LOCUS       AP019787               37217 bp    DNA     circular BCT 02-JUN-2021
DEFINITION  Methylomagnum ishizawai RS11D-Pr plasmid pRS11DPr4 DNA, complete
            genome.
ACCESSION   AP019787
VERSION     AP019787.1
DBLINK      BioProject:PRJDB8374
            Sequence Read Archive:DRR180485, DRR180486
            BioSample:SAMD00172935
KEYWORDS    .
SOURCE      Methylomagnum ishizawai
  ORGANISM  Methylomagnum ishizawai
            Bacteria; Proteobacteria; Gammaproteobacteria; Methylococcales;
            Methylococcaceae; Methylomagnum.
REFERENCE   1  (bases 1 to 37217)
  AUTHORS   Asakawa,S. and Watanabe,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-2019) to the DDBJ/EMBL/GenBank databases.
            Contact:Susumu Asakawa
            Nagoya University, Graduate School of Bioagricultural Sciences;
            Chikusa, Furocho 1, Nagoya, Aichi 464-8601, Japan
            URL    :https://www.agr.nagoya-u.ac.jp/%7Esoil/
            Soil_Biology_and_Chemistry/toppupeji.html
REFERENCE   2
  AUTHORS   Asakawa,S., Khalifa,A., Lee,C.G., Ogiso,T., Ueno,C. and Dianou,D.
  TITLE     Complete genome sequence of Methylomagnum ishizawai strain RS11D-Pr
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.7
            Genome Coverage       :: 725x
            Sequencing Technology :: Illumina NextSeq, GridION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..37217
                     /collection_date="2003-08-11"
                     /country="Japan:Aichi, Anjo, Aichi Agricultural Research
                     Center"
                     /culture_collection="JCM:18894"
                     /db_xref="taxon:1760988"
                     /isolation_source="rice rhizosphere"
                     /lat_lon="34.97 N 137.07 E"
                     /mol_type="genomic DNA"
                     /organism="Methylomagnum ishizawai"
                     /plasmid="pRS11DPr4"
                     /strain="RS11D-Pr"
                     /type_material="type strain of Methylomagnum ishizawai"
     CDS             complement(457..861)
                     /codon_start=1
                     /gene="vapC_4"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q3IUZ4"
                     /locus_tag="MishRS11D_45310"
                     /product="ribonuclease VapC"
                     /protein_id="BBL77433.1"
                     /transl_table=11
                     /translation="MPGDASFLDTNVVLYGLSTDLWRKERVADRLSDGGVLSTQVLAE
                     SANVMRRKFGRSVAEIEAFHDILLDTCRVRVIESATIRRALGVAERYGFSIYDSLIVA
                     TAMEAGCRTLYSEDMQHGQVIDHRLTIVNPFI"
     CDS             complement(851..1168)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45320"
                     /product="hypothetical protein"
                     /protein_id="BBL77434.1"
                     /transl_table=11
                     /translation="MNTTTRKSGSERQRELREKRFAKGLCRPEVWVYPTDIEKLRAAY
                     PGPRNGVDWQAVIKIALEQAGEQPQLDIKATERKAALLDRLSGFQVEMSGFKFDREEA
                     NAR"
     CDS             complement(1169..1297)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45330"
                     /product="hypothetical protein"
                     /protein_id="BBL77435.1"
                     /transl_table=11
                     /translation="MMAKTIDFQAVKESLAALDRIAAEHPELLGESSQEEWEKTLS"
     CDS             complement(1294..1872)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45340"
                     /product="hypothetical protein"
                     /protein_id="BBL77436.1"
                     /transl_table=11
                     /translation="MKAYAYIRVSTEEQATDGVSLDAQKAKVAAWADLNGYELAGVFM
                     DAGISGTKADRPGLAAALSAVGKGDALVVYSLSRLSRSTKHTIEISERLDKAGADLVS
                     ISEKIDTTTAMQHKKAKGERVGAVPYGKALAGDGVALVDVPAEQEIIAEARRLHTAGL
                     SLRKIAAVLAEKGFKARNGKVFAATQIQRMVA"
     CDS             complement(2124..2876)
                     /codon_start=1
                     /gene="aqpZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KHU2"
                     /locus_tag="MishRS11D_45350"
                     /product="aquaporin Z"
                     /protein_id="BBL77437.1"
                     /transl_table=11
                     /translation="MWSIYRRTAAEFIGTFWLVLGGCGSAVLAATVPDVGIGLLGVAL
                     AFGLTVLTMAYAVGHISGGHFNPAVSLGLWAGGRIPGSDLAPYIAAQVLGAVFAAGML
                     YLIASGKPGFDPSAGFAANGYGPHSPGGYSLGAGFLTEAVMTFMFLLIILGVTDSRAP
                     QGFAPLAIGLGLTLIHLVSIPVTNTSVNPARSTGVALFAGTWAMAQLWLFWVAPMIGA
                     VLAGWVHRSLAVAIHREDWQAAAPIRGPQTLP"
     CDS             2875..3060
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45360"
                     /product="hypothetical protein"
                     /protein_id="BBL77438.1"
                     /transl_table=11
                     /translation="MIKPSMVSKSPVRLAGGWRDNILLSKAGRTERIPSAPAKATTLA
                     KFRPSALEPSTAPLPTA"
     CDS             complement(3108..3353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45370"
                     /product="hypothetical protein"
                     /protein_id="BBL77439.1"
                     /transl_table=11
                     /translation="MAKKNAELTPGLVAVKGKATPDTASRAPEPTPTGPASAPLNFKV
                     SPQFRRRFRERAASADLKLNELLREALDAWEEKKGLR"
     CDS             complement(3364..4005)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011083586.1"
                     /locus_tag="MishRS11D_45380"
                     /product="chromosome partitioning protein ParA"
                     /protein_id="BBL77440.1"
                     /transl_table=11
                     /translation="MKTIVLASQKGGAGKTTLAAHLAVAAERDGAGPCVLLDTDPQAS
                     LSAWWNGREAETPAFAPTTLKELPAKLEALAQAGYAYAIIDTPPAIAESIRAVVALAD
                     LVLIPTRPSPHDLRAVGRTVELATDANRPFVFAVPQAKPNTKLTVQAVAALSEHGVVA
                     PAIVHDRVDYAASMIDGRTVLETDPRGRSARETVDLWRFVKARLGYSKKARKE"
     CDS             complement(4192..4701)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45390"
                     /product="hypothetical protein"
                     /protein_id="BBL77441.1"
                     /transl_table=11
                     /translation="MLLIVDANVLIDYAKTEAGILALCVRHLGPIHVPSVVLDEVEQL
                     DAAGCRRLGLTLIDEPLEILDEASQKSGALSFQDHVCLALAKANGWVCVSNDKPLHRA
                     CEREGVRTLWGLRLMIELAACGALGAEQAKAIALDIHTLNPKHITPAIIDRFDAEIDR
                     ATSRNTTYP"
     CDS             complement(4712..5848)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45400"
                     /product="hypothetical protein"
                     /protein_id="BBL77442.1"
                     /transl_table=11
                     /translation="MPIQTLGTHLIRHRKDRNLSQEKLAAKAGLSRGAYRNLEQGRAQ
                     PRAETLKSLASALDVPLRDLLNPAAPLRKVRFRSLKRLKSRGQVLADVGRWLRDFSDL
                     ERLTGDLSAPKLQTLADRIGEDRAPATVAGLARAHFGLTEREPVHDLCGLLEAQGIKV
                     YSVVVANDAFMGLSVADEEGGPAVIVNTWERLPVEAWIFSAAHELGHLLLHLGAYDVD
                     QEQEDETQEREADQFASHFLMPEELFRREWRETAGLALLDRVLKVKRVFRVGWRTVLY
                     RVAQGLPEDRRRPVWQRINEEYKARHKGRPLLKHDEPFGITRDHYRACGEPEGLGQHD
                     FQGDRLYRLVRQAVEAEIITLSRAAEILRLPLADMRDLSLSWLA"
     CDS             6115..6453
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45410"
                     /product="hypothetical protein"
                     /protein_id="BBL77443.1"
                     /transl_table=11
                     /translation="MVYFAHSKNKAGQRHLLTEHLRSVSELAGGFAEASGHAEEARLA
                     GLLHDLGKYGDLFQRRLEGKEHGLDHWSMGAWLALSQHKAVAAALAIQGHHIILSKPP
                     PLTAIHSTLP"
     CDS             complement(6401..7117)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002681373.1"
                     /locus_tag="MishRS11D_45420"
                     /product="metal-dependent hydrolase"
                     /protein_id="BBL77444.1"
                     /transl_table=11
                     /translation="MTETIQLGDIFIAVTRKAVKNVHLSVHPPEGRVTLVAPSGTRLE
                     VARAYAISKLGWIREQQTKLKNQARETPRQFIERESHYLWGRRHLLAISERECKPFVS
                     LDHKRITLIVRPGSDREKRAEIIHEWHKSLLHAVIPALISQWESKLKVKVAGYFLQRM
                     KTKWGSCNHAKGHIRLNTELVKKPKDLLEYVVVHEMVHLIEPTHSDRFIAILGEHYPT
                     WREARVELNELPLAAEVWKE"
     CDS             complement(7114..10218)
                     /codon_start=1
                     /gene="hsdR-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002681375.1"
                     /locus_tag="MishRS11D_45430"
                     /product="restriction endonuclease"
                     /protein_id="BBL77445.1"
                     /transl_table=11
                     /translation="MPETPRSERKTQNRVIDLFTNPQRADGLGYRYLGEWSQRANNRP
                     IEAELLRDNLKARGYSPAHIAAALHKLEAAADATGITLYQANLRTYQRLRYGIPVQVA
                     AGQAHRTVHLIDWNTPENNDFALAEEVTLKGGYERRPDLVLYLNGIAIAVIELKRASV
                     DVAEAVHQLITNQEEIFNRGFFSTVQLVLAGNDSQGLRYGTTGTPEQFFVTWKDETPI
                     AADPILEAGCWLDRPLAQLCHKARLLDLIRNFIIFDAGQKKVPRQHQFQGVKAAQERI
                     AKREGGVIWHTQGSGKSILMVLIAKWLLEHDPEARILVVTDRDELDKQIVGVMRNAGV
                     VGENAPSPRITSRAEFVEKLGATTPRLLCALIHKFDVADLKGPPPRVHGRFYVFVDEC
                     HRTQGGDMNKQMKRWLEGAIFIGFTGTPLLRKDKLMTRDVFGTYIHTYKFHQAVADKV
                     VLDLKYEARNVPQRLTSRAAIDEWFKDTTQTLNNFQKAILRKRWATMEELMSSGERKD
                     RIIANVIEDFRRKRRLNNDRGTAILVAASIYDACHYFRLFQNTMFGPCCGIITSYEPN
                     HNAISREPPHSDERYKFDTYTKHVLKPNQTTKQYEDETKRRFIEEPANMKLLIVVSKL
                     LTGFDAPSCTYIYLDNELHDHNLFQAICRTNRLDGEDKDYGHIVDFKELFGDVQQAIA
                     VYSSDELDIDQGSGGDNNVHLKNWLEEGKKQLEAARQALDYLCEPVPRPREIEQFIRY
                     FCGDAANPKALDEAEPLRVSFYKAVAVFTRAFADLVQNLAEAGYSEAEIAALHQEAAF
                     YAEMRAGIKRHAVEELDIKPYEADMRHLINTYIQADPAAELGQLGEMSLTELIVETGI
                     HDAIARKLNEKGKLSKNAVAEGIINNVRKTIIREQLTDPKFYEEMSKLLDDLIQQSRE
                     ETEAYEKFLRKAEDLVKRLASKQPEAGIPSVLHGKREATVLFNNLATIPATNFRYPTA
                     DDERADLALKIDLAIRENAPSGWKGDPTREAQVKNALFPIFERDRAATQAVFEIIKNQ
                     PGYE"
     CDS             10337..10528
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45440"
                     /product="hypothetical protein"
                     /protein_id="BBL77446.1"
                     /transl_table=11
                     /translation="MSKIVRYEIDLNNLPPLTDEQKAELKALPEMPDSQIDTSDIPPL
                     DADFGEKAVRNPLPIYRID"
     CDS             complement(10525..10713)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45450"
                     /product="hypothetical protein"
                     /protein_id="BBL77447.1"
                     /transl_table=11
                     /translation="MKTITIPPREQKLLDCLTQAVAEALERKRRLGQYAVVWREGKPV
                     FVGEDSPPSEPVATNPTP"
     CDS             complement(10710..11948)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_081423274.1"
                     /locus_tag="MishRS11D_45460"
                     /product="restriction endonuclease subunit S"
                     /protein_id="BBL77448.1"
                     /transl_table=11
                     /translation="MEVKPGYKLTEAGVIPEDWKMKLLGELATVSAGGTPTRANAKYW
                     NGDIPWITTSEVDFCTINDADQFITKDGLNNSAAKLLPFGTLLMALYGQGKTRGKVAV
                     LGIEAATNQACAAISLKSGISQEFIFYFLASKYDVIRKLSNTGNQENLNSSLVRSISI
                     LFPPLLEQRAIATALSDIDALIAKLDQLITKKRDLKQATMQQLLTGRTRLPGFSGEWE
                     VKQLGECLIGRPDYGINAPAVPYSDRWPAYIRITDISEDGRFSPESPVSVSHSDASRF
                     YLNDGDLVFARTGASVGKAYLYNRSDGDLVFAGFLIRVHPDPSKLIASFLFNFVQSKV
                     YWDWVRMMSMRSGQPGINGNEFAQLPLYLPSIDEQTAIAAILSDLDAELSALEARRDK
                     TRALKQAMMQELLTGRIRLV"
     CDS             complement(11939..14359)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45470"
                     /product="hypothetical protein"
                     /protein_id="BBL77449.1"
                     /transl_table=11
                     /translation="MAIKKSDLYSSLWASCDELRGGMDASQYKDYVLFMLFIKYISDK
                     YGDSDDFAPPVNIPPGASFKDMIALKGKSDIGERINTQIIVPLVASNSRLARSDFPDF
                     DDPNKLGEGAAKVERLTNLVAIFQNPSLDFSKNRAEHDDILGDAYEYLMRHFAQDSGK
                     SKGQFYTPSEVSRVIAKVIGIGSANTRASTTAYDPTCGSGSLLLKVAAEAGKHITLEG
                     QEKDVTTAGLARMNMILHNFPTANILSGNTLAAPKFKDGENLRTYDYVVANPPFSDKT
                     WSTGLTPSNDPYQRFAWGEPPAKQGDYAYLLHIIRSMKGTAKAACILPHGVLFRGNAE
                     ATIREQLVRSGILKGIIGLPANLFYGTGIPACILVLDKENATARKGVFMVDASKGFIK
                     DGNKNRLREQDIHKIVDTFMRQADDNPRYARMVPFDEIADPKNAFNLNLPRYIDSAEP
                     EDLQDIDAHLQGGIPERDLDALEDYWRELPSVRVELFEPLRPGYVRLKLALSEVKPAI
                     SGHAEFTAFHRSATQHFTDWRQANTPRLTAFDQGGHPKALIEVVSEDLLATFRAVPLL
                     DAYDVYQHLMDYWAGTMQDDAYLIAAEGWVAKPARIVETDKKGKTRDKGWACDLIPKP
                     FIVARYFAEAQAAIEAQQAELETAAAGLAELEEEHGGEDAAFSGFDSITVAAVKDRVR
                     EIGADEDGADELKVLKRWLALSERVAGLKKKVREAEAALDQSAYGQYAKLTEAEIKTL
                     VVDDKWMTRLSGDIQGELDRVSQSLTGRIRQLAERYATPLPELNDEVERLAARVGEHF
                     KRMGAVWK"
     CDS             complement(14555..15376)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45480"
                     /product="hypothetical protein"
                     /protein_id="BBL77450.1"
                     /transl_table=11
                     /translation="MIVLITIFLSEIFSDKRPWNEFQGGRKTFFGLMERIFIPTSRIF
                     FREVGGLREVGGLREVGGLREVGGFREVGGLREVGGLREVGGLREVGGLREVGGFREV
                     GGLREVGGLREVGGFREVGGLREVGGFREVGGFREVGGLREVGGLREVGGFREVGGLR
                     EVGGFREVGGLREVGGLREVGGFREVGGFREVGGLREVGGFREVGGLREVGGFREVGG
                     LREVGGFREVGGLREVGGFREVGGFRKVGGLCMERLSKNPEYREVLKRPLQMQNR"
     CDS             complement(16026..18149)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45490"
                     /product="hypothetical protein"
                     /protein_id="BBL77451.1"
                     /transl_table=11
                     /translation="MSTQSKPSLVRAGWDSCALRDALREACYAEGIIYREVPNDGRWH
                     RADITDDPHGKDDASIKLFADGEGGVLCNWKASGKPVFFWVRQDRALTQAEQEARQRR
                     IEAERTKADQEKRRLWDKTANRVRIEWENLPLAHSEMPQLVQKGVQAHGTKATPDGRL
                     ATPVYSPDGQIQSIQYRHADGQKRNFPCSKMEGGFWWIGTPDGDNPVFVATSFTTAAS
                     IHQALGEGHRVYISYGDGNLENVARMVQARHGGRRIVLCGDDDADKPGNPGRTTAEGV
                     GKALRLPVALPDFGPSRPPRASDFNDLCRLSGPESVRGQILAKLSQREPGTPPPFPAF
                     TPEELDTARLSPRCLVDHYLYADLALIAAAGGTGKTTMLIYEAVHIVLGMPLWGLKVW
                     HPGPVLFITAEDSRELFAARLREVIAAMGLHPYERRTVLSRIAVWDVSSDFVRFAELD
                     QGGNIRLTSLADDIITAYRDDPPAMIVFDPCVSFGPGERMVNDGEQAIVTACRRIIRG
                     LDCCVRIVHHTGKVPAQNGALDQYAVRGGSALPDGSRMVTILSSVNGEVSGAPEGFEL
                     GPEDSGFILARAKLSYAAPQPKLYIRRRGYTFEYFTGSKPTKEQKAASKKAQITKARA
                     AILAFIRDELAAGTKHSKKSLEDAVKVALDIPRDRTRVAVTALSLSGEIFEDELPQNE
                     RQGGKKTFLNLAESAEDVPRGSGEI"
     CDS             complement(18672..19001)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45500"
                     /product="hypothetical protein"
                     /protein_id="BBL77452.1"
                     /transl_table=11
                     /translation="MAKTIDFQAVKESLAALDRIAAEHPELLGESSQEEWEQTLKSTV
                     LERQKRLITKRQAEGQERHALWAPREEIEELRRQFPGSRNGVNWRAVIAAALKMSGQN
                     PENTGTP"
     CDS             complement(19001..19660)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45510"
                     /product="hypothetical protein"
                     /protein_id="BBL77453.1"
                     /transl_table=11
                     /translation="MKAYAYIRVSTEEQATDGVSLDAQKAKVAAWADLNGYELAGIFM
                     DAGISGTKADRPGLAAALAAVGKGDALVVYSLSRLSRSTKHTIEISERLDKAGADLVS
                     ISEKIDTTTAAGKMVFRMLAVMAEFERDQLAERTTTAMQHKKAKGERVGAVPYGKALA
                     GDGVALVDVPAEQEIIAEARRLHTAGLSLRKIAAVLAEKGFKARNGKVFAATQIQRMV
                     A"
     CDS             complement(19918..22302)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012027389.1"
                     /locus_tag="MishRS11D_45520"
                     /product="type I restriction endonuclease subunit R"
                     /protein_id="BBL77454.1"
                     /transl_table=11
                     /translation="MNEAETRADHIDPALKAAGWGVVPDSRIRREYPITLGRIEGHGQ
                     RGRALSADYVLEYRNTKLAVIEAKAWDKPLTEGVGQAKDYAGKLTVRFAYATNGQGIY
                     AIDMQTGAEGKTARYPTPSELWNRAFTQHNLWRDRFAAVPFEDRGGYFQSRYYQDIAI
                     ERVLGALTAGRNRILLTLATGTGKTFIAFQIAWKLFRSRWNLADWTQESEPTRRPRVL
                     FLADRNILANQAYNAFSAFQEDALVRIEPGDIRKKGRVPKNGSLFFTIFQTFMSGPPK
                     DGQPSPYFGDYPPDFFDFIIIDECHRGGANDESNWRGILDYFAPAVQLGLTATPKRKD
                     NVDTYAYFGEPVFTYSLKDGINDGFLTPFRVKQIETTLDEYVYAADDTVVEGQIEADK
                     RYTEADFNKNIEIMERERKRVEIFMAQIDQREKTLVFCANQEHALAVRDLINQTKTGT
                     DPNYCHRVTANDGARGEQYLRDFQDNEKTIPTILTTSQKLSTGVDARNVRNIILMRPI
                     NSMIEFKQIIGRGTRLYDGKGYFTIYDFVKAHHHFNDPEWDGEPMEPEPCPRCDSYPC
                     QCEKKPPRPCPACGQRPCECEKSPCPECFQRPCACRKKVKVELADGKERNIRHTLETT
                     FWHPDGTPMTAQQFLEALFGKLPEFFKDESELRSLWSAPDTRKRLLEGLAEKGFGRDQ
                     LVAMQKVIDAEKSDLFDVLAHVAYALPPLTREERASKAKVIISTHFNSKQQVFLDFVL
                     SHYVSVGVEELDQTKLTPLLHLKYGSTADAVADLGREIGQVFSGFQKYLYQDVA"
     CDS             complement(22330..22785)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45530"
                     /product="hypothetical protein"
                     /protein_id="BBL77455.1"
                     /transl_table=11
                     /translation="MKVDPRTWVVVDTNVLLSAALAPQGTPAQLVDRLLAGRRLVVSE
                     ATFAEFESRIWKPKFDRYLPIERRKRLLSELNASAKWVEVPEEIASQTYSRDPDDDKF
                     IHAALAVPTPWLVTGDKDLLDLRDSALSLGLRILPPAEALLLSEFTGPG"
     CDS             complement(22775..23026)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45540"
                     /product="hypothetical protein"
                     /protein_id="BBL77456.1"
                     /transl_table=11
                     /translation="MQTFTANEAKTRFGELLDRAQRGPVQVTRHNRVVGVMVSAEDYE
                     AMRAFYADRLRHTFKECAEGAAAAGLTEEKLAELLADES"
     CDS             complement(23108..24316)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45550"
                     /product="hypothetical protein"
                     /protein_id="BBL77457.1"
                     /transl_table=11
                     /translation="MKTGWQLKSLADVCQIKPPKSEVRRQLSETDLVSFVPMEDLGIE
                     QKLLVPTQTKPLLEVIGSYTYFADGDVLLAKITPCFENGKLGIAENLSNGIGFGSSEY
                     IVFRPSSSVNKDWLYYFLSRDSFRREGAERMSGAVGHKRVSKDFIEQYKIPVPPLSEQ
                     QRIVAILDEAFDGIATAKANAERNLQNARALFESHLQSVFTQQSEGWTEKRLQDVCEK
                     ITDGTHQTPTYFDNGIIFLSSRNVTSGKINWDDIKYIDIKQHVEMHKRVAPKVNDILL
                     AKNGTTGVAAIVDRDVVFDIYVSLALIRTLGFVIPRFLLHFMNSPVAKYQFNKRLKGI
                     GVPNLHLQEIREVVIRYPIDLEEQMEVVKKIDDIQKQIQRLESIYRQKLAALDELKKT
                     LLHQAFTGQL"
     CDS             complement(24313..25773)
                     /codon_start=1
                     /gene="hsdM_3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011242272.1"
                     /locus_tag="MishRS11D_45560"
                     /product="DNA methyltransferase"
                     /protein_id="BBL77458.1"
                     /transl_table=11
                     /translation="MFEQAFKNIDDVLRKEAGCTTELDYTEQTSWLLFLKYLDGLEQD
                     KALEAEMEGRSYAYIIERPHFRWENWAAPKTPEGKIDHNRAITGDDLREFVDRQLFPY
                     LHGFKQRASGPNTLEYKIGEIFGEIKNKIHSGYNLREIIDYIDELRFGSKAEKHELSH
                     LYEAKIKNMGNAGRNGGEYYTPRPLIRAIVRVVKPKVGERIYDGAVGSAGFLCEAFDY
                     LKAQPNLTTADLKTLQERTFYGKEKKSLAYVIAIMNMILHGIEAPNIVHTNTLAESLA
                     DIQDKDRMEVILANPPFGGKERKEVQQNFPIRTGETAFLFLQHFVKMLKVGGRAGVVI
                     KNTFLSNTDNASVSLRKLLVESCNLHTVLDCPGGTFQGAGVKTVVLLFEKGTPTRKVW
                     YYQLDPGRNLGKTNPLNDADLAEFVELQRTFADSPKSWSVDIANIDPATFDLSVKNPN
                     GGDVVTHRSPQDIMDEIVALDAESAEVLAGIRELLG"
     CDS             complement(25864..26136)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45570"
                     /product="hypothetical protein"
                     /protein_id="BBL77459.1"
                     /transl_table=11
                     /translation="MAKNMQALQEALKGTQKTPNASQAAPTSGTTQGYMAPSREGKTN
                     ITAYLSPDYKASLRLIQAKTGTSLQALIAESLNDLFRKYDVPTVDE"
     CDS             complement(26139..26768)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011090916.1"
                     /locus_tag="MishRS11D_45580"
                     /product="chromosome partitioning protein ParA"
                     /protein_id="BBL77460.1"
                     /transl_table=11
                     /translation="MFVTAIVGQKGGTGKTTTSLCLAVSAARAGQAAVIIDLDPQANA
                     ANWKDRRTGENPAVIAAPVSRLKQTLETARTYGAEFVIIDTPGKSDSAAVEAARAAHL
                     VLIPVRPQIFDLETLPGVRDLLRVAGDTPAYVILNGLHPQARKQAEDAKAMIEQTTGF
                     KVCPFHLCHRGSYAEAPTTGSTPQELDPDGKAADEIDRLYKFITQHENM"
     CDS             complement(26874..27116)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45590"
                     /product="hypothetical protein"
                     /protein_id="BBL77461.1"
                     /transl_table=11
                     /translation="MTHLYTKPRPGALPTTNAERIRNHRQRRKEAGQECLHLWLDQET
                     IIGLQPYLRQHEILVHGIARILKQLTEPQPPTRPRP"
     CDS             complement(27120..28727)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45600"
                     /product="hypothetical protein"
                     /protein_id="BBL77462.1"
                     /transl_table=11
                     /translation="MNAAAILDLFGPPAPAIGPREHFDTVHGGHSTKVAYLSIPIEGK
                     PHERTFPPEETRFVMEMAPGFDRMDLYFSQSGFHHRRMLGQVAALPTLWVDLDFYKDP
                     RLKRVGPMELLDRAQARYPTLPMPTLVISSGRGAYFEWVFDKPLPPTNLAQWQQVMDC
                     LIAMFKDFGADPACRDATRVLRIVGGTNQKNRREVTGYRTGIPVAFDEIRRAVLGYAG
                     TLRAIETPKAAPDHKETGNRKPSPTAKETLGHANQSETSTPKPTSQEQTRKLSEKQAK
                     SLLGPYLLHRARLSDYETLAKLRGGKLKDCRSRMLFAVATSLTWYIGDENRLKVELRD
                     FAQEHFLNPKKYEASRVKAVIDRLKLDQGGIVIPVWEGRRVPNRYRMTNAYLLKLLEV
                     TPEEEKKLTTIIGTEEKAQRRRHKAGAMSREEYEARAQEKRERIKGLSAEGLRQAEIA
                     KTVEVHRQQVHQTLKTGGRPEYKERTFDNASPNVSSDVSSLRAAGLSQRAIAAALGIH
                     QSTVSRILASQSEARQATEGTGIVTEE"
     CDS             complement(28835..29047)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45610"
                     /product="hypothetical protein"
                     /protein_id="BBL77463.1"
                     /transl_table=11
                     /translation="MNRKDSDWISISTAVRELPISRPRLIQAIEQGQIEAVYSGTKSV
                     RVRRNDVWTLLTTPPRKPQAHPAQAA"
     CDS             complement(29459..29752)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45620"
                     /product="hypothetical protein"
                     /protein_id="BBL77464.1"
                     /transl_table=11
                     /translation="MDPKVAGKILDRIAELSQGNEQRTMEYLSKTQTGADRQRKYAEK
                     RQSEGKKQVYLWLDNDNADALKREYPGIRGGINWQAIIKVALAHVEGKDRPKE"
     CDS             complement(29752..29880)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45630"
                     /product="hypothetical protein"
                     /protein_id="BBL77465.1"
                     /transl_table=11
                     /translation="MKLLREGGMSYPKIAAELEARDMKPRGKTWHPQTVKNIAEAA"
     CDS             complement(30034..31089)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45640"
                     /product="hypothetical protein"
                     /protein_id="BBL77466.1"
                     /transl_table=11
                     /translation="MGTVKKLAEEVGRGLEQALPGLRKTVVGKLALAVGAMIEGRTPN
                     TVELANLLPLPTERQDMREQWLRRLLKNPLLGSAVVMEPFARAELARAARNGQTVQLS
                     LDQTDLGDRMAVLMVGVRVGDRALPLAWVAEEGPANIGFEGQERVLERVLAWLPPGAD
                     VLLSADRFYPSVALFDWLGARGWGYRLRLKGNVLADTGEGEETTTGGLARGAEERYLP
                     GVRLFAHGVMTHVGILHEPGHPEPWIIAMDCAPTRAAVLDYAARWSIEPMFSDFKGRG
                     FGLEDSQLEHADRLERLILVMSLAMWWCVQVGRDDASDRPTPLEKKPGRKPMPDTGAS
                     GSSAAAWFPGSPGACAT"
     CDS             complement(31097..31612)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45650"
                     /product="hypothetical protein"
                     /protein_id="BBL77467.1"
                     /transl_table=11
                     /translation="MKAIGYIRVSTQGQADEGISLEAQRAKIAAWADLNGYELAGIFE
                     DAGISGTKADRPGLVAALAAVGKGDALVVYSLSRLARSTKHTIEVSERLTKAGADLVS
                     ISEKIDTTSAAGKMVFRMLAVMAEFERDQISERTSNALQHKKAQGGRVGSIPSSPINF
                     RVGLKAGTNFD"
     CDS             complement(31934..32293)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003656109.1"
                     /locus_tag="MishRS11D_45660"
                     /product="hypothetical protein"
                     /protein_id="BBL77468.1"
                     /transl_table=11
                     /translation="MANTVESLKKLDGFIAAALVDSSSGMMLESLVVGNYPVEIAAAA
                     NTEVLQSKLKAMDAIGLSDDNIEDILISLGSQYHLLRPLNSNREIFIYLALDRSRANL
                     AMARLEVKKVEGSIKRI"
     CDS             33218..35686
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45670"
                     /product="hypothetical protein"
                     /protein_id="BBL77469.1"
                     /transl_table=11
                     /translation="MTITKKMLLLITFNLLGLIGLSVLANYQIKQVFTSANYANINSV
                     PSLIAVNSEIKAFGQVRVRLLRHVLNEDRSQIERLGQELKSAQRDLAAAFEAYKPLIS
                     NAEDQHLFEANLVKWNQYEAGIPPVLASSQNMDKRSARDALDRLTDLGRDLQNSLEAH
                     AKYNADLAGKAATEAMNIQAAALWQSWAGALITAAFVAGVGYYIARTILRQLGGEPGT
                     AAEIANRIADGDLSTQIVLKSGDTGSLMAAMQHMSTNIKALVDDSLMLSEAGTEGKLA
                     TRADASRHRGDYRRIVEGMNSTLDAVAGPVERIREIMGRVAEGDLTVAVAGDYRGTFL
                     ELKEAINDAVGKLSKTLAEVNQATESISSASEQLSATSQSLAQASSEQASGVEETSAS
                     MEQMAASINQNKDNAQATDGIAEKTASEAIEGGQAVTQTVQAMRQIAGKIGIIDDIAY
                     QTNLLALNAAIEAARAGEHGKGFAVVAAEVRKLAERSQVSAQEIGALAASSVAMAERA
                     GTLLGEIVPSTKRTSGTSCALRGERLKDPSFAKRKRRRPMSCLEISDRLWEHVEPLLE
                     PFKRRRPGGSKPLEFRTVMNGILYVLKTGCQWDCLPACYGSKSAVHEHFQRWVAAGVF
                     KEMFRWSAAEYEELEGFDLAWQSMDGSLVQAPVRQARCQKDEGLGRNPTDRGRSGGKI
                     HLQVDGKGMPFAVAQAGANVHDSRLVTVTVEAAVIEAPADAGQSPRHLCLDKGYGYER
                     VEREVAGLGYTPHIRKIGEEKRSCDSEPTHPARRWVVERAFAWLKGFRAIRTRYTCRG
                     ANYLAFLQLACALILGRRIEAKTV"
     CDS             35694..36041
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45680"
                     /product="hypothetical protein"
                     /protein_id="BBL77470.1"
                     /transl_table=11
                     /translation="MCRMSSKKTAGLVQEITSASEEQATGAKQIAEAMNQLSKTIQQN
                     ASASEELSATAEEMSGQALELRQTLSFFKISANATDLTTPRYAIKTRTYPPQAHTSNS
                     TDRGGHEQGFSRF"
     CDS             complement(36148..36324)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45690"
                     /product="hypothetical protein"
                     /protein_id="BBL77471.1"
                     /transl_table=11
                     /translation="MIVGTEAPRRIPAVILEADLRPAFAASPEVKLIRVRDFPEIIGA
                     AKKAAGQPGPDAGS"
     CDS             37022..37210
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_45700"
                     /product="hypothetical protein"
                     /protein_id="BBL77472.1"
                     /transl_table=11
                     /translation="MRAYIDESANLRVIPETPGEALMLDYWFMAFIGQLSGNRSAGLE
                     IGTNVANATPLRDSYADE"
BASE COUNT         7077 a        10747 c        10967 g         8426 t
ORIGIN      
        1 cgccttatag gccgcgcttt gcgtttcctg tttgtggacc tcgcgttcgc cgccatcagg
       61 gaagcaatga cggtggcgtt gggcaattcg attttatggg tgcgtcgccg tggtcgttgt
      121 tgtgggtggg ggtggtgttc atgccgcgcc ctccgttgcc ttgcgtgcgc ccctgtcggc
      181 gctctcgaaa acgtccgccg cccggtcgag tccgcccgcg atgaaatcca ggttcaggca
      241 cagggcgtaa tcgggcggat ggggaaaggg tggtggtgcc ctggaattcg ggcaaatctc
      301 gggcggtccc gctacaatcg ggggtattca tggtcgcaat ctcctaatca gattgcggtt
      361 gtgataggga ggcgcggcga ttcgacccgc cgcgccatcc cgaactattc gccctggtcc
      421 tcgggcatcc cggcattccc cgcgccgggt cgggattcag ataaatggat tgacgatggt
      481 caatcggtgg tcgataacct gcccgtgctg catatcttct gaatagagcg tgcggcatcc
      541 cgcttccatc gccgtcgcca caatcaggct gtcgtaaatg gaaaagccgt agcgttccgc
      601 cactcccaac gcccgccgga tggttgccga ttcaataacc cgaacacggc aggtatctag
      661 caatatgtcg tggaaggctt cgatttccgc cacgctacgc ccgaacttgc gccgcatgac
      721 attggctgat tccgccaata cctgggtcga taaaacgccg ccatcgctca gacgatccgc
      781 cacgcgctcc ttgcgccata agtcggtgga caggccataa agcaccacat tggtatcgag
      841 aaacgatgca tcaccgggca ttggcttcct cgcggtcgaa cttgaagccg gacatttcaa
      901 cttggaaccc ggataggcgg tcaagcaatg ccgccttgcg ttccgtcgcc tttatgtcga
      961 gttgcggttg ttctccggct tgttccagtg cgattttgat aacagcttgc cagtcaacac
     1021 catttcgtgg accaggataa gccgctctca gcttttcaat atctgttgga tatacccata
     1081 cctctggcct acataagccc ttagcaaagc gtttttccct aagttcccgc tgccgttcgc
     1141 ttcctgattt tcgtgtcgtg gtattcattt aagataaggt tttttcccat tcttcctgcg
     1201 aagattcccc cagtagctcg gggtgttccg ccgcgatgcg gtccagcgcc gccaaggatt
     1261 ccttgacggc ctggaagtcg atagttttcg ccatcatgcc accatgcgtt gaatctgggt
     1321 ggccgcgaaa accttgccgt tccgggcctt gaaacccttt tccgccagca ccgcggcgat
     1381 tttgcggagg ctcaggcccg ccgtatggag cctgcgggct tcggcgatga tttcctgttc
     1441 agcgggcacg tccaccaggg ccacgccatc ccctgccagc gccttgccgt agggcaccgc
     1501 gcccacccgt tcgcccttgg ccttcttgtg ctgcatagcg gtggtggtgt cgatcttctc
     1561 ggaaatggaa acgaggtcgg ccccggcctt gtccaggcgt tcggaaatct cgatggtgtg
     1621 cttggtggac cgggagaggc gcgacaggct gtagaccacc agggcgtccc ccttgccaac
     1681 ggcggacagg gcagcggcga gtccgggccg gtcggccttg gtgccgctga taccggcatc
     1741 catgaagacc ccggccagtt cgtagccgtt gaggtcggcc cacgcggcga ccttggcctt
     1801 ctgcgcgtcc aaggaaacgc catcggtggc ttgttcctcg gtgctgaccc ggatgtaggc
     1861 gtaggctttc atggtggcgg ttccctaaaa attgttactt ggtgatagac taccataatc
     1921 acttggtaac gtaagatttt ttcgataccc gagtaacgag ccggacccct gttacggagg
     1981 gcaaaacctg acggtagaag gtggacatga gaaaggccaa cccggttgcc caggtcggcc
     2041 tttccatcga gtgggaaaaa tatcggatta cgaattccag cttggcatcg ccaagaaacc
     2101 gcgttcttgc cccatgcggg gcgctacggg agcgtctgtg gcccccggat gggcgcggcg
     2161 gcttgccaat cttcgcgatg gatagccacc gccagcgagc gatggaccca gcccgccaaa
     2221 accgcgccga tcatcggtgc gacccaaaag agccaaagct gggccattgc ccatgttcca
     2281 gcgaacagtg cgacgccggt gctgcgggct gggttcacgg aggtgttggt gaccgggatg
     2341 ctcaccaggt ggatcagcgt caggcccagg ccgatggcca agggcgcgaa cccctgcgga
     2401 gcccgcgagt cggtgacgcc caggatgatc agcaggaaca tgaaggtcat cacggcctcg
     2461 gtcaggaaac cggcccccag ggaatagccc cccggagagt gcgggccgta accattggcg
     2521 gcgaagcccg cgctgggatc gaagccgggt tttccgctcg cgatcaaata cagcatcccg
     2581 gcggcgaaaa ctgctcccag cacctgggcg gcgatgtacg gtgccaaatc cgaccccggt
     2641 atgcgaccac ccgcccacag gccaagggag accgccggat tgaaatggcc tcctgaaata
     2701 tgcccgacgg cataggccat cgtcagcacc gtcaggccga aggccaaggc gacgccgagc
     2761 aggccgatgc cgacatccgg gaccgtggcc gcgagtaccg cgctgccaca accgccgagt
     2821 accagccaaa acgttcctat gaattccgcc gctgtgcggc gatagatcga ccacatgatc
     2881 aagccctcca tggtttctaa atcgccagtc cgccttgcgg gtggctggcg ggacaacatc
     2941 ctgctttcca aggcggggcg gacggaacgg attccatctg cccccgctaa ggctaccacc
     3001 ttggctaaat tccggccatc cgccctggag ccaagcaccg cgccgcttcc aaccgcttga
     3061 ccggcccagt tgtccacagg aattgtggat aaccgggcgg tccactccta ccgcaatccc
     3121 tttttttcct cccaggcgtc cagcgcctct ctcaggagtt cgttcaattt cagatcggcg
     3181 gacgcggccc gttcccggaa tcggcggcgg aactgggggc tgactttgaa gttcagcggg
     3241 gcggatgccg ggccggtcgg cgtaggttcc ggtgcgcggc tggcggtgtc gggtgtggct
     3301 ttgcccttca cggccaccaa tccgggggtg agttcggcgt tcttcttagc catatttctt
     3361 tccttattcc tttcgtgctt tcttgctata gcctaatcgt gctttaacga agcgccataa
     3421 atcgacggtt tccctggcgc tacgcccacg gggatcggtt tccagcaccg tgcgtccatc
     3481 gatcatcgag gcggcgtagt ccacccggtc gtggacgatg gctggggcca caacgccatg
     3541 ctccgacagt gcagccacgg cttggacggt cagtttggtg ttcggtttgg cctgggggac
     3601 ggcgaacacg aaggggcggt tcgcgtcggt ggcgagttcc accgtgcggc ccacggcgcg
     3661 gaggtcgtgg ggggagggcc gggtggggat cagcaccagg tcggccagcg cgaccacggc
     3721 gcggatggat tccgcgatgg ccgggggcgt gtcgatgatg gcgtaggcgt agcccgcctg
     3781 ggccagggct tcgagcttgg cggggagttc cttcaaggtg gtcggggcaa aggcgggagt
     3841 ttcagcttcg cgcccgttcc accaagcgga tagggaggct tggggatcgg tgtcgagcag
     3901 gacgcagggt ccggccccgt ctcgctcggc ggccacggcc aggtgcgcgg ccagtgtggt
     3961 tttccccgcg ccgccttttt gactggcgag tacgatagtc ttcatttttg cctttcgtgc
     4021 tttcttttga tctgtctatg ttaggagaac gaaaagacga aaggaatatg tgtgcctcga
     4081 ttcgatgttt gttcagtcag ttgccattcc ctggaggact ggttgacgcg gcccggttcg
     4141 gtatacggga aagccccatc gtcgcgacgt gggcgaagct tggagcttgg cttatgggta
     4201 ggtggtattc cgggaagtgg cccggtcgat ttcggcatcg aagcggtcga ttatggccgg
     4261 ggtgatgtgt ttggggttga gggtatggat gtccagagca atggccttgg cttgttcggc
     4321 acccagagcc ccacatgccg ccagctcgat catgaggcgc aatccccaca gggtgcggac
     4381 accttcgcgc tcgcaggcgc ggtgcagggg tttgtcgttg gagacgcaga cccagccgtt
     4441 cgctttggcg agggcgaggc aaacatggtc ctggaaagac aacgcgccgc tcttttggct
     4501 ggcttcgtcc aggatttcca gcggttcgtc gatgagggtc aatcccaggc gtcggcagcc
     4561 tgcggcgtcc agttgttcca cctcgtccag aactacgctg ggcacatgga tcgggccgag
     4621 atgccggacg cagagcgcca ggattccggc ctcggttttc gcgtagtcga tcaggacatt
     4681 ggcatcgacg atcagcagca tggaccggac gttaggccag ccaggacagg gaaaggtcgc
     4741 gcatgtccgc caaggggagg cgcaggattt cggcggcgcg ggagagggtg atgatttccg
     4801 cttcgacggc ctgtctcacc agccggtaga gccggtcgcc ctggaaatcg tgttgcccca
     4861 gaccttccgg ttcgccgcac gcacggtagt ggtcgcgggt gatgccgaag ggttcgtcat
     4921 gtttcaacaa gggccgtccc ttgtggcggg ccttgtattc ctcgttgatg cgttgccaga
     4981 cggggcggcg tcggtcctcc ggcaagcctt gggcgacccg gtatagcacc gtgcgccaac
     5041 cgacccggaa cacccgtttc accttcagta cccggtccag cagggccaac cccgccgtct
     5101 cccgccattc ccggcggaac agttcttccg gcatgaggaa atgggaggcg aattggtcgg
     5161 cttcccgttc ctgagtttcg tcttcctgct cctggtccac atcgtaggct cccaggtgta
     5221 gcagcaggtg cccgagttcg tgggcggcgc tgaaaatcca ggcttcgacc ggcagccgct
     5281 cccaggtgtt gacgatgacc gccgggccac cctcttcgtc cgccaccgac aggcccatga
     5341 aggcatcgtt ggcgacaact acggaataga cctttatacc ttgggcttcc agcaggccgc
     5401 acaggtcatg caccggctcg cgctcggtca ggccgaaatg tgcccgtgcc agcccggcca
     5461 cagtggcggg ggcgcggtct tcgccgatcc ggtcggccag ggtttgcagc ttgggggcgg
     5521 acaggtcgcc ggttagccgt tccaggtcgg agaaatcgcg cagccagcgg cccacgtcgg
     5581 ccagcacttg gccccggctt ttcagccgct tgagggagcg gaagcggacc ttccgcaagg
     5641 gtgccgccgg gttcagcaga tcgcgcaacg gtacatcgag ggcactggcc agggatttga
     5701 gggtttcggc ccgcggttgg gcgcggcctt gttcgagatt gcggtaagcg ccacgggaaa
     5761 gcccggcctt tgcggcgagc ttttcctggg agaggttccg gtccttgcgg tggcggatca
     5821 ggtgggtgcc tagggtctgg atgggcatgg cggttcatgg gcgtcgaaat ggtgatttcg
     5881 acagtttttg tcgaaatggt tattaatacg tcacaccagg aaagcgggtt tttttcaagg
     5941 tgaatattca cacttccaga atgtgacggt ttctttgaat tgatgccgca tatatatgaa
     6001 ttatgaatta atggatggtg aatgtataaa atttagagca acgctatcgt ctacgccaga
     6061 aaagcagggg tctggtgttg ccatgtcgtt aaaaaaacaa aacgaggtat ttcaatggtg
     6121 tacttcgcgc acagcaaaaa caaagccggg caaaggcatc tgttgacgga acatctacgg
     6181 agtgtttcgg aattggcggg tggattcgcg gaagcttctg gccatgcgga agaagcccgg
     6241 ttggccggat tgctgcacga tcttggcaag tacggcgacc ttttccaaag acggttggaa
     6301 ggcaaggaac atgggctgga ccattggtcg atgggggctt ggctggcttt gtcgcaacat
     6361 aaggcggtgg cggcagcgct ggcgattcag ggccatcata ttattctttc caaacctccg
     6421 ccgctaacgg caattcattc aactctaccc tagcttcgcg ccaagttggg taatgttccc
     6481 ccaggatggc gataaaacgg tcgctatggg tgggttcgat caaatgaacc atctcatgca
     6541 caaccacata ttcgagcaaa tccttgggtt ttttcaccaa ttccgtattc aagcggatat
     6601 gcccctttgc gtggttgcag cttccccact tggttttcat gcgctgtaga aaataaccgg
     6661 cgaccttcac tttgagcttg ctttcccact ggctaatcag ggcaggaatt accgcgtgaa
     6721 gaagggattt atgccattcg tggatgattt cggcgcgttt ttcccggtca ctaccgggcc
     6781 gcactatgag ggtaatccgc ttgtggtcga gggaaacaaa gggtttgcat tcccgttcgc
     6841 tgatggccag caaatgccgc cgcccccaca aataatgact ttcgcgttct atgaactgcc
     6901 ggggcgtttc gcgtgcttga tttttcagct tcgtttgttg ctcgcgtatc caacccagct
     6961 tggaaatcgc ataggctcgg gcgacctcca agcgggtgcc gctgggcgcg acgagcgtta
     7021 cccggccttc cggcggatgc actgaaaggt ggacgttttt aaccgccttc cgcgttacgg
     7081 cgatgaaaat atccccgagt tggatggttt ccgtcattca taccccggct gattcttgat
     7141 aatctcgaac acggcctgtg tggcggcgcg gtcccgctcg aagatgggga acaaggcatt
     7201 ctttacttga gcctcgcggg ttgggtctcc tttccagcct gacggggcgt tctcccgtat
     7261 agccaggtcg attttcaagg ccaagtcggc ccgttcgtcg tcggcggtgg gataacggaa
     7321 atttgtcgcc gggatcgtcg cgaggttgtt gaaaaggacg gtggcctccc gcttgccatg
     7381 caggacggat ggaatgcccg cttccggttg cttactggcc aaacgcttca ccaggtcttc
     7441 ggccttgcgc aggaatttct cgtaggcttc ggtctcttcc cggctttgct ggataaggtc
     7501 gtccagcagt ttggacattt cttcatagaa tttggggtcg gtgagttgtt cccggatgat
     7561 agtcttgcgg acgttgttga taatgccttc ggcgacggcg ttcttggata gcttgccctt
     7621 ttcgttgagc ttgcgggcga tggcgtcatg gatgccggtc tcgacaatca actcggtcag
     7681 ggacatctcg ccgagttggc ccagttccgc cgccgggtcg gcctgtatgt aggtgttgat
     7741 gagatgccgc atatcggctt catacggctt gatgtccagt tcttcgacgg cgtgccgttt
     7801 tatgcccgcc cgcatttcgg cgtagaaagc ggcttcttgg tgtagcgccg ctatttcggc
     7861 ctcggaatat ccggcttcgg ctaggttctg gaccagatcg gcaaaggcgc gggtaaaaac
     7921 ggccacggct ttgtagaacg acacccgcag cggttcggct tcgtccagcg ccttggggtt
     7981 ggccgcgtcg ccgcagaagt agcggatgaa ctgctcgatc tcgcggggcc tgggaaccgg
     8041 ttcacacagg tagtccagcg cttggcgggc ggcttcaagt tgcttcttgc cttcttccag
     8101 ccaattcttc agatgcacgt tgttatcgcc gccgctgcct tggtcgatgt cgagttcatc
     8161 ggagctatag accgcgatgg cctgctgaac gtcgccaaac aattccttga aatcgacgat
     8221 gtggccgtaa tccttgtctt cgccgtccag ccggttggta cggcagatgg cttggaacag
     8281 gttgtggtcg tgcagttcgt tgtccaggta gatgtaggtg cagcttggcg catcgaagcc
     8341 ggtcaataac ttgctcacca cgatcaggag tttcatgttc gccggttcct cgatgaatcg
     8401 gcgcttggtc tcgtcttcgt actgcttggt ggtctggttt ggcttcagga cgtgcttggt
     8461 gtaggtgtcg aacttgtagc gctcgtcgct gtggggaggc tcgcgggaga tggcattgtg
     8521 gttcggctcg taggacgtga tgatgccgca gcaggggccg aacatcgtgt tctggaacag
     8581 ccggaaataa tggcaagcgt cgtagatgga tgcggccacc aggatggcgg tgccccggtc
     8641 gttgttcaag cgccgcttgc gtctgaaatc ctcgatgaca ttggcaatga tgcggtcttt
     8701 gcgctcgcct gaactcatga gttcttccat cgtcgcccag cgcttgcgca gaatcgcctt
     8761 ctggaagttg ttgagcgtct gtgtcgtatc cttgaaccat tcgtcgatag cggcccgcga
     8821 ggttagcctc tgggggacgt tgcgggcctc gtacttgagg tccaatacca ccttgtcggc
     8881 caccgcctgg tggaacttgt aggtatggat gtaggtgccg aatacatccc gcgtcatcag
     8941 cttgtctttg cgtaggagcg gggtgccggt gaagccgatg aaaattgcgc cttccagcca
     9001 gcgcttcatt tgcttgttca tgtcgccgcc ctgggtacga tggcattcgt ccacgaacac
     9061 gtagaaacgg ccatgcaccc tagggggcgg gcctttcagg tcggccacgt cgaacttatg
     9121 gatcagcgca cagagcaggc gcggcgtggt ggccccgagt ttctcgacga attccgcccg
     9181 cgaggtgatg cgcggcgaag gggcgttttc gccgaccact ccagcattcc gcatcacgcc
     9241 gacaatctgc ttgtccagtt cgtcgcggtc ggtgacgacc aggatacggg cctcggggtc
     9301 gtgttccagt agccacttgg cgatgagtac catcaggatg cttttgccgc tgccttgggt
     9361 gtgccagatc acgcccccct cgcgtttggc gatgcgttcc tgtgcggcct tgacgccctg
     9421 gaattggtgc tggcgcggca ctttcttctg tccggcatcg aagatgatga agttgcggat
     9481 caagtcgagc agccgggcct tatggcacag ctgggccagc ggtcggtcga gccagcagcc
     9541 agcctccagg atggggtccg ctgctatcgg cgtttcatcc ttccaggtca cgaagaactg
     9601 ttccggcgtg ccggtggtgc cgtagcgcaa gccttgggaa tcgttgcccg ccaggaccag
     9661 ctgcaccgtg ctgaaaaagc cccggttaaa aatttcttcc tggttggtga tgagttgatg
     9721 cacggcttcg gccacgtcca ccgaagcccg ttttaattca atcaccgcga tggcgatgcc
     9781 gttgagataa agcacgaggt cgggcctgcg ttcgtagccg ccctttaggg tgacttcctc
     9841 ggcgagggcg aagtcgttgt tttccggcgt gttccaatcg atcaaatgca ccgtccgatg
     9901 ggcttgtccg gcggcgactt gtaccgggat gccgtagcgc aggcgttgat aggttcggag
     9961 gttggcctgg tagagggtga tgccggtggc gtcggcggcg gcttccagct tgtgcagggc
    10021 ggcggcgata tgggcggggg aatagccgcg ggccttgagg ttgtcgcgca gtaattcggc
    10081 ctcgatgggg cggttgttgg cgcgttggct ccattcgccc aggtagcggt agcccaagcc
    10141 gtcggcccgc tgggggttgg taaacaggtc gatgacgcgg ttctgggtct tgcgttcgga
    10201 gcggggagtt tcaggcatgg cattgtcctg acaaagttgt tattagtggc ccacgccgtc
    10261 cgcgatgacg aggacggcac cgagattatc cgcatcgtgt aggcacgccg cgccgactcg
    10321 aaagagggga agcgttatga gcaaaatcgt ccgttatgaa atcgacttga ataacctgcc
    10381 gcccctgacg gatgagcaga aggccgaact caaggcattg ccggaaatgc ccgacagcca
    10441 aatcgacacc agcgacattc caccactgga cgccgatttt ggggaaaagg cggtaagaaa
    10501 cccgcttcct atttaccgga ttgattaagg tgttgggttt gtcgcgacag gctcagaggg
    10561 cggagaatcc tcgccaacaa aaaccggctt tccctcgcgc cataccacgg catattgtcc
    10621 taagcgacgc ttgcgctcca aggcttcggc gaccgcttgg gtcaggcaat ccaacagttt
    10681 ttgttctctg ggcggaatgg tgatggtttt cataccaagc gaatcctacc ggtcagtagt
    10741 tcctgcatca tggcctgttt gagggcgcgg gttttgtcgc ggcgggcttc gagggcggaa
    10801 agctcggcgt ccaggtcgga gagtatggcg gcgatggcgg tttgctcatc aatggacggc
    10861 aaatataagg gcaattgagc aaactcgttt ccattaattc caggttgtcc gctacgcatg
    10921 gacatcattc ttacccagtc ccaataaact ttgctttgca caaagttaaa aagaaaagat
    10981 gcgataagtt ttgaaggatc aggatgaacc cggataagaa atccagcaaa aaccaaatcc
    11041 ccgtcactcc gattatataa ataagctttt ccaacgcttg ctccggtgcg agcaaatact
    11101 aaatccccat cattcaaata aaaacggctt gcatcggaat gagaaacaga tacgggtgat
    11161 tctggtgaaa agcggccatc ctcggaaata tcggtaattc tgatataagc aggccaccga
    11221 tctgaataag gaactgcggg cgcattaatt ccatagtcgg gccggcctat taagcactcg
    11281 ccaagttgct ttacttccca ttccccacta aaccccggca accgagtccg cccggtaaga
    11341 agctgctgca tggtggcctg tttaaggtcg cgcttcttgg taatgagttg gtctaatttg
    11401 gcaatcaggg catctatatc gcttaaagcg gtggcgatgg cgcgttgttc cagtaacggt
    11461 ggaaatagga ttgaaattga ccgaacaagc gaactattta aattctcttg atttcctgta
    11521 ttacttaact tcctaattac atcatattta cttgcaagaa aataaaatat aaattcctga
    11581 gaaataccgg attttaagga aatcgcagcg catgcttgat tagtagctgc ttcaattcca
    11641 agaacagcaa ctttaccccg tgtctttcct tggccgtaaa gtgccatcaa aagcgttcca
    11701 aagggcaaca attttgcagc tgaattattt aatccatctt ttgtaatgaa ctgatccgca
    11761 tcgtttatcg tacagaaatc aacctcagac gtagtaatcc aaggaatatc tccattccaa
    11821 tatttggcat tagcacgggt cggagtgcca ccagcgctaa cagtggcaag ctcaccgaga
    11881 agcttcattt tccaatcctc cgggataacc ccagcttccg tcagcttata acccggcttc
    11941 acttccatac cgcccccatc cgcttgaaat gttcgcccac acgggccgcc agcctttcca
    12001 cctcgtcgtt aagctccggc aacggcgtgg cgtagcgttc ggccaattgc cgaatccgcc
    12061 ccgtcaagct ctgggaaacc cggtccaatt ccccctgaat atcgcccgat aagcgcgtca
    12121 tccacttatc gtccaccacc aaggttttaa tctcggcctc ggtcagcttg gcatattgcc
    12181 cataagccga ttggtccagc gccgcctcgg cctccctgac tttcttcttc aacccggcca
    12241 cccgctcgct caaggccagc caccgcttca acaccttcaa ctcgtccgcg ccgtcctcat
    12301 ccgcgccaat ctcccggaca cgatccttca ccgccgccac ggtgatactg tcgaaaccgg
    12361 aaaacgccgc gtcctccccg ccgtgttcct cctccaactc ggccagaccc gcggcggcgg
    12421 tttccaattc cgcctgctgg gcctcgatgg cggcctgcgc ctccgcgaaa taccgcgcca
    12481 cgatgaacgg cttgggaatc aggtcgcacg cccaaccctt gtccctggtc ttgcccttct
    12541 tgtccgtctc cacgatgcgg gccggtttcg ccacccaacc ctcggcggca atcaaatagg
    12601 cgtcgtcctg catggtcccg gcccaataat ccatcaagtg ctgataaacg tcgtaagcgt
    12661 ccagcaacgg cacggcgcgg aaggtcgcca gcaaatcctc ggaaaccacc tcgatcaacg
    12721 ccttgggatg cccgccctgg tcgaaagcgg tcaggcgggg cgtgttcgcc tgccgccagt
    12781 ccgtgaaatg ctgggtcgcc gaccgatgga acgccgtgaa ctcggcatgg ccagaaatgg
    12841 cgggcttcac ctcggacagc gccagcttga gccggacata accgggccgc agcggctcga
    12901 acaactccac gcgcacactg ggcaattccc gccaataatc ttccaaggca tccaaatccc
    12961 gctccgggat accgccctgc aaatgagcgt cgatgtcctg taaatcctcc ggttccgcgc
    13021 tgtcgatata gcgcggtagg ttgagattga atgcgttttt ggggtcggcg atttcgtcga
    13081 acggcaccat gcgggcataa cgcgggttat catccgcctg ccgcatgaag gtatccacga
    13141 tcttgtgaat atcctgctcg cgcagtcggt tcttattgcc gtccttgatg aaacccttgc
    13201 tggcatcgac cataaacacg cctttacggg cggtggcgtt ttccttgtcc aataccagaa
    13261 tacaggcggg aatacccgtg ccataaaaca ggttggcggg caagccaata atgcctttga
    13321 ggataccgga acggaccaac tgctcccgga tcgtggcctc ggcgttaccc ctgaacagca
    13381 cgccatgcgg caggatacaa gccgccttcg ccgtgccttt catactgcgg atgatatgca
    13441 gcagataggc ataatcgccc tgcttggccg gtggctcgcc ccaggcgaaa cgctgataag
    13501 gatcgttgga cggcgtaagg ccggtactcc aagttttatc ggaaaaggga ggattggcga
    13561 ccacataatc gtaggtccgc agattttcac cgtccttgaa cttgggtgcg gccagggtat
    13621 tgcccgacag gatattcgcg gtcggaaagt tgtgcaggat catgttcata cgggccaagc
    13681 ccgctgtggt cacgtccttt tcctggcctt ccagcgtgat gtgcttaccc gcttccgccg
    13741 ccactttcag cagcagcgac cccgagccgc aagtcgggtc ataggcggtc gtagaagccc
    13801 tggtattggc cgatccaatc ccgatcacct tggcgataac gcggctaacc tcggaaggcg
    13861 tgtaaaactg ccccttgctc ttgccggaat cctgcgcgaa atgacgcatc aagtattcgt
    13921 aggcatcgcc caggatgtcg tcatgctcag ccctattctt cgagaagtcg agggaagggt
    13981 tttggaagat ggcgaccaaa ttggtaaggc gctccacctt cgccgcacct tccccgagtt
    14041 tattggggtc atcgaaatcg gggaaatcgc tacgcgccaa gcgggaatta ctggcaacca
    14101 agggcacgat gatctgggta ttgatcctct cgccaatatc gcttttaccc ttgagcgcga
    14161 tcatatcctt gaagctagcg ccaggtggaa tattcaccgg gggcgcgaag tcgtcgctat
    14221 caccgtattt gtcgctgatg tacttgatga acagcatgaa caagacgtaa tccttgtact
    14281 ggctggcatc catgccgccg cgcagttcat cacaggaagc ccagagggaa gaatagaggt
    14341 ctgatttctt aatcgccata tagaaaagtt attctttgaa ccaaagtcat ttctcttccc
    14401 ttcaaaagca acgcataagt cgcctacttt aggctaattt taccataaaa ctttctaata
    14461 tcaagcgctt atacatgatc tctccttgct ttagactagg ttttaactgc caaataaaac
    14521 actgacatac acctagcaat taaactaaaa acttctacct attctgcatt tgcagtggac
    14581 gcttcaaaac ttcacgatat tctggattct tggatagtcg ttccatacag agtccgccaa
    14641 ccttgcggaa tccgccaacc tcgcggaatc cgccaacctc gcggagtccg ccaacctcgc
    14701 ggaatccgcc aacctcgcgg agtccgccaa cctcgcggaa tccgccaacc tcgcggagtc
    14761 cgccaacctc gcggaatccg ccaacctcgc ggagtccgcc aacctcgcgg aatccgccaa
    14821 cctcgcggaa tccgccaacc tcgcggagtc cgccaacctc gcggagtccg ccaacctcgc
    14881 ggaatccgcc aacctcgcgg agtccgccaa cctcgcggaa tccgccaacc tcgcggagtc
    14941 cgccaacctc gcggagtccg ccaacctcgc ggaatccgcc aacctcgcgg aatccgccaa
    15001 cctcgcggag tccgccaacc tcgcggaatc cgccaacctc gcggagtccg ccaacctcgc
    15061 ggagtccgcc aacctcgcgg aacccaccaa cctcgcggag tccgccaacc tcgcggagtc
    15121 cgccaacctc gcggagtccg ccaacctcgc ggagtccgcc aacctcgcgg aacccaccaa
    15181 cctcgcggag tccgccaacc tcgcggagtc cgccaacctc gcggagtccg ccaacctcgc
    15241 ggaaaaaaat ccgcgaggtt gggatgaata tcctctccat gaggccaaaa aaggtctttc
    15301 gtccgccctg gaactcgttc caagggcgtt tatcactgaa tatttcactc aaaaatatcg
    15361 ttattaagac aatcaatctg ttacagacaa cctcatggag ctttccacct ctcagaacct
    15421 cttacctaac ggacctcgct gaattccagt ctctcgaaca tctttatata taaatcaaag
    15481 gcttataata taaaatccca acctcgcgaa cctcgcggaa cttcataaaa atttttccgc
    15541 gaggttgggc tagattcctt ctgcgtgagg ttcaggaagg tcttctgccc accttcgcac
    15601 tcgtcttgag gacgtttttt cgaacatttc acccaaaaag ttcatttata agacaatcaa
    15661 gacgttacaa ataacctcgt ggaacctcca acctcgcgaa catcgcggaa tcgcaatgtg
    15721 gcgaacccag gaggctttcg atttcgtagt tctgtaggcc atccacacag gccatccagc
    15781 ccaaaaacag ccagccccaa cccccttaaa tcgaagatgg tgtacgtgtc tatgacattc
    15841 acacgtcttc ccagcttttt caccaacctc gcgaacctcg cgaacctcgc ggaacctcgc
    15901 ggaactgatt tccgcgaggt tgaaaaaaca ggaaaagggt ctgcgaggca ctaacctcgc
    15961 ggaacctttt ttctctatag gccgcgaggt tgttttccgc gaggttgtcc gcgaggttga
    16021 accgcctaaa tttctccact acctcgcgga acgtcttccg cagactccgc gaggttgaga
    16081 aaggtctttt tcccaccctg gcgctcgttc tgagggagtt catcctcgaa tatttcaccc
    16141 gaaagactca gtgccgtgac agcaacacgg gtacgatccc gtggaatgtc tagggccacc
    16201 ttcaccgcat cttcaagaga ttttttggaa tgctttgtcc cggcggcaag ctcatcccgg
    16261 ataaaggcga gaattgccgc tcttgccttc gtgatctggg cttttttcga tgcggccttt
    16321 tgttctttgg tgggtttgct tccggtgaaa tactcgaagg tgtagccgcg ccgccggatg
    16381 taaagcttcg gctgtggtgc agcataagac agcttggcgc gggccaggat gaagccgcta
    16441 tcctccggcc caagctcgaa gccttccggt gccccggaaa cctcgccgtt cacgctggat
    16501 aaaatcgtca ccatgcgcga accgtctggc aaagcggacc caccacgcac cgcgtattga
    16561 tccaatgcgc cgttttgcgc gggaaccttg ccggtgtggt ggacgatacg gacgcagcaa
    16621 tccagccccc tgatgatcct gcgacaggca gtgacgatgg cctgctcgcc atcgtttacc
    16681 atgcgctcgc cggggccgaa cgagacacag gggtcgaaga cgatcatggc cggtggatcg
    16741 tcccggtagg cggtgatgat gtcgtcggct agggatgtga gccggatgtt gccgccttgg
    16801 tcgagttctg caaaccgtac gaagtcgctg gaaacgtccc ataccgcgat gcgggataga
    16861 actgttctcc gctcgtaggg gtgaaggccc atcgcggcga tgacctcgcg gagccgtgcc
    16921 gcgaacaatt cccgcgaatc ctcggcggtg atgaacagca cggggccagg atgccaaact
    16981 ttcaagcccc ataatggcat tcccaggacg atatgcacgg cttcgtagat caacatcgtg
    17041 gtcttgccag tgccgcccgc cgccgcgatc aaggcgaggt cggcgtacag gtagtgatcg
    17101 acgaggcagc gtggactgag gcgtgcagtg tccagttctt ccggtgtgaa cgctgggaac
    17161 ggcgggggcg ttcccggttc ccgctggctc aacttggcga ggatttgccc acgcacgctc
    17221 tccggcccgg aaagcctgca caggtcgttg aaatcggaag cccttggtgg tcggctaggt
    17281 ccgaagtcgg gaagcgctac gggcagcctc agagcctttc ccaccccctc cgccgtggtc
    17341 cggcccggat ttcctggctt atccgcgtcg tcgtcgccac acagtacgat gcgccttcca
    17401 ccatgccggg cctggaccat ccgtgccacg ttctcaaggt tgccgtcgcc gtaggagatg
    17461 tagacgcggt gtccctctcc tagggcttgg tggatgctgg cggcggtggt gaagctggtg
    17521 gctacgaaga ccggattgtc tccgtcaggc gtgccgatcc accagaatcc gccctccatt
    17581 ttgctgcacg ggaagttgcg cttctggccg tccgcgtgcc ggtattggat ggactgaatt
    17641 tgaccatcag ggctgtagac cggtgtggcc agcctgccat ctggcgtcgc ttttgtaccg
    17701 tgggcttgca cacctttttg gactaattga ggcatttcag aatgggctag cgggaggttt
    17761 tcccattcga ttcgtaccct gttcgccgtt ttgtcccaaa ggcggcgttt ttcctggtcg
    17821 gctttggtgc gctcggcttc gatccgtcgc tgccgcgctt cctgctcagc ttgggtcaga
    17881 gcgcgatctt gccgcaccca gaaaaagacc ggcttcccgc tggccttcca gttgcagagc
    17941 actccgcctt cgccgtcggc gaatagtttg attgaggcat cgtctttacc gtgcggatcg
    18001 tcggtgatgt cggcgcggtg ccatcgtcca tcattgggaa cttctcgata gatgatgcct
    18061 tccgcgtaac aagcttcgcg tagcgcgtcg cgaagggcgc agctatccca tccagccctc
    18121 acgaggctgg gttttgattg tgtagacatg gttcatgccc ccgctgacgg ggatgcgaag
    18181 cgccattcgc ggcgtttgcc gatcaagtgc atcggataag taatacccac actatcagaa
    18241 tcggatttgt tgccgatgag ttcgcggtta cgccttgaga tggcgcgcgg gacggaaaac
    18301 gttgacattg gcctgggaat ccttggtttt ttcttgcatg gaaaccaagg caagccgggg
    18361 ggcgggattt tcagttttaa gtaagctgaa agttggcatt gacggcaggg tgctatcaag
    18421 ttgagaattg cacccgcacg ccgcgccccg gcctgccgcc aaggcccgca tccccttagt
    18481 tcgtcgccaa acaaagtggg gggatgttgg gccttaatca tgtctgccgt tttggcaggg
    18541 ctggcggact atagcatgtg gtccggctcg caaagcaatc gtgatatgtc tctgggaagg
    18601 cggatataat gctcggttgc tttggcgggg cgagaacagg cttgccaatg gtatggctca
    18661 aaagccgatg ctcatggagt gcccgtgttc tctgggttct ggccgctcat tttgagcgcc
    18721 gcagcgatga cggcccgcca gttcacgccg ttgcgcgagc ctgggaattg cctacgcagt
    18781 tcctcaatct cctcccgtgg tgcccatagt gcatggcgtt cttgcccttc ggcctgtcgt
    18841 tttgtgataa gtcgtttctg tcgttcaagc acagtgcttt tcaatgtttg ctcccattct
    18901 tcctgcgaag attcccccag tagctcgggg tgttccgccg cgatgcggtc cagcgccgcc
    18961 aaggattcct tgacggcctg gaagtcgata gttttcgcca tcatgccacc atgcgttgaa
    19021 tctgggtggc cgcgaaaacc ttgccgttcc gggccttgaa acccttttcc gccagcaccg
    19081 cggcgatttt gcggaggctc aggcccgccg tatggagcct gcgggcttcg gcgatgattt
    19141 cctgttcagc gggcacgtcc accagggcca cgccatcccc tgccagcgcc ttgccgtagg
    19201 gcaccgcgcc cacccgttcg cccttggcct tcttgtgctg catggcggtg gtggtgcgtt
    19261 cggccagttg atcccgctcg aattcggcca tgacggctag catcctaaac accatcttcc
    19321 cggcggcggt ggtggtgtcg atcttctcgg aaatggaaac gaggtcggcc ccggccttgt
    19381 ccaggcgttc ggaaatttcg atggtgtgct tggtggaccg ggagaggcga gaaaggctgt
    19441 agaccacgag ggcatcgccc ttgccgacag cggccagcgc cgccgccagt ccgggccggt
    19501 cggccttggt gccgctgata ccggcgtcca tgaagatgcc tgccagttcg tagccgttga
    19561 ggtcggccca cgcggcgacc ttggccttct gcgcgtccaa ggaaacgcca tcggtggctt
    19621 gttcctcggt gctgacccgg atgtaggcgt aggctttcat gctggcgacc ccgtgttaat
    19681 gattaacatt ggccgattat gctcttagtt aatgcttaac gcaaactttt tcggtcggta
    19741 gttgaaggtt tgatgggcgt agttggaacc aaaagaggaa ccattgtgga attgatgccg
    19801 cgaaagttag cggcgaagtt agcacccacc ggcaaaaaga catgatgctg ggatgggcgc
    19861 aagcaccctg cgccgagttg cggcgtggtt gcaggccgtg aacgtaaaaa gggggattca
    19921 ggccacgtcc tgataaaggt acttctggaa gccgctgaaa acctgcccga tctcgcggcc
    19981 caagtcggcc acggcatccg ccgtcgagcc gtatttgaga tgcagcagcg gggtcagctt
    20041 ggtctggtcg agttcctcca cgccgacgct gacatagtgc gacagcacga aatcgaggaa
    20101 gacttgttgc ttgctgttga aatgcgtgct gatgatgacc ttggccttgc tggcccgttc
    20161 ctcgcgggtc agtggcggca aggcgtaggc tacatgggcc agcacgtcga acaggtcgct
    20221 tttttccgca tcaatgactt tttgcatcgc caccagttga tccctgccga agcctttttc
    20281 ggcgagtcct tccagcaagc gcttccgggt atccggtgcg ctccataagc tgcggagttc
    20341 gctttcgtct ttgaagaact cgggcaattt gccgaacagg gcttcgagga attgctgcgc
    20401 ggtcatcggg gtgccgtccg ggtgccagaa ggtcgtttcc agcgtgtgcc ggatgttgcg
    20461 ctccttgccg tccgccagtt ccaccttcac ttttttccgg caggcgcacg ggcgctggaa
    20521 acactccggg caaggcgatt tctcgcattc gcaggggcgt tggccgcaag cggggcaagg
    20581 ccggggcggc tttttttcac attggcaggg gtagctgtcg catcgggggc agggttccgg
    20641 ttccatcggt tcgccgtccc attctgggtc gttgaaatga tggtgggcct tcacgaagtc
    20701 gtagatcgtg aaatagccct tgccgtcata gaggcgggtg ccccgaccga tgatctgctt
    20761 gaactcgatc atggaattga tgggccgcat caggatgata ttgcggacgt tgcgggcatc
    20821 cacgccggtc gagagttttt gcgaggtggt caggatggtg gggatggtct tttcgttgtc
    20881 ctggaagtcg cgcaggtatt gctcgccccg tgcgccgtcg ttggccgtga cccggtggca
    20941 atagttgggg tcggtgccgg tcttggtttg gttgatgagg tcgcgcacgg ccaaggcgtg
    21001 ttcttggttg gcgcagaaca ccagggtttt ttcccgctgg tcgatctggg ccatgaagat
    21061 ttcgacccgc ttccgctccc gttccatgat ttcgatgttc ttgttgaagt cggcttcggt
    21121 atagcgtttg tccgcctcga tttggccttc gaccacggtg tcgtcggcgg catagacgta
    21181 ttcgtccagc gtggtttcga tttgcttgac ccggaacgga gttaggaagc cgtcgttgat
    21241 gccgtccttg agcgagtagg tgaagaccgg ttcgccgaaa taggcgtagg tgtccacgtt
    21301 gtccttgcgc ttgggggtgg cggtgaggcc gagttggacg gcgggggcga agtaatcgag
    21361 gatgccgcgc cagttgcttt cgtcgttggc tccgcctcgg tggcattcgt cgatgatgat
    21421 gaagtcgaag aaatcggggg gatagtcgcc gaagtagggc gagggttggc cgtccttggg
    21481 cgggccgctc atgaaggttt ggaagatggt gaagaacagg ctgccgtttt tcggcacccg
    21541 gcctttcttg cggatgtcgc cgggttcgat gcggaccaag gcgtcttctt ggaaggcgga
    21601 aaaggcgttg tacgcctggt tggctaggat gttgcggtca gcgaggaaca ggacgcgcgg
    21661 gcggcgggtc ggctcgcttt cctgggtcca gtccgccagg ttccaccggc tgcggaatag
    21721 cttccaggcg atttggaagg cgatgaaggt tttgccggtg ccggtggcga gggtcaacag
    21781 gatgcggttg cggcctgcgg tcagcgcccc cagtacccgt tcgatggcga tgtcctggta
    21841 gtagcggctt tggaagtagc cgccgcggtc ctcgaacggc acggcggcga agcggtcgcg
    21901 ccagaggttg tgttgggtga aggcgcggtt ccaaagttcg gacggggtgg gataccgcgc
    21961 cgtcttgccc tcggccccgg tctgcatgtc gatggcgtag atgccctggc cgttggtggc
    22021 gtaggcgaag cggacggtga gcttgcccgc gtaatccttg gcctgcccga cgccttcggt
    22081 gaggggtttg tcccaggctt tggcttcgat gacggccagt ttggtgttgc ggtattccag
    22141 cacgtagtcg gcgctgagcg ccctgccgcg ttggccgtgg ccttcgatgc ggcccagggt
    22201 gatggggtat tcgcggcgga tgcggctgtc ggggaccacg ccccagcccg ccgccttcaa
    22261 cgcggggtcg atatggtcgg cgcgggtttc ggcttcgttc attgggagtc ttggggtggg
    22321 cggtttggac taccctggcc cggtgaactc cgatagcagc agggcttcag cgggtggcag
    22381 gatgcgtagg cccaatgata gcgcactgtc ccgcaaatcg agcaagtcct tgtcgcctgt
    22441 caccagccag ggggtgggca cggctagcgc ggcgtggatg aacttgtcgt cgtctggatc
    22501 gcggctgtag gtttgggagg cgatttcctc tggcacctca acccacttcg cggaagcgtt
    22561 cagttcgctt agcaggcgtt tccggcgttc gatgggtagg tagcggtcga acttgggttt
    22621 ccagatgcgc gactcgaatt ccgcgaaggt tgcttccgaa accactagcc gcctacctgc
    22681 cagcaatcta tccaccagtt gcgcgggggt tccctgcggg gcgagggccg cgctcaggag
    22741 tacgttggta tcgacgacga cccacgtcct ggggtcaact ttcatcggcc aacagttcgg
    22801 ccagcttctc ttcggtcagc ccggcagcgg cggcaccctc ggcgcattcc ttgaaggtgt
    22861 ggcgcagccg atccgcatag aaggcccgca tcgcttcgta gtcctccgcg ctgaccatga
    22921 cgccgaccac gcggttgtgg cgggtgactt gcactggccc gcgctgggcg cggtcgagca
    22981 gttcgccgaa gcgggtcttg gcttcgttgg cggtgaaggt ttgcatcgtg gtgcctctgg
    23041 gtccgtgggg taattgggcc agtttaggcg aatcgttcga tttagaccat tcgccatcgc
    23101 ttgcgggtca aagctggccg gtgaaggctt gatgcagcag ggtttttttc aactcgtcca
    23161 gggcggctag tttctggcgg tagatggatt ctaggcgttg aatttgtttt tgaatatcat
    23221 caattttttt cacgacttcc atttgctctt ctaaatcaat tgggtatcta attacaactt
    23281 ctctgatctc ttgcaaatga agatttggaa ccccgatgcc ttttaatcgt ttattgaatt
    23341 gatatttagc aactggcgag ttcatgaagt gaagtaaaaa ccttgggata acaaatccaa
    23401 gagttcgtat taatgccaga ctaacataaa tatcaaaaac gacatctcga tcaactatgg
    23461 ctgcaacacc tgtagttcca ttttttgcta acaaaatatc gttaaccttg ggagccacac
    23521 gtttatgcat ctcaacatgc tgcttaatat caatgtattt gatgtcatcc caatttattt
    23581 ttccgctagt tacatttcta gaggatagga aaataatacc attatcaaaa taggttggtg
    23641 tttggtgagt tccatctgtg attttctcac aaacatcttg taatcgtttt tccgtccatc
    23701 cttcactctg ctgagtaaaa acagattgca gatgactttc aaacagggcg cgggcgttct
    23761 gtaggttcct ttccgcgttg gccttggcgg tggcgatgcc gtcgaaggct tcgtctagga
    23821 tggcgactat gcgctgttgt tctgaaagcg gaggaacagg aattttatac tgttcaataa
    23881 aatctttact aacccgctta tgcccaacag cgccactcat ccgctccgcg ccttcccgcc
    23941 ggaaagaatc acgcgaaaga aagtagtaaa gccaatcttt attcactgac gagcttgggc
    24001 gaaatactat atattcgctt gaaccgaatc caataccatt gcttaaattt tcagcaattc
    24061 ctagttttcc gttctcaaag caaggcgtta ttttagcgag cagaacatcg ccatccgcaa
    24121 aataggtata gcttccaata acttccaaca atggcttcgt ttgcgtggga actaataatt
    24181 tttgttctat tcccaaatct tccattggca caaacgaaac taagtccgtc tcggaaagct
    24241 ggcgacgaac ctcagacttt ggtggtttta tctgacatac atcagctagt gattttagct
    24301 gccaacccgt tttcatccca acaactcccg aatccccgcc aatacctccg cactctccgc
    24361 atccagcgcc acaatctcat ccatgatgtc ctgcgggctg cggtgggtaa caacatcgcc
    24421 gccgttggga ttcttcaccg aaagatcaaa agtcgccggg tcgatattcg ctatgtccac
    24481 gctccaactc ttgggcgaat cggcaaacgt cctttgcaac tcgacgaact cggccaggtc
    24541 ggcatcgttc aacgggttgg tcttgcccag gttgcgaccg ggatcaagct ggtaatacca
    24601 gaccttccgg gtcggcgtgc ccttctcgaa caacagcacc acggttttca cccccgcgcc
    24661 ctggaacgtg ccgccgggac aatccagcac cgtgtgcagg ttgcagcttt ccaccaagag
    24721 cttccgcagg ctcaccgaag cgttgtcggt gttcgacagg aaagtattct tgatgaccac
    24781 accggcccgc ccgcccacct tgagcatctt cacgaagtgt tgcaggaaca ggaacgccgt
    24841 ttccccggtg cggatcggga agttctgctg gacctccttg cgctccttgc cgccgaaagg
    24901 cggattggcc aggatcacct ccatgcggtc cttgtcctgg atgtcggcca aactctcggc
    24961 cagggtgttg gtgtggacga tgttcggcgc ttcgatgcca tgcaggatca tgttcatgat
    25021 cgcgatgaca taggccagcg acttcttctc cttgccgtag aaggtgcgct cttgcagggt
    25081 cttgaggtcc gccgtggtca gattgggctg ggccttgaga tagtcgaagg cttcgcacag
    25141 gaagcccgcc gaaccgaccg cgccgtcata gatgcgctcg ccgaccttgg gctttaccac
    25201 ccgcacgatg gcccggatca acggacgcgg cgtgtagtat tcgccgccgt tgcgcccggc
    25261 gttgcccata ttcttgatct tggcctcgta gaggtgcgat agctcgtgct tctcggcctt
    25321 ggagccgaag cgcaattcgt cgatatagtc gatgatctcg cgcaggttat agccgctgtg
    25381 aatcttgttt ttgatctcgc cgaaaatctc cccgatcttg tattcgaggg tgttcggccc
    25441 gctggcccgc tgcttgaagc cgtgcaaata ggggaacaac tgccggtcta cgaattcccg
    25501 caggtcgtcg ccggtgatgg cgcggttatg gtcgattttg ccctcggggg ttttcggcgc
    25561 ggcccagttc tcccagcgga aatgtggcct ttcgatgatg taggcgtagg accggccttc
    25621 catctcggct tccaaagcct tgtcctgctc caggccgtcc aggtatttca ggaacagcag
    25681 ccaggaagtt tgttcggtgt aatccagttc ggtggtgcaa ccggcctctt tgcggagaac
    25741 gtcgtcgata tttttgaagg cttgttcaaa catgcggggg gtaatcactc gggaggaaaa
    25801 aaggccggtt cacggccaaa ggcgctttac ttgcaagaaa gtaatgatgt aaacatgttg
    25861 attttattca tccaccgtgg gtacatcgta cttgcggaaa agatcgttga gcgattcggc
    25921 aatcagcgct tgcaagctgg ttccggtctt ggcctggatg aggcgcaagc tggctttgta
    25981 gtccggcgaa aggtaggccg tgatgttggt tttgccctcg cggctcggtg ccatgtagcc
    26041 ctgcgtggtc ccggatgtcg gagcggcctg ggatgcgttc ggcgttttct gcgtgccttt
    26101 cagcgcctct tgcaaggctt gcatgttctt agccatgttt acatgttctc gtgttgagtg
    26161 atgaacttgt aaagccggtc gatttcatcg gcggctttgc cgtccgggtc caattcctgg
    26221 ggcgtgctgc cggtggtcgg cgcttcggcg tagctgccac ggtggcagag gtggaacggg
    26281 caaaccttga acccggtggt ttgctcgatc atggccttgg cgtcctccgc ttgtttcctg
    26341 gcctgggggt gtaggccatt gaggatcaca taggccgggg tatccccagc cactcgcaat
    26401 aggtcgcgca cgccgggcaa ggtctcaagg tcgaatatct gcggcctaac cgggatcaag
    26461 accaggtgcg cggcgcgggc cgcttccacg gcggcgctat cggatttgcc gggggtgtcg
    26521 atgatgacga actccgcgcc ataggtccgg gcggtttcga gggtttgctt gaggcggctg
    26581 accggcgcgg cgatgacggc gggattttcc ccggtcctcc ggtctttcca gttcgccgcg
    26641 ttcgcctggg ggtcgaggtc gataatcacg gcggcttggc ccgccctggc tgccgaaacg
    26701 gccaagcata ggctggtggt ggttttgccg gtgccgcctt tctgtccgac gatggccgtg
    26761 acgaacattc tatcttctca agatgtgaac atgttcatca tctaacaaca tcgggtttgg
    26821 cgctgtcaag tagggttagg gtgggtcgga tatttcgcga aatattatgc cccttatggg
    26881 cgcgggcgcg tgggtggttg tggttcggtc aactgcttga ggatgcgggc gatgccatga
    26941 acaaggattt catgttgtcg caggtatggc tgtaggccga tgatggtttc ttggtccagc
    27001 cacaggtgca ggcattcttg ccccgcctct tttcgccgct ggcggtggtt gcggatgcgt
    27061 tcggcgttag tggtaggtag agcgccgggg cggggcttgg tgtacaggtg ggtcattggc
    27121 tattcctccg tgacgatgcc ggtgccttcg gtggcctgcc gggcttcgct ttggctggcg
    27181 agtatgcggg aaacggtgct ttggtggatg ccgagcgccg ccgcaatggc ccgctgtgaa
    27241 agaccggcag cccgcaatga tgaaacgtcc gatgaaacgt ttggtgatgc gttgtcaaaa
    27301 gtgcgttctt tgtattcggg tctgcctccc gtctttaggg tttggtgtac ctgttgtctg
    27361 tggacttcca ccgtctttgc gatttcagct tgccgcaagc cttcggcgct taatcctttg
    27421 atgcgctcgc gtttttcttg ggcgcgggct tcgtattcct cgcggctcat ggctccggcc
    27481 ttgtggcgtc gccgctgtgc tttttcctcg gtgccgatga tcgtggtcag ttttttttct
    27541 tcttccgggg tgacttccag caatttcagc aggtaggcgt ttgtcatgcg gtatcggttc
    27601 ggtacgcgcc ggccttccca gactggaatc actatgccgc cttggtcgag ttttaaacgg
    27661 tcgatcaccg ccttgactcg gctcgcctcg tatttcttgg ggttcaggaa atgttcttgg
    27721 gcgaagtctc gcaactccac tttcagtctg ttttcgtcgc cgatgtacca cgtcagcgag
    27781 gtcgcaacgg caaagagcat tcgtgaccgg caatccttga gtttgccgcc gcgcagcttc
    27841 gccaaggttt cgtaatcgct gagccgtgcc cggtgcagca aatatggacc gagcaggctt
    27901 ttcgcttgct tttccgatag cttccgggtc tgttcttggc ttgttggttt cggtgtggac
    27961 gtttcgcttt ggttggcatg gcccagcgtt tctttagctg ttgggcttgg tttgcgattt
    28021 ccggtttcct tgtggtccgg tgcggctttc ggtgtttcga tggcccgcag ggttccagca
    28081 tatcccagca cggcccggcg gatttcatcg aatgccacgg gtattccggt tctgtaaccg
    28141 gtgacttcgc gcctgttttt ctgatttgtc ccgcccacaa tgcggagaac ccgcgttgcg
    28201 tcccggcacg ctggatcggc cccgaagtcc ttgaacatcg ctatcaggca atccatgact
    28261 tgttgccatt gcgcgaggtt ggtgggtggt agcggtttat cgaataccca ctcgaaatat
    28321 gcgccgcgcc cgcttgaaat caccagcgtg ggcatgggta gcgtggggta tctggcttgt
    28381 gccctgtcga gcaattccat tggaccgacc cgttttaacc gcgggtcttt gtagaaatcg
    28441 aggtccaccc acagggtggg cagggcggcg acttggccca gcatacggcg gtgatggaac
    28501 ccggactgcg aaaagtacag gtccatcctg tcgaagccgg gggccatttc catgacgaaa
    28561 cgggtttcct cgggcgggaa tgtccgttcg tggggtttgc cttcgatggg aatcgataga
    28621 taggccactt tcgttgaatg tccaccgtgt acggtgtcga aatgctcgcg tggcccgata
    28681 gcgggcgcgg gtggtccgaa tagatcgagg atggcggcgg cgttcataac tgcctcctgc
    28741 gccaaggtga acctaaaact gcaggatttt ggatgcggct atcccgtccc ggcttctgcc
    28801 gggcatcgtt tggtttttgc atggctgccc cccatcaagc ggcttgggcc ggatgggctt
    28861 ggggcttgcg gggaggggtg gtcaagagcg tccacacgtc attacggcgg acccgcactg
    28921 acttggtgcc gctgtaaacc gcctcaatct gcccttgctc gatggcttga atgagtcggg
    28981 ggcgggaaat gggcagttca cgcacagcgg tggaaatgga aatccagtcg gaatctttac
    29041 gattcataga gttacctcac agaggagtga ggcttacaca acaaaaacgt gcggggggat
    29101 tcttttgtgg ggtgtgaatt cgctataatc cacggtactc gccaaatttg gcgggtcgga
    29161 gataggcaac cgttccacgg taaaacctaa tccgcgcttt tgagagggta agccccttga
    29221 ttgcaaaaac catggacccc gctttcgcat tctgtagttc gcctgagaaa ctggctacag
    29281 aatgcggggc ggggtctaaa cgttttaagc cccgcaagca ggatgacgat attataacgc
    29341 cctgtacggt tgacacaaaa tattgaaaaa tttgtgctgg gtgacccatt atcttgtacc
    29401 tacccaacaa aaaccgcccg ctgattacaa atcagccgac ccagccggat aggaagcatt
    29461 attctttggg ccggtccttg ccctccacat gggccagcgc caccttgatg atggcttgcc
    29521 agttgatgcc gccacgaatg ccaggatatt cccgtttcaa ggcatccgca ttgtcattat
    29581 caagccacag ataaacctgt ttcttgccct cggattggcg cttttccgca tattttctct
    29641 gacggtctgc gcctgtttgt gttttgctca aatattccat ggtcctttgt tcatttcctt
    29701 gagatagctc ggctatccgg tcaagtatct tcccggctac ttttgggtcc atcatgccgc
    29761 ctctgcgata tttttaacgg tttgaggatg ccacgtcttg cccctcggtt tcatgtcgcg
    29821 ggcctcaagc tctgcggcga ttttcgggta gctcatgccg ccctcgcgca atagcttcac
    29881 cagccggata acctcctgct cagcttcgtc gtctacgagg gttttcccgt cttcgctcag
    29941 gcgcttgccg tagggaatcg accctcatca cctatcaatt tcgcatggcc gcgcaaaagg
    30001 cgggcaaagg catgtcgttt tgtaggcgtc gctttaggta gcgcaagccc cgggtgaacc
    30061 aggaaaccaa gctgcggcgg agcttcctga agctccagtg tccggcatcg gtttgcgacc
    30121 aggctttttt tcgagcggcg ttggacggtc cgaggcgtcg tcccgcccga cctggacgca
    30181 ccaccacatg gccagcgaca tgacgaggat caggcgttcc aaacggtcgg cgtgttccag
    30241 ttgcgaatcc tccaacccga agccccggcc cttgaaatcc gagaacatgg gctcgatgga
    30301 ccagcgcgcc gcgtagtcca acaccgccgc ccgcgtgggg gcgcagtcca tcgcgatgat
    30361 ccagggctcg ggatggccgg gttcgtggag gatgcccacg tgggtcatca ccccgtgcgc
    30421 gaacagccgc actcccggca gatagcgttc ctccgcgccc cgcgccagtc cgcccgtggt
    30481 ggtttcctcc ccttcgccgg tgtccgccag cacattgcct ttcaaccgca gccgatagcc
    30541 ccagccccgc gcgcccagcc aatcgaacaa ggccaccgag gggtagaacc ggtccgccga
    30601 gagcaatacg tccgcccccg gcggcagcca ggccaggacc cgctccaaca cccgctcctg
    30661 gccctcgaaa ccgatattgg ccggcccctc ttccgccacc caggccaagg gcagcgcccg
    30721 gtcgccgacc cgcacgccca ccatcagcac cgccatccgg tccccgaggt cggtctggtc
    30781 caggctcaac tgcacggtct ggccgttccg cgcggcccgg gcgagttcgg cccgcgcgaa
    30841 cggctccatc accaccgccg accccagcag cggattcttc aacaagcgcc tcagccattg
    30901 ctcgcgcatg tcctgcctct ccgtcggcaa gggcagcagg ttcgccaact ccaccgtgtt
    30961 cggcgtccgc ccctcgatca tcgcccccac cgccagcgcc agcttcccga ccaccgtctt
    31021 gcgcagtcca ggaagggcct gttccagccc acgccctact tcctcggcca gtttctttac
    31081 agttcccatc gcttcgtcag tcgaaattcg ttccggcctt caagcctacc cgaaaattga
    31141 taggtgatga gggaatcgac ccaacccgtc caccctgtgc tttcttgtgc tgtaaggcgt
    31201 tgctggtgcg ctcgctgatt tggtcccgct cgaattcggc catgacggcc agcatacgga
    31261 agaccatctt cccggcggcg ctggtggtgt cgatcttctc ggaaatggaa acgaggtcgg
    31321 ccccggcctt ggtcagccgt tcggaaacct cgatggtgtg cttggtggac cgcgccagcc
    31381 gggacaggct atagaccacg agggcatccc ccttgccgac agcggccagg gcggcgacga
    31441 gtccgggccg gtcggccttg gtgccgctga taccggcatc ctcgaagata cccgccagtt
    31501 cgtagccgtt caggtcggcc catgcggcaa tcttggcccg ctgcgcttcc aagctgatgc
    31561 cttcgtccgc ttgcccttgg gtggaaaccc ggatgtagcc gattgccttc atggtggtgt
    31621 gtccgcttgc gttagttggt gatgaggatc atatcagcat caccaactaa cgcaagcggt
    31681 ttcttcaatt accgctcccc tcgtaacaca cccaccggct cgttacggat cgcccccgta
    31741 acaaaggggg tggagcggtt cattccccgc catcccgcat cctcaaaaat tcggcccaag
    31801 cccgttcggc gtcggcggtc ggacttcgct cgggcctccg acaaggcgag taagcgggca
    31861 taaaaaagcc gacccggttt cccaggtcgg cgcgggtgta ttacggggat ggggttagat
    31921 cgggtatcgg cttctaaatg cgcttgatgc tgccttcaac ttttttgact tccagccggg
    31981 ccatcgccaa attggcgcgg ctgcggtcca gtgcgagata gatgaaaatt tcacggttgg
    32041 agttgagcgg gcgcagcagg tgatactggc taccaaggct gatgaggatg tcttcgatat
    32101 tgtcgtcgct gagtccgatg gcatccatcg ccttgagctt ggactgcaac acttcggtat
    32161 tggccgccgc ggcgatttcc accggataat taccgaccac caacgattcc agcatcatgc
    32221 cactgctgga atccacgagc gccgcagcaa tgaacccatc cagttttttt agtgattcca
    32281 cagtattcgc catttctcta tctcttcgat tgtttgattt aggtaatcca agggtccgcc
    32341 ttatatggtt atttgtgccg acttcatttc atcgaaccgc tgttccatat tgcctatccg
    32401 catatgagca gtgataagcg ccgcacgtgc cacctcccgc caatcaatcc caccgtcctg
    32461 atgcggaaac gaggcttgaa gctctgccag ggtatcggcg ggtaatccgg ggaagcatgg
    32521 ctgggattcc cgtagagacc tatctgtcgc caataagccc cggatggctt ccgccctcgt
    32581 gcctcccagg ccgtccagcc tcgccaattc ttcgggggct agatagattt ctactcggct
    32641 cttttggact ttcgcccgcc acgttgcttg atgctgtgcg ctcgccatcg ccttgcctat
    32701 tccggtagat cggatgagct gattgtagca gatgatagcg atttcttccg gtagacatcc
    32761 cccgtcgcgc cgtccgaccc cgcctttttt gccgcccgcc ttgcccgcgc tcgcgccgcg
    32821 atctctcatt ggcggtggcc cgcccgccct ggccgattcc tagccatccg ccccgaagcc
    32881 aagcgccgcg ccgggtccgt tcgttcatcc ggatcgccga ggctgggcgc gccagtggcc
    32941 ggtcggggaa ccgttcattc cccgagttgc ggaagctgcg ggcagaggaa atcgataaaa
    33001 ccgttactaa cactagattt gtgagcaagt cctaacgaga cccgccgcca tgatcgtcaa
    33061 aaatatccct cacgacgatc ctgcccaatg tcgggatttc cgaataggcc tctctgcgca
    33121 tctactacgc cgtccaccct gttcgcgggg cgatctccac aattgttgat tctcgcgcca
    33181 gcgcggcacc ttgcccgccc ctttcgagga attgaaaatg actatcacca agaaaatgtt
    33241 acttctaata actttcaatt tattaggttt gattggtttg tcggtcctgg cgaattacca
    33301 aataaaacag gtattcactt cggccaatta tgccaatatc aatagcgtcc cctctttgat
    33361 cgccgtgaat tctgagatca aggcgttcgg tcaggtcagg gtccgcctgc tccggcacgt
    33421 cctcaacgag gaccggagcc aaatagaacg gctaggtcag gaattgaaaa gcgcccagcg
    33481 cgatctggcg gcggctttcg aagcctataa gccgctgatc tccaacgccg aggaccagca
    33541 cctgtttgag gcgaacttgg tgaaatggaa ccagtacgag gcgggaattc ccccggtgct
    33601 ggcctcctcc cagaatatgg acaaaaggtc agcccgagac gcccttgatc gcttgaccga
    33661 tctcggccgg gatttgcaaa acagcctcga ggcccacgcc aagtacaacg ccgacctggc
    33721 ggggaaagca gccaccgagg ccatgaacat ccaagccgcc gccctatggc aaagctgggc
    33781 gggggcgctg atcacggcag ccttcgtcgc cggtgtcggc tactacatcg cccggaccat
    33841 cctgcgccaa ctgggaggcg agccgggaac ggctgccgaa atcgccaacc gcatcgccga
    33901 tggcgacctg tccacgcaaa tcgtattgaa gtctggcgat accggcagct tgatggccgc
    33961 catgcaacac atgtccacca atatcaaagc cctggtcgat gactcgttga tgctgtccga
    34021 agccggaacg gaaggcaaac tcgccacccg cgccgacgcc tccagacacc gcggcgacta
    34081 ccgtaggatt gtagagggca tgaactccac cctcgacgct gtcgccgggc cagtggagcg
    34141 tattcgcgag atcatgggcc gcgtggccga aggcgacctg accgtagccg tcgccggcga
    34201 ttatcggggt accttcctcg aactcaagga ggcgatcaac gacgcggtgg gcaagctttc
    34261 caaaaccctg gccgaggtca atcaagccac cgagtccatc tcttcggcct ccgagcaact
    34321 gagcgccacc tcccaatccc tggcccaagc ttcttccgag caagcctccg gcgtcgagga
    34381 aacctccgct tccatggagc agatggccgc atccatcaat caaaacaagg acaacgccca
    34441 ggccaccgac ggcatcgccg agaaaaccgc cagcgaggcc attgagggcg gacaggcggt
    34501 cacgcaaacc gtccaggcaa tgaggcaaat cgccgggaaa atcggcatca tcgacgatat
    34561 cgcctaccag accaacctcc tggccctcaa tgcggccatc gaggccgccc gcgccgggga
    34621 gcacggcaag gggttcgcgg tggtcgccgc cgaagtccgc aaactggccg agcgctccca
    34681 ggtctcagcc caggagatcg gcgcattggc cgcatccagc gtcgctatgg ctgagcgggc
    34741 tgggacgctg ctgggcgaaa tagtgccctc gactaagagg acatccggca catcttgtgc
    34801 tttgcgcggc gaacgcttaa aagacccgtc ttttgcgaag cggaagcgga ggagacccat
    34861 gagttgcctg gaaatctcgg accggctgtg ggagcacgtg gagccattgt tggagccgtt
    34921 caagcggcgc aggccgggcg gctccaagcc gctggagttc cggacggtca tgaacgggat
    34981 tctgtatgtg ctcaagaccg gttgccaatg ggattgcctg ccggcctgct acggctcgaa
    35041 aagcgcggtc cacgagcact ttcagagatg ggttgccgcc ggcgtgttca aggagatgtt
    35101 ccgctggtcg gcggcggagt acgaggaact cgaggggttc gacctggctt ggcagtcgat
    35161 ggacggcagc ctggtgcagg ccccggtccg ccaagcccgc tgccagaagg acgagggcct
    35221 ggggcgcaat cccacggatc gtgggcgcag cggtggcaag atccaccttc aggtggacgg
    35281 gaaggggatg cctttcgccg tcgcgcaggc cggggccaac gtgcacgaca gccgcctggt
    35341 gacggtcacc gtcgaggcgg ccgtgatcga ggcacccgcc gacgccgggc aaagtcccag
    35401 gcatctttgc ctggacaaag ggtatggcta cgaacgggtc gagcgggaag tcgcgggact
    35461 gggctacacc ccccatatcc gcaagatcgg cgaggagaag cgttcctgcg actccgagcc
    35521 aacccacccc gcgcggaggt gggtggtcga gcgcgctttc gcctggctca agggcttccg
    35581 ggccatccga acccgctaca cctgccgggg agccaactat ctggccttcc ttcagttggc
    35641 gtgcgccctg atcctgggaa gacggatcga ggccaaaacc gtgtaagcag tttatgtgcc
    35701 ggatgtcctc taagaagacc gccggtttgg tgcaggagat cacctccgcc tccgaggaac
    35761 aggccacggg cgcgaagcaa atcgccgaag ccatgaacca gcttagcaag accatccagc
    35821 agaacgcctc ggcttccgag gaactatccg ccacggcgga ggaaatgagt ggacaagccc
    35881 tggaattgag gcaaaccctg agtttcttca aaatctccgc caatgccacg gaccttacaa
    35941 cccctcgcta cgcgataaag acacggacgt acccccccca ggcccatact tcgaatagca
    36001 cggatagggg cggccatgaa cagggcttct cccgtttctg agcgggggac gagcacctgt
    36061 aaaaggtgat ggaagaccaa cttcctacca gttgcccaca ggttctgtgg ataacccggt
    36121 tgtcgccctg ccagggtgcc ggacggatca tgagccggcg tccggccccg gttgccccgc
    36181 agccttcttc gccgccccga tgatctctgg gaaatcacgg acacggataa gcttcacttc
    36241 cggggaagct gcgaaggccg ggcgcaaatc tgcttcgagg atgacggcgg gaatgcgtct
    36301 aggtgcttcg gtccctacga tcatgttcgg atcgccgatg ggactattaa cggcgacgat
    36361 agggtaatcg ccctatttct ggatgattcg cgccgatgga tgtccttgac cgaccgcacc
    36421 gattggcccg ccgtggtggt gaaggctgca taaccggacc aaggccaccc tccctgacac
    36481 ggtctgccat gttctgatgt gtcctgtcct gttttatttt gtcatatgcg gcccggtctt
    36541 ttttgggtcg gcaagaatag ctttagattc ccgaaaatcc ccccgcccga ccgttactgt
    36601 gtacgcatta tgtatacaca gtaacgtcag gagtaaggcg aggtctggcg ttcccattta
    36661 cgggaatcga tgatgatttt ttcgccgacc gaacgcaatt gggatgggca aataaaaacc
    36721 cccggacacc aactatgggg gggtgcccag ggtttccatc gagcatccca tccacttgga
    36781 tagctcaacg cggcaaagca tagcgggctg tggccctcgc caagccgggg cgatatatac
    36841 ccgatgcgcg aggtccagct ttttgccgtc tgtggcgtag gtgtttcccc ttataggcgg
    36901 tatgtaccgt cgaaggaatc atcgccgtgt ccgccagttc cttacctgtg tgaaggcgga
    36961 catagggaga tgtgaccgat ccggtaagcc gggtcggctt ttttgcttca aggaggaagc
    37021 tatgcgtgcc tatatcgacg aatccgccaa cctgcgtgtg atcccggaaa cccccggcga
    37081 agctttgatg ctcgactatt ggttcatggc cttcataggc cagctttccg gcaatcgttc
    37141 ggcgggcctc gaaatcggca ccaacgtggc gaacgcgact ccgcttcggg attcctacgc
    37201 ggatgaataa gggcatc
//