LOCUS       AP019788               35221 bp    DNA     circular BCT 02-JUN-2021
DEFINITION  Methylomagnum ishizawai RS11D-Pr plasmid pRS11DPr5 DNA, complete
            genome.
ACCESSION   AP019788
VERSION     AP019788.1
DBLINK      BioProject:PRJDB8374
            Sequence Read Archive:DRR180485, DRR180486
            BioSample:SAMD00172935
KEYWORDS    .
SOURCE      Methylomagnum ishizawai
  ORGANISM  Methylomagnum ishizawai
            Bacteria; Proteobacteria; Gammaproteobacteria; Methylococcales;
            Methylococcaceae; Methylomagnum.
REFERENCE   1  (bases 1 to 35221)
  AUTHORS   Asakawa,S. and Watanabe,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-2019) to the DDBJ/EMBL/GenBank databases.
            Contact:Susumu Asakawa
            Nagoya University, Graduate School of Bioagricultural Sciences;
            Chikusa, Furocho 1, Nagoya, Aichi 464-8601, Japan
            URL    :https://www.agr.nagoya-u.ac.jp/%7Esoil/
            Soil_Biology_and_Chemistry/toppupeji.html
REFERENCE   2
  AUTHORS   Asakawa,S., Khalifa,A., Lee,C.G., Ogiso,T., Ueno,C. and Dianou,D.
  TITLE     Complete genome sequence of Methylomagnum ishizawai strain RS11D-Pr
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.7
            Genome Coverage       :: 725x
            Sequencing Technology :: Illumina NextSeq, GridION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..35221
                     /collection_date="2003-08-11"
                     /country="Japan:Aichi, Anjo, Aichi Agricultural Research
                     Center"
                     /culture_collection="JCM:18894"
                     /db_xref="taxon:1760988"
                     /isolation_source="rice rhizosphere"
                     /lat_lon="34.97 N 137.07 E"
                     /mol_type="genomic DNA"
                     /organism="Methylomagnum ishizawai"
                     /plasmid="pRS11DPr5"
                     /strain="RS11D-Pr"
                     /type_material="type strain of Methylomagnum ishizawai"
     CDS             561..1751
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45710"
                     /product="hypothetical protein"
                     /protein_id="BBL77473.1"
                     /transl_table=11
                     /translation="MPRPPELYQWNREIAIHFPGLSKPMVMGLALWSLGMVVVGACSL
                     SALTDWWSCRLGQKGDAVRERLRYVYRGKEAKAGKERRELDVEACRAPWLGWVLEGWD
                     GNQLAVALDATSLGQRFVVLAVSVLYRGCAVPVAWKVLRAERKHPWKPEWLALLRHFK
                     DVAPASWTVLVLADRGLYAKWLFEGIQALGWHPMLRVNSGGTFRPRGWRHWRPFTRLV
                     PKVGDRWQGRGTAFGGKRTRLDCTLLAYWGEGHKDPWLVLTDLPPEAANACWYGLRGW
                     IEQSFKKIKGGGWQWQNTRMDDPERAERLWLAIAIATWWLLSVGGEAEAGMAAATFPA
                     IPGSPRQQAHRWRLVGIFRHGRSLILAALFERRALPVGKARPEPWPSVPIPGATVAIL
                     TGAV"
     CDS             complement(1796..2236)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45720"
                     /product="hypothetical protein"
                     /protein_id="BBL77474.1"
                     /transl_table=11
                     /translation="MQLLIRRNQKTGLMGGAKYTLYVRAQLSDEERNLVKKNNLAGEL
                     LVYYDRDADKANLAGSLKEAGGLAGALVRKMRDTALTVAKLIEGAEITCANVGELMGV
                     ERETREAALMLKNYLDVAATFGGEEVLDMDKLLAEANARDARRA"
     CDS             complement(2517..3557)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45730"
                     /product="hypothetical protein"
                     /protein_id="BBL77475.1"
                     /transl_table=11
                     /translation="MNPSPTKRLTALQIDMLAAVLRYRLMTTAQIHRLLYSRREGAGG
                     ETSVAKTMRKLHDSGFVKRDWLAVKPTERSILGRPNAIWSLEAPHLKRLAGHLAETGR
                     ADLLEELAPDAKAFREGSALAENTLRHELAITDFYMALEMRADEAGRTPPTWLRTSPA
                     HLDVSRSVIVTKTDKKTGRQTQAKLPLNPDGLHAVGVPGRGYAFFLLEMDMNTETALE
                     KLTHKFLAYYAYYEQGGFGREIAAPFAQRHALPVARPEAAPFRVLFVAPTAKRRNDLL
                     LKSRVLPTSNLFQFATMADVLADPYGPVWLSKDSFKDHLDEYNLRTNAEGPVTLRAWA
                     HGVLDSLPKHAL"
     CDS             4602..5891
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45740"
                     /product="hypothetical protein"
                     /protein_id="BBL77476.1"
                     /transl_table=11
                     /translation="MLEMSEKTLVVQHNAVIEARYRLTVEEQRLIKTLVSHIQPNDED
                     FKVYEIKIADLARLLDISDTSYYDRVKKVTRRILTNVLCFYDEKGNEVQTNWLSSAKY
                     HKGKGVVALRFDPELKPYLLQLKRLFTSYELGNILRLKGMYSIRIYELLKQYERIGRR
                     EFELEFLKKTLGIDAEYPQYRDFKKFVLVPAEKEISEKTDIKYATVEKKRGRKVIALV
                     FEIEPRKSSSPDEKPVKPDKKPQEIQAGHVVSQMMSLGVARKVAEELVEEYGEEKVRY
                     AIEYTQGQVKEGKVKSPGGFLVEAVKNGYRDGKKEERKRKEDSAKAEATETARRKAWE
                     RAKEQWGAWRNERTTARLDAMDAETLELEKEAWRASLADKPALLNMLKPGSDREGLFF
                     HQYMVGRTGGLGLAEWARAVGFDLSPFEDLARQDGKL"
     CDS             complement(6117..6503)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45750"
                     /product="hypothetical protein"
                     /protein_id="BBL77477.1"
                     /transl_table=11
                     /translation="MDKEYVDKRFDEALAAIQEMITIMDSRLMKLETGLQGRMTDFQE
                     NMENMRQALRDEIHTSENALRREIQHGQGKAMEEMREQRDILLRLEHFLMDKQEVQGD
                     LIQETRQRVERIEAKVGLPHSLSVAL"
     CDS             6637..7365
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45760"
                     /product="hypothetical protein"
                     /protein_id="BBL77478.1"
                     /transl_table=11
                     /translation="MPVPELEKRLVVQHNRLIEAVYRLPVEEQLLIKTLVSRVGPKDM
                     DFRPHTLRVADLAGLMGMTGGDAHAAVEWATKRLAGRVVALRDGDGKELQVSWLSSAL
                     YDGDEGSVSLCFDPRLKPFLLRLKNNFTVYELGNVVRLKRTYSIRLYELLKQYQPVGR
                     RRFTLDRLREMLMLRDGEYGTYNNFKKWVLVPSREELGRKTDIDFTWNEERERGRVVA
                     VEFVIKAQGRPETQPERAKIQPMA"
     CDS             complement(7424..7771)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45770"
                     /product="hypothetical protein"
                     /protein_id="BBL77479.1"
                     /transl_table=11
                     /translation="METKTTPKKRSLGTPPTDLRDNLKEPEIAPTGHVVTHKVDKRTL
                     RRAGRDYQLNAGVSLEFRNRFNEVAARDHLQNWELIMAGTALYERLTKEEREAIIEEI
                     RRKNPPAYRILSR"
     CDS             complement(7838..8485)
                     /codon_start=1
                     /gene="parA1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015042062.1"
                     /locus_tag="MishRS11D_45780"
                     /product="para1"
                     /protein_id="BBL77480.1"
                     /transl_table=11
                     /translation="MPYILACVSQKGGVGKSTVARGAAVALTRQGYKVRLADLDTAQG
                     TSVDWYRRRLNNGGDPLESVEYYRTAKEALEKSRDVDVLVVDAQGRSSESTLALAHAA
                     HVLIQPATGSLDDLDPAIRLYTELRNRQIQSSKLLFALLKTHNENEEAAAWDYIGQTG
                     FPCLKNTLRSRVGYKNAQNAGLSIVETFYPALNEQADAFLDELFLYIKKLYIKDM"
     CDS             complement(8901..9314)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45790"
                     /product="hypothetical protein"
                     /protein_id="BBL77481.1"
                     /transl_table=11
                     /translation="MDKDILEAIRGAVREAVKEEIGALTEVVTDGFEYLIGKVNLVDK
                     SLGVIESHVPAVKVDMEALKMDVTTVKREIAGLKLEFVEAMPEIHETRTAMLRIEHVL
                     QDKQEAHGDELEGVRQRIERIEDSLRLPHTLSTAA"
     CDS             complement(9493..9669)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45800"
                     /product="hypothetical protein"
                     /protein_id="BBL77482.1"
                     /transl_table=11
                     /translation="MEEKEFIMELTLPEDLALFVMERAKEEGYADPGGYVLALIMADL
                     KRRDEQRLEATERA"
     CDS             complement(9705..10139)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011393815.1"
                     /locus_tag="MishRS11D_45810"
                     /product="putative toxin-antitoxin system toxin
                     component, PIN family protein"
                     /protein_id="BBL77483.1"
                     /transl_table=11
                     /translation="MRNAKHPDRLRAVLDTNVLVSAFQFPKGSIAGAWWALKEGRYVL
                     VTSPTILSKLAEILRRRFGWNDNDRKALLKLVSRNAEIFQPKEIPEAVPNDPDDNHIV
                     ACAREGHADLIVSGDRHLLDLGEYEGIPIIRPADFLRTVGRP"
     CDS             complement(10096..10473)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45820"
                     /product="hypothetical protein"
                     /protein_id="BBL77484.1"
                     /transl_table=11
                     /translation="MSRVSKNLGFTVPPAMAEEFEQLAKAEQSTKSELFRRMVRLYKT
                     YRNPIGQRTDNAEGWVERLILEAQEEERRNPMTAEEFAAETERLMDYGAERSRALGIR
                     SEEELNEMLYAERETSRQATRRS"
     CDS             complement(10562..10774)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45830"
                     /product="hypothetical protein"
                     /protein_id="BBL77485.1"
                     /transl_table=11
                     /translation="MPETELRRYAVVLLDATRGRQWRDECDTEGEAQDILDRERHRAS
                     GYLVFDRESREIVKSRNLLAQDHGTD"
     CDS             complement(10867..11211)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015038887.1"
                     /locus_tag="MishRS11D_45840"
                     /product="hypothetical protein"
                     /protein_id="BBL77486.1"
                     /transl_table=11
                     /translation="MTTETPKDREPDGFLIPKPPLFQPGQVVATPGALAECPMEHLFE
                     CLVRHLGGDWGHVCPEDAKSNDAALKGGNRILSAYPIDPAQPCKGYGDNCLWVITEWD
                     RSVTTFLLPDEY"
     CDS             11750..13222
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45850"
                     /product="hypothetical protein"
                     /protein_id="BBL77487.1"
                     /transl_table=11
                     /translation="MLDELTPIKEQLVEALVSLPDTVTLPMEGALTRINLTKETQAEV
                     SHLTHYWEFILDNYDTSVIALVGMVNAGKSAIGNLLLHCSESSVFQEAPIRETSEPSI
                     ARLDEKVILVDLPGLGSVLADEDDAVVKSYLRRANLLLIVISVDSPITKHLFEFLKTE
                     ISSTYLAQRIIFVLNKIDIWDNLPELHRKKELSRYVEFLTNGQPSLGFCGINALFDYE
                     VPIMPISVKHARNNHSCQDIESLQNSIISLLCDSKNSTCIQAKEQLQISFSKHVYIAN
                     GYSGLQETLQKAEEQVEWVKTKLIEYVDTELSAFYTSIVELDKACWVAMEHLPKPDWF
                     EKTFETSGLSSKKQKLRETREYYSEKMKEVFDRFNKNIALTTKNILIAAFGCASEIAI
                     PAPSKTHEILDGLAYINWDIQDDIYFLDKSVSSSRINERTNQKLQDLEKEIGVLLDNY
                     AIFDAITYSAYNKFSEEIKTLESLRNFMQGMSNIYTSLFS"
     CDS             13251..15188
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45860"
                     /product="hypothetical protein"
                     /protein_id="BBL77488.1"
                     /transl_table=11
                     /translation="MSTQKTEYKKFTAEIHSGTLLDDFMPQIMDDLEKRYKPINDMKI
                     DYCDVLSKHAINIDKFNGFEKISEALSQSVEDINNIFVDIDERMKYFTIVFFGGVSAG
                     KTSMICDLANVNPHHLSEIISSNPNFNPAQDRISIGPNVATINLYEILIEKSCIRLVD
                     VPGIGGVVHDDDSLAPFVNMADCIMLLIQAGNDIMKSDEDFLYDHVAAFSKRDTSNAE
                     FKSEERTDKRVLVALNKWKMAYGDLPPAKADKIFEQKSEWILHANGLKANDKFSGIAG
                     YFHKPPIIARAETSYRDDETGDPLPAWFGENAKTDLSEVINALHEILKDDGSDFRLNR
                     PRQVLQKESNKLIGYIAQEKAATSLEELGKELESLGVKSTFTTNQINDQLIERLNRFE
                     QTVTFFLASRIKPAIHSWQPKVGFFDGLTGIFNKKGLQESLKKEWSNELRNLISSRID
                     VQEFANLIKQETDAFKKLVETSYQINFLSNPDLLKRIPGLQQSSSGSSSSEKEGIFKA
                     IERELDEAVKKIQMGILDDIINLVSWDAILAILVGAILSPVGSFLLLAYRRWKRGESK
                     GQEAKREIDYAVDKIAADVSSEIKQKIMLRLQKGVEDIHVAISNVLKQEKETINEPLI
                     LMDQIIADIREFQIKLQSIGI"
     CDS             15527..15883
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45870"
                     /product="hypothetical protein"
                     /protein_id="BBL77489.1"
                     /transl_table=11
                     /translation="MSIDKVIEILDKHSEVMESYVLLREIKLFLNVDHEHFHPEIRIK
                     IYESSALRVPYHFSVSHHVKTPTQAGPYMPSKTWAESEEEAIRQAISTTTSYIKSAIA
                     AGHEPSESWLIPDEDF"
     CDS             16081..16758
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45880"
                     /product="hypothetical protein"
                     /protein_id="BBL77490.1"
                     /transl_table=11
                     /translation="MINETDATWGVFISYSRMDRNIVAPITDLMRITGAKVFRDEDSI
                     LPGKKWKIIITESLNSARTVVVFWCGHSAQSDAVKFEYKTAIELNKDVVPILLDETVL
                     SDELREYQWIDFRSFTTLRENHCNVLSIGDAASAVGAGAVAGLSAGTAAGIGIAAGAA
                     VVIAAAPVVLPIALIGGLVGAGIALLKKDSNKQAPLEPSITYPKLTKDEEDKIIAVLT
                     KRILSFA"
     CDS             17230..17433
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45890"
                     /product="hypothetical protein"
                     /protein_id="BBL77491.1"
                     /transl_table=11
                     /translation="MGSQKAWIDNLDNPIVLIGFIVFILSGVIVSKIKNSKQQTKGYN
                     SPIINSNGSVNYSIDKSKNNKNL"
     CDS             17430..18716
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45900"
                     /note="frameshifted, insertion at around 18704"
                     /product="hypothetical protein"
                     /protein_id="BBL77492.1"
                     /transl_table=11
                     /translation="MSLDKKTDGHNSPIIDAKNVSIKQGISPDLVDKWMLFGEEKYQE
                     LLKKYKELENKLADKTGDNAENAKLKLISGDLYGAEQLLKIFNVPIPRNLFFTGRSDI
                     LEKLREALQNENKIAITPSKRATALSGLGGVGKTQTVAEYAYRYKDEYSAVLWVLADG
                     KDLLLNSFAQLSGLLGFKGEKQNDQILAVQSWLRNNNGWLLIFDNAETLDLLTAAKEL
                     LPTSAEGHVLFTTRAQATGGLASVIVDCFDNDTGAVFLLRRSKWVAIDLTTLEKVRPS
                     VSDKDWQVATELVYELGGLALAIDHAGAYIEQTECGLDGYLRRYRNNSAMMLKDCDYV
                     QRGNDYPNSVYRTFLLALEKVKKRSLLANEILLDSALFHPDGISEKLYTDYNFTELDK
                     ALATLKDYSLIQRVPEKHLFTVHRLVQVVIRDVCDG"
     CDS             18709..19851
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45910"
                     /product="hypothetical protein"
                     /protein_id="BBL77493.1"
                     /transl_table=11
                     /translation="MDRETTWRERAEKLVNRVNLAFPNPEFENWDLCEELLLSATSIC
                     EQIQHFSINIEIASKLLHRVAFYLTEKGEYIKSESLYLESIDIKEKQHYYTDISVSIS
                     NLAGLYLAKGKYNLVEPLFQRSIMLDEKYLGENHYYTTPSLLGLAELYRTQGKYEKAM
                     LLLQKSLAIIENSLGQNHPQFAQCLNNQAGIYHDQGKYSQAEELYKQSIKIREKIFKE
                     NHPKIAETLYNLGVLYREKNKFKQAEYLLERSFVILENSLGKTHPRIGGLLYNLAELY
                     DVQGKYEQAESSYQKSLSILEKALGKDHIEVAVCLHGLAIFFQMQKEHEQALPLYQRS
                     LSILESTLGENHKNTKRVRLNYKFFLIIRNTKNITNQAIRLVKSFL"
     CDS             complement(20195..20425)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45920"
                     /product="hypothetical protein"
                     /protein_id="BBL77494.1"
                     /transl_table=11
                     /translation="MKKFVVIFVRREEREKEARWSKEYDTEAEANEAIFEAKRKAIGY
                     ALFDRESQKFVKSKNFAFKDYETGGLTPNSDF"
     CDS             complement(20443..20655)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45930"
                     /product="hypothetical protein"
                     /protein_id="BBL77495.1"
                     /transl_table=11
                     /translation="MVFIKEDGERKTVVSAEYPTWAEAWPDIRDSFENGGATDCAILD
                     RDFHNLVGPASFASEIAARPTAGARQ"
     CDS             20800..20967
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45940"
                     /product="hypothetical protein"
                     /protein_id="BBL77496.1"
                     /transl_table=11
                     /translation="MGKNKNRSVKGCPGLSRKDYEKARKRGLRRLRRGFSPVVGKDNL
                     REAVKASLGAV"
     CDS             complement(21217..21549)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015038887.1"
                     /locus_tag="MishRS11D_45950"
                     /product="hypothetical protein"
                     /protein_id="BBL77497.1"
                     /transl_table=11
                     /translation="MPIEIETDREPDSLPKPPLFHPGEVVATPGAVDASTDEYLFQCL
                     TRHLGGDWGHVCPEDAQSNDAALEHGSRILSAYPIDPGKPCYGNNCLWIITEWDRSVT
                     TFLLPDEY"
     CDS             complement(21981..22607)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141199.1"
                     /locus_tag="MishRS11D_45960"
                     /product="hypothetical protein"
                     /protein_id="BBL77498.1"
                     /transl_table=11
                     /translation="MTAPFRIEPLGGQIDRATFASGEAALDRYFRTQVTQDIRRRVAN
                     CFVAVEAETRQVAGYYTLASASIPIADLPPEEARRLPRYPTMPAVRIGRLAVDHRFQG
                     RGLGASLLADAALKSLSAAPAAFALLVDAKNERAAAFYRHHGFQAFANQPKTLFLPLA
                     TAEKTLLGPAEAPNAVTQAAMEEARSDVLPKFATAQELFDDLEKDGEG"
     CDS             complement(22604..22921)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45970"
                     /product="hypothetical protein"
                     /protein_id="BBL77499.1"
                     /transl_table=11
                     /translation="MEVNLGKTEAPMTQPTQRTARLEARIAPDMLNVVKRAAEIQGRS
                     VSDFVVSAAHDAARRTIEETEIIRLSVEDQRRFVEAILNPPEPTPALRRAFARHHELF
                     GGE"
     CDS             complement(23055..23636)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000905027.1"
                     /locus_tag="MishRS11D_45980"
                     /product="DNA-invertase"
                     /protein_id="BBL77500.1"
                     /transl_table=11
                     /translation="MRIGYARVSRGDSQEVQAQVEALKAAGCERVYTEEASGGRWDRP
                     ELHRLLDHLRPGDILVVWKLDRLSRSLKDLIALLERIEGAGATFESLTEHIETRSPAG
                     RMLTQMLGSFAEFERAMIRERTRQGLEYAQSQGRKGGRRHKLTPAQRALIVRLVDSGE
                     QKAADAARSFKVSEATISRILAEHRQESRKGKS"
     CDS             complement(23867..24802)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45990"
                     /product="hypothetical protein"
                     /protein_id="BBL77501.1"
                     /transl_table=11
                     /translation="MAKNLLLTAKTAQDINNRIDRVLRGLGNPEPPLRLEDVRELLKL
                     DRAFYKADDPSVIQETISRIRIATIQVYQRPTLLIEAIQKFSLKALYIPDRKRILLDA
                     SLPEKKHRWNEAHEIGHSLIPWHDEMMLGDNIITLSHNCHEHIEAEANYAAGQLLFLR
                     DRFLMEACSVEPTINSINRLHNIFGNTISTTLYRFIETVGVELPIVGLITDHPHIMRR
                     PETFDYDKPCRHFIQSPAFAKRFSKLSETELFDSVSGYCGSQRGGSLGKAELILDDDN
                     GSQHRFIFETFFNTYDALTLGVYCHPESRIIAIAG"
     CDS             complement(24818..25303)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46000"
                     /product="hypothetical protein"
                     /protein_id="BBL77502.1"
                     /transl_table=11
                     /translation="MKIDVTREWCLRMAQLEADSDIGVGRYALNSIFDSETPSPMENL
                     EEPTIAFSRFVRLMRRNHGLTVEKLAEDADVDIAELVEIEDDTRYKPQPRTVYQLANY
                     FQVPRGKLLQVAGLTVPKDSRIIEEAFRFAARSEPVAALSPEERAALETFVAVLSEQK
                     P"
     CDS             complement(25300..25938)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46010"
                     /product="hypothetical protein"
                     /protein_id="BBL77503.1"
                     /transl_table=11
                     /translation="MTATVSPIYLFNVEKREPEEAELWDAITEQQISDWEGEWGPELS
                     KSIQRLKRAGVDRRSWPQSRHWNWRDKKADHLQGLLACQGFSVVGGGLTQGMMIVDTA
                     KKRCRIESQKNKHIVYIEYLENAPWNRKELFDPPRYRGVGSILIRAAIELSKNESFKG
                     RIGLHSLPQADEFYADTCNMTDLGVDAGYYGLRYFEMTPEQAVAFIEKGNQL"
     CDS             complement(25935..26150)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46020"
                     /product="hypothetical protein"
                     /protein_id="BBL77504.1"
                     /transl_table=11
                     /translation="MTATKKTMTLNLTDAEMRALEEMCVKKDLSKTAVLRQALRLYQM
                     VEARIEKGDKLFFEDDGSKEKTEVMML"
     CDS             complement(26364..26501)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46030"
                     /product="hypothetical protein"
                     /protein_id="BBL77505.1"
                     /transl_table=11
                     /translation="MLIRWPGVGHLQDLCAGWDRIVDYCRVEFQLFVSYQHLMQVMLV
                     Y"
     CDS             26472..27227
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46040"
                     /product="hypothetical protein"
                     /protein_id="BBL77506.1"
                     /transl_table=11
                     /translation="MAHARPADEHLVFQVLNSGLLEELRPDETTDLRTKGVEKFLVFR
                     NDRSFRFELDGRMFEWGGNLISGLTLKKLAGVDPKDYGVWLEVRGAGEDRPIADKDLV
                     DLSAPGTERFFTGIVQTTEGLGTPVLPAKCRRYLTDRGMKFEEVGEGGQHAVILRGFA
                     LPIGRFDAGTADILIYLPGGYPDNPPDMFYCQPWLKLVPANRYPRAADQPLVFRGQPW
                     QRWSRHNTTWRPGVDGIWTMVKRVENALLEAAS"
     CDS             27224..28633
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013533405.1"
                     /locus_tag="MishRS11D_46050"
                     /product="thiamine biosynthesis protein ThiF"
                     /protein_id="BBL77507.1"
                     /transl_table=11
                     /translation="MTCIDLTFQENHLQTLRGLVLREDGVEAAAYILCGESRIESDPW
                     ERRARRRLSSYEVVPIPPEDAVSASDRHITWNTASFVRLLKRAKEEGLVAGIVHAHPG
                     GPPRFSDQDDRNERELVRLALNRNGDGASLVSVLLTGAGEVRARLWPDLHAPLDAESI
                     RAIGQKLAFYDPALPMRGDDVFARQALAFGPELNARLKGMRIGIVGCGGTGSATALLL
                     ARLGAGQLVLFDDDIVETTNLNRLHGARRADADSMRPKVDVVAREIAEMGIGTRVVPM
                     RGWIGNPAFRDALKSCDVIFGCTDDHDGRLLLNRMAYFYLIPVLDMGLAIEPQPGGEG
                     MRELSGRVTVLTPGAPCLLCRHIVDPVAARDEDLKRHNPEEHERRKREAYVRGAGNPA
                     PAVVTFTTATACLAVDELIQGLTGFRGPEGWVWQRTRRFDLMQDRRPGAIQEPCCPIC
                     SETGYWGRADVQPFLDRAG"
     CDS             28602..29000
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46060"
                     /product="hypothetical protein"
                     /protein_id="BBL77508.1"
                     /transl_table=11
                     /translation="MSNRSLTVRGEDMWIEWLRWLLVSVGAIRRPDLVGRLMDRHPKP
                     DELPPGLLVVVKDGGYLKWACFRCPGGCGEKLQLSLNPSRRPRWTVGLDWLRRPTLTP
                     SVHQFNACRCHFVLKNGIVNWCRDSGRRGA"
     CDS             29105..29287
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004552967.1"
                     /locus_tag="MishRS11D_46070"
                     /product="hypothetical protein"
                     /protein_id="BBL77509.1"
                     /transl_table=11
                     /translation="MAKNTGDGYRKGSVTDRTQTHNPKTDSWVKRNATTGKFMDQKSD
                     GTPFKGVAKEKDGRRN"
     CDS             29487..30119
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005842205.1"
                     /locus_tag="MishRS11D_46080"
                     /product="peptidase"
                     /protein_id="BBL77510.1"
                     /transl_table=11
                     /translation="MKPTQETYTALQSAYEFFNRELFGGALPECLITLTRKEKRVYGY
                     FWGQRFEEIGGTQKTDEIAMNPQHFKSRSVAQALSTLVHEMCHQWQAHHGTPSRSAYH
                     NREWADKMESLGLMPSDTGQPGGKRTGQKVSHYIIPGGLFERVCAVILSDGFKLAWGE
                     IVAEVEGDEGSGKGRTTRAKFTCPDCRANAWGKPDLNLVCGDCMVPMVAE"
     CDS             30664..31263
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46090"
                     /product="hypothetical protein"
                     /protein_id="BBL77511.1"
                     /transl_table=11
                     /translation="MDKETEKGADWLDFKEIKARAEVRPVLGHFGILEHLEERGPELV
                     GWCPLGREHGKQDSFSFNVEKRSFQCFACKARGSVLDFVAKYGDISLRDAAKTVMGIL
                     DEEPESAEAEPEGRPYGKAGRGMRKPAARRPGVRRGSKRERPNEPNRETGGLPFFTWS
                     HAESLVRESMLDPARLVVIDADALETFLKVTARPSEETA"
     CDS             31329..31559
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46100"
                     /product="hypothetical protein"
                     /protein_id="BBL77512.1"
                     /transl_table=11
                     /translation="MWIAARNEKPPFRAVSLSTDARGETRRLRLSLTAAPGNRNAVPM
                     LMEAVCVAVGWAGGGLIQIHRQNGKTVMAKTE"
     CDS             complement(31608..32519)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46110"
                     /product="hypothetical protein"
                     /protein_id="BBL77513.1"
                     /transl_table=11
                     /translation="MHDEHQNDTNGNIDKPAGIHEASQAEADKTNLSRIILAVGIGLL
                     AVGILTSVFYPSPGTDKKLPSSQALESLRSSLSSYNQARNLGEPSFEATLIDIRLELY
                     QAIASGGEASQSLPSASLLQYPVHKNDVAFRIEKDDPAIRPDYGKMRTTDYFLHGFIK
                     AFKHKKYKSPNVWVVCLILKQNGKGQAGNVAVDMERVELKEVRELYDASFMGIHPEDD
                     ALRGPFSVTKKEQVALGDMGSGSGVIIPLAITNVFIPINEMDMESKSVVSNIAYIPVN
                     ISFLSGKSKERKTLPVEKIVSDPIIIN"
     CDS             complement(32561..33361)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_46120"
                     /product="hypothetical protein"
                     /protein_id="BBL77514.1"
                     /transl_table=11
                     /translation="MPPKGKKKPPSTADRLNTVLGLIASILGIFLTVSTLYGKSLELK
                     DGDEKTKLELQKLRDSARESAPQIDIEYAELSNDLFISLSDSKKRQDRKQNLFLNYPV
                     IPNEVVDENIAIKPVSLNPSTSPDGDGEQRVTFLVLKNKGKRDAKDVKVTFERLALSR
                     TVRVNEEKGKATGDYIRQIKEKAEAYSQSEISIPYPIETNQGVLIPLFVTIYPYESQG
                     KEWDVASKAVFLPKTLGFSDPLDGSVKSENIRQMRDPVRLESGLLERG"
BASE COUNT         8151 a         8836 c         9910 g         8324 t
ORIGIN      
        1 cgacgctggc gaggaggccc gccaggatgt cggccacgta gtcccggacg gtggcctcgt
       61 ggcgctgcgc ttccctcagc agcaggattt tgtcccgtaa ctcttcccgc agcgccaagc
      121 cctcggccag gtcggagagc gcgtagtcca gggccgcatc cggcgggaag ccgtacagcc
      181 cggacgcttc cagcagttcc ccggccagcg tttccagcgc ctccgccagg tcgccctcgg
      241 ggtcgaggcc cgcgtcaccg cacaggcacc gggccgtctc cgccgcccac gggccgggat
      301 gcagcgacag ccgggcggtc gcggccagtt gccttgcctc gtgccacagg gcgcgggtct
      361 cccgctgctc gggcgggaag cgcggggctt ggggcgggaa caggaaatgc caccgccagc
      421 gcagcaggac cagcaggacc gccagagcca ggaggatggg gaggcttaca agtgtaggtt
      481 tttgaaaaaa ccggaggcga gacaaagggt taaggtacat tggtgagtaa cgacaaacac
      541 cctgtaccgg aggaaccgcc atgcctcgcc ctccagaact gtaccaatgg aaccgggaga
      601 tcgccatcca ctttcccggc ctttcgaagc cgatggtgat gggcttggcc ctgtggagcc
      661 tgggcatggt cgtggtcggc gcttgcagcc tttcggcgct gaccgactgg tggtcgtgtc
      721 ggctggggca gaagggcgac gcggtgcggg agcgcctgcg ctacgtctac cgtgggaagg
      781 aggccaaggc cgggaaggag cgccgcgaac tcgacgtgga ggcgtgccgg gccccctggc
      841 tgggctgggt tttggagggc tgggatggaa accagttggc ggtcgccttg gacgcgacga
      901 gcctggggca gcggttcgtg gtcctggcgg tcagcgtact ttaccggggc tgcgcggtgc
      961 cggtggcctg gaaggtgctg agggcggaac ggaagcatcc gtggaagccc gaatggctgg
     1021 ccttgctgag gcattttaag gacgtcgcgc ccgcgtcgtg gaccgtcctg gtgctggcgg
     1081 accgggggct gtacgccaag tggctgttcg aggggatcca agcgctgggc tggcacccga
     1141 tgctgcgggt gaactcgggc ggcaccttcc gcccccgggg atggcggcac tggcggccgt
     1201 tcacccgcct ggtgccgaag gtgggcgacc gctggcaagg ccgggggacg gcgttcggcg
     1261 gcaagcggac ccgcctggac tgcaccctgt tggcctattg gggggaaggc cacaaggacc
     1321 cctggctcgt cctgacggac ctgccgccgg aagccgccaa cgcctgctgg tacggattgc
     1381 gcggttggat cgagcaaagc ttcaagaaaa tcaagggcgg cggctggcaa tggcagaaca
     1441 cccgcatgga cgatcccgag cgggcggagc gcctctggtt ggcgatcgcc atcgccacct
     1501 ggtggctgct ctcggtgggc ggggaggccg aggccggaat ggccgccgcc accttcccgg
     1561 ccattccggg ctctccccgc caacaggccc accgctggcg gctggtgggg attttccgcc
     1621 atggccgttc cctgatcctg gccgccctct tcgagcgccg cgccttgccg gtggggaagg
     1681 cccgcccaga accctggcca tcggtgccaa tcccaggggc aaccgtggcg atcctcacgg
     1741 gggcggtatg aataaaccta cacctgtaag ggatggggag ggcgggcggc acggcctatg
     1801 ccctccgggc gtccctggcg ttcgcctcgg ccaagagctt gtccatgtcc agcacttctt
     1861 cgccgccgaa ggtcgcggcg acatccaggt agttcttgag catcaacgcc gcctcgcggg
     1921 tttcccgctc cacccccatc aactcgccca cgttggcgca ggtgatctcc gccccctcga
     1981 tcagcttggc gacggtcagg gccgtgtcgc gcatcttgcg cacgagcgcc ccggccaggc
     2041 ccccggcctc cttcagggaa cccgccaggt tggccttgtc ggcgtcgcgg tcatagtaga
     2101 ccagcagttc cccggccagg ttgttcttct tgaccaggtt cctctcctcg tcggaaagct
     2161 gggcgcggac gtacagggtg tacttcgcgc cgcccatgag gccggttttt tggttgcgtc
     2221 ggatgagcag ttgcacggtg cctcctgcct ctcggcgggg atgggtcgct tgcgggattg
     2281 gggcttgtgt acgtggctgt tccgttaatg cgtcgatcat ggaaagggtc cgcgcccgtt
     2341 gtcaacggtg aatattcacc ttgacacggc gggctttccc cgttccgtgg cgtccgtccg
     2401 tccgtcgggc cgggcgggga ggacgcggaa aaccccctgg aaggctttcc gggggcgcga
     2461 gggtagttgg ataccctgcg gagggagaac ggcccgccac gcgcctcctg ggggcctcag
     2521 agcgcgtgct tggggaggct gtcgaggacg ccgtgcgccc aggcccgcaa cgtgaccgga
     2581 ccctcggcgt tggtgcggag gttgtactcg tccaggtggt ccttgaagga gtccttggag
     2641 agccaaaccg ggccgtaggg gtcggccagg acgtcggcca tcgtggcgaa ctggaatagg
     2701 ttggaggtcg gcaggacgcg ggacttgagc aaaaggtcgt tccggcgctt ggcggtcggg
     2761 gccacgaaca gcacgcggaa gggggcggct tccgggcggg ccacgggcag ggcgtgcctc
     2821 tgggcgaacg gcgcggcgat ttcccgccca aacccgccct gctcgtagta ggcgtagtag
     2881 gccaggaact tgtgggtcag cttttcgagg gccgtctcgg tgttcatgtc catttccagg
     2941 aggaagaagg catagccccg gcccggaacc ccgaccgcgt gcaggccgtc cgggttgagg
     3001 gggagcttgg cctgggtctg cctgccggtc ttcttgtcgg tcttggtgac gatcacgctg
     3061 cgggacacgt ccaggtgtgc cgggctggtc cttagccagg tgggcggggt ccggcctgcc
     3121 tcatcggccc gcatctccag ggccatgtag aagtcggtga tggcgagttc gtggcggagg
     3181 gtgttctcgg ccagggccga gccttcccgg aacgccttgg cgtccggggc cagctcttcc
     3241 agcaggtcgg cgcgtccggt ctcggccagg tgcccggcta atcgcttgag gtgcggcgct
     3301 tccagcgacc agatggcgtt cggcctcccg agtatggagc gctcggtcgg cttcaccgcc
     3361 aaccagtcgc gcttgacgaa gccggagtcg tgcagcttcc gcatggtctt ggccacggag
     3421 gtttcgccgc ccgcgccctc gcggcggctg tacagcaggc ggtgtatctg ggccgtggtc
     3481 atcagccgat agcgcagcac ggcggccagc atgtcgattt gcagggcggt gagccgtttg
     3541 gtgggggatg ggttcatggg cttggatttt gacgttttac ggggcgtccg gggtcttggg
     3601 ggtgcctgga tacctttcgg aggggaaagg ggccttgccg gtcggtttgg agcgtctggg
     3661 agcgtgctgg tcgtgatggg ggaggatgct ttttcggttt tcccagttcc cggatttttc
     3721 ctttcggctt ttttcccttt tccgtttccg gcgttttcgc catttccgtt tttcgcggcg
     3781 cggatttcgt ttgtcgcgcc cgtccccggc acaccgccgc cgttgcggca cggggacggg
     3841 actccggtgt tctttcgtcc gtggcatcgt cctcgggcgc tggtggggtg tggggaaagg
     3901 gttgtttggc ttggctccgg taggggctgt gtccgtcgcc cgtggacgct ccctcgcccg
     3961 tcctccctgt ggtgtccgaa tccggctttg tagccggttc ggtcgttggg tgggttccgt
     4021 tggttccgtt gttttcggcc ttggccggtg tgtgttcggg cacgtctcgc ggttcgccga
     4081 gaccggattc tctggctgtt taaaacgtag agagaatccg gtctcggggg ttgggcggtc
     4141 agcccccgag acgtgcccag ccgttaagcc gttcccggcg gttgccggtc gggttcggtg
     4201 gttagtgcga tgtcccggct ttctgtccta tctcctaacc tatgacaggt cttcggatca
     4261 gtcaagggtg cccggtttgc cggggttccg aaggaaaaca acaacaggga gggtgggcgg
     4321 acaggctccg gcggggctgg gagtagaagg taacgggtgg gcgcgcgcgt tgttgttgtt
     4381 ttccctgttt tccctgtttt tgttgttttc ggcgattaaa gccaattgaa aatccttgat
     4441 tttatgcggg gtttcggcgg gttatggtgg tgaaattggg tgcctatggt ggtgaaattg
     4501 ggtgcctatg gtggtgaaat tgggtgccta tggtggtgtt taatttgata tcaccatcaa
     4561 atatatgata tatttgtgga gtaactctaa aaaacaccac gatgcttgaa atgagcgaaa
     4621 aaacgctagt ggttcagcac aacgccgtca tcgaagcccg ctacaggctg accgttgagg
     4681 aacagcgcct tataaagacg ctggtttccc atatacagcc gaatgatgag gattttaaag
     4741 tatatgagat aaaaatagcc gatttagcaa ggctattgga tatttcagat acgagctatt
     4801 acgatagggt aaaaaaggta acaaggcgga tacttacgaa cgtcctatgt ttttacgatg
     4861 aaaaaggaaa tgaagttcag acaaactggt tatcatcggc aaaatatcat aaaggaaaag
     4921 gggtcgttgc ccttcgtttc gatccagaac tgaagccata tctgcttcaa ctgaagcggc
     4981 ttttcacatc ctatgagcta ggcaatatcc tccgcttgaa agggatgtat tcgatacgca
     5041 tatacgagct tttgaagcag tacgaacgga tcggaaggag ggaattcgag cttgagtttt
     5101 tgaaaaagac gctcgggata gatgccgaat atccgcaata cagggacttc aagaagttcg
     5161 tcctcgtacc ggctgagaag gaaatatccg agaagacgga tataaagtac gccacggtcg
     5221 agaagaaaag ggggcgcaag gttatcgcgc ttgtcttcga gatcgagcca agaaagtctt
     5281 cttcacccga tgaaaaaccc gttaagccgg ataagaagcc tcaggaaatc caggccgggc
     5341 atgtggtgtc gcaaatgatg tccctcgggg tcgcccggaa ggtcgcggaa gaactggtgg
     5401 aagaatacgg ggaggaaaaa gtgcggtacg ccatcgaata tacccagggc caggtcaagg
     5461 agggcaaggt gaagagtccg ggcggcttcc tggtggaagc cgtcaagaac ggctaccggg
     5521 acggtaaaaa ggaagagcgc aaacgcaagg aggattcggc gaaggccgag gcgacggaaa
     5581 ccgccaggcg caaggcgtgg gagcgggcca aggagcagtg gggcgcgtgg aggaacgagc
     5641 ggacaacggc ccgcctcgac gccatggatg ccgaaaccct ggaattggaa aaggaagcat
     5701 ggcgggcctc cctggcggac aagcccgcgc tcctgaacat gctcaagccg ggatcggacc
     5761 gggaggggct tttcttccac cagtacatgg tcggcaggac gggggggctg ggcctcgccg
     5821 aatgggcgcg ggccgtcggg ttcgacctct ctcctttcga ggacctggcc cggcaggacg
     5881 ggaagctgta ggacgccgga ccgggcggta acctcacctc ttggagcctg ggaactgccg
     5941 catggttggg cgtcggatga ccggagataa ggaagaccat ggtccaaagg tcggctggtt
     6001 agccgccatc cgcttcggta cgtgttcacc tatggcgtag gttataaata ttgcatagat
     6061 ataacatatg gcatagcttg gaccgtggcg cggccaggat cgccggttcg actccgctaa
     6121 agggcgacgg agagtgaatg gggcaggccc accttggcct cgatccgttc cacccgctga
     6181 cgggtttctt ggatgaggtc gccctgaacc tcctgtttgt ccatcaggaa gtgttccagg
     6241 cgcagtagga tgtccctctg ctccctcatt tcctccattg cctttccctg gccgtgctgg
     6301 atttcgcgcc gtagcgcatt ctccgacgtg tggatttcgt cgcgcagggc ctggcgcatg
     6361 ttttccatgt tctcctggaa gtccgtcatc ctgccttgca agccggtttc caacttcatc
     6421 aggcgggaat ccatgatcgt tatcatctcc tgaatcgccg cgagtgcttc gtcgaatctc
     6481 ttgtccacgt attccttgtc catggcttta ttataatggc tacattctta gtatatcatg
     6541 ctgtatttta cgcaataagt ataggttttt attattctac ttgtcatgat ttattttttg
     6601 agggattatt gctatataac ccgataaaat aatcctatgc cagtacccga gttggaaaag
     6661 cgcctggtcg tccagcataa ccggctcata gaggcggtat ataggctgcc cgtcgaggag
     6721 cagttgctta tcaagaccct ggtttccagg gtcggcccca aggacatgga tttcaggccg
     6781 cacaccctgc gcgtcgccga cctggccggt ctgatgggga tgacgggcgg agacgcccac
     6841 gcggcggtgg agtgggcgac gaaaaggctg gccgggcgcg tcgtggccct ccgggatggg
     6901 gacgggaagg aattacaggt ttcctggctg tcctccgccc tgtacgacgg ggacgaaggg
     6961 tcggtttcct tatgcttcga tccgcgcttg aagccgttcc tgctgcgcct aaagaacaat
     7021 ttcacggtct acgaactcgg caatgtcgtc cgcttgaagc ggacctactc gatacggcta
     7081 tacgaacttc taaagcagta ccagccggtc ggaaggcgca ggttcaccct ggataggctg
     7141 agagagatgc tgatgctgcg cgacggcgaa tacgggacct acaacaactt caagaaatgg
     7201 gtattggtgc cttccaggga ggaactgggg cggaagacgg acatcgactt tacgtggaac
     7261 gaggagaggg aacgggggcg cgtcgtggcg gtggagttcg tcatcaaggc gcaaggcagg
     7321 ccggaaaccc agccggagcg ggccaaaatc cagcctatgg cataggttat atataggcca
     7381 taggtattgg atattgacat aggcgcttcc tgcttctgtt gggctacctg gaaaggatgc
     7441 ggtatgcggg cgggttcttg cgccgtatct cctcgatgat cgcctccctt tcttccttcg
     7501 tgaggcgctc atagagcgcg gtgcccgcca tgatgagttc ccaattttgg aggtggtcgc
     7561 gggccgcgac ctcgttgaaa cggttgcgga attcgaggga gacccccgcg ttgagttggt
     7621 agtcccgccc ggcccggcgc aaggtccgct tgtccacctt gtgcgtcaca acgtggccgg
     7681 tgggcgcgat ctcgggttcc ttcaggttgt cgcggaggtc cgtgggcggc gtgcccaggc
     7741 ttcttttctt gggggtcgtc ttggtttcca taggttgcgt ctaccgatta ggttaaagat
     7801 atgacatagg tattggatac gtcataggtt atagatatta catatcctta atgtacagct
     7861 tcttgatata caggaaaagc tcgtcgagga aggcgtccgc ttgttcgttc agggccggat
     7921 agaacgtttc cacgatggaa agaccggcgt tctgggcgtt cttgtagccg acgcggcttc
     7981 ggagcgtgtt cttgaggcat gggaaacccg tctgcccgat gtagtcccag gcggcggcct
     8041 cttcgttctc gttgtgcgtc ttgaggagcg cgaacaggag cttgctggac tggatttggc
     8101 gattcctgag ttcggtgtag agccggatgg ccgggtcgag gtcgtcgagc gagccggtgg
     8161 cgggctggat caggacatgg gcggcatggg ccagggccag cgtggattcg ctggaacggc
     8221 cctgtgcatc gaccaccagc acgtccacgt cccggctttt ttccagggct tccttggcgg
     8281 ttctgtagta ctccaccgat tccagcgggt cgccgccgtt gttgagccgc cgccggtacc
     8341 aatcgacgct cgtcccctgc gccgtgtcga ggtcagccag ccggaccttg tagccttgcc
     8401 gggtgagcgc cacggcggct ccccgtgcga cggtggattt gcccacgccg cccttctggc
     8461 tgacgcacgc gaggatgtat ggcataggta aggttttgtt ttttaacact gtttacaata
     8521 tcccatgaat tccggccttt gcataggacg tataaataac ctatggcata tctataaaat
     8581 atggcatagg tttagcatac gacatacgga aaatcggctt tcctaggccc ggttcttctt
     8641 aggggccacc tcacgaaacg gaaaatatcg tacggcaagc cagggggttg tcagattgag
     8701 gtctatgagt cggcaaaatg catgtcagag aaaaacgaaa ctgaccctaa tctgacagtt
     8761 ctcgtgctat tgcctgacac ccgtttgggg tataccccaa acggacgggc caagacgcaa
     8821 caagccgctt gaagccccgg ccaaacaggg gctttgatcc cttggcgtac gatattttcc
     8881 gtttcgtgag gtgacccctc ttatgccgcc gtggaaaggg tgtgtgggag acgcaagctg
     8941 tcctcgatcc gttctatccg ctggcggacg ccttccaatt cgtcgccgtg ggcttcctgc
     9001 ttgtcctgta ggacgtgttc gatacgcagc atcgccgtcc ttgtttcgtg gatttcgggc
     9061 atggcctcca cgaattcaag cttgaggccc gcgatttccc gtttgaccgt cgtcacgtcc
     9121 attttcaggg cttccatgtc caccttaacg gctggcacat ggctttctat gacgcccaag
     9181 cttttgtcta ccagattaac cttgccgatg aggtactcaa agccgtccgt taccacttcg
     9241 gtcaacgccc ctatttcctc tttgacggct tcccttaccg ctcctcggat agcttccaaa
     9301 atatccttat ccatgatgat ataaaaggtt ttatatctct attataccac accgaatata
     9361 accgtattct tcttgcagcc gctccctgtc ttcggcgctt gccacacgca tggttatagc
     9421 gttgatattt tatatataaa actatctgct atcacaagat agcagatagt taatagaggt
     9481 ctctcggctt tcctaggccc gttcggtcgc ttccaggcgc tgctcgtccc ggcgcttgag
     9541 gtcggccatg ataagcgcca ggacataccc gccaggatcg gcatagcctt cctctttcgc
     9601 ccgctccatg acgaacaggg cgaggtcttc cggcagagtt agctccatga tgaattcctt
     9661 ctcttccata ggggagggtg gtttcaaaag gttttatgag gccgttacgg acggcctacg
     9721 gtgcggagga agtccgccgg gcggatgatc gggatgcctt cgtattctcc caggtccaga
     9781 aggtggcggt cgccggaaac gatcaggtcg gcgtggcctt cgcgggcgca ggccacgatg
     9841 tggttgtcgt ccgggtcgtt cggtacggct tcggggattt ccttgggttg gaagatttcc
     9901 gcgttccggg aaacgagttt cagcagcgcc ttcctgtcgt tgtcgttcca tccgaagcgg
     9961 cggcggagga tttcggccaa tttgctgagg atggtcgggg aagtgacgag gacgtaccgg
    10021 ccttccttga gcgcccacca tgcgcccgcg atggagcctt tcgggaattg gaacgctgaa
    10081 acgaggacgt tggtatcaag aacggcgcgt agcctgtcgg gatgtttcgc gttccgcata
    10141 gagcatttcg ttgagttctt cttccgaccg gatgccgagc gctctcgacc gttccgcccc
    10201 gtagtccatg aggcgttcgg tttcggctgc gaactcctca gcggtcatgg ggttccggcg
    10261 ctcttcctcc tgggcttcca gaatgagccg ttccacccat ccttccgcgt tgtcggtgcg
    10321 ttgcccgatg gggttccgat aggtcttgta taaccggacc atccggcgga aaagctcgct
    10381 cttggtgctc tgctcggctt tcgccaactg ctcgaactcc tccgccatgg cgggcggaac
    10441 ggtgaagccg aggtttttgc tgactctgga catgctcata cccaactaag ttaaacttgg
    10501 ttatgtttct actctaacag gctaacggaa tccgtcaagc tcgggaactg tccgctggcc
    10561 ctcaatcggt gccgtggtcc tgggccagca ggttcctgga tttcacgatc tcccggcttt
    10621 cccggtcgaa caccaggtag ccgctggccc ggtggcgctc ccggtccagg atgtcctggg
    10681 cttctccctc cgtgtcgcat tcgtcgcgcc actgcctgcc tcgggtcgcg tccaggagga
    10741 cgaccgcgta gcgcctgagt tcggtttctg gcataggggt atgttcaagg gattatgcct
    10801 agggtattac agtggaacag aaggaaaggc ccgtggtcgc gttggacgca cgggcgttgg
    10861 gccgaatcag tactcgtccg gcaaaaggaa ggtggtaacg ctgcggtccc actcggtgat
    10921 cacccataaa caattgtcgc catacccctt gcagggctgg gccgggtcga tgggataggc
    10981 cgaaaggatg cggttcccgc ccttgagggc cgcgtcgttg ctcttggcgt cctcggggca
    11041 gacatggccc cagtcgccgc ctaggtggcg caccaggcat tcaaaaaggt gttccatggg
    11101 acattccgcg agggctcccg gcgtggcgac gacctggccg ggctggaaca ggggaggttt
    11161 ggggataagg aagccgtccg gctcccggtc tttcggggtt tctgtggtca cgccgcgtac
    11221 tccttttgtg gcggttgtgg aaaggacttt catggactgt acaattccac ggtagcacac
    11281 aggtttttcc tgtcaaaaca aggggatatg cgcgactcgg tttctatgcg ccggttccgg
    11341 tgcttccgtc cgtccgggac atgttggacg gtagcgggat ggatcgttcc gcccgtggca
    11401 ggctcaagcg ctttggtgct ggttacgtga gagggttgtc agggctatgg ggcgggcgta
    11461 ggattgcgct gcgtcccggc gatttgccat aacgcccgat atgcgcggta aacgcgcaac
    11521 ggtgcataac cccgatgggg tctcattgcg ataagggcag caaggtgcct aaaccgtttc
    11581 ccaatcaccc cgctaaaaat acacagttca ttgaaatcag tgggttggcc atatgtgttc
    11641 cgtcttatac gccccaaatg gtgcaataaa agacaccttt tagggcgtct acttcacgtt
    11701 aggcttctgc gtgaagttcc catcagtagc aacactaaat tttgtaaaca tgcttgatga
    11761 attgacacca atcaaagaac aacttgttga ggcattagtg tcgttgcccg atacggtaac
    11821 tttacctatg gaaggcgcct tgacacggat aaaccttaca aaagagactc aggctgaagt
    11881 atctcaccta acccactact gggaatttat actggataat tatgatactt cagttattgc
    11941 tttggttggg atggtaaatg ccggaaaatc tgcgattgga aatttattgc tgcattgctc
    12001 tgagtcaagc gtttttcagg aggctccgat tagagaaaca tcagaaccga gtattgcacg
    12061 cctagatgaa aaagtcattt tagttgattt gccaggcttg ggttcagttc tagctgatga
    12121 ggatgatgct gttgttaaat catatcttcg acgagcaaat ttgcttctaa ttgtaattag
    12181 cgtcgattct ccaataacaa aacacctttt tgagttttta aaaacagaaa tatctagcac
    12241 atatttggct caacgaatta tttttgttct aaataaaatt gatatttggg acaatctccc
    12301 tgaattacac agaaaaaaag aactatcaag atatgttgaa ttccttacta atgggcagcc
    12361 atctctaggt ttttgtggaa taaacgcgtt atttgattat gaagtaccaa taatgccgat
    12421 ctctgtaaaa cacgctcgta acaatcattc gtgtcaagat atagagtcat tacagaactc
    12481 gataatcagc ctcctttgtg actctaaaaa tagtacatgc atacaggcca aagaacaatt
    12541 gcaaatatcg tttagtaagc atgtatatat agctaatgga tattctggct tacaggaaac
    12601 cctgcaaaag gcggaagagc aggtagaatg ggttaaaaca aagcttatag aatacgttga
    12661 tactgaatta tcagcgttct atacaagtat agtagaattg gacaaggctt gctgggttgc
    12721 gatggagcat ttgccgaaac cggattggtt tgaaaagaca tttgaaacaa gcgggttatc
    12781 ctcaaagaaa caaaagctac gtgaaacacg ggagtattac tcagaaaaaa tgaaggaagt
    12841 gtttgataga tttaataaaa acatagctct aacaaccaaa aatattttaa tcgcggcatt
    12901 tggatgtgct agtgaaatag caattcctgc cccatcaaag acacatgaaa tacttgatgg
    12961 attggcttat ataaattggg atattcagga cgacatctat ttcttggata aatcagtctc
    13021 atcttccaga ataaatgaaa gaacaaacca aaaacttcaa gatttggaaa aggaaattgg
    13081 cgttttattg gacaactatg ctatttttga tgcaataaca tattctgcat acaacaaatt
    13141 tagcgaagaa attaagacat tagagtcttt gcgcaacttc atgcagggca tgagcaatat
    13201 atatacaagc cttttttcat agtccaacca atagatgcgg agattgaagt atgtcaaccc
    13261 aaaaaacaga gtataagaag ttcacagcag aaatccatag cgggacacta cttgatgatt
    13321 ttatgcctca aataatggac gacctagaaa agaggtataa accaatcaat gacatgaaaa
    13381 tagattattg tgatgttctt tcaaaacatg cgattaacat agataaattt aatggttttg
    13441 aaaaaatttc tgaagcattg tcacaatcgg tagaggatat aaacaatatt tttgtcgata
    13501 tcgacgagcg tatgaagtac tttaccatcg tattttttgg cggtgtaagc gcaggtaaaa
    13561 catcaatgat ctgcgacctc gccaatgtta atccgcatca tctttctgaa ataatctcta
    13621 gtaatccgaa tttcaatccc gcacaggatc gtatttctat tggccctaat gttgccacaa
    13681 tcaatcttta tgaaatactt attgaaaaaa gctgcattcg acttgtagac gtacctggca
    13741 ttggtggcgt agttcatgac gacgattcac ttgctccgtt tgtcaacatg gctgactgca
    13801 taatgttgct tattcaagca ggtaacgaca ttatgaaaag tgatgaagat tttctgtacg
    13861 atcatgttgc cgcattttca aaaagagata cttctaatgc cgaattcaaa tctgaggagc
    13921 gcacagacaa gcgagtatta gtggctctca acaaatggaa aatggcttac ggagatctcc
    13981 cgccagccaa agcggataaa atttttgaac aaaaatccga atggatattg cacgcaaatg
    14041 gattaaaggc aaacgataaa ttttctggaa ttgctggtta ttttcataaa ccaccgatta
    14101 tcgcccgcgc tgaaacgagt tatagagatg atgaaacggg tgatcctttg cctgcttggt
    14161 ttggagaaaa cgcaaaaact gatctgagcg aagttataaa tgcactacat gaaatcttaa
    14221 aggatgatgg ctcagatttc cgattaaatc ggcctaggca ggttttgcaa aaagagagca
    14281 ataaactcat tggttatatt gctcaagaaa aagcggcaac ttctttagag gagttaggta
    14341 aagaactgga atctctcggt gtaaaatcta ctttcacaac aaatcagatt aacgaccaat
    14401 taattgaacg ccttaatcgt tttgagcaaa ccgttacttt ctttcttgct tcccgcatta
    14461 aaccagcaat tcattcttgg caaccaaaag ttggattttt tgatggatta actggaatat
    14521 tcaataagaa aggattacag gaatctttaa aaaaagaatg gagtaacgaa ttacgtaact
    14581 taatttcaag cagaattgat gttcaagaat ttgcaaactt gattaagcaa gaaaccgatg
    14641 cttttaaaaa gcttgttgag acaagctacc aaatcaactt tttgagcaac ccagacttac
    14701 taaaaaggat accaggttta caacaaagct cctcaggctc tagttcatcc gagaaagaag
    14761 gaatttttaa agcaatagag agggagcttg atgaagccgt caaaaagata cagatgggga
    14821 ttttagatga catcatcaat ctcgtatcgt gggatgcaat tttagcaata ctagttggcg
    14881 caattctctc tcctgtaggc tcgtttctct tgctcgcata tcgtcgttgg aagcgaggtg
    14941 aaagcaaagg acaagaggcg aaaagagaaa tcgattatgc ggtagataag attgctgctg
    15001 atgtgagttc agagataaag caaaaaatca tgcttcgact acaaaaagga gtagaagaca
    15061 tccatgtagc aatcagcaat gtattaaagc aagaaaaaga gactattaac gagccactta
    15121 tattaatgga tcaaattatt gctgatatac gtgagtttca gataaaactc caaagcatcg
    15181 gtatatgacc acctttttct aattagtgaa aaacaccagc ctaatatggc gctcaagccg
    15241 accgcttccg ctacgctcca gcggtcggct tagctctacg ttatctgcca aaatccctgt
    15301 gccaaagctc aggtattttg gcacaagtcc gctccccgaa aagttgacgg taatactcag
    15361 ttgaacgggc gggttcacga ggcgggaaat tgtgcttccg ccctgccgct tttggcataa
    15421 gggaccgtta tccgcaaaag tgggcaatga tgcataacac ccggtttcca agaataggcg
    15481 tcaagaatga cgtatattcc acgttaggct cttacaggag aaaatcatgt caattgataa
    15541 agtaatagaa attcttgata aacacagcga agtaatggag tcatatgtct tgttgagaga
    15601 aataaagtta tttctcaatg ttgaccacga gcattttcat cctgaaatta gaataaaaat
    15661 ttacgaaagc tctgctcttc gtgttcctta ccattttagc gtgagccatc atgttaaaac
    15721 gcctacacaa gcaggaccat atatgccatc aaaaacatgg gcagaatcag aagaagaggc
    15781 tatccgccaa gcaatatcta caacaacaag ttatattaaa tcggcaattg ccgcagggca
    15841 tgaaccatca gagtcttggt tgatacctga tgaggatttt taagtttttg ccagcttgga
    15901 ctcgaaaagg ttttttgaat agttgagccg aaaactcctg ctctccgtag taggcctaac
    15961 aaatcattca agtgggacgt ggattcaagg gcatttctcc gaacctgctt cggagcgccg
    16021 cgccccttaa ttcaatcgtt aggcttgcaa atcccatcaa catttttgct atctacaaaa
    16081 atgattaacg aaactgatgc tacctggggt gtgtttatct cttatagccg catggatcga
    16141 aatattgttg cgccaataac tgaccttatg cgcataacag gggccaaagt gtttcgagat
    16201 gaggactcta tactaccagg taagaaatgg aaaataataa tcactgaatc attgaactca
    16261 gcaagaacag tagtagtttt ttggtgtggg cattcagccc aatcagatgc cgtaaagttt
    16321 gaatataaaa cagccattga gcttaacaag gacgtagttc caatattatt ggatgaaaca
    16381 gtgctttctg atgaactacg agaatatcag tggattgatt ttaggtcttt tactacttta
    16441 agagaaaatc attgcaatgt cttgtctatt ggtgatgctg cctcagcagt aggtgcaggt
    16501 gcagttgccg gactatccgc agggaccgca gcaggaatcg gaatcgctgc cggtgctgct
    16561 gtagtaattg cagcagcacc ggtggtatta ccaattgcgc taataggtgg tttggttggt
    16621 gctggaatag ctttattgaa aaaagatagc aataaacaag caccccttga gcctagcatt
    16681 acttatccta agttaacaaa agatgaagaa gataaaatta tcgcggtgct tacaaaaagg
    16741 attttaagtt tcgcgtgaaa gctcgcataa gttgaactga gaaacacccc taatatttac
    16801 gaccaacaag ctggtaacga accgttccag cgcacccgca ccacgaagtg gcttcgtgtt
    16861 ttctagttcc gtggggtggc gcggggcgct gatcgtgggc gttagctgac aaaatacctg
    16921 ggtcagaaat caagattttt gacgcaagag gggcgttggg cagtggaaga tatgctatcg
    16981 tcctgtccaa ctctgggaga gtgggaacag tctggaagcc gatccgagtt tggcgcacac
    17041 tttcgacgat cggacagaat ggtttttctt gcaatccatt cgttgaacac ttgcccattc
    17101 catgggaaga ttcgactcgc ctagattccc gccattataa gaaatatact tggtttctac
    17161 atctatctaa cgttatatct tgtagacctc gtcacttacc attttaaaag ttaaaaaaat
    17221 aacaaattta tgggatcaca aaaagcctgg atagataatt tagataatcc aattgtatta
    17281 attggattta ttgtttttat attatctgga gtaattgtat caaagataaa aaacagtaaa
    17341 cagcaaacaa aagggtataa tagcccaata attaatagta atggaagtgt aaactattca
    17401 atagataaat caaaaaacaa caaaaattta tgagcttaga taaaaagaca gatggacata
    17461 atagccctat tattgatgca aaaaatgtta gtattaaaca aggcatatct cctgacctag
    17521 tagacaagtg gatgctattt ggtgaggaaa aatatcaaga attattaaaa aaatataaag
    17581 agctagagaa caagctagcg gataaaacag gtgataacgc tgaaaatgcc aaattaaaat
    17641 tgataagtgg tgatttatat ggtgcggaac agttacttaa aattttcaac gtcccaattc
    17701 cgcgtaattt attttttaca gggcgcagtg atattttaga aaagctacgt gaagctttac
    17761 aaaatgaaaa taaaattgcg ataacaccat caaaaagagc taccgcatta agtggtttag
    17821 gtggtgttgg taaaactcaa accgtcgctg agtatgcgta tcgctacaaa gatgaatact
    17881 ctgcggtgct atgggtttta gccgatggca aagatttatt actcaatagt ttcgcgcagc
    17941 tttctggatt gttaggtttt aaaggagaaa agcaaaatga ccaaattctt gctgtgcaat
    18001 cttggctacg caataataac ggttggctat taatttttga taatgccgaa acgttggact
    18061 tgctgaccgc agcaaaagag ctattaccga ccagtgcgga aggtcatgtt ctattcacca
    18121 ctcgtgccca agctacgggt ggtttagctt cagtcatagt ggattgtttt gataatgaca
    18181 caggcgcagt atttttattg cggcgatcaa aatgggtagc aattgattta acgacattgg
    18241 aaaaagtacg tcctagtgtg tcagataagg attggcaagt ggcaacggag ttagtgtatg
    18301 aattaggcgg tttggcattg gcgatagacc acgcaggtgc gtatattgag caaacagaat
    18361 gtggtttgga tggttattta aggcgttatc gtaataattc cgccatgatg ttgaaagatt
    18421 gtgattatgt gcaacgcgga aacgattatc caaattcagt ttatagaact ttcttattgg
    18481 cacttgaaaa agttaaaaag cgcagtttgt tggctaacga aatcttgcta gatagtgcat
    18541 tatttcatcc agatggcata tcagagaaat tatatactga ttataatttt acagagctag
    18601 ataaagcatt agctacacta aaagattatt cgctgattca gcgtgttcct gaaaagcact
    18661 tgtttacggt acatcgatta gtgcaagttg taattcggga tgtatgtgat ggatagggaa
    18721 acgacatggc gggaacgagc tgaaaaatta gttaaccgag taaatctagc ctttccaaat
    18781 cctgaatttg agaactggga tttatgtgaa gaattactat taagtgcgac tagtatttgt
    18841 gagcaaatcc agcatttttc tattaatata gaaattgcat caaaattact acatagggtg
    18901 gctttttacc ttaccgagaa gggtgaatac ataaagagcg agtcactata cttagaaagt
    18961 atagacataa aagaaaaaca gcactattat acagatattt cagtatcaat aagcaattta
    19021 gcaggacttt accttgctaa aggaaaatat aatttagttg aacctttgtt tcaaagaagc
    19081 ataatgcttg atgaaaaata tttaggagaa aatcattatt atactactcc aagtctactc
    19141 gggttggctg aactttatcg cactcaaggc aaatacgaaa aagctatgct cctcttacaa
    19201 aagagcctag caattattga aaactcatta ggtcaaaatc acccacaatt tgctcaatgt
    19261 ttaaacaatc aggcaggaat ttaccatgat caaggtaagt actcacaagc tgaagaattg
    19321 tataaacaaa gcattaaaat acgagaaaaa atttttaaag aaaatcaccc taaaattgca
    19381 gaaacattat acaacttagg ggttctatat cgagaaaaaa ataaatttaa acaagctgaa
    19441 tatttattag aaagaagctt tgtaattctt gaaaactcat taggaaaaac tcatccacgg
    19501 attggagggc ttttatataa tttagctgaa ctttatgatg tacaaggcaa atatgagcaa
    19561 gccgaaagtt catatcaaaa aagtttgtca attcttgaga aagctttagg taaagaccat
    19621 attgaggttg ctgtttgctt gcatggctta gcaatatttt tccaaatgca aaaggagcat
    19681 gaacaagcct taccattata tcaaagaagc ctgtcaatat tagagtcaac attaggagaa
    19741 aatcataaaa acacaaaacg agttagacta aattataaat tctttttaat aataagaaat
    19801 actaaaaata taacaaacca agcgatcaga ctggttaagt cttttctgta aaaaaatatc
    19861 tatttactaa caagctactt ttagaaaaat ccatccacgt tgtcaaatct acaaagtata
    19921 cagcgttttg taattgaaaa aatttatttt ttaaactgaa caaccaccag ctaaaagctg
    19981 gtgggttcgc gccgggcaca gaggactaaa agtccaccca cacgcgcccg gcgccaaatg
    20041 cgggagaaag acacgcgagc gttcccggac actctaggcg atccctgtcc cccaagacgc
    20101 gaggctgaaa gctgaccggc taaagccggt ggttttaacc ccgagcatgg aaataaatca
    20161 aggccaaaac tgggaatgga gcggcgagcc atcctcagaa gtcgctgttc ggcgtaagcc
    20221 cgccggtttc atagtccttg aaggcgaaat tcttagactt gacgaatttt tgggattccc
    20281 ggtcgaaaag ggcgtatccg atggctttgc gtttggcctc gaaaatggcc tcgttcgcct
    20341 cggcctcggt gtcgtattcc ttcgaccacc tggcttcctt ttccctttct tccctcctga
    20401 cgaatataac tacgaacttt ttcatagccg tatgttgaat ggttattgcc gtgcgccagc
    20461 cgtcggcctg gccgcgattt ccgaagcaaa gcttgctggc ccgacgaggt tatggaaatc
    20521 ccggtcgagg atggcgcaat ccgtcgcccc gccattctca aaactgtcgc ggatgtcggg
    20581 ccaggcttcg gcccaagtgg gatattcagc cgagaccacg gttttccttt ccccatcctc
    20641 cttgatgaac accacaagaa accttcttct tctcatatgt ctggtataat agttatatcg
    20701 tttcgagtat tgcacgggca ggatgaaatt ttcatcaaat atttctaaaa tatatatcaa
    20761 atccgccagc gtgtggcgtt tcggtatgaa taatcaccta tgggcaagaa taaaaaccgc
    20821 tctgtgaaag gctgtcccgg cctttcaagg aaggattatg agaaggccag gaagcgcggg
    20881 cttcggcggc tgaggcgggg cttttccccg gtcgtcggaa aggacaacct acgagaagcg
    20941 gtaaaggcta gcctcggggc cgtttgacgg tttcctctgg ctgggatata ccgaccgata
    21001 gcggcgcggc aagccttgcg aacgacccaa tgatgaaaac cgccaccagg gcggtttttt
    21061 ctttcctgtc tttcttattt tgtgcaatac aaaaacggct ccccgcgccc aaacggggac
    21121 ggacgctcgg gatgttcact cgaacaggtc ggcgtgggtt ccggccagga aaagaaaagc
    21181 ccgtgggccg cattggacgc acgggcgttg agcggatcag tactcgtccg gcaaaaggaa
    21241 cgtcgtcacg ctcctatccc attcagtgat gatccacagg cagttgttgc cgtagcaggg
    21301 cttccccgga tcgatgggat aggccgagag gatgcggctg ccgtgttcaa gcgccgcgtc
    21361 gttgctctgg gcgtcctcgg ggcagacgtg gccccaatcg ccgcccaggt ggcgagttaa
    21421 gcactgaaaa aggtattcgt ccgtactggc gtctacggct cccggcgtgg cgacaacctc
    21481 accgggatgg aataggggtg gcttcgggag gctgtccggc tcccggtcgg tttcgatttc
    21541 gataggcata ctcataccat tttgctagtg gttatataag tggcttttaa atcaattcaa
    21601 ttaccacagt agcacgcctg ttttttctgt caaaactgag agattaattt atatatgaac
    21661 acgcctacat accaaagtat cagcgacgag gataagcctc cattgagtga gttgacggct
    21721 aatggcgtac cagtggaaga gttattccga gaggtattgg aggaatcggc tttcacggtc
    21781 gtcgttttgg acgaagggaa tgcgtcggtc agggcaggga aagcgaagcg ctggcgcaaa
    21841 aggaagacgg atacgagcca tataaggaaa acgcacggga tacaggagta aggcaagcct
    21901 gcttttcctg tcaaaagaga cgctgccagt ccttcccgaa ttccttaatg cggggtatgt
    21961 ctcggtgagg acgggcgcgt ttacccctcg ccgtcttttt cgaggtcatc aaagagttcc
    22021 tgggccgtgg cgaatttcgg gaggacgtcc gaacgggcct cttccatcgc cgcctgagtg
    22081 acagcgttgg gcgcttcggc ggggccgagc aaggtttttt ccgccgtggc gagaggcagg
    22141 aagagcgtct tcggctggtt ggcgaaggct tggaagccgt ggtggcgata gaaagccgcc
    22201 gcccgttcgt tcttggcgtc aaccaacaag gcgaaagcgg cgggagcggc gctcagggat
    22261 ttcaaggcgg cgtcggccaa gagggacgct cccaggccgc gcccctgaaa acgatgatcg
    22321 acagcaagcc gaccgatgcg gacggcgggc atggtcgggt agcgcggcaa gcgcctggct
    22381 tcttcggggg gaaggtcggc gatcgggatg ctggccgaag cgagggtgta gtaacccgcc
    22441 acttggcgcg tttcggcttc gacggccacg aagcaattgg cgacacggcg gcggatgtcc
    22501 tgggtaacct gggttcggaa ataccggtcc agcgccgcct ccccgctggc gaacgtcgcc
    22561 cggtcaatct gcccgccgag cggttcgatg cggaacggcg cggtcactcg ccgccaaaca
    22621 gttcgtggtg cctcgcgaag gcgcggcgga gcgccggggt cggctcgggc gggttaagga
    22681 tggcctcgac gaaacggcgc tggtcctcga ccgagaggcg gatgatttcc gtttcctcga
    22741 tggtccggcg ggccgcgtca tgggcggcgg acaccacgaa atcgctgacg cttcggcctt
    22801 ggatttcggc ggcacgcttc accacgttga gcatgtccgg cgcgatgcgg gcctcaaggc
    22861 gggcggtgcg ctgtgtgggc tgggtcatgg gagcctctgt tttccctagg ttgacttcca
    22921 ttgtacgaca taaatccgta catcgcgtga tgtggcgggc ggcgtcatga atcctggccg
    22981 ctccgcccgg acggcctttc cgcctgcggg aaagcgggtg tatattctga cagccgtatc
    23041 tcggaaggga cggcttagct ttttcctttg cggctctcct gtcgatgttc ggccaggatg
    23101 cgggatatgg tcgcctcgga gaccttgaag gaccgggccg cgtccgccgc cttctgttcg
    23161 ccggagtcca ccaacctgac gatgagcgcc cgctgtgcgg gggtgagctt gtggcggcgt
    23221 ccgcccttcc gcccttggga ctgggcgtat tcgagaccct gccgggtccg ctcccggatc
    23281 atggcccgct cgaactcggc gaagctaccg agcatctggg tcagcatccg cccggcgggg
    23341 gaacgggtct ctatatgctc cgtcaggctc tcgaaggtcg ccccagcccc ctcgatccgt
    23401 tccaggaggg caataaggtc tttcaatgac cggctgaggc ggtcgagctt ccagacaacg
    23461 aggatgtcgc cgggacgcaa atgatcgagg aggcggtgaa gttcgggccg gtcccagcgt
    23521 ccgccggacg cttcctcggt gtagacgcgc tcgcaacccg cggccttgag cgcttcgacc
    23581 tgggcttgta cttcctggga gtcgccgcgg gagacgcggg catagccgat acgcataaaa
    23641 ttctttcata aaccgcttac attactcctt cattttgcaa gaggtttgtg aaagcgtcaa
    23701 acccgcatgg ctgctagggt ggggaaatcc tttcacaaat ggccgtttgt gaaataaatt
    23761 tccaatacca atacctatcg aacggcaaag cacttatatc ctctcggcct atctcatcga
    23821 cccggctaag ctctgcgctg gtgttctaac ctttagaatt tggtatttat ccagcaatag
    23881 caatgattcg agattctgga tggcaatata cgcccaaggt aagggcatca tatgtattaa
    23941 aaaacgtttc aaatatgaaa cgatgctgac ttccattatc atcatcaaga attaactcgg
    24001 cttttcctag cgagccaccc cgttgacttc cgcaatatcc actaacagaa tcaaataatt
    24061 ccgtttccga taacttagag aaacgttttg caaaagctgg agactgtata aaatgtctac
    24121 aaggtttgtc gtagtcaaaa gtctctgggc gacgcattat atgtggatga tctgtaatta
    24181 ggcccactat tggtaactca actccaaccg tttctataaa acggtagagt gtagtggaaa
    24241 tcgtgttgcc aaaaatatta tgaaggcgat taatagaatt aattgttggt tctacagaac
    24301 acgcttccat taagaagcgg tcacggagga ataataactg ccctgctgcg tagtttgcct
    24361 ccgcttcgat atgttcatgg caattatggg aaagggtaat tatattatca cctagcatca
    24421 tctcatcatg ccacggaatt aagctatggc ctatctcatg agcttcgttc cagcggtgct
    24481 ttttctcagg taggctggcg tcgagaagta tccgcttcct atcagggatg taaagcgctt
    24541 tcaaagaaaa tttttgaatt gcctcgataa ggagggtggg acgctggtaa acctgaatag
    24601 tcgcgatacg aattcgacta attgtttcct ggatgacact aggatcgtca gccttataaa
    24661 aagcccggtc gagtttgaga agttccctga cgtcttctaa acgcaacggg ggctcaggat
    24721 taccgagccc ccgcaaaacg cgatcaatgc gattattgat atcctgagca gtttttgcgg
    24781 tcagcagcag atttttcgcc acggatatac caattcctca tggtttttgt tcgctaagca
    24841 ccgccacaaa ggtctcaagc gcagcacgtt cttccggtga aagtgcggca accggttcag
    24901 agcgtgcggc aaatcgaaat gcctcttcaa tgattcggct gtctttcggc acagtcaacc
    24961 cagcgacctg taaaagttta ccacgaggaa cctgaaagta attcgcaagt tggtaaaccg
    25021 tgcgaggctg tggcttgtag cgtgtatcat cctcgatttc caccagctcg gcaatatcaa
    25081 catcggcgtc ttccgctaac ttttcgactg tcaatccatg atttcgtcgc atcaaccgaa
    25141 caaatcgact aaacgcaatg gtaggttctt ctaaattctc cattggagat ggagtttcac
    25201 tatcaaaaat ggaattcagc gcgtagcggc ctacaccgat atcagagtca gcctcaagct
    25261 gcgccatcct caaacaccat tctcttgtaa catctatttt cataattggt tccctttctc
    25321 aatgaaggca accgcctgtt caggcgtcat ttcaaaatat cgcaaaccat agtagccagc
    25381 atcaacaccc aaatctgtca tattacaggt atcagcataa aattcatcag cttgcggtaa
    25441 agaatgcaga ccaatccggc ccttaaagct ttcattcttg ctgagttcga tggccgctct
    25501 tataagtata gagcctactc cacgataccg tggtggatcg aatagctctt ttctattcca
    25561 aggcgcgttt tcgaggtatt caatataaac gatatgtttg tttttttggg actcaatacg
    25621 acagcgtttt tttgccgtat caacaatcat catcccttgg gtcaaaccac ctccgacaac
    25681 actaaaaccc tggcaggcta acagcccctg caagtgatct gcttttttgt cacgccaatt
    25741 ccaatggcgg gattgaggcc aggatcgtcg atcaacaccc gcccgtttca gcctttgtat
    25801 agacttggat agttctggac cccattcccc ctcccagtca gagatttgct gctcagtaat
    25861 agcatcccat aattcagctt cttcaggttc tctcttctca acattaaaga gataaatcgg
    25921 actaacggtg gcagtcatag catcattacc tcggtctttt ctttggaccc gtcatcctcg
    25981 aaaaataatt tatccccctt ctctatgcga gcttcaacca tttgataaag gcgtaatgct
    26041 tggcgcaaga ccgcagtttt actaaggtct tttttcacgc acatctcctc caatgcccgc
    26101 atttcggcat ctgtcaggtt gagcgtcatc gttttctttg tggcggtcat acgaactcct
    26161 cccagcggac attaatcata tagccgatgt caacggtgtc aagttgtttt ttagcttaaa
    26221 aatagctatt gactagctaa aaagtagcta cttataattg ccgcacagcc ggacagtccg
    26281 gcgactactt gacggtgaaa atcatgacag acgtaagaaa cgcaactttt gaagatgttc
    26341 aggaagcagc tctggctggg tgttcaatac accagcatga cctgcatgag gtgctgatag
    26401 gaaacgaaaa gctggaattc cactcggcag taatcgacga tcctgtccca accggcgcac
    26461 aaatcctgga ggtggcccac gcccggccag cggatgagca tctggtcttc caggttctca
    26521 acagcgggct tctggaagaa ctgcgccccg acgaaacgac agacctgcgg accaaaggcg
    26581 tcgaaaaatt cctcgtcttt cgtaacgacc gctcgttccg cttcgagttg gacgggcgca
    26641 tgtttgaatg gggcggaaac ttgatctcgg ggttgacgct aaaaaagctc gccggggttg
    26701 acccgaaaga ctacggggtc tggctggaag tgcgcggcgc tggcgaggat cgccccattg
    26761 ccgacaagga tttggtggac ctgtccgctc cgggaaccga gcggttcttt accgggatcg
    26821 tccagacgac cgaaggactg gggacgcccg tgcttcctgc aaagtgccgc cgctatctga
    26881 cggatcgcgg catgaaattc gaggaagtag gagagggcgg acaacacgcc gtcatcctgc
    26941 gcggcttcgc gctgcctatt ggccgcttcg acgctggaac ggctgacatc ctcatctacc
    27001 tgccaggcgg gtatcccgac aatccgccgg acatgtttta ttgccagccc tggttgaagc
    27061 tggtcccggc gaaccgttat ccgcgagccg ccgatcagcc gctcgtattc aggggccagc
    27121 cctggcagcg ctggtcccgc cacaacacga cctggcgacc gggcgtggat ggaatctgga
    27181 cgatggtgaa gcgggtcgaa aacgcgcttc tggaggcagc ctcatgacat gcatcgacct
    27241 gaccttccag gaaaaccatc ttcaaaccct gcgcggcctc gtgttgcgcg aggacggcgt
    27301 agaggctgcg gcctatatcc tgtgcggcga aagccggata gagagcgatc catgggagcg
    27361 ccgcgccagg cggcgcttgt cctcttacga agtggtgccc atcccgccgg aagatgctgt
    27421 ctcggccagc gaccggcata tcacctggaa tacggcgtcc ttcgtgcgcc tgctcaagcg
    27481 ggcgaaagaa gagggtttgg tcgctggcat cgttcacgcc catcctggcg gaccgccccg
    27541 tttctccgac caggacgacc gcaacgagcg cgaactcgtc cgcctagcgc tgaaccgcaa
    27601 tggcgacggg gcctctctcg tcagcgtgct gctgaccggc gcgggcgaag tccgcgcccg
    27661 gctgtggccg gacttgcacg caccgctgga tgccgaaagc atccgggcga ttggccaaaa
    27721 gctggctttt tatgatccgg cactaccgat gcgcggagat gacgtgttcg ccaggcaggc
    27781 actggctttc gggccggaac tgaacgcccg cctcaaaggt atgcgaatcg gcatcgtagg
    27841 ttgcggcggc accgggagcg ccactgcctt gctgctggcc cggctcggag ccggacagct
    27901 tgtgctgttc gatgacgata tcgttgaaac taccaatctc aaccggctgc acggagcgcg
    27961 gcgggcggat gccgattcga tgcgccctaa ggtcgatgtc gtggcacgcg agatcgcgga
    28021 aatggggatc gggacgcggg tcgtaccgat gcgcggatgg ataggcaatc cggccttccg
    28081 cgacgcgctc aagtcctgcg acgtgatttt cggctgcacc gacgaccatg atggccgtct
    28141 gctgctgaac cggatggcct atttctacct gatcccggtg ctggatatgg gcctggcgat
    28201 tgagccgcag cctgggggcg aaggaatgcg ggagctgagc ggtcgtgtca cggtactgac
    28261 tccgggtgcc ccctgcctcc tgtgtcggca tatcgtggac ccggtggcgg cgcgggacga
    28321 ggacttgaag cggcacaacc cagaggagca tgagcgccgc aaacgggaag cctacgttcg
    28381 cggggcgggg aatccggccc cggccgtggt gacctttacc acggccacgg cctgcctggc
    28441 tgtggatgag ttgatccagg ggctgaccgg attccgggga ccggaaggct gggtctggca
    28501 acggacccgc cggttcgacc tgatgcaaga tcgaaggccg ggcgcgatcc aggagccttg
    28561 ttgtccgatc tgctcggaaa ccggctattg gggccgggcc gatgtccaac cgttccttga
    28621 ccgtgcgggg tgaagacatg tggatcgaat ggctccggtg gctgctagtc agcgtagggg
    28681 caatacggcg tcccgatctg gtcggacgcc ttatggatcg ccaccccaag ccggatgaat
    28741 tgccgcccgg cttgctggtg gtcgtgaagg acggtggcta tctgaaatgg gcctgtttcc
    28801 gctgtccggg tggctgcggt gagaaactgc aactttcgct gaacccatcc agacggcccc
    28861 gctggacggt cgggctggat tggttgcgac gcccgaccct gaccccatcg gtccaccagt
    28921 tcaacgcctg ccgctgccac ttcgtcctca agaacgggat cgtcaactgg tgccgggata
    28981 gcgggaggcg aggagcctga ttatcgaaac ttggtttatt ggttgcctca aatcctgctt
    29041 tttttaaaac tgccaatagc ccatttacca aaaacagcaa tcaacactac ctaaggagcc
    29101 aaaaatggca aaaaacacgg gcgatggtta tcgcaaaggt tcagtaacgg atagaaccca
    29161 aacccataat cccaaaacgg attcctgggt aaaacgtaac gcgactacgg ggaaattcat
    29221 ggatcagaaa tcggatggaa ccccgtttaa aggggtggcc aaggagaaag atggtcgccg
    29281 aaattagcta gcaagacttt aatcctaaag ctacaacctc tttgtagctt agaataagcg
    29341 ccgcttgaag cggcgttttt tatcactata aatcagccat taaaattcca accaatatgc
    29401 gccatatatg accaatttga attggtattt gacaagctgg acgtatactg ccatatttgt
    29461 attgtacaat acaataaggt ggaaatatga aaccgacaca ggaaacctac acggccttgc
    29521 aatccgccta tgagttcttt aaccgggaat tattcggcgg ggctttgccg gaatgcctta
    29581 tcaccctcac ccgcaaggaa aagcgcgtgt acgggtattt ttgggggcaa cgcttcgagg
    29641 aaatcggggg aacgcaaaaa accgatgaaa tcgccatgaa cccccaacac ttcaagagcc
    29701 gatccgtcgc acaggcgctt tcgacgctgg tacatgagat gtgccatcag tggcaagcgc
    29761 accacggcac gccttcccgt tcggcttacc ataaccgcga atgggcggac aaaatggaaa
    29821 gcctcggcct gatgccttcg gacacggggc aaccgggcgg gaagagaacc ggccagaagg
    29881 taagccatta catcatccct ggcggcttgt ttgagcgggt gtgtgcggtg atcctctcgg
    29941 acggcttcaa gctggcctgg ggggagatcg tggctgaagt cgaaggcgac gaaggaagcg
    30001 gcaagggcag gaccacgcgg gccaagttca cttgcccgga ttgcagggcg aacgcctggg
    30061 gcaaaccgga tttaaacctt gtttgcgggg attgcatggt gccgatggtg gcggaataag
    30121 tcttgatcgg aaagaaactc cttccggcgt atctatgccc gtgttctaca tgcacgggca
    30181 ttttcttttt atggctccaa atatattttt gtaacccgcc agggttgcga aaaatatgtt
    30241 tggacacgcg gcggctaccg tggccgattg gagcgccgaa cctctcccgc cgcgtaattg
    30301 ctccgggcgt ataatttgac ggaaaaggat atagttgcta tcaatgaggt atgtctactt
    30361 ttgtagatga aatggcgaac agaatataac acttcccgtc cgttagaccg gttgcatagt
    30421 gtgaaaggtc gccgaaaagg cggacttgtc gggcgacaat atgccgtgtg agaaaaccgc
    30481 ttcggcggtt ttctttttga ttgcctcaag aagaagccaa agcgcccgct ccgttttaat
    30541 atctttggtt ttcaggtata caaccaatgt ggttctttta actggttttg cccttcgttt
    30601 ccagcgttgc taaaccatag tatttcgctg gttttaaaac attggaattc ggaggttaaa
    30661 accatggata aagaaacgga aaaaggcgcg gactggctgg atttcaagga aatcaaggcc
    30721 agggcggagg tgaggccggt actcgggcac ttcgggatac tggaacacct ggaagagcgc
    30781 gggccggaac tggtcggatg gtgcccactg ggcagggaac acgggaagca ggacagcttc
    30841 tcgttcaatg tcgagaagcg ctccttccag tgcttcgcct gcaaggctcg cgggtcggtc
    30901 ctggatttcg tcgccaagta cggggacata tccctgaggg acgcggcgaa gacggtcatg
    30961 gggatactcg acgaggagcc ggaaagcgcc gaagcggaac ccgaaggcag gccctacggg
    31021 aaggcgggcc gggggatgcg gaaacccgct gccaggaggc cgggagtgcg gcgcggatcg
    31081 aagcgggaac gaccgaatga accgaacagg gagacgggcg gtctgccgtt cttcacctgg
    31141 tcccacgcgg aatccctggt acgggagagt atgctggacc cggcacggct ggtggtcata
    31201 gacgccgacg ccctggaaac cttcctcaag gtgacagccc ggccttccga agaaacggcg
    31261 tagggaaaag ccggaagcgg ccaagggcca gacaagcccc gtcctctgaa atggaggcgg
    31321 ggctttttat gtggatcgcg gcgcggaatg aaaaaccgcc ctttcgggcg gtttccctgt
    31381 ccaccgacgc acgcggcgag acgcgccggc tgcgtctatc gttgaccgct gcgcccggca
    31441 accggaacgc cgtacccatg ctcatggagg ccgtgtgtgt ggccgtgggt tgggcgggag
    31501 gtggactcat ccaaatacat cggcaaaatg gcaagactgt catggcgaaa accgaatgat
    31561 cagcataacc catattcaaa gccatttatt accgataaat atcccgctta attaataatt
    31621 atcgggtcgg aaacaatctt ctctactggc agggttttcc tttctttcga tttcccgctt
    31681 aaaaacgaaa tgttgaccgg tatgtaggca atgttgctta ctacgctttt actttccata
    31741 tccatctcat ttatggggat aaacacgtta gtaatcgcca gcgggattat gacgccgctg
    31801 ccggaaccca tatcgcccag agccacctgc tccttcttgg ttacgctgaa cggccctcgt
    31861 aaggcgtcgt cctcgggatg gatgcccatg aaggacgcat cgtagagttc ccttacttcc
    31921 tttaactcca cgcgctccat atccaccgca acgtttcccg cctggccctt gccgttctgc
    31981 tttaggataa ggcataccac ccaaacattc ggggacttgt acttcttgtg cttgaacgct
    32041 tttatgaacc catgtagaaa ataatccgtc gtcctcatct ttccataatc gggcctgatg
    32101 gctggatcgt ctttttcgat acggaaagcc acatcgtttt tatgcaccgg gtattgcaga
    32161 agggaagccg agggcaagct ttggcttgcc tcgccgccgg atgcgatggc ttggtaaagc
    32221 tccaacctga tgtctatcag cgtggcttca aagctgggct ccccaaggtt acgcgcctgg
    32281 ttgtacgagg ataacgaact ccttagtgat tccagcgcct gtgaggatgg gagcttttta
    32341 tcggttcccg gcgacgggta aaacacgctg gtcaggattc cgaccgccaa caggccaatc
    32401 ccgacggcta ggatgattct ggaaaggttg gttttatccg cctcggcctg gcttgcttca
    32461 tgtataccgg caggtttatc gatatttcca ttcgtatcgt tttggtgttc gtcatgcatg
    32521 tcagcaccat agccatattg cggacgagcg ggctcgcatc ttatcccctt tccagaagcc
    32581 cgctctccaa acggacagga tcacgcatct gccggatatt ttccgatttg accgagccgt
    32641 ccaaagggtc tgaaaaaccc aaggtttttg gcaagaaaac agccttggat gccacatccc
    32701 actctttgcc ttgggactcg taaggatata tcgtcacgaa taatgggata agaacgcctt
    32761 ggttggtttc aatcgggtat gggatgctta tttccgattg gctataagct tctgcttttt
    32821 ctttaatttg acggatatag tcgccggtag ccttgccttt ttcttcgtta actcgaactg
    32881 ttctggatag ggccaggcgc tcaaatgtta ctttgacatc ctttgcatct cttttcccct
    32941 tgttctttag cactaaaaat gttacgcgct gctcgccgtc accgtctgga ctggtggatg
    33001 gattcaacga aaccggcttg atagctatat tctcgtcaac cacctcgttt ggaatcacgg
    33061 gatagttcaa aaacaagttc tgtttacggt cctgtctttt tttcgagtcc gacaggctta
    33121 tgaacaaatc gttggaaagc tcggcatact ctatgtctat ttgcggcgct gattcccttg
    33181 cggaatccct cagcttttgc agttcaagct ttgtcttctc gtcaccgtct ttcagctcta
    33241 gcgatttacc gtaaagggtc gaaaccgtaa gaaagattcc aaggatgctc gctatcaggc
    33301 ccaagactgt attaaggcga tcagcggtgg acgggggttt cttttttcct ttaggcggca
    33361 tggctggccc cattcgtcga aaaagttatc gcaaagctat cacacgggtt gattgttata
    33421 aattcctagc tcacgtagaa gtccagatcg tccttgggcc gtatgtgccc gtcctcgccc
    33481 ctcagcggct cctggggcgg gggcttcggc ccgctcctgg gagttttggg gctgtaccgc
    33541 ctcggcctgg ccgtggtccc ggtcggctcc ggcccggctt ccgttgccgg tcgtgcttgg
    33601 gattccgcct ccgtccctat gttcacgtcc actgtcgccc cgtccccgcc tgacgcctcc
    33661 tcgggcctct cgggcggcgg cagttccggc ctccgggcca ccctggcgcg gttgtcctcg
    33721 atcagccggg cgtgggcctc ggcgtccatc cggggcaggc gctccatggc cccgagcggc
    33781 acggccagcc gcaccggctg cggggtgtgg tggcggacgt agcaggcgaa ctcggtatgg
    33841 ccctgccgct cgcgcttgcg catcgattgg acgaactcgg cggagcagtt catctcctgg
    33901 gccagcgcca gggcgtcggc gtggttgacg ccgccgacca gcttgacgct cgtgctggcc
    33961 ttgagggtgg cccgcagttc ggtgtcgagc tggttgaggt gctggtgggc cagggtcaca
    34021 cccacccgga acttgcggcc ctggttgagg agttcatcgg tcttgcggtc gaagtactcc
    34081 tgggcctcgt cgatgtagac gtggtacggc gtgcgctccc gctccggcac ggcggcgcgg
    34141 gccagggtgg cctggacgat gagggcgacg aagaaccgcc ccaggatcga ggagccttcg
    34201 ctcttgagga ggtccttggc ggtgttcacc accacgacct ggcccgcctg catggccccg
    34261 aacatgtcca cgttgttctt gggatgggcg aacatccgct cgaacgcggg gttgcccagc
    34321 acgcccagga gccgggtcac gatctgctgg cgggtctggg agtaggcgtt ggtgaagaac
    34381 tgggtctcga agaaccggcg ggggatgccg tccagcttct cgatgtacgg tttgaatttg
    34441 gtcccgtcct ccacgaagtc gtagaaggtg tagatggtcg ggtcgggcat caccagcatg
    34501 gcccgcgcca ggttggtgaa caccacgccc tgcttctggg tcagttccgc gcccaggagc
    34561 gaggagaaga tgtaggcgta cagttccagg acgccgtgga atatcttctc ccgctcgacc
    34621 tcggagaagc cctggaagcg gtccaggtcg taatcgaaca ggttcagccc ggcggggtgc
    34681 ttgaggtcgt tggggtcgat gatcgtcagc cgcccggcca gttcgccgcc ctcggggtcg
    34741 aacagggaga gccgggtgag ccgggcgatg aggtcgccct ggctgtcgat gagcgcgaag
    34801 ccgaagcgct cccgccgcgc ccggtccagg tcggccagga tcaggtgttg cagggtctgg
    34861 gtcttgccgt ggccgctccc ggccacgacg tgggtatgct cgaagcgggc ggactgcggg
    34921 atggaaaacg gcagggaggc cgcgaaggcg gggaggaacg gcgtgccctt gaggtaggtt
    34981 tccagggtct cggcggggtc gagcttcttc ttcctggcgt attccctcgg cgtcagttca
    35041 tcggacacgg cgtcgaggtt gtccatcagc cggtcgcgca gcccccggaa cagggacgta
    35101 tggcggatgg cgtcgtccag ggtccgcccg acgatcccct cgacgagggc gggcgcgtcc
    35161 tcgacgcacg acaggagcgg cacccggaac gcgccctggc cgcgctcgga cggcggggcc
    35221 t
//