /locus_tag="ZMTM_05370"
                     /product="tail-specific protease"
                     /protein_id="BCM24278.1"
                     /transl_table=11
                     /translation="MKEISVKKITILVLLAFAIITQAATMDSAAQFQELKPTTDQARA
                     AHLSAEVLTRYHYSAIPLDDEASKKIFDAYIKSLDGEKMFFTQQDIDQLSEARTHLDD
                     AILNENLSIPFAIFNLYKLRLNDRLSYAKTLLNKGFDFTAKESYQYERENEPWVSNEA
                     DMQELWRKRVKNDWLRLKLAGKDDKTIVDVLTKRYDSNLKSVTKLKGEDVFQSFMNAY
                     AMAIDPHSNYFGVRASEDFDISMRLSLDGIGAVLEDKDEYTTIRELVPGGPAALSGKL
                     KTGDRILGVGQGKNAPVVDVTGWRLDDTVALIRGATDSEVVLEILPAEAGADGKHTFI
                     SLIRKKISLEKQDAKKSVIEVKDGSITRKIGVITLPVFYQDFGARGKGDKDYKSASRD
                     VATLIDSLKKDNIDSLLIDLRNNGGGSLDEAIKLTGLFIDQGPVLQERDSKGNVQVDA
                     DKDTGVLWDKPMGVLINRSSASASEIFAAAIQDYGRGIIIGETSFGKGTVQTVVNLDE
                     IAKNKDPQFGELKMTVAQFFRINGGTTQLKGVTPDITLPTITDPDTYGESSFKNALPW
                     TQIKPADYQVSTEAKAIVPALIASHDARIAQDKDFQYLKDDIADLNVERKKNSISLNL
                     AERQKQRDDKNAKLAAREGSNGLDKTGKVRGRKEAIISQNASAQDDGLQSNERNIKDD
                     LAIEKAQKDAKDVLLSESAHILSDEIGLLKTSKNASVQN"
     CDS             complement(567753..569024)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05380"
                     /product="hypothetical protein"
                     /protein_id="BCM24279.1"
                     /transl_table=11
                     /translation="MTTNQLISNDEKLFLSIIEHAPIGMCVLNKGYQFELVNKAFCDM
                     LGYSKWELSSLTPMDITHPDDKAVSLLHLDRLIKGKVDGYQLEKRYLSKAGISVWTSL
                     TISVLRDDAGNPYNYIGQVQDISARRLFEDQLRLAATVYNSSMQAMMVTDVQNRIVAT
                     NPAFTALTGYSTEEVMNKTPQMLSSGRQSKDFYAEMWKTIESDGHWEGDIWNRKKSGE
                     IYAEWLSISAVKDEIGKVQNYVALFSDVTKKRQAADKIWEHANYDALTRLPNRRLFYD
                     RLNQAMARIKRTEKTLALLFIDLDHFKEVNDQFGHQVGDELLIQVANRLIAVVRASDT
                     VARLGGDEFMVILSELNESSDAAKIAQSLVESIFKPFYIANETMHISASIGVIFYLQD
                     ADDADSLIKGADTAMYQSKKQGKNQFSYYLN"
     CDS             569243..569932
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064801.1"
                     /locus_tag="ZMTM_05390"
                     /product="outer membrane protein"
                     /protein_id="BCM24280.1"
                     /transl_table=11
                     /translation="MKKTLVALALASTITPLMAHAEAGDWVVRARVVDVSPNTGSELG
                     KTVNANVAPLMSPGAQLEVDSNVIPEVDISYYFTKHIAAELILAIGTRHDVSIKGDSL
                     ATVGNQNLGSVNALPPTLTLQWHFNPDQTIDPYVGAGINYTAMLDRKLQFSSGALAGT
                     DIKVDNNTFGYALQAGVDINLKDGWLINADVKYVDMNTDVKMNNGGSWTKIDSLDINP
                     WLFGVGVGKRF"
     CDS             complement(570024..571436)
                     /codon_start=1
                     /gene="hemN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P554"
                     /locus_tag="ZMTM_05400"
                     /product="coproporphyrinogen-III oxidase"
                     /protein_id="BCM24281.1"
                     /transl_table=11
                     /translation="MNVREIKDTAELNPKISPEILKRFDIAGPRYTSYPTADRFVEAF
                     GEGEYIQTLEQRRVGGFALPLSVYIHIPFCESLCFYCACNKVVTKRHQRGAEYLWYLN
                     REIELHAAHIGSGQSITQLHLGGGSPTFLSDTELSDLMLSLHRHFVLKPGGEYSIEVD
                     PRTVNQSRLEHLAKLGFNRISFGVQDFDHEVQKSVHRIQDEAQAFNLVEASRQLGFTS
                     INIDLIYGLPKQTLKSFERTLNKVTQLRPDRIALYAYAHLPARFKPQRYINESELPTA
                     QAKLEMLSSAISIFLAAGYVYVGMDHFALPDDALAIAKRQGRLHRNFQGYSTQPDCDL
                     IALGISAIGRLGASYSQNAKTLDEYYDHLNRGHLPITRGLAMSRDDLVRRAVIMALMC
                     QGNVQFESIELAYLITFNTYFAQELKSLRFLQNDGLVEITENSIQVTALGWFFVRGIA
                     MIFDRYLQTDKTRATFSKII"
     CDS             571598..572317
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002212452.1"
                     /locus_tag="ZMTM_05410"
                     /product="transcriptional regulator"
                     /protein_id="BCM24282.1"
                     /transl_table=11
                     /translation="MTPDAIKVACSNCNLRELCMPVGFDLADLARLDEVVATRRKIKQ
                     GQTLFNSGEVFTSLYAIRTGFFKTSVSTEDGREQVTGFQMAGEIMGLDGIVNDHHSCN
                     AIALEDAEVCVMPFSNIEDLSREFPVLQRHVHKIMSREIVRENSVMLLLGNMRAEERL
                     AAFLLNLVQRLHARGFSKSEFVLRMTREEIGSYLGMKLETVSRTFSKFSEEGVIEVKQ
                     RYVRILDPDALQKIFNPQPCI"
     CDS             572501..572725
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05420"
                     /product="hypothetical protein"
                     /protein_id="BCM24283.1"
                     /transl_table=11
                     /translation="MRTISTKLLSIRASLAKGFAPRLWAKNPKAFKWEIIAILLIKLI
                     MLYGVWTLFFAHPLSKSERLENLSRVILNK"
     CDS             572737..574302
                     /codon_start=1
                     /gene="cydA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195345.1"
                     /locus_tag="ZMTM_05430"
                     /product="cytochrome d ubiquinol oxidase subunit I"
                     /protein_id="BCM24284.1"
                     /transl_table=11
                     /translation="MLPSAEVVDLSRLQFGATALYHFLFVPLTLGMSWILVIMESVYV
                     MTGKQVYKDMTRFWGKLFGINFAMGVTTGITMEFQFGTNWAYYSHYVGDIFGAPLAIE
                     GLMAFFLESTFVGLFFFGWDRLSKEKHLMVTFLVAIGSNLSALWILIANGWMQNPVGA
                     EFNYETMRMEMTNFSALLFNPVAQVKFVHTVAAGYVTASMFVLGISSWYLLKKRDTGF
                     ALRSIAVASGFGLASVLSVIVLGDESGYTTGEVQKVKLAAIEAEWHTEEAPAAFTLFG
                     WPNQAEERTDYAIKIPYALGLIATRSTDETVTGLSDIRQDNEQHIRDGMLAYEALIRL
                     KSGDQSAKETFDQYKNQLGYGLLLKKYTPNVTDASESQIKQAAQDTIPKVLPLFWTFR
                     FMVALGFLFLFIFASAFYYSARRKIQDKPWLLKLAVVAIPLPWLACELGWFVAEYGRQ
                     PWTISGILPTHLSSSSLSTGDLYFSLIGFIGFYTVLLVTELYLMFKYARLGPSSLFSG
                     KYHFEQANQQGVA"
     CDS             574299..575441
                     /codon_start=1
                     /gene="cydB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195344.1"
                     /locus_tag="ZMTM_05440"
                     /product="cytochrome d ubiquinol oxidase subunit II"
                     /protein_id="BCM24285.1"
                     /transl_table=11
                     /translation="MIFDYESLKLIWWLFIGVLLIGFAVTDGFDMGVAAWLPFLGKND
                     DERRVIINSVGAVWEGNQTWLITAGGAIFAAWPFVYAAAFSGLYVALLLVLFALFFRP
                     VGFDYRSKIADKRWRSFWDWALFAGGAVPALVFGVAFGNLLEGLPFYFDDTLRVFYTG
                     SFWALLNPFALLCGVVSLSMLMMHGAIYLQVRTEGIIRQRASKAALVAGFVCAITFAL
                     AGIWVAVGIDGYRILSMPDANSVFSPLSKIADKSTGAWFSNYHQYPLTMIAPVLGFLG
                     VALALWQASARRELLAFLFSSLALAGIIFTAGISMFPFIMPSSIDANSSLTVWDAVSS
                     KKTLGIMFFVTIIFLPIILLYTSWVYRVLRGKVTVQSIQDNTHTAY"
     CDS             complement(575637..580730)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05450"
                     /product="hypothetical protein"
                     /protein_id="BCM24286.1"
                     /transl_table=11
                     /translation="MNVFEPEARSPLTPIEAHMIAENHKAAGRLNEAEHVLRQILAIA
                     PQFPPAYHTLGLIAYEVGKLPLAVELIAQAIAIDPNIGLYYRDMGEMCRRLGRLDEAV
                     AAGKRASTLTPKELDAHYNLGLALTDQCAWAESITAYRQALALNPQHGLSWNNLGAAL
                     EKQGNLAEAEVAYAKAVAINPGHSEAQNNLGALYSEQGRLEDACRCFDASIEAAPDFI
                     EPHFNLSSLKTYTETDPHLTMLERHRSQVPSMKTQAQIRYWFALGKAYEDVARFDEAF
                     AAYEAGNRLQHSLLPCDEARADEMVAEIKAVFNSVFFETHAQVPGSDQAPIFIVGMPR
                     SGTTLLEQILSSHPAVHGAGELLDMHEVLMRAGGNMNKAEQRFPSLVPNMHPQDFARL
                     GAEYAERVWKLAPDAKHITDKMPANFFYLGMIHLMLPNARIIHAMRDPMDSCFSCYSR
                     LFNDTMEFAYDQGTLGRYYVRYMELMRHWHAVLPKGRILDLRYEELVADTEGQARRIL
                     DFVGLPWDDNCLAFHQNKRHVKTASVAQVRKPIYKTSVARWQRFEAHLQPLLQMVQAT
                     DYANPDTTTLPPSAAPLFSNSAEELHLQGVSLYQSGQVEAAVVLYRQALALKPGFAIA
                     LNSLGYALQDLDKLEEARSCYELALKLAPDYAMARLNLGMVQLKLGNWTEGWEHYEAR
                     WIGSAESAAGVFQPIQCALPSWSSETETESDTAQLGLLVICEQGFGDLFLMARYLALA
                     TKRFARVGLVCSAPVRRLMEWSFGGSIKLFGHIPTTSTDWDRQCPLMSLPRAFATRPD
                     NVPNHTPYLAVPKAEQSSWQQRLDDASDGRITIGLAWAGRKTHVYDARRSMSLAQLPP
                     LFEDDRFIWVSLQKWDKTNVVPPDNDRWLDWTNELNDFADSAALITALDYVITIDSAM
                     AHLAGALNKPVWMMNRFDNEWRWMRNREDSVWYPSMRIFRQPALGDWASVVANVATAL
                     QALPDKPATSKTRKNKIPASISKAAPAMSIEQMLELASQLQAQGRLQESEQWLQQILQ
                     AQPDNAFALHLLGVIAHLVGQSSLAINLIEKAIQINNNVALFHANLSEMLRQQKRLDE
                     AIMFGEQAVMLDTTMVSAHGNLGVAYFDRKDYALAETCHQRALAITDQFAPSLNNLGS
                     IERARKNIPAAIAWYRKAIVANPNYFEPLNNLGAVLLEEELFEEALFPLNQALDINPQ
                     NADALCNLGLIRHHLDDDGTAFELLQQALHFRPDYPEAHSGLARVLQSQEKWEAAEQH
                     ALQAIALAPDNADGFSLLGTLYTEMGRDAEAQYQRALALEPEHTDALVGLGNLCMENG
                     DMVRAENLFRQAVAIDPDNIGARFHLTQVKKVSADDANFAALIQTAKKLKMSESEDSL
                     PNSKAISLHFALGKCYEDNKNYEQAFPHFIEGCRLKRASFEYDAAQNHQQFINLMQMF
                     DQSTLDRLRSVGNSLQNSSTTPIFVLGMPRSGTTLTEQIIASHPEVYGAGELPDLMEI
                     LQHDADGKGLGFPYNLVNLTSERIPQLAAEYLSRLEKRAPSSRYITDKMPANFYAVGL
                     IHLMLPQAKIIHVNRNPVDTCVSCFTRLFQRKQHSTYDLAELGQHYADYARLMQHWRK
                     VLPAGAFLEVNYEDIVANQEAEARRLIAYCGLEWNDACLSFYNTNRTIRTASLAQVRQ
                     PIYSSSVERWRLYEAYLTPLLEALGDLAP"
     CDS             complement(580787..581872)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05460"
                     /product="hypothetical protein"
                     /protein_id="BCM24287.1"
                     /transl_table=11
                     /translation="MPKAYSKTVSQIIAAQEQRYAYPAEDTAAPSAQPRIIHQNFTVT
                     NEAVALQAQAWRDYVGRILDVSVSRTQLANGFLGEIDTYVLKDMIYLDSRTDPVTQTR
                     TAARISRDGVRDYVFHVAVEGIIETVTGSFSKRKSAQFVPGILALDMNQTMHMVRPAY
                     ARVLAFFLPRTMVESAIPDAESIHGRMVAYTSPLTRLILNHLLTLCHQLPMMDEVKAE
                     NTIQTCAHLIIAAFSKQARLSDSARTTAHVAIRAEVQRYIQANLYRNDLSPEAVQQVF
                     QLPRATLYRMFEHEGGLGTYIRNCRLREAAHDLVRFPQMAIIEIAYGLSFNSASDFTR
                     AFRRAYGMTPLDFRALALDIDTFDSAS"
     CDS             582178..585909
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05470"
                     /product="hypothetical protein"
                     /protein_id="BCM24288.1"
                     /transl_table=11
                     /translation="MNRSHRIIWNETRKAFVVASEGAKAKGKPSSTRKAITVAVVGAL
                     GALAGMPALAASSCPGGGSLVTISTAETSTCQLNAGDSLTVTNAGSITSTFNGILVQS
                     VAGVGSISNSGSISGNNNGILLMAQSTIAGNITNNTGGTISGGTDGIQLSLTSVSGSI
                     INSGSIAATVGGRSAIYVGDSTVSGSITNNTGGTISGGNEGVWLNHATVSGGITNSGS
                     ISGVNHGIISFSGSEAGSITNNTNGAISGGNTGISLSHSTVSGSISNSGSISGTGQSG
                     IWINGSTLGSIINSGNVSGGNVGFGIAGSTISGITNNAGASISGAGSHGIFLSQSIVS
                     GGILNSGSISGGNNGILLTNSTISGSITNNAGGTISGDNGNGIMVNYSTVSGGISNSG
                     SISGHNFGIDLNYSSASNISNSGSISGAGQAGMIIYASSVGDFSNSGTISGGNAGFGI
                     LSALVSSITNNAGGTISGGTYGIALTYGSVSGSITNSGNISGGNVGAIGISLSHMNVG
                     SITNNAGGTISGGTYGIKLDNSSVGSISNSSTISGGSYVGIYATNSTISGNITNNAGG
                     LISGGSAGIYLINGSVSGSITNSGNIFGGNSGSGISLSHISVGSITNNAGGSISGGYV
                     GINLSNTTISGSITNHAGGLISGGVTGIYLSNSSVGSLINSGTISGGNYAVYLESNST
                     LPTIDITGNNTARFIGDVKAWTTDVNVKAGATFTNDNAFSVLSFTIEHGGIFNMGAGT
                     STSGMANGVETGSGFTNAGRLNVAEGVTATITGDYSQTAAGIFQTAASSDTSYGKLVV
                     SGTATLAAGTGINVNVASVNTLANGNILSSVISAGTLSASTFSITDNSALFDFSAVLN
                     GNAVDLLTNKAAAGVLTSVVATGFTPGVGAANVLDGFVGGGTTGTDTDNIVTALGQLG
                     TQKQVTDAVQQTLPLMTGSMAESTKSTLASINRVIESRQHANRGSSSGDDFYGDKQVW
                     IKPLGAWTNQDDRKGVTGYSANTYGLVGGIDGEISDTTRVGVALAYAHTNVDSNSSAA
                     PQSADIDNYQAILYGSHSLDERTTLSLQGNLGTNTTKGDRVINFGGLNRIASSEYDSW
                     SGHIGAGLSRSYAINPQTTLAPGIRIDYTKLHAQGYTETGAGALNLNVGSSNAEELIL
                     LAESRVAYQVTDHATLIGNLGLGYDALASRNSITAAYTGGGASFITQGIDPSPFLMRG
                     GAGYVVTNSNAIEVTARLDFEVREHFDNETASVKVKVPF"
     CDS             586059..586661
                     /codon_start=1
                     /gene="cysC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VE24"
                     /locus_tag="ZMTM_05480"
                     /product="adenylyl-sulfate kinase"
                     /protein_id="BCM24289.1"
                     /transl_table=11
                     /translation="MAENNIHWHQALISRSDRELRHGHKSVILWFTGLSGAGKSTLAH
                     AIERRLFEKHCATFVFDGDNVRHGLCSDLGFTQGDREENIRRVGEMAKLFTEAGVIAI
                     TAFISPFSADRERVRSLVATNDFIEIYCRCTIDVCEQRDVKGLYAKARQGLIPNFTGI
                     SSPYEIPQNPELTVDTGKLSLDECVEQVLAYLKLQRVIVY"
     CDS             complement(586814..590998)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011339516.1"
                     /locus_tag="ZMTM_05490"
                     /product="hypothetical protein"
                     /protein_id="BCM24290.1"
                     /transl_table=11
                     /translation="MKTRAIPLAIALIGSICAHGVYADPTMQNPTAPDQPLRSQTIPD
                     FANETGKRVDNARVEVNGLPHPAEVESTIDYPLPSGVTRQMLATMKAGVDTLPTRQAE
                     VVTKLLDNSGDAQFNSGKAELTTASQIYLDNLAESLRGKTGIRIDVSGHTDNQHLSAN
                     SRKIFGNNQGLSEARALAVASYLKNKLSLKDGQLALKGYGESRPLASNDTPAGMLQNR
                     RVEIKIWFDEVIPEPVVVVPPVPRADCAAIASKRSNAPFRISVDGEPVALDDQPLEAD
                     RQRCTDVALEKADIQVRYDNLTNLPQMNAWATPNAVVRGEKVEFRAWANYLPWIKKAE
                     LRLFKPGQLTQENPLAVLPVSWNGVTSWQAPIDGPDQVMFLLRVYDNEGRYDESVLKP
                     LELVTHTTAHSDLRPDKNESLIGYGENSLSLRNIPVKGGTVTVNGKNLQPGQTIEAFG
                     LNIPVDSKGKFAMKQIMPGGPNTVEVKLTEPSGESTTFRRNLTIAEDDWFYVAMGDLT
                     AGKNSVSGPAQLVTGDTQHYDGSTYVDGRGAFYLKGKVKGEYLLTASADTREQPLEHL
                     FSNFAAKDPQYLLRNINPDLYYPVYGDDSTTVDDAPTQGKFYVKLARGDSHVMWGNFK
                     TSWSGTELLQYSRGLYGANARYRSETTTSYGEKKTQVDAFAADPGTLGSRDEFRGTGG
                     SLYYMRHQDITLGSERIWVETRDRDSGLVIDRKLLSPAQDYEINYLQGRITLQVPLNS
                     TGSAPGLITTSTLNGNALYLVTTYEYVPGLTSVSNFSTGGRVSEWVNDNFQIGLTGYK
                     QGEDTNKQSLQGIDTTLRYKPGTYIKLETAHSDGAGDGAQTSLDGGFGFSTLTATGGP
                     ASAYSVTGAVDLAEVTKDSKGKISAYAQQREAGFSAPGQITTNGEQVTQEGLKASIQI
                     TDKTQLEAKADIRDATSLSSQVAEVAVREQLDPTWQVGVGLRQDNRDVNIPNASQILS
                     QTGNRTDAQIRLDYTPLKDDGMPGEKKDWNGYGYVQGTLAADGTRNENNRAGLGMSWR
                     ITDRIKMLAEASEGNMGPGVKLGTDYRLSDRHNAYASYIIESERPDSAYVGRQGTWVS
                     GSSYRVTDEMRVFGETRSTQGAGPQSLINAFGLDFAANDYWNLGAKGEMGTVSDPLAG
                     DLKRTAGSFSAAYKKDTTKYSGNIELRDEKSNISGERTTWLLRNTLGYQATKEWRLLG
                     KLNWSVSNNTQGAFYDGDYHEIVSGAAYRPVTNDRWNTLFKYTNFYNLPSPGQLSPSG
                     ITADYAQRSQVFSVDTIYDVRPWLSLGAKYAFRIGELKDNKVNGEWFSSQADLLILRA
                     DWHFVKEWDAVAELRNLRATEAQDSRAGTLLAIYRHMAKGVKAGVGYNFTNYSDDLTN
                     LSYRSNGWFVNVLGTF"
     CDS             complement(590995..596412)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05500"
                     /product="hypothetical protein"
                     /protein_id="BCM24291.1"
                     /transl_table=11
                     /translation="MNISRPSVDQSTRARSKWLLQSLTIKASRFILLGLLALVALPAY
                     AATDLLISTFTDSPDPAARGGTITYTIVASNNGSDPASNVTVTIPLPLTTTYEGATMS
                     GGTCPAAGTVTAGNDIVCTLTGNLAGSGSNTNISLLVATTATTGNTINMSATAATSTA
                     ESNSGNNTSTQNTTINNGADLRLTSLNGTPDPVNGGSNITWAIAGGNQGPNDATNSTV
                     KVTLPGSLSFVSGSGGGFSCSAAGQDVTCTGPVLANGDTFSGLNLVTKVTAGSGNAAI
                     TPLISSTVADPNPNNNSLTGSVAISPGADLQITQGTPSQSPAISNTDVTFSVQATNQG
                     PSDATNGITVTYQLPAAFTFVSATPTGANWNACTVSGSNLVTCVNTGNYTVGLTDSIS
                     IVATAPTVTSVQTFNNIQATIAHNAGNPADPVSSNNTASINLNVSPNGAGLTLNKSRT
                     PNPVAEGQNITSTIRVGNQGPLPASANTIEVTDTINTADENFVSFSTTTDWSCDNVVT
                     PPNTLNPAATTVTCTYKNPLASGANATLTIITKSLVKGAAYTATNNAGVSCVAGSQCW
                     FPGGQTTSANVSVTQATNSVDLAVTKTVSTTGGTNASLESNESTMTYTVVLRNNSTTV
                     DAQDIVIRDPIPGYRSDTPSAAAATIIATNYTQGSTAAFTCAMDASQTTVLVCTQNSG
                     VLKNGDTVTFTIPVSRNLNSGSFTNTATATSTTQGDTNTSNNSASVAVQIAPIADVEM
                     VSKILTPSTTKAGTDATYVLTFRNNGPSQAANVSVTDTFTVAAADPGFTVISITPTNW
                     TSGAPTCTGLTAGQSYGAGSTPTLTCTGTTLNSGEQRTVQIVVRPNWKSGQSADWTIP
                     NTASITTSTAENINGTDGGNNSKTALLTVQAASVDLLINNNDNVDPLGYDASNSGNNA
                     QNDVIYTINTVNNGPSLATGVRFTYAITPATGKTVRFLGDSAVAGPPSGSICNNIGSE
                     VTGPNTLTISCVYTGTDSNLDNGASRNRYLSVRMLSTPASGGDIENSIATVFANETDS
                     NSSNNTETETTTVRSDIAPNNLSLSGKVFIDPNDNGIQNTGEVGISGVTITLSGTTST
                     GVDVCTLITCTVQTAGDGSYIFTGLPTSNATGYRLVESQPSGYTDGKDQVGSLGSITP
                     TRTAGTIINAGTDSFIVALTGAISGSGYNFGESTPAGGFASISGHVWLDNNHDRKFDT
                     STDTAQSGWIVELLLNNTLVTSTTTETSGNDIGSYSFTGLAPGTGYQVRFRNPNTGVL
                     YGRPVTNEDANGNNPGSANTRDGTLNDITLAPGQDLVQQSLPLDPSGLVYNSVTRLPV
                     AGAVVTISGPAGFDAATGLVGGIANQTQTTGIDGRYTFLLIPKVPVPGDQGAPDGVYT
                     ITVTSVPSGFAAAPSTIIPVCNTSVPLNVGSIPSVALVQQSASPPTTSVIDNPATCAV
                     STDSTFANGSGLVTTRYYFTFNLTSASSNVVNNNIPIDPILGGSVIVTKTTPLVNVTK
                     GDLVPYTITVKNSLATVINVQDRIPPGFKYRTGSATVNGVAIEPTAAGRDLTWVNQSF
                     TAGETKTYKLILIVGTGVGEGEYINQAWALNGATGTLLSNVAAATVRVTPDPTFDCSD
                     IIGKVFDDQNANGYQDEGEPGIANVRVVTVRGLLVTTDPEGRFHVACADIPQADHGAN
                     FVMKLDERTLPSGYRLTTENPRDVRVTRGKMVKLNFGATVHRVVRLDLNGAAFAPNQT
                     ELLPEWQQALEGMPDRLASRPSVLRIAYNSGSDDPALCKKRLEAVAKKMDKLWKDKQK
                     GGGANAPLYPLVIETAVEAQQ"
     CDS             596779..597465
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004193573.1"
                     /locus_tag="ZMTM_05510"
                     /product="DNA-binding response regulator"
                     /protein_id="BCM24292.1"
                     /transl_table=11
                     /translation="MRIAALDDNIDELDLVRKTMLSIGHECHVFSKGEALLRALGRES
                     FDLILLDWELPDISGPEIVEWIRTNIADPIPVLMLTNRSEEVDVVHALSIGADDFMTK
                     PIRAKELTARVQAILRRLYPPQEKAEYIWGKYRFVTSSQQLEFDGQPVVLKTKEYELA
                     LFLFRNLGRLLSRQYLKEQLWGIKAAELNSRSLDTHVSSVRNKLGLNPQNGFRLTSVY
                     GFGYRLEIAE"
     CDS             597483..599129
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05520"
                     /product="hypothetical protein"
                     /protein_id="BCM24293.1"
                     /transl_table=11
                     /translation="MIEFFLVSLAMNTNYLLSSALFILITGVTPPLYAATDTHKVVKG
                     DTLYQLSKQYLGNSNAWHAFLRVNTIKNPRQLVPGSTLVIPTIDTQLVTIVYVQGDVE
                     LLSSEGVAGKALQMEDVLAAGAQVRVGKNSYVSFQFKDGSIARVLSESVIRLSQLPAV
                     NAKLRKNTLLKLDKGVVDISVIPRINKKAPFEVTTPMAAAAVRGTRFGVSVSEQDQTS
                     SDVTHGVVAFSTLTVTKNAKTRSAALHAGEGAAVSADGRLGQVHPLLAAPDVSILPEV
                     ISDEGFIHFDVPPLSGASIYRARIAKDSALEQVVQNAEFTTSDIRFSALADGDYTLGL
                     RGVDGEGILGYEATRHFKVKATPAYPFYIKPSLGEVVASDVKFNCTNVAGASSYHLQV
                     ATDMAFSTLELDAPNLESCAYDASALKLGEYFWRISSTVVNSDKQTEEGPFSSPSSFV
                     VSDSNLTQLPTTIYWIAEPELSYTLQISKDAQFAEMLDQELLSKPEFGIENLPGGSYF
                     VRLQPKSKEGLTGPVSTVRTFNIKLPEQPATERTWMDKAK"
     CDS             599238..601505
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010925685.1"
                     /locus_tag="ZMTM_05530"
                     /product="histidine kinase"
                     /protein_id="BCM24294.1"
                     /transl_table=11
                     /translation="MVGWLSAQTTLVQMNRLIQDFVIAMQGHALQDKVVIVAIDDTSI
                     ATLGRWPWRRALHAELLHRLHADQAKVVGLDILFTEPDKRYPIDDATLAAAIKQNSPV
                     VLPLLVQSQNGFAIATQPLKDYAEAATAIGHVQLKVDSDGIVRSVSLQEQVDNISQPN
                     FALSLLNAGGETIEQGSAINANTSGNLQHQAPTLIPYAGGAGYFPRISYLDVLQGNVP
                     KGTFSGKYVIVGATAAGIGDQYATPTTNKDQLMPGVEILANITDALLRNTPLNSATAL
                     QNIGLNVCFVILALIGFALLEPLRALLLTVVLGILLVATTYLAGNAIGILFAPSAGIL
                     GLVFVYPLWSWHRLDAATRFLTDEYNALQNDTDSFYARTAQLGAKDFLDKRIAALDGA
                     TRQLRNLHRFISDSVNALPDATLICGVDGKVRIANSAAHRHFASLNLPDLVACDLHML
                     VKDVLSTENHLPIITQDMLYMPSHIEGEGRDGRGRDLLVKCVPCFNAEEQHIGWILSL
                     VDVTQLWQAERDRDEAFRFITHDIRSPISSIISLLELQRLDKNEPASKSILVDHLLDK
                     IEQQATNALDLTESFVTLSRAKSSQYQLVQLDLVDLLNEVVDDAWAQAKIRAITIKII
                     AFPEDAWVMADREMMKRSLINVLGNAIKFSPDSALVTCSISSVFRQANHEFWDIAITD
                     EGLGIPLEKQDDLFQPFKRLHNTSHPEITGTGLGLAFAYAVVQRHGGEITVSNGATAG
                     ATFHIVLPRLMDLNI"
     CDS             complement(601502..602014)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05540"
                     /product="hypothetical protein"
                     /protein_id="BCM24295.1"
                     /transl_table=11
                     /translation="MKTTQQDSIKNLNIAILASDGVDLDAIVAVRRALKDSGISSLIV
                     GCNAGVVRSVQGVNIEVDSNLAEVNSINYDGVFIPGGIGIDHLCDDENTISFVRNAYK
                     NGKLVASSEGGEKLVIKAAQSAKMPNGAFVGEGVISQSDNDTNFLKRFLAAITDMQSF
                     NRPDKDFIAN"
     CDS             602365..602544
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="ZMTM_05550"
                     /product="hypothetical protein"
                     /protein_id="BCM24296.1"
                     /transl_table=11
                     /translation="MAYVYSYKLYDEVTDDFETQPFKATLEEIQRQVGLPIMRTKEFI
                     PDYAVIDGRYHLLAA"
     CDS             complement(602574..603281)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072508.1"
                     /locus_tag="ZMTM_05560"
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="BCM24297.1"
                     /transl_table=11
                     /translation="MSNRRSPDKNRFLAKLNTATYEQLLPDLELVAFIRDGDLYHHTG
                     VIDYIYFPVTSIVAMVNVLQDGTSPEVAAIGNDGLIGTNLLLGVQSPTTKFIVQSAGF
                     GYRIKADLIKKLFDSDIEFRDLTLRYVHLLMSQSIQIAACNRYHSIEQQLCRFLLSCL
                     DRWNSNRISLTHQRVADLLGVRRASVSEASAKLADAAYIKYHRGCVTILDRKGLENEV
                     CECYQVVKSETDTLLKE"
     CDS             complement(603320..605383)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I1V5"
                     /locus_tag="ZMTM_05570"
                     /product="glycogen operon protein GlgX homolog"
                     /protein_id="BCM24298.1"
                     /transl_table=11
                     /translation="MRTIKEGSPYPRGASFDGKGTNFALFSDHASSVTLCLFNKDGSS
                     ETERIQLKECTNGVWHGYLDDIKPGQLYGYRVDGSWAPTEGQRFNQNKLLLDPYARKL
                     SGAIKWDDSLYGYTISDAADADLTMDERDSASFMPKAIVIDPATLVKSKKPNIRWPKT
                     IIYEAHVKGLTMQHPLIPHDIRGTFAALSDSALISHLQKIGITAIELLPIHAFSQDRH
                     LLEKNLANYWGYNTLSFFAPEPDYMNSGELEEIAKTVDTLHQAGIEVILDVVYNHTCE
                     GNHLGPTLSFKGIDNLSYYRELPGNPRYYDNLTGCGNALNTSHPKVLQMVMDSLRMWA
                     TVYGIDGFRFDLALTLGRNENGFSRDHALFHAMLQDPILTKCKLIAEPWDVGPGGFQL
                     GSFPPGFSEWNGDYRDVTREFWTGKEGTLSKFANRFAASSDLFNEQHRRPWSSVNFIT
                     AHDGFTLHDLVSYNEKHNDANGEDSNDGANDNRSWNCGAEGETDSTEINALRSQQKRN
                     FLATLFLSQGIPMLLAGDELNNSQSGNNNTYCQDNEIGWVNWDKADDSLIDFVGDLAA
                     LRKEHNAISRAEFLTGKLNEQGNSDVSWFNVNGEAMSDEQWNDPNNKAVVVKFVSKDK
                     NECAVLVCINASHVEVEAKLPDDDQHKWKQLIDSTLSEADTTAQTAIKLAPRSLRIYE
                     SNTPT"
     CDS             complement(605506..606099)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004529073.1"
                     /locus_tag="ZMTM_05580"
                     /product="hypothetical protein"
                     /protein_id="BCM24299.1"
                     /transl_table=11
                     /translation="MIAMVLPHDWSLVTRILTGWNAGVWSYLALMGWLITKADHAQIQ
                     RISAQEDKGAIAVLAIMSLSAVFSLAAIGFELASVSNLATHERISHYILTIITVLSSW
                     LLVGIIFTFHYAHTFYLSDKTKRAFMFPDKKSNPDYWDFLYLAFTIAAAAQTSDVSVM
                     TSSARKAVTAQSILSFLFNAAVIGLLINIAAGIIGSH"
     CDS             complement(606165..607859)