LOCUS       AP019783             4607412 bp    DNA     circular BCT 02-JUN-2021
DEFINITION  Methylomagnum ishizawai RS11D-Pr DNA, complete genome.
ACCESSION   AP019783
VERSION     AP019783.1
DBLINK      BioProject:PRJDB8374
            Sequence Read Archive:DRR180485, DRR180486
            BioSample:SAMD00172935
KEYWORDS    .
SOURCE      Methylomagnum ishizawai
  ORGANISM  Methylomagnum ishizawai
            Bacteria; Proteobacteria; Gammaproteobacteria; Methylococcales;
            Methylococcaceae; Methylomagnum.
REFERENCE   1  (bases 1 to 4607412)
  AUTHORS   Asakawa,S. and Watanabe,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-2019) to the DDBJ/EMBL/GenBank databases.
            Contact:Susumu Asakawa
            Nagoya University, Graduate School of Bioagricultural Sciences;
            Chikusa, Furocho 1, Nagoya, Aichi 464-8601, Japan
            URL    :https://www.agr.nagoya-u.ac.jp/%7Esoil/
            Soil_Biology_and_Chemistry/toppupeji.html
REFERENCE   2
  AUTHORS   Asakawa,S., Khalifa,A., Lee,C.G., Ogiso,T., Ueno,C. and Dianou,D.
  TITLE     Complete genome sequence of Methylomagnum ishizawai strain RS11D-Pr
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.7
            Genome Coverage       :: 725x
            Sequencing Technology :: Illumina NextSeq, GridION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4607412
                     /collection_date="2003-08-11"
                     /country="Japan:Aichi, Anjo, Aichi Agricultural Research
                     Center"
                     /culture_collection="JCM:18894"
                     /db_xref="taxon:1760988"
                     /isolation_source="rice rhizosphere"
                     /lat_lon="34.97 N 137.07 E"
                     /mol_type="genomic DNA"
                     /organism="Methylomagnum ishizawai"
                     /strain="RS11D-Pr"
                     /type_material="type strain of Methylomagnum ishizawai"
     CDS             1..1338
                     /codon_start=1
                     /gene="dnaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83FD8"
                     /locus_tag="MishRS11D_00010"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BBL72903.1"
                     /transl_table=11
                     /translation="MSALWTQCIAKLEGELPPQQFNTWIRPLQAVEEGAELRLLAPNR
                     FVLDWVKQHFIGKIEEVLAAQKLQPAPSLILEIGSRKSADSAAPAPSPASASKKTQGA
                     KKSLPHNLNTGFTFDSFVEGKSNQLARAASVQVAQNVGRAYNPLFIYGGVGLGKTHLI
                     HAIGNEILRANPSAQVVYLHSERFVSDMVKALQHNAIGAFKDYYRTVDALLIDDIQFF
                     AGKERSQEEFFHTFNTLLENKHQVVLTCDRYPKEIKGLEERLKSRFGWGLPVAIEPPD
                     LETRVAILKSKAVNLGVELSDEVAFFIGKRIRSNIRELEGALRRVMANSHFTGKPITM
                     EFAKDALRDLIALQDRLINVDNIQRTVAEYYKIRVSDLLSNKRTRNLSRPRQMAMALA
                     KELTNHSLPEIGQMFGGRDHTTVLHACRKSEELRACDNKFAEDYSILLRTLSA"
     CDS             1362..2462
                     /codon_start=1
                     /gene="dnaN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I7C4"
                     /locus_tag="MishRS11D_00020"
                     /product="DNA polymerase III subunit beta"
                     /protein_id="BBL72904.1"
                     /transl_table=11
                     /translation="MKFTIARETLLTPLQQVIGVIEKRQTLPILSNVLLKLSDGQLEL
                     TGTDLEVQLITRTTVESGEDGAITVPARKLLDICRLLPDKSAINVDCKDERFAIRCGS
                     SKFNLATLPADNYPEFDTGTTELEVAVPAATLRRALEKTTFAMAQQDVRYYLNGLLLD
                     VDGRTLRTVASDGHRLAVFEEVLEIEGQGRQIIIPRKGVLELARLLGEGAETVTVQIA
                     PNTVRVNLGAVSFAAKLIEGRFPDFQRVMPRDLARIMLIDKDVFKGALTRVSVLSNEK
                     YKSISMEVDEEAVMSLKAQNPEHEEAEERVPIQLEGSGLSVGFNAAYLLDAINNVGSA
                     QVRLSFTEAANSCLIEDCEDSHFKFIVMPMRL"
     CDS             2599..3675
                     /codon_start=1
                     /gene="recF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87TQ5"
                     /locus_tag="MishRS11D_00030"
                     /product="DNA replication and repair protein RecF"
                     /protein_id="BBL72905.1"
                     /transl_table=11
                     /translation="MSLLKLEAQDIRNIPAATLLPTPRLNFLVGPNASGKTSLLEAIY
                     LLGRARSFRTSQPNQIIRFDQPALTVVGQVAADAAPPLPIGLRIARNGLRDIHLDGRT
                     LQSSAELLRAFPVLAIQPGSATLLEGPPKTRRQFLDFGAFHEDPAYLGHWRRYTKALG
                     QRNALLREKRVRELAPWTHEAARYGTIVGETRRLYAERLEPFFQDTAQRFFKGLVFQL
                     HTQAGWDTANPLEKLLEQDIPHDLRHGHTQSGPHKGDFSIALQGRPVKAYLSRGQMKL
                     LVYALLLAQARLLEERAGAAGCVLIDDVASELDEDNKKNLLGFLREGRTQYFITTTAT
                     PTIETALDPDAALFHIAGGQVIQA"
     CDS             3672..6104
                     /codon_start=1
                     /gene="gyrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZZK5"
                     /locus_tag="MishRS11D_00040"
                     /product="DNA gyrase subunit B"
                     /protein_id="BBL72906.1"
                     /transl_table=11
                     /translation="MTDPMNTATQPAHDYDSTSIQVLKGLDAVRKRPGMYIGDTDDGT
                     GLHHMVFEVVDNAIDEALAGYCKNIRVIIHADESVTVTDDGRGIPVDIHEEEGRSAAE
                     VIMTVLHAGGKFNQNSYKVSGGLHGVGVSVVNALSELLTLEIHRGGKKYRQEYRHGEP
                     QAPLAEFGESSDTGTRLRFKPSDQTFTHIEFHYDILAKRLRELSFLNSGVRIVLEDER
                     SGKSDTFEFEGGIRAFVEHLNKNKTPLFEKVFHFLAEKDGITVEAALQWNDSYQENIF
                     CFTNNIPQRDGGTHLAGFRAALTRTLNQYIEEQGLLKKQKVDTTGDDAREGLTAVLSV
                     KVPDPKFSSQTKDKLVSSEVKPVVEAAMGEKFQEFLLEQPTTGKLIANKMIEAARARE
                     AARKAREMTRRKTALDIAGLPGKLADCQEKDPALSELFLVEGDSAGGSAKQGRDRRTQ
                     AILPLKGKILNVERARFDRMISSEEVGTLITALGCGIGREEYDPNKLRYHRIIIMTDA
                     DVDGSHIRTLLLTFFYRQMPELIERGHIYIAQPPLYKVKKGKQEQYVKDDTELNHYLL
                     QLALEKTRLHPNPQTPPIQGPGLEQLARDYLAARGVAQRLAHRYDATLLDLLAELPAL
                     DADTMADEARRAAWFDHLRARLNRAEPGASFEIDLRSGGGEFHASIKKRLHGVYKAIE
                     LGAGFFNSADYKKLAAFGQITADLFGPDSFVAADEKKAHVANFKAVFDWMMTEAKRGQ
                     HIQRYKGLGEMNPEQLFETTLDANSRRLLQVKIEDGIAADQIFTTLMGDQVEPRRDFI
                     EKNALEVTNLDI"
     CDS             6215..6775
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00050"
                     /product="hypothetical protein"
                     /protein_id="BBL72907.1"
                     /transl_table=11
                     /translation="MPTRKFSALTEYAKAFSALTPDKEAILRELGLAVSPRLGEVTDH
                     FYTKLQAIPQARPVLEGRVDDLKRTHVRWLRSLFDGPYDDSFTAAMYRVGDVHVRVKL
                     PVEFMAGGIVLITEQLIELVGEIHRDNIDRYRQAMGALNSILGFCLFIMQESYQSSSL
                     AEELEKFLKITGMSRKLFDNLAAAYR"
     CDS             6779..8143
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004521730.1"
                     /locus_tag="MishRS11D_00060"
                     /product="acid phosphatase"
                     /protein_id="BBL72908.1"
                     /transl_table=11
                     /translation="MPRPPRPACALLAALLSLPSWTAAGKPGPARGLARIDHIVVIYL
                     ENHSFDNLYGLFPGAAGIAQAPPQATRQTDLQGRVYDTLPPVVNTEHKPPVHDGRFPA
                     DLPNQPFDIGRHVPADQRTGDLVHRFYQHQQQINGGRMDRFAAISDAGGLAMGYYDGS
                     KLPLWQYARRYTLADHFFQAAFGGSFLNHLWLACACTPRHPDPPPAMLARLDDQGGLV
                     KDGTFSPDGYAVNTVFPAQGPHPAAIDPRKLLPPLTQPTLGDRLSDRHISWAWYAGGW
                     NDAVAGRADPGFQFHHQPYAYFQRYAEGTRDRAEHLKDGADFLAAIEHGQLPAVAFYK
                     PIGGLNEHPGYADLLSGERHIADILGRIEHSKSWPRTLVVVTYDEYGGFWDHVPPPKL
                     DRWGPGSRIPALIVSPFAKRGHVDSTVYDTTSILKLIETRFGLAPLGERDAQAQSLSK
                     ALGW"
     CDS             8254..8514
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00070"
                     /product="hypothetical protein"
                     /protein_id="BBL72909.1"
                     /transl_table=11
                     /translation="MKRLLLALLLGIALAMQGCAYSYPGYYRAYPVYPRYGYGFSYGY
                     AAPYYGYRGYYRPYYGPRWGYGWRGGYGWHGGGGGWHGGHWH"
     CDS             complement(8553..10127)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00080"
                     /product="hypothetical protein"
                     /protein_id="BBL72910.1"
                     /transl_table=11
                     /translation="MIKPGDLFEHILTHYRGIFATLFLLPISAVYGAYSTLRAQIAFR
                     RNSAPARHDARVQAVIAQVEAWKQDGCKEKLTTGRSGWKTMSELVPKYKLTHRKIDVG
                     LYDILEIDEARAVVRVEPLASMGQISRSLIAKGWTLAVVPELDDLTVGGLIMGFGVET
                     SSHKYGLFQHICESFEIVTAEGKLLKCGPVENSELYYQIPWSHGTLGFLVAVELRIVR
                     AKPYIRLHYQPVYSLDEMVEVFEQASRDTVNNDFVEGLVYSGGTAVIMRGQFADELGS
                     DGAFNSMGCYMRPWFYKHVQTYLEARRSGVEYLPLRDYFHRHTRSYFWAMEEIIPFAH
                     HPVFRYLLGWALPPRIELLKYTETRTTQRLRERYHVIQDMLVPIRYLKESIRYFDGHF
                     QIYPLWLSPMAIKENPGKQGFIQPLKMADGTVDEMYVDIGAYGTPGIGKAFDSAVALP
                     ALEQFVIAHRGYQALYARTCMSREDFRAMFDHTGYDALRERLPYCREAFDDVYDKVSA
                     RGRVSPVEMRELERQA"
     CDS             complement(10237..11370)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141920.1"
                     /locus_tag="MishRS11D_00090"
                     /product="3-chlorobenzoate-3,4-dioxygenase"
                     /protein_id="BBL72911.1"
                     /transl_table=11
                     /translation="MSPAQTQSPPPVFTDAKTTRQKARSAGLDPDRWYVVEYDKAVKK
                     GQVKEVVFWNNSIALYRDEEGQLNAVQNRCPHRHLKLTHGVVDKCHLRCVYHGWAFDR
                     EGKLVDYSHDSFGKPLIKTQLRTYPVRVRYGLIWLFPGDPALAEVHKIPEIPELSGDN
                     PWASFAADFTWKTHHSMVIDNICDFAHAFLHRKYRPFIDAKLTHHEADEDRVYLTYDA
                     YMAGGRVSGIFVDRNRVNTQSIELCYQYPYQWTNTGDSIKNWSFMLPINDRTTRAFFL
                     FYFDAVTIPFLSVKTPKWLTQTVLNIAKPLVFKPILLEDGVALEAEQLGYEEHWDAPP
                     IELNPVVPLFQKLTARKWEEYLARKAGGQSPAQPTEDGAQAAA"
     CDS             complement(11400..12416)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010933588.1"
                     /locus_tag="MishRS11D_00100"
                     /product="epimerase"
                     /protein_id="BBL72912.1"
                     /transl_table=11
                     /translation="MTAGINLVTGATGHLGANLVRRLLEQGESVRVMLRAGRDNGALD
                     GLDVERVQADLRDASAVAQAVRGCARVYHCAALVSTIEGDAAHKREIYDTNVGGTRHI
                     LAAAREHGVEKVVVSGSLSATGYEPDRASHEDMPFYPFERHLPYGFTKHLTEHECLKA
                     HADGLNVVVATSCAIIGPHDYVPSRMGRVLVDFAHGQLRAYIPGGFEFVSAWDVAEGH
                     LLAMRQGRSGQKYIFSTAYASVDDLLGLFREVTGRPLPRLKLPPQVMAAVAEVADKTW
                     FRLFPNQPRRFTPAAVRLLTLRRQAGHDKARRELGYQPTGLRPAVEAAYQDFVRRGVI
                     VPAQ"
     CDS             12339..12566
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00110"
                     /product="hypothetical protein"
                     /protein_id="BBL72913.1"
                     /transl_table=11
                     /translation="MFEQAADQVGPEMAGGPGDEVDTGGHGFAPGFRRKQAGLAFIAG
                     LKQADEGLQGIATASSRYFRATPDGTRWNPG"
     CDS             complement(12603..14195)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015367567.1"
                     /locus_tag="MishRS11D_00120"
                     /product="ABC-F family ATPase"
                     /protein_id="BBL72914.1"
                     /transl_table=11
                     /translation="MLTTANLTIQFGAKPLFENVSVKFGDGNRYGLIGANGCGKSTLM
                     KILGGDLEPTSGNVSLDAHERLGKLRQDQFGFEEYTVIDTVLMGHGELWRVKAERERL
                     YSLPEMSEDEGMRVADLEILFAELDGYTAESRAGELLLGVGIPLEQHYGLMGAVAPGW
                     KLRVLLAQALFSDPDILLLDEPTNNLDINTIRWLENVLNDRNSTMVIISHDRHFLNSV
                     CTHIADLDYGELRVYPGNYDDYMIASTQARERLLADNAKKKAQIAELQTFVSRFSANA
                     SKAKQATSRARQIDKIKLDEVKPSSRVNPFIRFNQKKKLYRLALEVKDLAQGYGAEPL
                     FQGLDLMVEVGERVAVIGPNGIGKTTLLRSLVGELPPDRGTVKWSENVSLAYFAQDHA
                     ADFSTDMSLFDWMDQWKQEGDDEQSVRATLGRLLFSQDEIKKPVRVLSGGEQGRMLFG
                     KLMLQQANVMVMDEPTNHLDMESIESLNTALEQYPGTLIFVSHDREFVSSLATRIIEL
                     TPQGVVNYSGNYEDYLTSQGVQ"
     CDS             14480..15802
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010938460.1"
                     /locus_tag="MishRS11D_00130"
                     /product="MFS transporter"
                     /protein_id="BBL72915.1"
                     /transl_table=11
                     /translation="MKNRGLIALAGIGIHISIGSVYAWSVFSKPLQQAFGWNLKQANF
                     TFGLAIFTLGISAALMGHVVERRGPRFSGSLSALLWATGLLGSAFATSGHIACEELRL
                     WLLYLCYGLIGGFGLGTGYITPVSTLMKWFPDHRGLATGLAIMGFGFASFLGAPLIGR
                     LIEAQGISATFAILGVVYLVVMLASALYLAPPPEGWQPAGYSGREDGPQVRRKPIDLM
                     PMTANEAVKTPPFYGLWLMMFINIGCGIAVISVASPMTQELTGIDAVAAAAIVGMNGL
                     FNGLGRLGWASLSDRIGRPNTYIAFFVLEILAFGCLPALRDILAFQALLYLIMTCYGG
                     GFSTLPAYIGDLFGMRQVGAIHGYVLTAWALAGITGSSLAAYLREETGSYGDMMRIFA
                     LVFLLALGAAIVMRGFVRRELARKHLGYAEVEGDALEVAVSESETGNG"
     CDS             complement(15815..16477)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00140"
                     /product="hypothetical protein"
                     /protein_id="BBL72916.1"
                     /transl_table=11
                     /translation="MNPTPWAALALSLLLLPGCGTLRDAFLDTASPLAPPRGATLGQT
                     SREDIVRQFGEPDEIDARRLDARALEVAYYFADDLDDDHEPRYKLLVCEFAKGVLTGY
                     AFHDTGVPAKLGFEEAGRAKLSKGQSTRREVENALGAPDGKAFLPTTITLPALDIRLG
                     AAPFPLAAIPAGSKEAWQYYTEGFDETRHSASRQTLTVFFDERGIFLGDALLHELVGK
                     AP"
     CDS             16607..16975
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003313912.1"
                     /locus_tag="MishRS11D_00150"
                     /product="translation initiation factor"
                     /protein_id="BBL72917.1"
                     /transl_table=11
                     /translation="MNSKKSPATGGLVYSTGQGRMCPACRQPVARCACKKSPVLPKTD
                     GIVRVRLETKGRKGKGVTVVTGASADPAELDSLAKQLKQRCGSGGTVKEGVIEIQGDH
                     VALVMEEFQKRGKTVKKAGG"
     CDS             17063..17287
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00160"
                     /product="hypothetical protein"
                     /protein_id="BBL72918.1"
                     /transl_table=11
                     /translation="MAKLSSGKAAVDFLVEDEDMAEVARWIMANLPFDRLYFYGRERP
                     IHVSSSAEPVGEAYEMREINGRRVPGKFKG"
     CDS             complement(17340..17753)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258116.1"
                     /locus_tag="MishRS11D_00170"
                     /product="twitching motility protein PilT"
                     /protein_id="BBL72919.1"
                     /transl_table=11
                     /translation="MPGLIVLDSHIWFWWINMEHHRLPSTLLDDIDHAERVGVSPVSC
                     FELALAHWKGRLELSPSPSEWFSRALADSGVELLPFTPEISVRATGLSDIHRDPFDRI
                     IIATAVELDGMLASVDGYFSDYPELDGRLIPRKSL"
     CDS             complement(17741..17974)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00180"
                     /product="hypothetical protein"
                     /protein_id="BBL72920.1"
                     /transl_table=11
                     /translation="MQVQRQILEATSRRVVIELPESFINHRVEIIALTLDEEGPKTGQ
                     SLRRPHPDIAGKSKTLGDIVAPVVEEGDWQCLD"
     CDS             18263..19591
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00190"
                     /product="hypothetical protein"
                     /protein_id="BBL72921.1"
                     /transl_table=11
                     /translation="MLELFRQKMPLSCLLHGLLERCFAAERLDRIFLENAKEQYTREI
                     LFSTVCDLMLSVVLKVHPSINAAYQKHPEPLGVTVSALYEKLKGVELSVSQALLRDTS
                     EDLSDILDALGFTPEPWLPGYPVRLLDGNCLAASEKRLAVHREVGGAALPGKSLVVFD
                     PERRLMRDVFPCEDGHAQERRLLDAVAGIPKAGELWIADRNFCTVGFLDRLQGRNAHA
                     LMRLHLNLPLTEETLFSQAGEQGGGRLLEKRVGVAGRPYRLVRVELEQPTRDGDAFVD
                     ILTDLPADIPAATVADLYRRRWTLETAFQHVEKHFKSEIETLAYPKAALFGFALALVA
                     YNLFSVMISALDCAHGKPVSKDISGYYLSHEIAATFLALIQLSGVGDWLFVSEQTPAE
                     FAAWLRETARNIPLRTLKKHPRGPKKPIDKPPYDPKQPHVSTYQLLRKKK"
     CDS             complement(19592..20410)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010942015.1"
                     /locus_tag="MishRS11D_00200"
                     /product="HNH endonuclease"
                     /protein_id="BBL72922.1"
                     /transl_table=11
                     /translation="MDLVRRDAITTSFIDIQGDLDELDELFTDYWNRILPGGHKSSIA
                     FPFFRLKNEPFWELVIKPGKDALPDISTVKKLREYILGARLDDALFAFMQYPQSREAL
                     AQCLFQSCFSASARQALAEVYVFHEQAFQYSTLLEEKAHGKKISDISLFDKYRDAARN
                     QGFRRIVVKSYEHRCALCGVRIITPEGRSAVDAAHIVPWRESRNDDIGNGMALCKLCH
                     WAFDEGLMGVSKSFTVLLSEQLGQYPNAAGLLGTLSGRGIVGPSDKMLWPALSK"
     CDS             complement(21024..22856)
                     /codon_start=1
                     /gene="glmS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZL28"
                     /locus_tag="MishRS11D_00210"
                     /product="glutamine--fructose-6-phosphate
                     aminotransferase [isomerizing]"
                     /protein_id="BBL72923.1"
                     /transl_table=11
                     /translation="MCGIVGAVAHRIVTPVLLEGLRRLEYRGYDSAGVAVLDDAEQLR
                     RVRKKGKIKALETALETCRAEGKIGIAHTRWATHGVPSERNAHPHLCRDTVAVVHNGI
                     IENHDALRRNLAQQGYEFESETDTEVIAHQVHAFLAAGLDLREAVQRTCAILEGAYAI
                     AVISAQAPRRLVAARHGSPLVVGLGESENFVASDIFALVGETQRFVFLEDGDSVELTT
                     EAVEVYDRDRQPVQRPVHETKLVVDAVERGEYRHYMQKEIHEQPVAIEKTLDGRIRAG
                     KVLDAAFGPLAERAFDQIRSVQIVACGTSYHAGMVARYWMEAIAGLPCSVEVASEFRY
                     RKNVVPPGTLFVSISQSGETADTLAALKEAKHLGYIHTLAICNVPESSIVRESESTLM
                     TRAGIEVGVASTKAFTTQLTALLLLVVALGKRNALRPEQEARIVKELESLPEQIRHVL
                     RLEDEIQAWAEQFGDKQHALYLGRGAQYPVAMEGALKLKEISYIHAEAYPSGELKHGP
                     LALIDDQMPVVAVAPNNELLEKLKSNLQEVHARGGQLYVFADVDAPMENVPGVKLLRV
                     AETDEVVAPIVYTVPLQMLAYHVALIKGTDVDQPRNLAKSVTVE"
     CDS             complement(22860..24230)
                     /codon_start=1
                     /gene="glmU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E8C2"
                     /locus_tag="MishRS11D_00220"
                     /product="bifunctional protein GlmU"
                     /protein_id="BBL72924.1"
                     /transl_table=11
                     /translation="MPLEIIILAAGQGTRMRSALPKVLHKVGHRSLLEHVHALAASLS
                     PDQITLIYGHGGEQVPQTLAHLDATWAEQKQQLGTGHAVMQVADGIGDEATVLILYGD
                     VPLLKKATVEKLLPLAGPDSLGLLTVELDDPHGYGRIVRDAAGRVLRIVEEKDASPQE
                     RAITEGNTGILALNGRRLKSWLARLGTDNAQGEYYLTDVIALAVAEGCAVETAQPASM
                     DEVLGVNNRQQLAHLERVFQAEQAEALMLAGATLRDPARFDLRGEIVALGRDVEIDVN
                     VILEGRIKLGDRVRIGPNTLIRDCEIGDDVEIFANCVLEDSVVGRAGRIGPFARLRPE
                     TRLAEDVHIGNFVEIKKSTIAQGSKANHLSYIGDTEMGAGVNIGAGTITCNYDGANKH
                     KTIIEDGVFVGSDSSLVAPVRIGRNATIGAGSVITKEAPQGQLTLTRAKQVTIAGWQR
                     PVKSRS"
     CDS             complement(24360..25202)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00230"
                     /product="hypothetical protein"
                     /protein_id="BBL72925.1"
                     /transl_table=11
                     /translation="MVAGVGDVLDENHNHQYPGRRLDFQGLRRIYGQQLLAKQIDDEN
                     KWLDIQRHDFRKLIQAVAKVRSIRVDSLLREVFFEGHADLAQAVLSLAPWPWLNHIGL
                     EIHQPFDLLLCCLDDWIDSLSRIAQNPIQIEPISRFPASPALRRRVGAHAEILCLRLC
                     LAGRVSILELFDIVRPVDRLDIPVFPAIDTLDIACPRRASEMFQEDTIQHYSIGLENR
                     RAVDYMHRQLLGLSKRCPKYKLVYDHPVENRHDRSFHTKVANLALGMELEFCAGPGAV
                     EPWG"
     CDS             25339..25971
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00240"
                     /product="hypothetical protein"
                     /protein_id="BBL72926.1"
                     /transl_table=11
                     /translation="MKKSTLFNTASTALSMAASLWGINAQAGSISLNVNYSPNGDNIT
                     SVTDGYLHNTFTASPTAVSGIAWGFGIYANGSGGCTTSWDGSTFSLGACIGAFVIATD
                     VNPNSMEVYLVAQGASQADLNAFGGAFDSAIASSLGGGTVNDYLNFYQIEATGGTQDI
                     TSMTAGTFGGIGNDAVVTLTTPASVPEPASLALLTAGLAGLVGTRRRKVH"
     CDS             complement(26015..27550)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228885.1"
                     /locus_tag="MishRS11D_00250"
                     /product="fatty-acyl-CoA synthase"
                     /protein_id="BBL72927.1"
                     /transl_table=11
                     /translation="MLPAWENLSDAIFHHAERRPQVPALVEGPTVLSYREFAAWVGAA
                     SRYLRGLGVEAGDRVGLILDNHADHFILAFALMRIGATPIEIPTDLPPPMQDAVIQRC
                     AIKALFLEYGMAAGGGLPLRVAVGAGWRRALEGHAGDARCDKRAGDNRLVILTSGSSG
                     PPKATVTTHRQRLARAPVYAEFLGGRWTPDDPGHALLKAPVSNAAFHEFAINQILFGG
                     TLHILPGFDRLNPFARALAAYEDAVCFATANMCRALLASCDREDGPFLPRLRALVSLG
                     LPLSPAEKRALRERVTPEFHEIYGASGFGMISGLRPGDIAAQAGTVGRAAPGAVLEVV
                     DAAGVRLASGATGHLRCRGATVAEGFLLEEDAARGPEAFREGWYYPGDLAAIDAGGWV
                     HLKGRKTDLIVRAGVEIYPYAIEAVLMALPGIKEAAVIGLPAKDGPGEEPVAVVVADE
                     PLRHEFLASYCAVSLPPEQRPLGFLAAPSIKKTSVGKIDRPALRAQVEALLEAMRPAG
                     GED"
     CDS             27824..29125
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039086.1"
                     /locus_tag="MishRS11D_00260"
                     /note="frameshifted, deletion at around 27800"
                     /product="AMP-ligase"
                     /protein_id="BBL72928.1"
                     /transl_table=11
                     /translation="MPPDSPFAAHRGQILPLQRFQAQVSALAGRLPDAPYAVNFCEDR
                     YHFCVAFAACLARGIVTLAPPDRSPRNLALLAQGYPGALRLIDGTTPCALGTDGYRID
                     LETLPPPAHPVPLPIPPERLALIAFTSGSTGEPQAHAKTWGSLCESARLIEQALGPVR
                     GKRIVATVPPQHMYGLELSILLPLCRGGVLDAAKTFFPGDIAQALAAAPGPKILVTTP
                     IHLRALMGEAGDWPALDRIVSATAPLDAGLAGECERRFRAPLIEIYGCTEAGSIASRR
                     TVEGGEWAWFEGVAWAGDGGAGHLRAAHLAAPVPLNDLIEPRGERHFLLRGRAADLLN
                     IAGKRNSIGALNRALLDIEGVADGAFFLPDEVDGKTARLVAFAVAPGLSAETLLRRLR
                     EQLDPAFVPRTVHLLDALPRNETGKLPRHKLAELLRERSGG"
     CDS             complement(29127..30401)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00270"
                     /product="hypothetical protein"
                     /protein_id="BBL72929.1"
                     /transl_table=11
                     /translation="MKAQGAETLLCFTLLQIGLIILAARVAGHVARRLGQPRAVGEIV
                     AGLMLGPSMLGALAPDAFHWLFRSVDAAPLTIVSQIGLILLMFQVGLEFDFSHLGERR
                     NRRAVVLVTLAGIVAPFALGLGFGWASAPVLAPGVPPLAYSLLLGVALSITAVPILGR
                     IMIEFGLTRHRLGVITIAAAATSDAVGWVLLALVAAVAASRFSWVATATQIGGLLAYL
                     LASWFVLRPVLRRVLRWFPHGPDSLPQDLLALLLVVVFGSALLTSQLGIFAIFGGFTV
                     GVLLHDRHDLVSAWKHQVESLIMVFFLPIFFTYTGLRTDIGSLASGELWAWCGLLIGL
                     AVLGKFGGCYLAARWAGLSAAESRNIAIMMNTRALMELIVVNLGYDLGLITRPVFTML
                     VLMAVASTLMTAPGLRLWLPAVGHRIPGGRGA"
     CDS             complement(30398..31117)
                     /codon_start=1
                     /gene="fabG_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039074.1"
                     /locus_tag="MishRS11D_00280"
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="BBL72930.1"
                     /transl_table=11
                     /translation="MKQALVTGGSGAIGAAIVRALAAEGFHVLVHAHRNLERAEALAG
                     EILQTGGSAEALAFDVTDAEACARILGERSEARPIQVVVNNAGLHEDVPMVGMGRDQW
                     DRVIDVSLNGFFNVTRPLLMPMLRTRWGRVVNIASVAALTGNRGQANYAAAKAGLIGA
                     SKSLAIELASRNVLVNVVAPGIIESAMSGAAFDAGRIAALVPMKRAGRPEEVADLVAF
                     LASERASYITGQVFGINGGMV"
     CDS             complement(31114..31551)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105317.1"
                     /locus_tag="MishRS11D_00290"
                     /product="3-hydroxylacyl-ACP dehydratase"
                     /protein_id="BBL72931.1"
                     /transl_table=11
                     /translation="MVLSRSEFAHLLPHAGSMSLLDRVLAYDAERLHATAQSHRAADN
                     PLRREGQLSPCAGIEYAAQAMAVHGALRAGGGAARQGFLALAREITWTVARLDDIPAD
                     LDIHIHQLALRADSAMYEFSLAALGRVLVAGRAAVFFPEEAGR"
     CDS             complement(31542..32336)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00300"
                     /product="hypothetical protein"
                     /protein_id="BBL72932.1"
                     /transl_table=11
                     /translation="MRRVYIAGVGLLGPGLEGWAASRAILAGIEPYAPAAMPRPTGTG
                     LPATERRRATLVTRLAVDVAGAALGGADPGNIVAVFASSGGEVEVIHGIFEQLAGPDR
                     RLSPTAFHNSVHNAASGYWSIATGCRGAVDSLCGYDDSFGSGLAEALLRCGLDGKEVL
                     LVAYDLPPPFPVAEFRPLSAPFGVALRLRASAAPGVIAELRGGFLPEGLPATRLDDPG
                     LESLRLGNPAARGLPLLAALAGDRDAEIRLGCGMGGCLRLEVRPWF"
     CDS             complement(32333..33517)
                     /codon_start=1
                     /gene="fabF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039069.1"
                     /locus_tag="MishRS11D_00310"
                     /product="beta-ketoacyl-[acyl-carrier-protein] synthase
                     II"
                     /protein_id="BBL72933.1"
                     /transl_table=11
                     /translation="MPSIAIRAYALVNALGVGRAATLAALRSGCSGLRPCDFPGTDLA
                     TWIGRVEGVETLPLPGRWARYECRNHRLARMALECDGFAERVAEARGRYGARRVGVIV
                     GTSTSGILETEAAYRDRDAQGRLPRGFRYRRVQNTSALADFVRDYLGLAGPAVAISTA
                     CSSSAKVFASAARWLAADWCDAVVVGGSDSLCLTTLYGFAALELVSDEPCRPADVLRK
                     GISIGEGAGFALLERAGGGSGLALLGYGESADAYHMSSPHPEGAGAAAAMAECLGRAG
                     LGPGAVDYTVLHGTATRGNDSAEDRALHTVLGPDALCSSIKGWTGHTLGAAGILNALV
                     ACLCLEEGFAPHSLQTRRVDPDFSAHILLEPRHRPMNAVLCNAFGFGGNNASLLLGRL
                     GP"
     CDS             complement(33582..35903)
                     /codon_start=1
                     /gene="actII-3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039076.1"
                     /locus_tag="MishRS11D_00320"
                     /product="membrane protein"
                     /protein_id="BBL72934.1"
                     /transl_table=11
                     /translation="MRAKAPLLLWLLWLALCAWWLLFRTAITTDLTFFLPRDAGFLGA
                     VLVQQMREGPASRVLMIALENADEAALAATSRQLAESLASDPRFDRVDNGAVGAGLAT
                     LERRLFGYRYVLDPEPGPEPFTAAALRAALQARLAELASPTGMLQKAWLTRDPTGVWQ
                     RLLKGWLVPQGPVSRHGVWFARDGRRALLLARTQASGFDIAAQAEALERVRERFQTLR
                     TDPAMRLALGGPGPLSVESNRRITHDAAVLSVLNSGLVMLLLFGVYRSLRVLGLGLVP
                     LLTGVVSGAAATRWAFGEVHGITLGFGATLVGVAADYPNHFFTHLSPREAPARAMARI
                     WPTLRLGLLTNVAGFAAMLFSGFAGLAQLAVFAGGGLLAAGLATRWVLPVLAGKGTVR
                     LPAWVERGAGFPWPGFPRWRWLPLGLTLLLAAVFMLGRAPLWNDDIAALNPVPAERQV
                     LDEALRRDFGVPDLRKLVLATGPDAEAALSLSEAVAADLEALKRDHALGGYELAARFL
                     PSRAAQAGRLAALPPGPELAANLRVALRGLPFKPDVFQPFLDEVEAARQQAPLSRADL
                     ADTPFAAQVDSLLLPLEDRWVALIPLSGIADDAAIANKLAPWRERGVYYLDLREESTR
                     RVRDYRREAIALLAGSLAAIVLLLGLGLRSLPLAMRVLAPVLGAGLCTGLAMAVLFHG
                     LTLYHLVSLLLVMGLSLDQALFFNRDAADPEERRRTLLSLWVCGLSSVLAFGTLALSD
                     INILRSIGSTVALGALLAIAFAAWLAQPRPVPR"
     CDS             complement(35900..36466)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00330"
                     /product="hypothetical protein"
                     /protein_id="BBL72935.1"
                     /transl_table=11
                     /translation="MVLLVLLLAGVAHAAGSPPALTLPDLFARLAARSHMRARFVETK
                     TLAVLKTPLRLEGTLEFRRPAYLAKHVEQPAPEDYIIDGGSVTVNKPAEGQKIELALA
                     DYPALEAFAESLRAPLAGDLAGLSRYWRPSLGGSRKHWLLALAPIRPELVAVVRGVRL
                     EGEDDRLLRMEIEEAGGDHASLRFEPLP"
     CDS             complement(36477..37376)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039079.1"
                     /locus_tag="MishRS11D_00340"
                     /product="acyltransferase"
                     /protein_id="BBL72936.1"
                     /transl_table=11
                     /translation="MTEAWLNIPERSSLFWLRAITWIALRLGRGVAWLLLYPITAYFL
                     LFANRTGAASQAYLRRILGREPGFAERFRHYHTFACTLLDRVYVLAGQDRRLDIRVHG
                     LELLERRARSGRGCILVGAHLGSFEIIRAVGRVRGGFKIKALMHGERTPLIAGLYRRL
                     NPALHEDIVDMGNPSSLLGLDGHIAGGGWVALLGDRALHGDKRVLCDFLGAPAYFPQA
                     PVLLGQILQAPLLLFVCLHRGWGRYEVYFETLTEAPPGLPRGERETAVRDIMQRYAGR
                     LEHYCRLAPYNWFNFHDFWRIED"
     CDS             complement(37373..37672)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039080.1"
                     /locus_tag="MishRS11D_00350"
                     /product="hypothetical protein"
                     /protein_id="BBL72937.1"
                     /transl_table=11
                     /translation="MSPPVEFTIPHHHPALAGHFPGRPIVPGVVVLDEVLALLARIEP
                     ARRVSGIVGAKFTGILAPGEACRVEFEPRADGGLRFACVAAGRPIASGLLALFPP"
     CDS             complement(37669..38343)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00360"
                     /product="hypothetical protein"
                     /protein_id="BBL72938.1"
                     /transl_table=11
                     /translation="MAQARLPVFTALALGFPLLSFALLQSGLLPPVWLGLPNGVLALG
                     LLLGLCVEGAAWVRAVAVGVGAGLASAGLALWPGYAVAAFPVAVNLMVGWLFLSTLRP
                     GYEPLITRIARLARDGEPMADALVLYTRRLTAAWAGLFCLLALNATALAVFASTGTVV
                     LFGNTLDYALMALFFLGEYGYRRRRYRAYRHVGLPQVIRTLLRHGWLGREHLSAPCAD
                     TAVPRP"
     CDS             complement(38349..38618)
                     /codon_start=1
                     /gene="acpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_639351.2"
                     /locus_tag="MishRS11D_00370"
                     /product="acyl carrier protein"
                     /protein_id="BBL72939.1"
                     /transl_table=11
                     /translation="MPILNPLELELARLMVDALNLDAEAGSIDPAAPLYRDGLGLDSI
                     DLLELSVVVSKRYGFQIKSDDPDITRIFSSLGALAATVAARRTLA"
     CDS             complement(38681..39637)
                     /codon_start=1
                     /gene="rapK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_639353.2"
                     /locus_tag="MishRS11D_00380"
                     /product="pteridine-dependent deoxygenase like protein"
                     /protein_id="BBL72940.1"
                     /transl_table=11
                     /translation="MSGLRLAYAPADRLPPAGAGEALLGVIGYGGLPDGMAPSVLPRA
                     DIPLEPLGGPALEAWYAPGPVEYGEAEGIRYALNGGALFGMVRVDAEAPEAAAQGAYR
                     RIVELARALGYPTLVRMWNYLPDINREQFGLERYRRFCVGRYQAFAEMGFALGEDLPA
                     ASAIGSGREDLWVVFLAGKGGAIQIENPRQLSAYRYPPAYGPRSPSFSRAMVFGRTLF
                     ISGTASIVGHETVHPGDLLGQCRTTLANLAAILERAGADGPARLGEAAAWKVYLRHPG
                     DYAAVRDFLADALHPASPVLYLAGDICRGDLLAEIEGVVRLA"
     CDS             complement(39704..40999)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039084.1"
                     /locus_tag="MishRS11D_00390"
                     /product="hydroxylase"
                     /protein_id="BBL72941.1"
                     /transl_table=11
                     /translation="MQNATPRTCDVLVIGGGPAGAAIGTLLARRGWHTVVLEKDRHPR
                     FHIGESLLPLSLPYFEQLGVREELDRIGLRKYAAEFHSMDHGKHVAFQFGDAIDKSYP
                     YAYEVRRSEFDQLLLGNCAAQGAEVHEGCRVDGVEYADDAIAAVGAVDGEGGRQRWTA
                     RFYVDATGRDTLLADRLGVKEANPRHRSAALYGHFQGAERWTGRDEGNISIYWFDHGW
                     FWMIPLRDGTMSVGAVCRPEYLKSRAVPVEQFFRDTIARCPGVAARLQNASPVGGVTA
                     TGNYSYQSRRMTGRNFILVGDAYAFIDPVFSSGVHLALNSAFLGAEAVDGLLKDPASA
                     PARLARFERSVRRGLKTFSWFIYRVTTPAIRDLFMHPRNAFRMREGVISLLAGDIFRD
                     TPLMLPLFAFRWVYRINSLWMRWRGVATPPGPALAEGGR"
     CDS             complement(41109..41864)
                     /codon_start=1
                     /gene="ubiE_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9R7"
                     /locus_tag="MishRS11D_00400"
                     /product="ubiquinone/menaquinone biosynthesis
                     C-methyltransferase UbiE"
                     /protein_id="BBL72942.1"
                     /transl_table=11
                     /translation="MNPDHRFAPHPVLAPHYASSVEKQAFLRQVFDQSAPYYERVAGW
                     GFFGTGDWYRRRALVRAGLAPGMAVVDIAAGTGLTARAAAHIVGDPARIACVEPSPGM
                     LRESARRLPAAQHILGTADAVPLAGGGFDFLSMGFALRHVENLATAFGEFYRVLKPGG
                     RLLIMDITKPDGRIAQTWVRLYFRDFMPRFTQLVTGSREARYLMEYYWETLDSMVEPA
                     RVLEALALAGFERPHRHVEARIFSEYTALKAAR"
     CDS             42058..42873
                     /codon_start=1
                     /gene="nodB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038465.1"
                     /locus_tag="MishRS11D_00410"
                     /product="acetylxylan esterase"
                     /protein_id="BBL72943.1"
                     /transl_table=11
                     /translation="MTDTDTPNPWHPPPFIVLSVLAHLGAVAAWLWRPDLWAWSLGIV
                     AADQAVLSVAGLWPNSRLLGPNWTALPQTAALRGEIAITLDDGPDPEVTPAVLDLLDR
                     YGAKATFFCIGERALRHPELCREIARRGHALGNHSHRHAPGFAASGLAGFTQELALAQ
                     AALTQATGLRPRFFRAPFGLRNPLLDPALARFGLTLASWTRRGFDTRERDPDRVARRL
                     LCGLKAGDILLLHDGNAGRTATGEPVVLAALPPLLDAIAAAGLRPVTLEEARR"
     CDS             42870..43613
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00420"
                     /product="hypothetical protein"
                     /protein_id="BBL72944.1"
                     /transl_table=11
                     /translation="MTARPLSELVATAAARYRPAGRFALHFARGKLAGDPVFAGLLAR
                     GLIADGAAILDLGCGQGLLAAWLQAAQECHGTGAWPSAWPPPPRIRAYRGIELMPADA
                     QRARTALGADADIVTGDIRDADLGTPDTVVILDVLHFIGHADQAALLARIHAALPPGG
                     TLLLRIGDAAGGAGFGFSLWVDRWVAFVRGHGLARLHCRTLRDWVALLERLGFAVEAL
                     PMAQGTPFANQLLIARKPAAATTGPAGGA"
     CDS             complement(43561..44325)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00430"
                     /product="hypothetical protein"
                     /protein_id="BBL72945.1"
                     /transl_table=11
                     /translation="MNPPFETHLVLIPSYNPGPKVHATVMEARRYWSPVWVVVDGSTD
                     GTAASLAALAAHDPGLVVIVLPENRGKGAAVLHGIELAARAGFSHALTMDSDGQHPAA
                     SIPEFMAASLREPDAMILGMPVFDASAPALRVKGRKISNWWANLETLWSGIGDSLFGF
                     RVYPIAPLRRVMAGRRWMRGFDFDPEAAVRLRWLGVEAVNLPAPVKYWSREEGGVSHF
                     DYWRDNRLLTWMHIRLVFGFMLRLPVLLWRRLVSGR"
     CDS             complement(44309..45118)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003402969.1"
                     /locus_tag="MishRS11D_00440"
                     /product="acyltransferase"
                     /protein_id="BBL72946.1"
                     /transl_table=11
                     /translation="MRKLKTLYEYAALCFGLAFLACLCIAWSLLAATLCRLLPERRGR
                     QLGRWVIMAGFRLYLAVLGWIGACRFDLAALDALRGGPALIIAPNHPGLLDAVMILSR
                     LPDVACILKASLMDHLLFGAGARLACYIRNDMGHAMIKRAVRALDGGSHLLLFPEGTR
                     TTRLPVNAFKGSTGLIAHHARVPVQTVFIEAGSPFLGKHWPLFRRPDLPLGYRVRLGR
                     RFDPPEDIRAFTRELETYFAAELGADPRPSHRPAAPQYPRTRQETADEPTL"
     CDS             complement(45265..45687)
                     /codon_start=1
                     /gene="atpC_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZRA2"
                     /locus_tag="MishRS11D_00450"
                     /product="ATP synthase epsilon chain"
                     /protein_id="BBL72947.1"
                     /transl_table=11
                     /translation="MAMTIHVDIVSAEAAIYSGQAELVVAPAEMGEVGIAARHAPFLS
                     RLKPGEVRVKVSADEVHPFYISGGMIEVQPHVVTILADSAIRARDIDEMAALEAKRQA
                     EDMLADKSGKLDYAKAQAQLVDAMAQLRTLEKYRKGRG"
     CDS             complement(45703..47085)
                     /codon_start=1
                     /gene="atpD_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HT20"
                     /locus_tag="MishRS11D_00460"
                     /product="ATP synthase subunit beta"
                     /protein_id="BBL72948.1"
                     /transl_table=11
                     /translation="MSSGKIVQIIGAVVDVEFPRELLPKVYNALTVLGSNTVLEVQQQ
                     LGDGVVRTIAMGTTDGLKRGLAVADTGAAISVPVGQKTLGRIMDVLGNPIDEKGPIGE
                     EVRWGIHRKAPSFEEQAAANELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMME
                     LIRNIAIEHSGFSVFAGVGERTREGNDFYHEMSEGGVLDKVSLVYGQMNEPPGNRLRV
                     ALTGLTMAEYFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGV
                     LQERITSTKIGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELGIYPAVD
                     PLDSTSRQLDPLVVGQEHYQTARRVQSTLQRYKELRDIIAILGMDELSEEDKLTVSRA
                     RKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFKGIVEGEFDDVPEQAFYMVGSIDE
                     ALEKAKRLAA"
     CDS             complement(47131..47997)
                     /codon_start=1
                     /gene="atpG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HT19"
                     /locus_tag="MishRS11D_00470"
                     /product="ATP synthase gamma chain"
                     /protein_id="BBL72949.1"
                     /transl_table=11
                     /translation="MAVGKEIRLKIASIKNTQKITRAMEMVAASKMRKTQDRMQATRP
                     YSRKIAQIIQHLATANPEYKHPFMIERDVKKVGVILISSDRGLCGGLNANLFRLALRK
                     LRGWSEDGTGVKLCTIGQKGSVFFNSVGADIVAQATKLGDRPHLEHIIGVIKVMLDEY
                     NEGKIDQLYVLHNEFVNTMTQKPNLVQLLPINAGELGGEPNKGQWDYLYEPDAKEVLD
                     QLLVRYVESIVFQGLVENNACEQAARMVAMKSASDNAGKLIKELQLIYNKARQAAITQ
                     EIAEIVGGAAAV"
     CDS             complement(48008..49549)
                     /codon_start=1
                     /gene="atpA2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZR99"
                     /locus_tag="MishRS11D_00480"
                     /product="ATP synthase subunit alpha 2"
                     /protein_id="BBL72950.1"
                     /transl_table=11
                     /translation="MQLNPSEISELIKARIQNFDLGVESRTEGTIVSVTDGIVRVHGL
                     TDVMQGEMVEFPGNSYGMALNLERDSVGAVVLGPYEHLAEGDTVRCTGRILDVPVGRG
                     LLGRVVDALGNPIDGKGPIYFEERSPIEKIAPGVIARQSVSQPLQTGLKSIDSMIPVG
                     RGQRELIIGDRQTGKTAIAIDAIINQKGTGVKCIYVAIGQKQSSIANVVRKLEEHGAM
                     EHTIIVAASASESAALQFIAPYSGCSMGEFFRDRGEDALIIYDDLTKQAWAYRQISLL
                     LRRPPGREAYPGDVFYLHSRLLERASRINAEEVTKLTNGAVTGQTGSLTALPIIETQA
                     GDVSAFVPTNVISITDGQIYLETNLFNAGVRPAVNAGLSVSRVGGAAQTKIIKKLGGG
                     IRLDLAQFRELAAFAQFASDLDEATRKQIERGQRVTELMKQSQYAPYSVAQIAVSLFA
                     ANEGFVDDVPVNKIRDFEEALQGYMKSAQAALMDQINATGDYNDAIQAGLRSALTQFK
                     ATHTW"
     CDS             complement(49566..50102)
                     /codon_start=1
                     /gene="atpH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HT17"
                     /locus_tag="MishRS11D_00490"
                     /product="ATP synthase subunit delta"
                     /protein_id="BBL72951.1"
                     /transl_table=11
                     /translation="MAELTTLARPYAVAAYQRAKETGTAAQWADALAFVAAVMDDPRI
                     LAAASNPKTQREAFTRAFLDLCQGRLEGETGNFVRLLIQNRRLGLAKHIAEQFREYKA
                     EDEGYVEVDVASAYPLEESEQSKVVAAVEGFLKKKAHLRVTVDASLIGGVYIRAGDRV
                     IDASVRGQIERLTKSLWN"
     CDS             complement(50102..50581)
                     /codon_start=1
                     /gene="atpF_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87KA4"
                     /locus_tag="MishRS11D_00500"
                     /product="ATP synthase subunit b"
                     /protein_id="BBL72952.1"
                     /transl_table=11
                     /translation="MSINATLIGQMITFALLVWFTMKYVWPPLMQALEERKKKIADGL
                     AAADKGKHEMELAEKRATTLLREAKDQAADLVSLAQKRANELVDESKQQAKVEGDRIK
                     TAAQAEVEREIQKAKEGLRLQVAELAIAAAGQILQKEVDQDKHRDIIDNLAKELGQA"
     CDS             complement(50636..50908)
                     /codon_start=1
                     /gene="atpE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZR96"
                     /locus_tag="MishRS11D_00510"
                     /product="ATP synthase subunit c"
                     /protein_id="BBL72953.1"
                     /transl_table=11
                     /translation="MEIASIASVQGLTAIAVGIILGMGALGTAIGFGLLGGKFLEGAA
                     RQPEMVPMLQVKMFIVAGLLDAVTMIGVGLALFFTFANPFLSALKG"
     CDS             complement(50956..51732)
                     /codon_start=1
                     /gene="atpB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQY4"
                     /locus_tag="MishRS11D_00520"
                     /product="ATP synthase subunit a"
                     /protein_id="BBL72954.1"
                     /transl_table=11
                     /translation="MATEAHGSGGATGYIVHHLTPLSSGEGFWTFHWDTLFFSAALGA
                     FFLILFRKAAVEATTGVPGPLQNFAEMLVEFVDGQVKDAFHGHSKVIAPLSLTIFVWI
                     WLMNFMDLIPVDLLPLIGSAMGLEYMRVVPSTDLNATFGMSISVFFLILFYSVKVKGP
                     IGFAKELALTPFGPWMIPFNLLLKVVEEIARPVSLALRLFGNMYAGELIFILIALLPW
                     FIQPLLSFPWAVFHILIITLQAFIFMVLTIVYLSLAHEDH"
     CDS             complement(51752..52075)
                     /codon_start=1
                     /gene="atpI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010948673.1"
                     /locus_tag="MishRS11D_00530"
                     /product="ATP synthase subunit I"
                     /protein_id="BBL72955.1"
                     /transl_table=11
                     /translation="MQLLAVALITLAVWALWGWIPARSAFLGGMTAFLPNAYFAVKFG
                     SPDSTRTAKDIVKRFYYGETIKLITTAVLFVFIFQLPDIMFAPLFTGFGAVLAVFWFA
                     LLARG"
     CDS             complement(52190..53050)
                     /codon_start=1
                     /gene="spoOJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003100240.1"
                     /locus_tag="MishRS11D_00540"
                     /product="chromosome partitioning protein"
                     /protein_id="BBL72956.1"
                     /transl_table=11
                     /translation="MSVKKRGLGRGLDALLGGGGAQLEAVALEKMKTVAVERLQPSRF
                     QPRKDIDPAKLQELADSISAQGMVQPVVARTVGEGRYEIIAGERRWRAAQLAGLREVP
                     VVVRDVTDQAAMAIALIENIQRQDLNPLEEAEALKRLLDEYGMTHQQLADAVGKSRAA
                     VTNLLRLNELHPEAKQLLLAGSLEMGHARALLGLDTALQADIAQQVAAKQLSVRATEA
                     LVQQAKAGIKPAPKPPVPKDPDIRQLEENIAMNIGAPVSIRHGKQGAGRLIIQYDSLD
                     QLEGVLERLR"
     CDS             complement(53205..53579)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00550"
                     /product="hypothetical protein"
                     /protein_id="BBL72957.1"
                     /transl_table=11
                     /translation="MDKVLEKYDFKTVFLEDFRFAEQVAIFKNANAVIGVHGAGLTNI
                     LFCGPKNTRVGEILPPLCATRAYWVLSNALGFEYGAFIAEDKEFPKPDYAGWKHQGKL
                     YNKRNVLVNIKAFERFVKKMVR"
     CDS             53979..54152
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00560"
                     /product="hypothetical protein"
                     /protein_id="BBL72958.1"
                     /transl_table=11
                     /translation="MTNIEDIELIIYERQASGIEILDFTEDERLGAMAEFEVFILIED
                     IKLYITSIRAVRR"
     CDS             complement(54755..55558)
                     /codon_start=1
                     /gene="soj"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010958543.1"
                     /locus_tag="MishRS11D_00570"
                     /product="cobyric acid synthase CobQ"
                     /protein_id="BBL72959.1"
                     /transl_table=11
                     /translation="MGKIIAVANQKGGVGKTTTSVNLAASLAATRHKVLLVDLDPQGN
                     ATMGCGVNKKTVSPSAYEVLSGQVHARDAILSIKEVGLDVLPGNSDLTAAQVELMQRD
                     RRECALTDALAITRAEYHFVVIDCPPSLNILTLNALVAADSVLIPVQCEYYALEGLSD
                     LMDTLRNVRETVNPHLQIEGLLRTMHDTRSRLAGEVSEQLLKHFGEQVFRTVIPRNIR
                     LAEAPSHGLPVMKYDKASKGALAYLALAGEIARRNQGKAKAGKGAKSAA"
     CDS             complement(55558..56181)
                     /codon_start=1
                     /gene="rsmG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P94614"
                     /locus_tag="MishRS11D_00580"
                     /product="ribosomal RNA small subunit methyltransferase G"
                     /protein_id="BBL72960.1"
                     /transl_table=11
                     /translation="METLDRRLAAGMETLALPHTPEQRARMLAFLDLMRKWNRTYNLT
                     AIRDLNTAVDLHLLDSLTAAPYLHGASVLDVGTGAGLPGIPLAILCPDKAFALLDSNA
                     KKTRFVQQAVIELGLKNVDVITARVEQYRPERGFDTVLARAFASLAEIVAATARLLAP
                     GGRILAQKGVWPQQEIETLKGRGVRVHKLAIPGLDVERHLVEIMAGS"
     CDS             complement(56184..58058)
                     /codon_start=1
                     /gene="mnmG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KNG4"
                     /locus_tag="MishRS11D_00590"
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme MnmG"
                     /protein_id="BBL72961.1"
                     /transl_table=11
                     /translation="MFFSETFDVIVVGGGHAGTEAALASARAGAKTLLLTQSIETLGQ
                     MSCNPAIGGIGKGHLVKEIDALGGFMAQAADRAGIHFRVLNASKGPAVRATRAQADRA
                     LYKAVVRRKLETQPNLALFQQQVADLIVEDGKAAGVVTQMGLKFRARCVVLTVGTFLA
                     GRIHVGLENYEGGRAGDPASNALALRLRELPFRVARLKTGTPPRIDGRTLDYSVMEAQ
                     PGDVPVPVFSFLGSPEQHPRQVSCYITRTNGRTHDIIRGGLDRSPMYTGVIEGVGPRY
                     CPSIEDKIVRFADKDSHQIFVEPEGLDTHEIYPNGISTSLPFDVQYALVRSIRGFENA
                     HITRPGYAIEYDFFDPRDLKASLETKPMDGLFFAGQINGTTGYEEAAAQGLIAGLNAA
                     LKAQDREAWSPSRDEAYMGVMIDDLITRGTAEPYRMFTSRAEYRLLLREDNADLRLTP
                     KGRELGVVEDEHWRRFEAKQAAIARVQTELAEREIRPNSPEALSLEPILTSPLTREAR
                     LLELLRRPEVRAEHLRDICPVLAAVDDPQALEQVEIQAKYQGYIDRQQAEIDRARRYE
                     HWRLPDQFDYANVVGLSAEVRDKLKQQRPETVGQAARIPGVTPAAISLLLVHIKKLSA
                     "
     CDS             complement(58339..61809)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00600"
                     /product="hypothetical protein"
                     /protein_id="BBL72962.1"
                     /transl_table=11
                     /translation="MFKPTTKQRKFMLWSLGLLVPLGVYALAGVYLMPWLVRAQVLPR
                     LSARLGAGLSAQAVAFDPFALRLVLKGFALKDKTGLALIELGRLEADLAGVGSLGQRA
                     ATLELKLDALSVHLQRGADGKFNLLALVPPRTDPPGSGGGFPFLLTRFTLAQGQIEYR
                     DISGPAPFAVSLGNIRLDLENLGSASQNPARFEFSATTSQRETLSVDGTLALAPFGAA
                     GKLEARDLDLAVWAGGLAPALPWRLTSGKLGFQAEFSVAAGDKPSLDLNAGEVVGANL
                     AATANGASGEAVKLGGVKLAGLRYAGAAQRLDLDTIQVENADSTWAKLAHLDAGKLAF
                     TLADRKLTLESARLATASTPQGIQLGQLTLGKLAYALPQQTLSLDTVALQNLDTPWAR
                     LGQFNAGGLAYAGAEQSLKLKSAALNEAIADQESASDQWRAAGQDSERKAASNAVEGK
                     PNPVADGQAAAPKREIPLRARIGALKIGDVAVSLKRRVVDIGTLDTDQGEIGLRRTAT
                     GELKVPGLPDTPAPVPSSGGRAGSSRSPEPWTVRVDEFRLTGYSLGFRDETPTTPVRI
                     RLDPASLRMDGFSTEPGKQFQFLLNTGLGEQGKIEVDGQARLFPLQSEMRFGVDKLWL
                     RSVQPYWEKFVGFNLARGRLNLWGDLVVRQEQDIAVDYSGAFDIVDFTAVDRRENQDL
                     LRWHSLKFDGVVVGTAQRRASIRSITADQSYSKVFIGPDGVLNLTRDLIAPPAETPAQ
                     AAPPPRQAAAPAAPWSYVIGSVRVVDAHMDFSDLTLNPSFATQIRDLNGNIRGLSSQE
                     NAKAEWLLEGHINQSSPAKLYGQLQPAHFKNNTDVTLEFRGVNLTTLSPYSGKFAGYR
                     IEKGKLDMDLRYKLKASRLEVSNRMVLDQLVLGERVESPTATSLPVDMAVALLKDSEG
                     KIDIDLPISGDLNNPQFSLGNLYSTAVRQMLTKLVGSPFSLLGNLVGGGDEKLSTVRF
                     RAGDAELSADEKGELDKVAAALKERPALKLNIKGSADPVQDRMALAEAALLKQLRSDR
                     AAELRALGQRVAQADGLDLSDEDYRRLFSRYYRQRQAPVPAVVAPPSGKEPSLEGATF
                     NAAKRRVLEQWNVSELELRLLAQARAEAIRGYLVNQAGLVDRRIYLLDVRLNPPEERE
                     IKAWLSVSGA"
     CDS             62031..63491
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004526224.1"
                     /locus_tag="MishRS11D_00610"
                     /product="serine protease"
                     /protein_id="BBL72963.1"
                     /transl_table=11
                     /translation="MPTQTLRHSLIAAAIAGVLVAGYARFGGDSPRPAPVPAAPPAQA
                     AAAPVPAPAAAPTVTLPDFGSIVRQNSPAVVNISVSGTTKVSARDIPQLDPNDPFSQF
                     FRRFQPPQAETPMHGMGSGFIVRPDGVILTNAHVVEGASEVTVKLVDKREFAAKVVGI
                     DKPTDTAVLKIEAQDLPTVKLGSPARTGVGDWVLAIGSPFGFENSVTAGIVSAKSRSL
                     PEEGYVPFIQTDVAVNPGNSGGPLLNTQGEVIGINSQIYSRTGGYQGLSFAIPIDVAL
                     KVEQQLLDHGKVSRGRLGVGVQDMNQALADSFGLSRPEGALVDMVPEDGPAARAGVKA
                     GDIIVALNDQPIHDSRELPPLVADLKPGSEAKLTLWRDGQHEEVALKVGELQEPAQAS
                     AEPAEAKGRLGLAVRPLSPEEHRQADIKGGLVVERVAGPAAKAGIAPGDVVLAVNGQP
                     INDAGQLRELAAKAGKHLALLIQRGEATLFVPLDLG"
     CDS             63791..64885
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00620"
                     /product="hypothetical protein"
                     /protein_id="BBL72964.1"
                     /transl_table=11
                     /translation="MFSKFTSSLKLHLPELKLPEFELPSFDLPDIALPELTAADYQTL
                     AVLGFFAALLALEAPSSRAERRPQVYRQSYLANLGTFFLNDTLLSLLSVSSLWLVAEH
                     YAGWGLLSGLRDSWWKAALSFLLLDLTLYGWHRANHTFDWLWLFHKVHHSDPAMNVTT
                     AFRLHIVEVLLTTLVKALFIVVAGVDAALVLANEAIITVFVMFHHSNLAFRGERWLAH
                     IAIVPALHRVHHSTRREEHDHNYGFVFSLWDAWFGTLADTRPTAIGLRGVGGQNAWQL
                     LKFGFTWRTTPRRLPLAKPQPLNGSLLDVVKFGLSPAHAPKLPNSAALRAMIAEAAYF
                     RAEKRGFAPGDEFRDWVEAEREILRRLAHR"
     CDS             64989..65531
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00630"
                     /product="hypothetical protein"
                     /protein_id="BBL72965.1"
                     /transl_table=11
                     /translation="MTTARKSAAFFATSVLGFALSGCGGLGGLTQQLNTLKEPKVSLA
                     GLALKDISLTEPSFLVKLKVENPNDLSVNLDGADVNLALNGQPVATGISRGPLTLAKR
                     GASTMDVEVKANTLGVLQQIMQVQSKGGVQYDVSGHLNLLNWLGALGKVPFNFQGSVD
                     KATLLKGAEGLGGLGKLLLR"
     CDS             complement(65654..65896)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00640"
                     /product="hypothetical protein"
                     /protein_id="BBL72966.1"
                     /transl_table=11
                     /translation="MHKLISTGAIAVLLGGCALLGKHYPPPPPGLTAEEAADRLEESK
                     REYDTCIQNREPGRPTCDRLEDLYERDKANYEALSH"
     CDS             complement(65985..66761)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00650"
                     /product="hypothetical protein"
                     /protein_id="BBL72967.1"
                     /transl_table=11
                     /translation="MNAPFQAGTALLLAALAMMPPGAAAEAGPVLALPPADRAAIEHA
                     LGRGVLGKPVPAPVIADPAHYLAFAPGVWTYQIRTGAKGHSTEPYRWSHDGRGEQGPR
                     WRYDAGGEETGFVESRADGVYLTGVREIRDAATTRYAPPEPLLLKGLAPGQERRQRMK
                     VRVYEDDGPEPAHEGELDVVYRYLGAYRLTVPLGSFDAVVIKSSFAGRVGPAELDDVQ
                     YRFFAPGVGPVALMEKREVSAFVLYNLHLDVGKVLVSRPK"
     CDS             complement(66781..67476)
                     /codon_start=1
                     /gene="kdpE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004185947.1"
                     /locus_tag="MishRS11D_00660"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL72968.1"
                     /transl_table=11
                     /translation="MSKANPAIVLIEDDPPIRRFLRTGLSSHGFQVFEADTGKQGLVE
                     AGVRKPDLVILDLGLPDMEGIEVVRALRGWSPLPIIVLSARSAEQDKIDALDAGADDY
                     LTKPFGLGELLARIRVALRHLNTGAGYAKDGVFTTGKLKVDLGKRLVYRDGEEVHLTP
                     IQYRLLGVLVKHAGKVLTHHQILKEVWGPNALDNAHYLRIYMSQLRQKLEADPAKPEY
                     FLTESGVGYRLKV"
     CDS             complement(67486..70239)
                     /codon_start=1
                     /gene="kdpD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004526440.1"
                     /locus_tag="MishRS11D_00670"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBL72969.1"
                     /transl_table=11
                     /translation="MSSERPDPDALLAKVERDEAKARRGRLKIFFGAAAGVGKTYAML
                     LAARERRAEGINVLAGLVETHGRKETAALLKGLAVLPHKAIEYRGTTLREFDLDAALK
                     RKPALILVDELAHSNAPGSRHPKRWQDIEELLDAGIDVYTTLNVQHLESLNDDVGQIA
                     GIRVWETVPDTVFEAADEVELVDLPPGELLERLKEGKVYLREQAQRATENFFRKGNLM
                     ALRELALRQTASRVDAQMRDYREDHAIREVWQVGELILVCVGHTPLAERLVRAGKRFA
                     TSLRANWIVAYVETPELQRLPAERRDLVLRVLRMAEQLGAETVTLSAPEMSTAILKFA
                     RERNVTKIVMGKPTRRGWRRWLLGSVVDIIIAEAHNINLYLLGSPRPGSGPQGDEVEE
                     EPVLFRKPPPPGMNDPVNRRRHTSYAGYGWSVAVTALCTGIAALMRGGFDLANLVMIY
                     LVGVIVIATRYGRGPSVLASVLSVLSVDFLFVTPYYSFKVSDSQYLITLLAMLVVAVV
                     TSHLMSHVRYQAKVAGHRERRATALFAISKELSASRSEEEIVGCAVRHIHGEFGGKNI
                     ILFADEEGRIVYPEGRKQEESLEGCDLSVAQWVYDHNELAGLGTNTLAGANAIYFPLA
                     AGDKVLGVLVVQPANLRRVFLPEQRKLLETFTGQIVQAIERVRLAEQARAAAVQMEAE
                     SLRNSLLSSISHDLRTPLATIVGSASALIENGSGLKPEDRRELSRTIHDEALRMSRLI
                     DNILDMARLDAGAARLNRQWHMLEEIIGTVLNRLGKRLEGREVEVKLPPHMPLVHVDA
                     VMIEQVLTNLLENVARYTPPDSPIEISAEKSDFTLTVEVADRGPGIPRGQEEQLFEKF
                     YQVDRERAQSGVGLGLAICRAIVESHGGYIRARNRPRGGAVFSFTLMQDQTPPPPLPE
                     EET"
     CDS             complement(70283..70465)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00680"
                     /product="hypothetical protein"
                     /protein_id="BBL72970.1"
                     /transl_table=11
                     /translation="MADILPFRKPKAAKKPDTTLCRSGFHKWKVDKDKVFDVKQGRLV
                     TAYRCERCGALKTEAR"
     CDS             complement(70469..71089)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004543360.1"
                     /locus_tag="MishRS11D_00690"
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="BBL72971.1"
                     /transl_table=11
                     /translation="MGAPGLSAADGFGPNLARQDGELYYLEHFIPVAEADHWLETLLA
                     GLAWRTETIAVAGRAVPVPRLVCWYGDAEAHYRYAGVDHAPEPWTPGLALLRRRVEDY
                     CARRFNSVLGNLYRDGGDAMGWHADREPELGPWPFIASLSFGAERRFDLRHNRSREIL
                     NLPLAHGGLLLMGGMLQHHWRHRVPRLPGVRAPRINLTFRAILPPP"
     CDS             71264..71440
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00700"
                     /product="hypothetical protein"
                     /protein_id="BBL72972.1"
                     /transl_table=11
                     /translation="MKCGGCESTVKTAVSALAGVAAVTPSFKANTVEVDYDEAQTDPE
                     TIKQAIQGKGFAVA"
     CDS             71513..72493
                     /codon_start=1
                     /gene="mdh"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9RXI8"
                     /locus_tag="MishRS11D_00710"
                     /product="malate dehydrogenase"
                     /protein_id="BBL72973.1"
                     /transl_table=11
                     /translation="MKTPVQITVTGAAGQISYVLLSRLVAGDLLGDDQPIVLRLLEIP
                     EALGIVRGVNMELVDYASPLLEDVIISSDPEVAFKDADLAFLVGARPRGPGMERQDLL
                     QVNADIFSVQGKAIDAAAKRSVKVLVVGNPANTNALIALRNAPGISPRQFTAMTRLDH
                     NRAVSQLAQKCGRTARDIRRVVVWGNHSTTQHPDLCHALVDGKPALDLVERAWYENDF
                     IPTVQKRGAEVIQARGKSSAASAANAAIGHMRDWVLGTPPDDWTSMAVHSDGSYGIEP
                     GVMCSFPVRVRDGDYAIVQGLEIDAFTQERIKATETELMIERDMVRHLLD"
     CDS             72871..73167
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00720"
                     /product="hypothetical protein"
                     /protein_id="BBL72974.1"
                     /transl_table=11
                     /translation="MSSSLSRAALAIAVLAATAGTALARPDEVSEAQVRGCQYLSTVA
                     GSSGYGKHFGWQPIAKADAEKRAGAIGATHIVWSDIRPVGAFNGEARAKAYACR"
     CDS             complement(73412..76462)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00730"
                     /product="hypothetical protein"
                     /protein_id="BBL72975.1"
                     /transl_table=11
                     /translation="MKENLLQAAVGAVLALGPVAGSATAFGPLANFDVINDTGQTAHG
                     FEIEIEDLHPNEITSIFGVAPRWTGMNRYGDPAIVEIQKPTAAKGYATRITFQSKYSG
                     GWAVGTPSGTLPVKPSDSCWPLGASGQYGPNYPCDHFGISTSVATGPVKYSWLVESTP
                     GSASLAPVDVAVPTPVWTVVPQPPVVIQPPPPAPNLPPPPPIVQPQPPKVNVVIAAPR
                     PNYYEFGEPRWVKVTATGTLQDIGIENLMAEDRVIKQAKTQVQVEWQLLQVDIGSPGS
                     GQIDLTGVALDAGATGVVYRFEFYAYTGARDPETNQALPKTSDTPKQPDPADLGKFLV
                     AQNAGLNFDGQIPPAPPIPVAPTLNATIAGAVVNSPYSQVIGATPGVPGDPLSFAVTG
                     LPQGLSLVGDTISGTPTVVGDFPLNITVTDTVNQLSTAGATSLNVADAPIVFGLSLSQ
                     GTVGAAYAETLAAGGGYGGITYLVFNNSLPPGLSLSGNQITGTPTAAGSYDVTLLAKD
                     SLGFIANASQTVTIVAAAVPPPPVACADSNLVITNVGPASVDVGGGVANGGQSILYPA
                     GQGAAQYKVGDLLSFSGTLDGQGFCAADTLSSLPGLSLPALSFLPAMAGSAYTTASIA
                     PVGGIAPVTVFVSGLPQGLGFDGSVISGTPTTPGTYTLTITAADAIHEQVVATPRLVV
                     DAAACSATNAVITNMANRGAWFEVNGGMNGGGQTVTYPAQNATVVNPPLTPLTAWTLG
                     NLVSFQGTLDGIGMCHPTTATLSQGLTFAVPVLANAAVGSAYASAPLAPTGGVPPYSV
                     AVGGLPPSLGVQGSAIVGTPALGQQGTYPLTITVGDATGRVRAVSASLTVDPAPALVL
                     GASNLPATGTVGLAYTGAATAGGGVGTLAWTATGLPTGVNIAADGTLSGTPTAAGTFQ
                     PVLTVTDALGQTASLGATVTIAPATQPSCALPKGAKPTQGKKKVTAVGTGYYYAGTVK
                     VAYGDCTRLELNGGAKAIKVGDVAEWEGYVRADGSVFAQILTIN"
     CDS             complement(76989..78182)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257829.1"
                     /locus_tag="MishRS11D_00740"
                     /product="glycosyl transferase"
                     /protein_id="BBL72976.1"
                     /transl_table=11
                     /translation="MIDADTLRRVPGPGRYLFRNPVLRGVIGGLDAVLETFHRPSPGP
                     LAIRPGKILVCNQAHIGDAILATSVLPVLRAAFPEARIGFLVHPGSAGVLADHPDIAW
                     AHCFSHWRLDRQESALWRKLARDGRSRFAAVRDIRAVGYDLALDLYPYFPNSIPLLFA
                     AGIPLRLGWTSGGCGGLLTHALDWSSGPDHVVDHHRRLLGQIAACREHLPLARPRLHA
                     SETLRRQWRALAEARGIPAGFVAFHVGAGGVHRHWPGGHWRELAALCLEHGLSLALLG
                     HGPREQAVCREVAGLSGAIHDLSGQLGWRLMTEAIGQARLLVGLESASGHIAAARAVP
                     SVSIYSGTAQTSTWRPYHPAAKTLVHPVPCSPCHLSGGCPGMECVQGTTPAAVFAEIV
                     RILAA"
     CDS             complement(78189..79685)
                     /codon_start=1
                     /gene="hldE_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:D1B7C7"
                     /locus_tag="MishRS11D_00750"
                     /product="bifunctional protein HldE"
                     /protein_id="BBL72977.1"
                     /transl_table=11
                     /translation="MNPQRRLLEAVRGGFRAAGTLDIPRILVVGDLMLDRYLWGEVER
                     ISPEAPVPVVRLRRRTERFGGAANVAANLAGLGAEAWVAGYLGGDEAGLRLTEMLADT
                     GIHGGGLVRSDSRPTTTKTRVIGGRQHMLRLDQEATGPYPDAERGRLLGAVLDLLEHT
                     PIAVLVLSDYAKGALDPGLCQSLIGAARAKGIFVLVDPKGLDYRKYHGANAITPNLRE
                     AAQAVGEPVQDVAAVLERAGQLRRELGLDFIAVTLGEQGISLIGAEAARHLPAQAREV
                     FDVSGAGDTVIASLAAGIAAGLSPWDACRLANHAAATVVAKVGTLPVERDELLRAIEQ
                     ADADTQADKVRALPDLLRQVEHWRSQGETLVFTNGCFDLLHAGHVGYLEAARRLGHRL
                     VVGLNTDRSVAALKGPDRPVIHEADRARVLAALAAVDAVVLFDEDTPLALIQALRPDV
                     LAKGDDYAEAEVVGAAEVKAAGGRVELIPVLAGRATSRIIARLVGQAA"
     CDS             complement(79682..80248)
                     /codon_start=1
                     /gene="gmhA1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9PNE6"
                     /locus_tag="MishRS11D_00760"
                     /product="phosphoheptose isomerase 1"
                     /protein_id="BBL72978.1"
                     /transl_table=11
                     /translation="MHCKSIFDQALAEHRAILDRLPEGYPAIERLARLMRESIARGGK
                     LLWMGNGGSAADSQHLASEIVGRFRRERRGLAAIALTTDSSVLTAVGNDFGFERVFAR
                     QVEALGQPGDVLIGISTSGNSANVAAALHAGRCMDLTTVGLLGSGGGRIAGLCDHALI
                     VPSDDTARVQEAHILIGHILCELLEAIP"
     CDS             80594..81784
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00770"
                     /product="hypothetical protein"
                     /protein_id="BBL72979.1"
                     /transl_table=11
                     /translation="MLVCALSSGGPAWGAADPTDIFQPNFTETLSYDDNLFRLTDNAN
                     PIVTANTGKRWDIINRVAAGLKIEYPWKRQSLIFDGNLGYQSYANHGYLDNVNGFANG
                     KWKWQLGNDWDGLMSYGYQRAIGGFTNTGFFGKDMISNYTALFDINYWFNPSWRINGQ
                     YLWLDSQHSAEQRQFLDLVANTGSGGIYYQSSVFKDSYLGLRYRHSDGFQPHRQVDAL
                     TLIDNSYTDDEVVLDSLWKPSGKSQLQGNIGWLRRTQPDFPQRDFQGATWRLDYLWTP
                     THLTQLELTTYRQLRSFQDLTASYIVVDGVSFAPGWSATEKISLHARLTWESWSYQGN
                     PSTVFGGKTREDNFWSEQLVASYQFIRNAEASLTYQAAQRTSNYPNQSFQDNMVFASL
                     SLKF"
     CDS             complement(84445..85326)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887479.1"
                     /locus_tag="MishRS11D_00780"
                     /product="glycosyl transferase"
                     /protein_id="BBL72980.1"
                     /transl_table=11
                     /translation="MKLVVGIATAGRREQLTLTLLQLARQTRPPDALVVCPAELSDYD
                     PAVAEILPFPVRSVAAPRGLPAQRNAIIAACVDADVMVFFDDDYYPSPDYLAETEKLF
                     QVQNIVVARGYLLADGIGGPGIEPEQALRLIVDRKPLPPWDSAIKATYGGYGCNMVVR
                     MNTARRHGIAFDENLPLYGWQEDIDFSRALAAYGRVVICLRMTGVHLGSKRGRTSGLK
                     FGYSQVANPVYLCKKGTMSPGYAGRLVLKNLLANVLKSLKPEPWVDRRGRLKGNIQAL
                     GDLARGRIDPRRILCME"
     CDS             complement(85253..86689)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189631.1"
                     /locus_tag="MishRS11D_00790"
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="BBL72981.1"
                     /transl_table=11
                     /translation="MKRGKRGTARNRRGNRRRHAARLEPTRSPLAARQEKPLSTRRSL
                     GFVYIAHVFRYIYGLILIPYYGRVLGAEEYGKVLAASALFQVIWLCVEYGCPVAGVRD
                     LAGTTDRPGIAAQVGRQTMARAIMVPLAIAIGVGGAWLSPVLRVEPELVAYAVAIGIN
                     SGFNLGWYFQGALQFRTQALLEVFGFALSLGFILLMVRGREEGARVLEALLLSGLISN
                     GIAYTLVARQIDLQYLSLTGAFRLIWDSTALFASRGLRIMMANASTYLLSLFAPAAQV
                     GYYGPAERFSSVGLSFMQPVGQVLIGTVTRHLSCDETEREAYRLMRKGILFMLGFGGL
                     ALLATVGLSAWIMPLILGPGFEQSILIMQIFGFMFPFAAFNQAVSNYVLIPLRKDTYI
                     IKSTAVCAGLSIATVLASTLFGEVGGSTIAGARVVAEVVSSCFLAMVLVKLGLGRKIF
                     MENPDEISRGYSDRGPSRATDTNPASTR"
     CDS             complement(86706..87959)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00800"
                     /product="hypothetical protein"
                     /protein_id="BBL72982.1"
                     /transl_table=11
                     /translation="MQNLSGGPRGLKLQLPPPESPPLPYSAAGSLRVAVVHEWLVSRA
                     GSEKVVEQILKVYPQADLFALVDFLEADERAFLEGRKARTSFIQRLPRARTCYRNYLP
                     LMPLAVEQFDLSDYDLVISSSHAVAKGVITGPDQIHISYVHTPIRYAWDLQHQYLRES
                     RLETGFKSWAVRACLHYLRLWDTRTAYGVDTFLANSAYIARRIRKVYGREATVVYPPV
                     DTEAFPLRLDKEDFYLAAGRYVAYKRMPLIAEAFAAMPDKRLVMIGEGAELDRVRFLA
                     RRAANIEVLGYQSGAVLADTMGRAKALVFAAEEDFGITPVEAQACGTPVIAYAAGGAL
                     ESVVADPDPGRGTGWFFPRQTAASLCQAVREFESMGGFRPEVCRANAERFSQENFRQA
                     LAAAVGHALARQPDHPLLARLGLCP"
     CDS             complement(87947..89062)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204846.1"
                     /locus_tag="MishRS11D_00810"
                     /product="group 1 glycosyl transferase"
                     /protein_id="BBL72983.1"
                     /transl_table=11
                     /translation="MSQCGIAYLSPRQTVFINGRFLGQRVTGIQRYAREVLAELDSIL
                     AHGEGNGLRCRLLAPKGVDLPELRAIPAEQFGHFRGHLWEQLDLPWRVGRGFLFSFGA
                     TGPVLKRRQSITVHDTSVRRIPESFGWRFRLWHEVLLRSITRRSPLTITVSRFSAGEI
                     AQCFGVAQDRLRIATEGWQHLSRIEEDDAVLDHYGLGIEPYALAVSSPTPNKNFATIA
                     EAIRLLGDAAPPCVAAGMADPGVFRGTAAHPDAIKRVGYVSDAALKALYRGAGCFIFP
                     SFYEGFGIPPLEAMACGCPVLASTAPAVREVCGDAALYFDPNRPDQLAGQIREVFADT
                     GLRQRLSRAGLARAKCYSWKESARLNLAFMQEAVCKT"
     CDS             complement(89291..90736)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887433.1"
                     /locus_tag="MishRS11D_00820"
                     /product="hypothetical protein"
                     /protein_id="BBL72984.1"
                     /transl_table=11
                     /translation="MEITVFALPVILAGLLASGGGILYALMICLLFGGTATLSFSMLG
                     DAPILPVILLMPFLVWKAIADRGISLSPRFLLYPEPGFWLLLLVLWEVLSAMSLPRLF
                     SGETLVFSTNRGVIGGVALMPLKPLSTNLTQSIYALLGLVCFLSVRSLLDSERRMAKM
                     RDAVLLLTALNILAAVLQLAENHLGFPSVLNLFRNASYATFTGGEVGGLLRIYGTFPE
                     TSVFSSFTLALFAFAASLCRDGVRGVYSGTVALVSLGLLLITTSSTAYAGLLIYGIIA
                     TAMALAQAYWHRQALRVGPTTLMMVAVVLAGCFIMLSQPEIFSRIFEFFDVTLVNKLD
                     SNSGRERSLWNRQGWINFIDTYGLGIGFGSARTSSFPMALLSNTGVIGVGLFTLFCWR
                     LFTGPTIAEPTTVAAVSRAARHGLLAVLVAGTISGTMADPGMVFYTLSAAAAAGLAYR
                     QPQRESATVEAGFKPREYPGVNPLRGHLGKG"
     CDS             complement(90787..92199)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00830"
                     /product="hypothetical protein"
                     /protein_id="BBL72985.1"
                     /transl_table=11
                     /translation="MSKQDRRLLWITLGLVVWTGWASALAADWGAVLPPPGGDFQPAA
                     APFRETLCLGVKFSQGEPLANLPNLSELGVRWVRDHVGWATMEPTAGRFLSRFPNDFQ
                     QRLDYYRSHGIGVVFMLAYGNQKAYPNTPENPTNSVNATGFARYAAQVARLMKASGVS
                     FVLEVWNEPHNDAVLQKFGGNWQGKAPSPWVDQYIKIAQESVRAVKAIDPSIKILSDD
                     DMWVVHYWFLEAGLPKEIAGFAVHPYNAPANPEYTAVAYDTDWTRPFKVVDQDRSFRS
                     AVRRLRDQGKTKLGYIPEIWITEWGWPLEGAKGSVPESTLVAYLPRAYILAAAAGIKA
                     TCWFSSYDAVDGPMGLTRNNGQHRQTYFAYQTMARQLGDMVLLSQLAGTDHPASGIQG
                     FVFTGARGRKLVVWSVEGATPYLSFPANEKTIEAVDVLGKPVALDTSVQGRRRVKLGA
                     APVYVSGTWLDAPLDISVNY"
     CDS             complement(92258..93181)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00840"
                     /product="hypothetical protein"
                     /protein_id="BBL72986.1"
                     /transl_table=11
                     /translation="MKELHKESHAEPVRVERLERRAGFPAVPGSKPIGKLLVETGKIG
                     FLDIDAIERRQQERGLRFGEAAVSLGLIQDVDVQTALARQFDYAYLVPGQPEAQAFSP
                     ELALAYAPFGDRAEAFRRLRSQLNLRLFGLEDATALAVAGLDRGDGCSYVAANLAVAF
                     SQLGVRTLLVDANLREPRQHRIFGLAQRQGLADVLAGRRGTEVIAEIGVFGNLAVLPA
                     GTVPPNPQELLDRPAFAALLRECGRIYPVVIVDTPAANRYADTQIIAANTRHVLLVVR
                     KHQTRMRDLEAVKAHLIDARVEWVAAVFNDI"
     CDS             complement(93178..94605)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00850"
                     /product="hypothetical protein"
                     /protein_id="BBL72987.1"
                     /transl_table=11
                     /translation="MTYTQMFLILAARWRAVLAVFLGVVGLVVGVSLALPKTYTAHAS
                     VLVDFKGVDPITGMILPGQLLTGYLATQVDIITSHAVALRVVDSLKLTEVPELVEKFD
                     QETEGRGEVRDWVADRLIKALDARPGRDSSVIAIEFSNTDPEFAAGVANAFARAYIQT
                     NLDLRVDPARTQASWFEDQIKTLRGQVEAARQRLSEYQRRTGIVASDEKLDVENARLA
                     ELSSQWVIAQTQTYDIQTRQRQVAEAEAKGRLEELPDIQGNALIQNLKNALAQSEAKL
                     AETADQLGPKHPVHQSARAERDSLKRKIAAEIQNVKGSLAHAAAQAQQRETQIEHALD
                     RQKNRVLELKEGRDRAMVLTHEVENAERAYDSARQRTEQIRLESQRSQTEIAVLNSAV
                     PPLWPSKPRLALNLAIGVVMGGLFGVACALLREVGDRRVRAEGDIERGLGVPVLVSIA
                     PRRARRPALGFRHKPALPPRGGPCP"
     CDS             complement(94615..95439)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00860"
                     /product="hypothetical protein"
                     /protein_id="BBL72988.1"
                     /transl_table=11
                     /translation="MSKAISIAPTLGVGAILRWWMVFWLLLCGFGTARAEDYLLGPGD
                     FVKITVFDYPDLAVETRVSASGGITFPLVGEVLVGGKSPRQAETLLTQKLTEQGFIKQ
                     PHVNLVVTEFASQQVSVMGSVSKPGQYALERASTLSQVLAAAGGVSGEGGEVAVLVRT
                     AGGGNEHREIDLHALFAGDVSKDIGMTGGDLVYVPKAQTFYIYGEVQHPGVFRLERGI
                     NIAQAISIGGGLTARGSDDGVEVKRRGGQGELLTETAELGDLVRPDDVIYVGESWF"
     CDS             complement(95436..96353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00870"
                     /product="hypothetical protein"
                     /protein_id="BBL72989.1"
                     /transl_table=11
                     /translation="MAKVLARIILVFIGLALAGCDAPEAKHSSQVVARVNHEEITVHQ
                     LNSFLAHTGIKTWKTPREASRDALETLIEQELLVQQAVREDLEHDPQIMLAVEDAKRR
                     VLALAYLERKVLPKTPPTPEDIQAFYHKHPELFSQRKLYRLQAFAMPADRFDEGLKRL
                     LDPAQTPQETAHLLQARNIDYQTEWLQWSAEQAPLELLPRLAVMEPGDIAAVQRGKTL
                     LLLQLEAALLAPLDEAKAKPAIEAYLSSARNGEASRIHLSRLWRAAEIHYQGEFAGYE
                     SETTQQLGAGQNDVTSSGGRHLQKGIDGL"
     CDS             complement(96448..97929)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005478391.1"
                     /locus_tag="MishRS11D_00880"
                     /product="undecaprenyl-phosphate glucose
                     phosphotransferase"
                     /protein_id="BBL72990.1"
                     /transl_table=11
                     /translation="MRWRKGNQGTYTETQAGLEFLPSARLTKAPSHGATSLDLPGVIL
                     IKWLLCPVVVSLGLALVTLGHGHALDQSYVILGVLGFLVSAQVFDEINLYRDRPRFPY
                     FEAINYILWNWCVVFGVLLLVGYATKTLAMFSHRIIFTWFVMVPIALLGSQLLARNAL
                     RSVVNRTKTRKAVIIAANPLGLALHKKVTEDAYLGIRVVGFFDDRQAWRLPENMEDRL
                     LGRVAEAADYVRKHGVDLIYIALPMSLQPRIQHLLEALRDTTASVFFVPDIFIFDLIQ
                     ARFSQINGMPIVAVCDTPFYGLRGLIKRAFDIIGSLAILLVISPVFIVVAIAVKLDSK
                     GPVLFRQRRYGLDGEEVIVYKFRSMTVTEDGASNYTQVTQNDNRVTALGKFIRKTSLD
                     ELPQFINVLQGRMSLVGPRPHAIAVNEQYRKQILGYMIRHKVKPGITGWAQVNGFRGG
                     DDLEHMRGRIECDLEYLRNWSLGLDCWIILKTIKVLFGDRHAY"
     CDS             complement(98094..98669)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00890"
                     /product="hypothetical protein"
                     /protein_id="BBL72991.1"
                     /transl_table=11
                     /translation="MKRLYFIALSGTLWIGFWSGVVEAAIYSVTVKDVNRNILRPGIF
                     INDSFSIATPLSNGSFVEFQGNIVGVGGFTKDIVFSLSDPAFGRGFLASVQTVAGLDL
                     DLAGGTAPKPFNPVNPVYTFAGLTSGITYTLIASGNAIDPYSGIAGSFQVLAVPEPEQ
                     WAMVVVGISLIAFQIRRKHKALGQGQGTISG"
     CDS             complement(98831..99025)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00900"
                     /product="hypothetical protein"
                     /protein_id="BBL72992.1"
                     /transl_table=11
                     /translation="MPPWRQMGIAAAAVAAMPGGGNRARLFRGNTVFTGGFSEKGQFP
                     IHAAKLGKATYTQPGKIYVS"
     CDS             99147..99713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528153.1"
                     /locus_tag="MishRS11D_00910"
                     /product="FMN reductase"
                     /protein_id="BBL72993.1"
                     /transl_table=11
                     /translation="MSKIKVGIVSGNLGSPSKTLALAGQILEAVQRLAPVDKELHSLA
                     ELAPVFGPARSPAELPEAGHAVLRSIVAADLLIAVTPVYKGSYTGLFKHLFDFIDPKA
                     LNGVPVILGATGGGDKHALIVEHQLRPLFGFFGAWTVPSGVYASDQLYDGSRFADPTV
                     LERIDTAARQAVDAVRLRQQSFHPAQAA"
     CDS             99723..100907
                     /codon_start=1
                     /gene="acd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013227551.1"
                     /locus_tag="MishRS11D_00920"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBL72994.1"
                     /transl_table=11
                     /translation="MSTPDYERIRGEIRALVDEVVRPNADKIDTHGIFPRENLEALGR
                     AGWNGVLIPEEYGGLGLDHVAFSIVAEEIGRACASTGLVYVMHTGAAQTINLFGNHDQ
                     KQRWLRPARDGLIGTYSTSEKASGGHWWFNFSEAARDGDGHYLLNAEKSFTTSAGQAD
                     YYVFQTRSPGAKGPTDISFFIVDSKLDGIAHGTWEALGVRGNHSGPITYKDVRVEARD
                     RLGEEGQGKDIVYHGVSPVYLIGLGAVWHGVARAALERAATHLTGNIHRDFNRKLSDY
                     QVLRQQLGESKVAVESLRPWQHDLARQLDRLQAEGRAQGEILLPLTEFKVHAAEVANL
                     SARNALDVSGGYGYKKGPIERIFRDARAGIGMGPSNNIAREWIGKTLVGLPLELFEAG
                     GE"
     tRNA            complement(99785..99867)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="MishRS11D_t00010"
                     /product="tRNA-Lys"
     CDS             101340..102638
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00930"
                     /product="hypothetical protein"
                     /protein_id="BBL72995.1"
                     /transl_table=11
                     /translation="MLAAGAAVSPLAQALNTGTDLDLSLKAIAGGMAGAAFVRPQEVS
                     AALFGNPATLTQFKGMNAGVGAAILEPVVTNTQTSQGYSHESPSEAGNYVAPDFAIGG
                     EVADGVVLAGGVEVDSGLGADYRTHPISAGAGLGLGGSGPGGAATLPLLVEYLSFSAN
                     VGGAVEITPELSLGAALTVGVGFGQLGTSGNTSGLAGLSGDFGGTTSSVHNISARGSA
                     GLSYRINPTVTFGASFKTPLEYNFHNVLSTTVGGSQAYQAAKLEQPWEVQWGFAATPI
                     PELLVEVDGLWKNWSNAALYKDVWDDQFLALLGAQYSLDQWQLRLGYSYATALLRDNP
                     NGTLAGFQGLGTLPLDTAVPGVLNQNDLVRVVQTTLVPVVWQNTVTAGVGYAFTPKFR
                     LDFFGAYAFQGNASRSTLALGNYSVDASEWALGGGANFKF"
     CDS             102663..103556
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003807268.1"
                     /locus_tag="MishRS11D_00940"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL72996.1"
                     /transl_table=11
                     /translation="MHSNPPLAAAPFLNARPQPPARPARRTAQRAAPVLYPPAAQPHP
                     VLLRVEQVSLSFKGVKAVSDISFEVKRGEVCALIGPNGAGKSSLLNIINGVYTPQEGR
                     IVLDGVPYRRVNAHRAATQGIARTFQNIALFKGMSVLDNVMTGLNLNVRSNFLEQALR
                     LPRARREEAELRRKAGEVIAFLDLQAHTHSPVGNLPYGLQKRVELARALAAEPKLLLL
                     DEPMAGMNAEEKHAMCGFILDVHREFGTTVVLIEHDMGVVMDISDHVVVLDYGRKIGD
                     GTPDEVRGDPAVIDAYLGVAH"
     CDS             103575..104456
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011104319.1"
                     /locus_tag="MishRS11D_00950"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BBL72997.1"
                     /transl_table=11
                     /translation="MDFFLEVALGGLLAGVMYSMVAIGFVLIYKASGVFNFAQGSMVL
                     FAALTFVSLLEKGINFWLALLLALCAMLLLAVAIERCVLRHLVNRPPITLFMATLGLS
                     FVIEGLAQLFWGAQVHGLELGIADEPLELGGLLLSQFDLFAAATALVLVISLSLLFNK
                     TRIGLSLRAVADDPLAALAVGIDLEQIWRVVWMAAGCVGLVAGLLWGARVGVQFSLSL
                     IVLKALPVLIIGGFSSIPGAIVGGLIIGASEKLAEVYVGPLVDGGIENWFPYVLALLF
                     LLVRPAGLFGEPSVERV"
     CDS             104459..105526
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007246481.1"
                     /locus_tag="MishRS11D_00960"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BBL72998.1"
                     /transl_table=11
                     /translation="MWFSETEAWRATGGKSRRLPVWRKAPMAWVALLVLGFGVVPFIG
                     NDYWFSAILIPFLVLSLAGLGLNLVTGYAGQLSLGSAAFMAVGAFASYNFSLRVEGLP
                     LLASFGLGGLSAALVGVLFGLPSLRIKGFYLLVSTLAAQFFVQWVLVKFSWFSNDNPS
                     GVISAPPLVVLGQDFNSPAGRYVLTLGVVAAMTGLALNLVRGATGRNWMAVRDMDTAA
                     AVIGIPILKTKLLAFGISSFYLGVAGALWAFAYLGTVEPHGFDLNRSFQVLFIIIIGG
                     LGSVLGAYLGALFFVLFPVFLDHLAGGLFAGIIDAGHLENLQKIVFGSLIIFFLIREP
                     EGLARLWWRFRARLGLDPAAS"
     CDS             105568..106902
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011104318.1"
                     /locus_tag="MishRS11D_00970"
                     /product="ABC transporter permease"
                     /protein_id="BBL72999.1"
                     /transl_table=11
                     /translation="MSKINRKLLLSLAVGAVLGAIQPAAAAPNEQYFPLQSYRVGPYA
                     AGGTGFFGGFIDYMKLVNLRDGGVNGVKLTWSECETEYVVERGVECYERLKGGLNGAP
                     AAATNPLSVGIAYATLDRSTADKLPLITINHGRTDSTDGSVFPYIFPLQLNPYSEVSA
                     IINYIGQREGGLDKLKGKKIVTLYHGSPYGKETIPILDLLAKKYGFQVNHIEVPHPGN
                     EQQSQWLNIRRIKPSWVILRGWGVMNPVALKTAAKTGFPVDHIIGNIWSNSEEDAAPA
                     GAAGKGFISITTHPSGTDFPVLQDIKKYVVDKGQGDLEDPKRFGSVYYNLGVVNGILN
                     VEAVRIAQEKYGKRPLTGEETRWGFEHLDLDDTRLKALGALGLAQPLKLSCADHEGGG
                     AVRFQQWDGQQWNLISDWVQADRALLRPIIEQSSAKYAKEKGIAPRDCAKET"
     CDS             106955..107776
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002719435.1"
                     /locus_tag="MishRS11D_00980"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL73000.1"
                     /transl_table=11
                     /translation="MTSTDPPILSVENIEVVYDHAILALRGVSLGVAAGRIVALLGAN
                     GAGKTTTLKAISKLIGAERGAIVAGDIQFQGVSILDRPPDQLVRAGLVQVLEGRHCFA
                     RLSVEENLLTGAFVRKPGRAALKSELERVYAYFPRLKVRRKSLAGLTSGGEQQMVAIG
                     RALMAHPRLLLLDEPSMGLAPQVVDEIFHIVTELNRREGVAVLLAEQNATLALKHAHH
                     GYILENGRVALAGSAEELRGRDDVKHFYLGMAGEERRSFKSGSGTGQRLAGDISG"
     CDS             108404..109795
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_00990"
                     /product="hypothetical protein"
                     /protein_id="BBL73001.1"
                     /transl_table=11
                     /translation="MGCALTLGFALSPALATAQSESARIKQLLEQMQEYQRQLAETNA
                     RLQALEKKDATKTETQGNGLGNNGYANGTANGNGKKVASDTATAKARNIQEQPDVEDP
                     ATAKVPKERFLKGFYDGGFTLRTSDNRYSITINGLAQARYTLNLPSKYTGSDSQTFDL
                     ALGRLFFSGTVFDPNLSYFFFYQTSTLANDNRVDTIDWWGKYQLGDWGIKAGRILPQY
                     SRQFYTDIGKYLFMDLQAPEYAFSLQRTPGAEVMWHADKWTVSLTAGNSVRALDSTTQ
                     ENTNLKLAGIARVVYDVLDPYTYVQETIPDVVERPQLSLGAAFGFNPVDTNSSLQNTI
                     AGMDTYNGTLDIGYRYQLFNTEAAFFWREDHRPKNTGPGTSDNYGWYWQAGYFLLPKR
                     LEIAGTANQVLFDFPDGSSYKNQTIGSVGLNYYFYDHNFKLQSDYSYITGEDWSHHSL
                     EDNRFRLQGQVYF"
     CDS             110066..111184
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003093107.1"
                     /locus_tag="MishRS11D_01000"
                     /product="dimethyl sulfone monooxygenase SfnG"
                     /protein_id="BBL73002.1"
                     /transl_table=11
                     /translation="MSHSAPLHRPGSEALKFAYWVPNVSGGLVISNIEQRTSWDIDYN
                     RKLAQIAEAAGFEFALSQIRFTAGYGAEYQHESVAFTHALLAATEKLRVIAAILPGPW
                     HPALLAKQIATIDHLTGGRIAVNIVSGWFRGEFTAIGEPWLEHDERYRRSEEFIRAIK
                     GIWTDDSFTFLGDFYRFHNYSLKPKPLQQPHPLIFQGGSSRAARDMAARVSDWYFTNG
                     GTLDNIKAQVDDIQAKAAQAGHSVRIGVNAFIIARDTEAEARAVLDEIIEKANPEAVK
                     AFGHEVKQAGKASPEGEGNWAKSTFEDLVQYNDGFKTNLIGTPEQVAERIVALKAVGV
                     DLVLGGFLHFQEEVEYFGKRVLPLVRELEARQPHKAAA"
     CDS             111184..112374
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003104714.1"
                     /locus_tag="MishRS11D_01010"
                     /product="FMNH2-dependent monooxygenase"
                     /protein_id="BBL73003.1"
                     /transl_table=11
                     /translation="MTAPGAHHSGPASAAAWFERAERLAAEFAATAVARDKAGGTAKA
                     ERDRLRDSGLLNLIIPAEYGGHGFDWHDTLRIVRIISRADSAMGHLFGFQHLLLATVR
                     LFGEQWPHYYRETARNGWFWGNTLNPLDTRARILPDGPDWLIHGSKSFCSGAMDSDHL
                     IVSALTEAGKLVIAAVPSDRPGIHIHADWDNMGQRQTDSGSVDFHEVRVYDREILRSP
                     GPLGSVFASLRPLIAQLVLTNIYLGIGEGALAEARAYTQSQSRPWFLSSAPSATKDPY
                     VLQKYGEFWVELNATALATDYAARLLDAAWRQENALTAAERAEAAVACATAKVLATRA
                     GLDVTQRLFEVTGARATSAQAGLDRFWRNLRTHSLHDPVDYKLLDLGEWALNGQAPTP
                     SFYS"
     CDS             112387..113646
                     /codon_start=1
                     /gene="ribA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3D4W9"
                     /locus_tag="MishRS11D_01020"
                     /product="riboflavin biosynthesis protein RibBA"
                     /protein_id="BBL73004.1"
                     /transl_table=11
                     /translation="MHYDSIETAIEAIRAGGFVVVADDAARENEGDLIIAAEKITPER
                     MAFLVRHSSGVVCVSLPEERVDALNLPPMAPRNDDPHGTAFTVSVDLNKGTSTGISAA
                     DRSATIRALADPKAGAADFARPGHVFPLKAKRHGVLERPGHTEAAGDLARLAGLSPAG
                     VLCELVNDEGGMMRGPELRDFAQRHGLPYIRIADLIAYRRRNERLVEHIAEARLPTAA
                     GVFTAHVYRSVLDGSEHLALVKGQVSGRDNVLVRVHSECLTGDVLDSLRCDCGNQLKL
                     ALQKIEQAGSGVLVYLRGHEGRGIGLGHKLRAYGLQDRGRDTVEANLDLGLPVDSRSY
                     DVGAQILTDLGITTLRLMSNNPAKFTELAGYRLKIVGRVPLEPAPNRENIVYLRTKSE
                     KMGHLLNLDALPWETHTEHQRPTAAGE"
     CDS             113680..114822
                     /codon_start=1
                     /gene="ssuD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZRE3"
                     /locus_tag="MishRS11D_01030"
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="BBL73005.1"
                     /transl_table=11
                     /translation="MNIFWFLPTNGDGRYLNTPQGARAVDFAYLRQIAQAADSLGYGG
                     VLIPTGITCEDSWVVASSLIPATERLRFLVAVRPGLTSPTVAARMASTLDRLSGGRVL
                     INVVAGGDPVELAGDGLFLGHDQRYALTHEFLTVWKALLAGETVDFQGQYIRVEGAKL
                     PFPPVQKPHPPLYIGGSSAAGHRLAAEQIDHYLSWGEPPAEVARKIEDVGIRAGLAGR
                     SVRFGLRVHIIVRDTTEQAWAAARALIRHVDDEAIATARRAYERSDSEGQRRMTKLHG
                     GSRDQLEVAPNLWAGVGLVRGGAGTALVGDPETVAARLKEYADLGIETFVLSGYPHLE
                     EAYRVAESLFPLLPVTPPAPQAQAEPVFHLSPVGDTGKVQLRARTG"
     CDS             115014..116192
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003115339.1"
                     /locus_tag="MishRS11D_01040"
                     /product="transcriptional regulator"
                     /protein_id="BBL73006.1"
                     /transl_table=11
                     /translation="MHLLAFPNPSELSLSVRASALVFEDPKSRELLARIELVGPSELN
                     ALIIGETGTGKELVARHIHQLSPRKQGPFLAVNCAALSENLIESELFGHEKGAFTGAV
                     STKQGWFEAAAGGTLFLDEIGDLPQPMQVKLLRVLQEREVVRVGSHKPIPIDVRLVAA
                     TNVKLEEAVLAGRFREDLYYRLNVAALHLPPLRQRPGDILPLAHHFLRFYGHRLGCPE
                     TALSPAAEQAILGHGWPGNIRELENALHHALLVARDRTIVPGDLNLSPMRVRALPQEE
                     REPGFEDLERLLEALCAQGEPDLYGRVEKILFAAAYRQCQRNQLATARLLGISRHVAR
                     AKLIQHGLLSLAGGLGGRVEKPEPLAAPSGLFPAHRPLAATAPPDRPVADAAADWWGF
                     "
     CDS             116471..117718
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531687.1"
                     /locus_tag="MishRS11D_01050"
                     /product="integrase"
                     /protein_id="BBL73007.1"
                     /transl_table=11
                     /translation="MGRLSRDARLETRDARARLKIQHEPYWRQITPGLFLGYRKGSRG
                     GVWMVRKTEDGQKIKRTLGAADDHQDANDVDVLNYKQAHRKAIEFAESKIEVRRQDRY
                     TIAQAMVDYMAWLSVHGKSAAQTRPTVDAHILPAFGDMNLCDLSTEKLILWQKQLVEQ
                     PIRRRGKLLPVDPDDAEALRKRKASANRIMTVLKAALNHAWKNGKVESKDAWERVKPF
                     RAVDIPKQRYLSELECSRLLNACGPDFRELVRGALLTGCRYGELTRLRVEDFVVDAGA
                     VLVREAKSGKSRHVPLTDEGRTCFARWAAGKLRGEFIFTRADGGPWGKDHQARRMAEA
                     CANAKIEPAVSFHDLRNTYGSLLAMRGVPLQVIAAALGHADTRMTERHYAHLRDSYVA
                     QTIRANLPSFGADLENVVPFATA"
     CDS             118213..119235
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01060"
                     /product="hypothetical protein"
                     /protein_id="BBL73008.1"
                     /transl_table=11
                     /translation="MAIPTPTPDVRMSATGFFCGGGSRAHNSMSIAYRLEEFRNFIAS
                     RYGLALIGQLQPDGYFHGLKTDLDRHGGRPFRYSVHLDPPQNVFYTDLKRNFSGVWFP
                     EGGAALSLAEREHLRREAEARRLRRDAEIRAVHLKAAIKARALWRSAVPALPHHPYLI
                     RKHIDAHGVRFLPVWQRRIEREPGRFEWIRVERVLLVPMRNQHGQLWSVQAIFPEHCP
                     ELGRDKDFLPGSRKKGLFHWLGPRTATICLVEGFGTGCSVFEATGYRTVVCFDAGNLP
                     VVAEIVRGILPETRIVVCADHDQAGLEKGREAAERVDGFLAVPPTVGADFNDWAVSLK
                     EVGHGR"
     CDS             119225..121150
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01070"
                     /product="hypothetical protein"
                     /protein_id="BBL73009.1"
                     /transl_table=11
                     /translation="MADEKDNQGTIKLVIDNASKPTKRVKKTADTQPSKATSESRARY
                     LVHEGRICKLDGDLRKPLCNFQARIVEEVLHDDGETAETLFSIEGQLWNGRNLPRIEV
                     SASSFAGLGWVTARWGAGAIVHAGSAVKDQLREALQELSADIKQRTVYTHTGWRLLDG
                     GWRYLHGAGAIGADGNREGVEVFPGQGHMRLYRLPPPPEGVDLAPAVRASLGLLDLAP
                     NRPDLGAYLLGATYRAPTAEAAPIDHGGWLFGTTGNFKSEAAALSLAHFGEFDGRHLT
                     ANFTDSEGNIEYKSYSAKDALFLVDDFKPIGGANEVNKLHAKADRIFRGVGNQAGRGT
                     LTANRKERAAYYARGMVLATGEDLPRGQSLRARLTITELAKGDIDRERLSQLQRAARG
                     GLFRQAMAAYLRWLAPQMQELKVRLPELIRHFRDQAISTGFASAHARTASDYASLKLG
                     LSLFIEFATESGVLASAEASDFEARAEGALRDLMARQGDNQAEENEVRRFFTLLRSAL
                     SAGRCHVSDRHHQGPPEVQPHAWGWRAVPAGPLEGTTKETKPQGSCIGWTDGKTLWLD
                     GDAAFAIAQVYAREQGGLFEIGKITLWKRVHEAKLLMACTHEKGRFRKLTVKRRIAGV
                     QTPVYELAATVFESMEE"
     CDS             121857..123305
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01080"
                     /product="hypothetical protein"
                     /protein_id="BBL73010.1"
                     /transl_table=11
                     /translation="MTKKTNSNPPIPAEPVADSIRSLHHRAKRKNIPAAGLEAHGRIQ
                     EVPKIRHEYNPHLPPVLRSAKEPNAADKLPELLQTARQRPLIEEEARLLAEALRRHEP
                     WLEWSGKREKPWFEVEPVALHMHERVSTQAILRVLAREDVQRDLFADPQQSYSEAVQF
                     YRHEIDWANRMILGDSLQVMASLARREDLAGKVQMIYFDPPYGIKFSSNFQPQLGQRD
                     VKDREQDLTREPEMVRAYRDTWTLGIHSYLAYLRDRLAMAKELLTDSGSIFVQIGEEN
                     LHRARCLLDEVFGLGNFISQITVKKTTGSTADFIPSSCDYLLWYGKNKEQTKFIPLFQ
                     EKKPGDEGATGYSKVELPNGERRSIQDEELEDPSLFPKGAEIFAGDNITSQSMGREKG
                     EGAASWFTVRVDGFDFTPGPKARWKTNEEGMSRLLIAERLIGGDRTTLSYKRKLSDFP
                     VTPLAGIWSDTVGQNQLGGEKISPFKVTTSSS"
     CDS             complement(123289..124617)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01090"
                     /product="hypothetical protein"
                     /protein_id="BBL73011.1"
                     /transl_table=11
                     /translation="MLELFRQKMPLSCLLHGLLERCFAAERLDRIFLENAKEQYTREI
                     LFSTVCDLMLSVVLKVHPSINAAYQKHPEPLGVTVSALYEKLKGVELSVSQALLRDTS
                     EDLSDILDALGFTPEPWLPGYPVRLLDGNCLAASEKRLAVHREVGGAALPGKSLVVFD
                     PERRLMRDVFPCEDGHAQERRLLDAVAGIPKAGELWIADRNFCTVGFLDRLQGRNAHA
                     LMRLHLNLPLTEETLFSQAGEQGGGRLLEKRVGVAGRPYRLVRVELEQPTRDGDAFVD
                     ILTDLPADIPAATVADLYRRRWTLETAFQHVEKHFKSEIETLAYPKAALFGFALALVA
                     YNLFSVMISALDCAHGKPVSKDISGYYLSHEIAATFLALIQLSGVGDWLFVSEQTPAE
                     FAAWLRETARNIPLRTLTKHPRGPKKPIDKPPYDPKQPHVSTYQLLRKKK"
     CDS             124641..126437
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01100"
                     /product="hypothetical protein"
                     /protein_id="BBL73012.1"
                     /transl_table=11
                     /translation="MLSADNTIGYFSLKGLGEKIYIVQTALKIVERCLLMTTDPGDLV
                     LDPTCGSGTTAYVAEHGGRRWITIDTSRVALALAKQRLLTARFPYFKLRPLTPDDLAR
                     NPKGTWLKHDGDEARTFHCKTVPHITLKSIARNASLDPIFAKHEPLLADQLAALNSAL
                     AAWGNATMRGKLVAKLEAKVRDEGIKKITDADLRRWLLPGTLPTEITFKKAAKLRDRI
                     PPENRWRDWEVPFDTDPDWPDALAQALTDYRAAWRAKMDEVNACIAANAEMEELVDKP
                     DEQKGVVRVSGPFTMEGVIALEDGPDSPIAGAPETLDTFDAADPDGTGDGAAVVNAEA
                     HLDKVRRLLAASGVDFPGNKNMRFTRLDAITDASLIHAEGEWTSDEGERRVAVSIGPE
                     VGNLTAFQVEDTIRASNRRGYDEVVFAAFGFDAAAQAVIEEASHPTLRLHMALIRPDV
                     AMGELLKTQPGNQIFTVFSAPRVKGPTPRKDGEYVVEVEGMDVYDPVSNQLYPTDKDR
                     IAAWFLDSDYDGRTFCVCQAFFPDKGKWAKLAKALGEKGVIEEEKFAALSGLVSLPFA
                     RPAEHRPGRVWRVAVKVIDPRGNEGLRVVEIR"
     CDS             127559..128584
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01110"
                     /product="hypothetical protein"
                     /protein_id="BBL73013.1"
                     /transl_table=11
                     /translation="MNLAKADFTGANLSGASFANADLRNAKLTRAVLLGADLSRTKLT
                     GAYIGHWNIDKHTCFEGIECEYVYLDEIGENRQPESGEFRPGEFEKLYQEIAHTVDII
                     IEGPAQMDALLCSLAEIRTRFGKDAAQIQKVERKGDALKVSVEVPPEQEELLRKEIRR
                     EYETQLLEQQHKYALLQKDLERAQSERDLVREGKDEIKALIGTFVPLLKRPNETIINI
                     KATAVNNRSSTISGSNITNSSINQGGDHVEQHNETHAGLPATEISSLLEQLRGLIGQS
                     DALPEAMKANALQQVETLRQAAAKPPAEAKTAAIAPLEALKMVGTLAGGIGSLMGAVA
                     KLFGLEN"
     CDS             128589..128927
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01120"
                     /product="hypothetical protein"
                     /protein_id="BBL73014.1"
                     /transl_table=11
                     /translation="MPRAKPTPEEIGTYQPVPFDPATELAKDLEDPAFREAYAALEEE
                     YAALDVMLNARKAAGLTQEDIARRMGTTKSAVSRLEASFGNDRHSPSLATLRKYAKAC
                     GKRLEIRLVE"
     CDS             128933..132013
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036267.1"
                     /locus_tag="MishRS11D_01130"
                     /product="restriction endonuclease"
                     /protein_id="BBL73015.1"
                     /transl_table=11
                     /translation="MTDPAHPIQPVENPILCSPYTEPDQHWRYDPLTGQPFKEPLRRP
                     ASYWYKSERTGTAQGTLFAQEESDDLPLVNVLRDDVRRWRKSGWVNASRTTKQLLRHW
                     WREDRTRRLFFCQLEAVETIIYLREILALDRKPGFNPNLTLDEYRALTAGRNPRPDEW
                     RAKVAQHPKLADFPNEPAAQPIPRYAAKMATGSGKTVVMAMLIAWAFCNRGTQSGDPR
                     FPRRALIVCPNLTIKERLAVLRPGDLANYYDRFDLVPTPLRPELAKGKVRVTNWHDFL
                     PKAEVQKVGGVPITQLGPETPAAFAQDRLQDLWDDEPLLVLNDEGHHAYRPAPVPPDA
                     ELSAQEKADREAATVWVAGLDKINAACGIAFCVDLSATPFYIHGSGYPEGSPFPWIVS
                     DFSLVDAIESGITKIPRLPTQDNTGRPDPKYFKLWQTITDGLKRGEKLSGGKPKPDVV
                     YRKAEDALLTLAGEWKQRFEQLNASTPGQDRAPPVMIVVCDNTDIAEHFHRMISGEET
                     VVLDESDHEADDDEAPKRKKKPKPQKRYNPGLQGFSELWNQPGAEVTLRIDSDLLAQA
                     ESEDPKATRKEAAEELRKIVSSVGRPGEPGERIRCVVSVNMLSEGWDANNVTHILGLR
                     AFGSQLLCEQVVGRGLRRMDYTPDPNTGLLTEEYVDVFGVPFSLIPFKGRKPKNGPPP
                     EDRPKHEVKALPERKHLEIRFPVVEGYVVDLKHHRVRCDLSQVERTRLDPSSTPTAAF
                     VRPQVGYKIGHPSAYGGFGFEQVDRQAYYQSTHPQTIAFEIAREIVRALTETSHPGRE
                     TPQRQGRSVLFPQVVRIVQNYIDARVDLNGCHPCEIGLQNYAQRIVGLLVAAIEPDEG
                     HGETPLLPRLNRYQPIGSTSRVHFKTVKPIQATTHSHLNYVACDTDTWEQAAMFRLEQ
                     LAQEGLVLAYARNDHLEFNIPYEFFGLPRVYEPDYLVLLVNGITLSLEVKGQPHPETD
                     AKHQAARRWTAAVNHWGELGRWEFLVCWEPQQLGEQIARLIGGGGNLNFRGVVP"
     CDS             complement(132087..133943)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01140"
                     /product="hypothetical protein"
                     /protein_id="BBL73016.1"
                     /transl_table=11
                     /translation="MRSAEDLLQELTLLDESHRIEAKRGSQVDRSIMETVCALSNEPG
                     MGGGYLLLGVVRDPYDLFSNAYAVEGITEPDKIQSDLVTQCANNFNRPVRPRVAVQEL
                     NGKAIVVVYVPEAAATDKPIYLKNLGLPRGAYRRVGSTDQEGTDDDLIALYSGHQVDT
                     YDAALIPDTDLSDIDPTALNDYRQQRRAINPDAEELAWTDEDLLRALGCAKRDNGELK
                     PTVAGILLFGTTMALRRCFPLMRIDYIRVPGKRWVENPDHRFDTQEIRTPLFTAIRRA
                     TNTVRDELLQSFSLPEGALAREDEPTLPLRVVREAVVNAVMHRSYRIQGAIQIIRYAN
                     RLEIRNPGHSLKAEEQLGEPGSETRNPKIAAVLHEVNIAETKGSGIRAMCELMLAQGL
                     LPPTFESSRRPDQFVATFLFHHFLGTDDLAWLRQLTGEFLSDEEARALVFVREAGAID
                     NAAYRAINRTDTLNASSHLRRLRDLGLLDMKGSGSRSYYVPGSKFGPLLQEPEPPTNS
                     HQPPPDSHQLPENSHQLPENSHQLLSAIPESIRHRLPPPGSKPRRPVLRELIVELCRW
                     RALSAEEIAAILGGREQKPLVRDYLTPMVEEGVLSYRIPEMPNHPGQRYIVP"
     tRNA            complement(134151..134226)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="MishRS11D_t00020"
                     /product="tRNA-Glu"
     CDS             complement(134279..135295)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705074.1"
                     /locus_tag="MishRS11D_01150"
                     /product="isocitrate dehydrogenase"
                     /protein_id="BBL73017.1"
                     /transl_table=11
                     /translation="MHSITLIPGDGIGPSIVDAAVKVIEATGVQIAWDRQLAGMAAVE
                     KHANPLPDATLESIRNNRLCFKGPLTTPVGGGYRSVNVTLRQAFNLYANVRPVISFEG
                     TDTMYDNVNLVTIRENTEGLYAGIEHFIKVDEEKIAAESIAVITKVGSERIIRYAFDY
                     ARKAQRKKVTLVHKANILKCTSGLFLEIGREIAKEYPDIEFDDKIVDATCMHMVMKPQ
                     SFDVIVTTNLFGDILSDLAAGLIGGLGLTAGANIGTDAALFEAVHGSAPDIADKGIAN
                     PTAMILAGAMMMEHIGELAAARKIEQAVREVIRAGKYVTPDLNPESTCGTAQMAEAIC
                     AKIG"
     CDS             135516..135851
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WCR2"
                     /locus_tag="MishRS11D_01160"
                     /product="glutaredoxin"
                     /protein_id="BBL73018.1"
                     /transl_table=11
                     /translation="MDINDRIKAQLAENPVILYMKGTPSFPQCGFSGRAVQILEQCGT
                     DYAFVNIFEDPEIREGLKAYSNWPTFPQLYIKGELIGGSDIMLDMFQKGELQQHLAAA
                     GTASPEASS"
     CDS             complement(135843..136376)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01170"
                     /product="hypothetical protein"
                     /protein_id="BBL73019.1"
                     /transl_table=11
                     /translation="MDGQGRLHLAETHASHVKPFPGAKLEPSALSFNKIDPFHPFRFA
                     LDEKEALDKLFHPIRAAVKRNACTRAILVGHNPAFDLGFLNAAVERAGIKRNPFHPFS
                     TFDTATLSGLVYGQTVLAKAAQAAGLEWDGEQAHSAIYDAEQTARLFCGIVNRWADLV
                     EAEGRLHGPGSEPEPSA"
     CDS             136260..136511
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01180"
                     /product="hypothetical protein"
                     /protein_id="BBL73020.1"
                     /transl_table=11
                     /translation="MEGIDLVEAQRRGFQLRAWERLDMAGMGLRKMQAALAVHLHDNR
                     RDFQDGVFGGIETGSLDIDDYRQEAAETAGENGMRWIVH"
     CDS             136662..137504
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01190"
                     /note="frameshifted, insertion at around 137495, deletion
                     at around 137568"
                     /product="hypothetical protein"
                     /protein_id="BBL73021.1"
                     /transl_table=11
                     /translation="MKISRHPSRARRSLGFALAASLAGCASTGTSPQSDPRDPWEGWN
                     REVQSFNDKLDDYMMKPVARGYQYITPSIVDQGVTNFFSNVDDVAVIGNDLLQFKLLQ
                     TGQDVGRLVVNTTLGLGGFVDVAKHLSMPKHNEDLDQTLGAWGIPSGPYLVLPFIGPS
                     TPRGVVGVAGDTMSNPINWINPVGIPWGSGVLKTTDMRADLLSATKIMDEASVDRYEF
                     MRNAYFQQRKYLIYDGNPPMDEDLEKEMDLELEGLDSGGSTPPPSVAAPMPTEQQPAE
                     TAGK"
     CDS             complement(137534..138694)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004082008.1"
                     /locus_tag="MishRS11D_01200"
                     /product="nucleotide pyrophosphatase"
                     /protein_id="BBL73022.1"
                     /transl_table=11
                     /translation="MVLPDYAGGSIVNLMASLIQGLGGAGTGYVPLSILGPQEVADYR
                     QVVLLVVDGLGCDFLARRARRNRLGGLVRGTLTSVFPSTTAAAITTFLTGVAPQQHGL
                     TGWHMYFRELGAVIAVLPGTPRYGGVALSQAGVDANKLFDHLPVFDRVPVPGYVAAPR
                     RIIHSDFNLAHRGKADLRPYDGQEDFFLTLAHTLRKAPDRKFVYAYWPELDRISHEAG
                     TLSAEADWHFAGFEEGFLRFLDYIKGTGTLVLVTADHGFIDVPEDRRVRLDDHPALAA
                     CLALPLCGEQRVAYCYVKPERCGDFEGYVRTELGHCADLLPSAELIGRGYFGLGTPHP
                     ALRDRIGDYTLVMKEDYVIKDWLPGEHRHEHIGMHGGVSAAEMRVPLIVAAA"
     CDS             complement(138778..139704)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003971490.1"
                     /locus_tag="MishRS11D_01210"
                     /product="oxidoreductase"
                     /protein_id="BBL73023.1"
                     /transl_table=11
                     /translation="MIRHFKKFTVYRFWHSEGKAMYREINGTGWRIPPIGLGAMPLSI
                     QGRPDPGQAFEVIRTFLDAGGGLIDTANVYCLDDADIGHNERLIAQALDYFGRRGLAL
                     VATKGGLRRPQGDWVVDGDPAFLRRSCEQSLQALGVERIALYQLHAVDTRLGLLPSLE
                     ALVRLKEEGKIEHIGLSNVDRALLEQALAHTPIASVQNRCNPFEQHDFASGLVDFCRE
                     RQIAYLPHSPVGGHRGHQRLGQNALFGQLAGKYGASPYQIALAWFLAKGEHILPIPGA
                     SRPASIADSLRAPSLRLDAADVSAIDRLREAA"
     CDS             139909..140484
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011084272.1"
                     /locus_tag="MishRS11D_01220"
                     /product="phosphohydrolase"
                     /protein_id="BBL73024.1"
                     /transl_table=11
                     /translation="MDPHPPAESPLPTSAADLLRVALFAAERHKNQRRKDAEASPYIN
                     HPLTVANILANEGGVGDAVVLFAALLHDTIEDTATTWEELEAEFGREVTSVVLEVSDD
                     TSLPAAERKRLQVQHAPKASERAKLVKIADKIANLRDLSHRPPAGWRLSRKQDYFDWA
                     KAVVDGLRGINPALEAAFDAEYAKRPRDRDA"
     CDS             complement(140554..140889)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01230"
                     /product="hypothetical protein"
                     /protein_id="BBL73025.1"
                     /transl_table=11
                     /translation="MVSAITLNPANPKANQAFTASVTVTNQGTAAGDAGYLDAWANRP
                     KAQACGAEGDAWAGIGSLAAGASKTVKLSLIAGTAGAKTFRAFANSWCETGEANETNN
                     QTTQTYTVQ"
     CDS             140842..141300
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01240"
                     /product="hypothetical protein"
                     /protein_id="BBL73026.1"
                     /transl_table=11
                     /translation="MIGLGIGRVERDGADHEIGQVAVDAIGQGALVVGLVDFGGGAQA
                     VGEGAEGERARLGGLESTEGQGFAGTRSQGADGGGLVGGRAANLGFGLVGPGQQGATV
                     GGGVALVLDRDRGGVGGVEEGRSGVEGDGGDGEVGAVGINDIGSVEFGGG"
     CDS             complement(141297..142379)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01250"
                     /product="hypothetical protein"
                     /protein_id="BBL73027.1"
                     /transl_table=11
                     /translation="MRRDKVGLRCAVWLFAAWAVVFLGAARAAGWSWTGAMPKARYFH
                     TDTLLSNGKVLVAGGYDIGGSLTSAALYDPSTGTWATTGFMSDARVYHTATLLSNGKV
                     LVVGGSNNGAKIFLNNATLYDPTTGTWSITGSMPDARVGHTATLLPNGKVLVVGGFNY
                     LVTLTSAVLYDPSTGTWTATNPMPDPREGHTATLLPNGKVLVAGGFNGTADISKAALY
                     DPSTGTWATTGSMPGARDTHTATLLSNGEVLIVGGQHYSNNTFQSLSLPQRCTIRLLE
                     PGLPPNPYPIRELAIQPPCYPAAKSWSQGALTVRPIFLKRRCTIRLLEPGLPPLRLSR
                     HFVVIPPRCSLTAKFSQQAGTMLEAL"
     CDS             142759..143097
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015703181.1"
                     /locus_tag="MishRS11D_01260"
                     /product="toxin RelE"
                     /protein_id="BBL73028.1"
                     /transl_table=11
                     /translation="MVIIEYPGFTKTIGELMDDEDYRALQNALVENPERGDLIPGTGG
                     LRKIRWSLAGRGKQGGARIIYYWWTRTSRLYLLLAYPKNVQDNLTPTQAKRLAEAIHR
                     ELDDGRKTIR"
     CDS             143075..143374
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002670672.1"
                     /locus_tag="MishRS11D_01270"
                     /product="transcriptional regulator"
                     /protein_id="BBL73029.1"
                     /transl_table=11
                     /translation="MDEKLFDELLAGIQWMGAHHRGETQTGQVFEYPEPDVGAIRAAT
                     RLSLPEFAYLIGVTPRTLRNWERKCVCPTGPARALLKIVSANPQAAVAALRSSCR"
     CDS             complement(143532..144719)
                     /codon_start=1
                     /gene="metK_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8DK88"
                     /locus_tag="MishRS11D_01280"
                     /product="S-adenosylmethionine synthase"
                     /protein_id="BBL73030.1"
                     /transl_table=11
                     /translation="MRKSFLFTSESVAEGHPDRVCDTIADAIVDRFLQQDPYSHVVTE
                     CALSKGLVFVAARFASKATVDIPELARQVVGEVGYRKEGFNASECTVVTSLTAQPLEQ
                     RYAWDERQLSDKELDRIEVRNQTTQFGFACNQTPEFMPLPIAMANRLARQLRTARESK
                     AIPYLSPDCTTQVGVEFVEGVPQRIHSITLIVGQQGKVQVEPANLRNDLLKHVVGPVF
                     AGIAVKPDEATDVFVNPRGGFAKSGPVAHSGMTGRKTASDTYGGYARHAGSALSGKDP
                     CRMDRVGAYAARYAAKNVVAAGLAEECEVQLSYTIGQARPVSIEVRTFGTGTVAEDLI
                     ESRLAECIDFRLGAIIRDFDLRHLPSKHKGGFYARLPVNGHFGASFTELPWEKLDKAQ
                     QLR"
     CDS             complement(144741..147911)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_041272458.1"
                     /locus_tag="MishRS11D_01290"
                     /product="calcium-transporting P-type ATPase, PMR1-type"
                     /protein_id="BBL73031.1"
                     /transl_table=11
                     /translation="MNDSLNPSRVPAQAATPVDAVLVTLVHYGAHGRMRVKVKGLYRS
                     EAMRHALEGLVATHAIFVSIQANPVTGSAVVHFQPGLALAGLVEELEACVRAHWRGGA
                     VRPAAERVAPAEPVASAQRPATGQRPGFGLRLPRWRRGPARPSQTQRPVDLATVEAPP
                     RQTWHAAEGDIVLDALETHREGLPEAHALVRLDRYGPNVLGEQKPRSAWSMISGQLLN
                     PPVALLGLSAAVSVATGGVADALVILGVVLINAAIGYSTESAAEKIIGSLGTMTPTHA
                     KVVRAGQRREIVVENVVPGDILVLEPGTYIPADARLLSSNRLTVDESALTGESLPVGK
                     HHGLVVAEDTPLADRKNMVHRGTVVTGGSGLAVAVSTGRHTEIGVIQSLVGEVKTPDT
                     PLQRQLDRMGTQLAVLSGAICAGMFGMGLARGFGFLQMLKSSISLAVAAVPEGLPAVA
                     TTTLALGIRQMREKKVLVRQLPAVEGLGSIQTLCLDKTGTLTENRMRAVGVELFEHSV
                     TFGTDGFLANDEPIAPLERSDLKLLLDMVTLCSEVKFIDRGDSVGLEGSPTESALIEI
                     ALAAGADVKAIREAHPLVKTLHRAEDRPYMVTVHTGTNTGAEHLIAVKGSPADVLELC
                     THRCLPDGSQVELDDEQRSTILHCNERLAGEALRVLGVAYGHSADTSTAAVTQNLVWL
                     GLGSMEDTIRPGMAELMAQFHSAGIDTVMITGDQSTTAFSVGKRLGLSGDKPLEIVDS
                     ASLEKLEPELLSGIVNDTTVFARVSPAHKLRIVQSLQKAGRVVAMTGDGINDGPALKA
                     ADVGVALGERGTEVARSVADVVLEDDNLHTMITAVEQGRTIYANIRKSLRFLLSSNLG
                     EIEMMLIGTAIGAGEVLNPIQLLWINLVTDILPGLALALEPPEQDVLKQPPRDPAEPI
                     IRKDDALRLVRESLALTGGAMSVYAYSLLRYGGLTANAGTNAFMTVTLAQLLHAISCR
                     SEKTGVFHPGERPKNRYLTYAVGGSILLQIAAAYIPPLRALLRLAPIGPVDWLAIGAG
                     ATLPFVVNEGIKRLQHPPEPASDFGK"
     CDS             complement(148002..149297)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010920470.1"
                     /locus_tag="MishRS11D_01300"
                     /product="guanine deaminase"
                     /protein_id="BBL73032.1"
                     /transl_table=11
                     /translation="MNATTLHTGTLAHLRGDPFAQPDALEIIPDGALAVDAQGHIAAY
                     GPRPELLARFPEARRIDHGPDWLIPGLVDGHIHFPQFYATAAPGGQLLDWLERSVFPA
                     EAAFQDVDFATATAGRFVAKLLAAGTTTALVFGSQYYPANAALFAAAKRSGLRLIAGM
                     TLMDRNGPPVLLQTLDQAVDGMAKLMALCEGEPRLHYAITPRWPMACTETLLGICGEL
                     LRDQPTAYLQAHINENHGEIAAVASGFPDSRDYLDVYDRYGLVGPRTVLAHSLHSSAR
                     ELDRMAGAGCAVCHCPTSNLYLGSGLFPLLRHVERGIPVIMGTDIGAGTEFSLWRELA
                     ETYKVQQLQGLGLDAARLLYLGTLGGAKALWLDHATGNFAPGKDADFFALAVGDDAYL
                     AARLARCDSWEQRLFCLLHLAGPAQVRATYVQGRIVTVF"
     CDS             complement(149421..152720)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01310"
                     /product="hypothetical protein"
                     /protein_id="BBL73033.1"
                     /transl_table=11
                     /translation="MNGVLPLDHGGPTDRPFEPFAPEAIEQSVPTRFATIARRYADRP
                     ALLDRQRRFSYGEVWESVGRLALRLAGAGLVPGAPVGILLGHDALFPIAMLGVLRAGC
                     GYVPLDAGFPAERNRLILAQAGIAALVTDQAHWAQAAGLLAPELPLLVMDDAGVAAPD
                     CALPEATPDSLAYILYTSGTTAAPKGVFQNHRNLLHDVMQYTNAVHLGADDRLTQCYS
                     PSVNGAIRDIYGALLNGASLHILPPGEGVDLAGFVRKRRITIYHSVPVVFRHLVRDLD
                     PGQGFDEVRIVYIAGDRLDGGDVAAFKRHFPLGGWLYTGIGATEAATLYRHRFIGHAT
                     PIEPERVPVGHAIPDREMLLLGPEGDPVATGEIGEIHVESRHIALGYWNAPALTAERF
                     VPHPRDPGVRRYRTGDLGRLRPDGLLEFLGRADHQLKIQGHRVEPAAIEAILKTHPGV
                     AEVAVLGRPTPGSGEPRLVGYWTAATAPDAGPDAATLKAFLRERLPPYMVPVRLARIE
                     ALPLLPNFKIDRAALAQLDPPAPPETVLPTTPLGWSLKRLWENLLGLDAIGMDDDFFE
                     LGGNSLLAFTLVTRITQALGRELPLVALFEHPTLARLARHLEQSAPRVAGGLEPLRAE
                     GRLPPLFFAYGVLGQSLYARPLLPYLDTDRPVYGFKARGFGDGLVPDETLEAMAAYCL
                     GQIRGLQPTGPYHLAGYSFGGRLAFEIARQLRLQGQDVAFLGIIDANAPPPLPGPPPV
                     HGQNDSTGRNRVAARNRAASQRYPAHSYPGTAVLFLSHDWPEERYVLPDAGWAGLVQG
                     GVRYHVLACAHLDLVREPWAAQLGGLLDRCLREGADGGETWAGGDPRWPELWREAAEL
                     RRRGDIAGEIAAYRRVLALGQAPSAWVYRDLYLALRAVGDPGADRFDNEAPIHLAQHA
                     PALYLLGKTAMQEGDLVLAGRCLEQAIALDPDQPLVRGQLVRLRLRQGRAAEADEHLN
                     GLAGFTLGRSTQLHRWIARLLLDCGHLEGAERHFRHLAGLEPQNPRPQAVLGWTLIRR
                     GCWIEAEECYGRAIALDANFPEAHNGLGHALRPQGRIDEAIAAVRRAVELAPGQSQFQ
                     THLEVLLRQRG"
     CDS             complement(152717..153715)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01320"
                     /product="hypothetical protein"
                     /protein_id="BBL73034.1"
                     /transl_table=11
                     /translation="MATLAGDALPVTPVSLWLHHPGLDQDGETLGRASVEFQRAFDLD
                     FSKITPASTYQVRDYGLTDTWDGDHFGRRTVVGRVVAQADDLWALPDLNPQAGFVGGL
                     LRAAVVTRRSLPRAIPVLMTVFNPVFQLGLLAGAELFAALLRDFPAQVRAGLGQITAN
                     TLRLIAALVDTGIDGIYFATQHAQPTGLSLADYREYALPGDRACLAAAAALPCNVLHV
                     HGAAVYTDLLGDWAGLPVAILHYDTQADNPPPAFLTRCWPGGISTGLSHTHAVFAESA
                     ARVAAATGRLLAECRGPRFVLGAGCALPLVAGTAQIAAIVDAARSPSPAVWRATTP"
     CDS             153747..154061
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01330"
                     /product="hypothetical protein"
                     /protein_id="BBL73035.1"
                     /transl_table=11
                     /translation="MELERGQAHIKYGKGMPVAIRPLRPFVRRQADIGPPWVFKIAPA
                     IDPARARQSHRKQRDPQADQGAWINPPRKQPTNGAYSPKNPGNSRTESTTTSGRTAEA
                     RT"
     CDS             complement(153983..154786)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000971814.1"
                     /locus_tag="MishRS11D_01340"
                     /product="haloacid dehalogenase"
                     /protein_id="BBL73036.1"
                     /transl_table=11
                     /translation="MDPISSAAPRLVAPKGLLIDLDGVLYVGQNPIEGAAESLARLRA
                     GGLALRFATNTSTLSLASLHRKLLGLGLDIDAGEIISAPQAARLYLESLGRPRCALLL
                     AGDVKSDFAAVEEVDIESADYLVLGDIGPAWDHGLLNRLFNRLMLGAKLVAIHRNRFW
                     QTEAGLCMDIGGLVAALEYCTGHRALVMGKPAADFFRVALREMGLAADEVAMVGDDID
                     VDVGGGQAAGLAGILVRTGKYREAYVRASAVRPDVVVDSVRELPGFLGL"
     CDS             complement(154817..155701)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010943212.1"
                     /locus_tag="MishRS11D_01350"
                     /product="HD family phosphohydrolase"
                     /protein_id="BBL73037.1"
                     /transl_table=11
                     /translation="MSSQPRTAMSALTLANEIKTLFSLPEAVFKLGQLLNSPYVTNGE
                     IGEVIISDPALTARVLQLANSGLMDSPAKIETVSGAIALIGREALRNLLVATTVTNRF
                     QGIPPELIDMERFWLNSVACGVIARSLAFRCRVFDSEPLFVAGLLHKVGRLAFYSGRA
                     DLYRQVLAQHDSSEEGLNQAEFSVFGFTHAELGAELLRLWGLPERLQAAVAFYLAPNM
                     APCYRKSAALIHVASALASNIEPSVSPDEAIYGDSVCFEKGAWNLLGLPLHVIPPILD
                     EAWIQAFEIFEILRPNPV"
     CDS             complement(155946..156854)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036906.1"
                     /locus_tag="MishRS11D_01360"
                     /product="transcriptional regulator"
                     /protein_id="BBL73038.1"
                     /transl_table=11
                     /translation="MTKLSLDALEVLEAIDRRGSFAQAAEELFRVPSALTYTVRKLEE
                     DLGVEVFDRRGHRAKLTAAGRELLEQGRPLLVAAAALEARVKRVAQGWEPELRIAHDD
                     ILPTEGLFPFVERFYRLGSGTRLRIATEVLGGGWDALLSDRADLVVGTPCEGPAGGGY
                     AVKTLGSHEFVFAVAPHHPLAAAPEPLASCAIQAHRAVAVADSSRNLPPRSTGLLSGQ
                     DILTVPTLRAKLLAQELGLGVGYLPLGLAADALAAGRLLAKAVAAPKPAGPFCMAWKA
                     GPRGRALAWWVEALSAAEAGAWWQPG"
     CDS             157021..158091
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388234.1"
                     /locus_tag="MishRS11D_01370"
                     /product="alkene reductase"
                     /protein_id="BBL73039.1"
                     /transl_table=11
                     /translation="MSLSSNPLFDSLALGSTVLRNRIVMAPMTRSRADDAGVPGALAP
                     LYYGQRASAGLIITEGTFPSPMGKGYVRTPGIHSEAQVEAWHRVTDTVHAAGGTIFMQ
                     IMHAGRISDPSFLPDGATPVAPSAVRPEGQSYTDAGMQPHVTPRALDLAEIPGLIEEY
                     QSATRNALRAGFDGVELHAASGYLPEQFLSSKTNRRDDAYGGDIGRRARFVLELLEAM
                     AGVAGAGRVGIKLSPEMNFNDIADDTPRETYTHLVEQLAGLGLAYLHVALFGTPVDYH
                     GLLRPLFPGPYLVGGGLTQATATALLNEGKADAAVFGSLFIANPDLPERFRSGAALAE
                     PDRSTFYTPGGQGYTDYPTLAA"
     CDS             158125..159012
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005770654.1"
                     /locus_tag="MishRS11D_01380"
                     /product="quercetin 2,3-dioxygenase"
                     /protein_id="BBL73040.1"
                     /transl_table=11
                     /translation="MATTHHPITADTVQRSRQIEQRIAGQATSDGAGVKLVRVVDRAL
                     HRRLDPFLMLDAFGTDRPEDYIAGFPDHPHRGFETITYMIAGRMRHRDSAGHEGLLEN
                     GGVQWMTAGRGVIHSEMPEQEQGAMEGFQLWLNLPARDKLAEPWYRDFPNAAIPQFTT
                     ADGVTVRVIAGESQGVAGAVRREVTEPLILDLHLPAGSRHAQSLPAAANAFLYTYRGE
                     VAVGGGAVPAGQLAIFANSATADGVVIEAARDSRVLLVAGQPLGEPIVQYGPFVMNTQ
                     AEIEQALRDFRSGRLGTAA"
     CDS             complement(159040..159945)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011390380.1"
                     /locus_tag="MishRS11D_01390"
                     /product="N-acetylglucosamine kinase"
                     /protein_id="BBL73041.1"
                     /transl_table=11
                     /translation="MSKHSLRFGIDLGGTKIELIALAPDGAELWRRRKPTPQGDYQGT
                     LRAIADLVAEAERALSAEGTVGIGTPGALSRASGRLKNSNSACLNGQPIVEDLERLLG
                     KPVRIANDADCFALSEATDGAAAGAEVVFGVILGTGVGGGIVVRGRPLNGPNAIAGEW
                     GHNPLPWPTAEELPGPACYCGRRGCIETFLSGPGLARDYERHAGAALAGPEIVARAAA
                     GDVACEAALLRYEERLARALAHVINLLDPDAVVLGGGLSNCARLYANVPKLWGRHVFS
                     DRVDTRLVAPRHGDSSGVRGAAWLW"
     CDS             160150..161337
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01400"
                     /product="hypothetical protein"
                     /protein_id="BBL73042.1"
                     /transl_table=11
                     /translation="MPSRSHRRVRTAHPPGTTGLIWILGFFLVLTAIVVATVLLNSGQ
                     EEATPVASILNQADALWRPEQAPKAVALLKAARATHPGTEAEIDSRLGMIYQKAGLTA
                     EALPYLDRSVRLGADMGVKANALRRLIRAQLGVDNYDAAQKLVKTLPPDDPEVERWRL
                     IMRTAQQDDPAQALAVFRELAAATPSERESQRRLGRAELDQQRWAEAAQTLALALERF
                     PDDMEFLGLAGDAAYRDRDYGRSKAWFERLVDLERQWSGGKAAHTVELARAQIALDQR
                     APANALLDAFLAQQPDHAEALFYRALSAFRDGDYQTAYDHISLVAPAHPSWTDCNLLA
                     GAAALALDRVESARTHLALFANPAGPETGKHLLRIAQAGPEERAGTLASGELKHLFDN
                     LLR"
     CDS             161571..162524
                     /codon_start=1
                     /gene="chrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004552495.1"
                     /locus_tag="MishRS11D_01410"
                     /product="chromate resistance exported protein"
                     /protein_id="BBL73043.1"
                     /transl_table=11
                     /translation="MNPSWLLLITSLPTQHAAGRMRVWRALKALGCGILRDGVYLLPN
                     RPGFRDLLAAQAEEVKAGGGNAYLLALDPADGAGQDGFEALFDRTEDYAQLSGAIHHA
                     MPVAEPGDLAGLRRQVQRLRKEFEALAAVDFFPGPARDQAAIRLEALELALDRRLHPD
                     EPRGLPGQIQTLRREDYQGRTWATRRRPWIDRLASAWLIRRHIDPAARFLWLAEPGDC
                     PADALGFDFDGAAFTHVGAKVSFEVLLASFGLDPDPALRHLAGLVHYLDVGGIPVPEA
                     AGLSLLIRGLGRRWAGDDDALLAAAETLFDALYQAYSGTDP"
     CDS             162521..163879
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013096587.1"
                     /locus_tag="MishRS11D_01420"
                     /product="chromate transporter"
                     /protein_id="BBL73044.1"
                     /transl_table=11
                     /translation="MTDPHPARTRPAPVGFGQALRYWLKLGFISFGGPAGQIAIMHQD
                     LVERRRWISERRYLHALNYCMLLPGPEAQQLATYIGWLMHGTWGGIAAGGLFVLPATL
                     ILMVLGWIYLEFGQVPAVAGALYGIKPAVTAIVLCAAYRIGTRALKNAALWAIAALAF
                     LAIFALDAPFPLIVAAAALAGAVGGKLAPGRFALGGGHGAAKQGYGPALIDDDMPPPE
                     HARFSWRRLAWTVGAALLLWTGGIGLLCGQFGWQGTPTQLGWFFTKAALLTFGGAYAV
                     LPYVFQGAVEHYHWLTPAQMIDGLALGETTPGPLIMVVTFVGFVAGWGQAWLGPEHPG
                     LAGVMAALVVTYFTFLPSFLFILAGGPLVESTHGNLKYTAPLTAITASVVGVILNLAL
                     FFAYHVFWPQGFGGDFDAMSAAIGGGALLALLRFKVAVIPVILACGGAGLLFTFAQTW
                     LA"
     CDS             163991..164968
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005768670.1"
                     /locus_tag="MishRS11D_01430"
                     /product="membrane protein"
                     /protein_id="BBL73045.1"
                     /transl_table=11
                     /translation="MKECQFIADRRADWETWDRWLEARRGGVQAQAALPVAALPRKFR
                     ALCQDLSLARDRRYSEPLLDELQSRVLAAHQRIYGAHRPQERHATRFVLRELPRLVRR
                     EARLAALSALLFFLPLFAALIALQTYPDGVYFLLSPETVGRIEEMYSPTTLVPGRPRD
                     ATDDVMMLGHYLANNVQIDIQCFAAGIVFGLGSVFFLVYNGLVIGAVAGHLTQLGFIP
                     TFWGFVAGHSAPELTGVVLSGMAGLKLGAALIAPGRWSRTEALKQAARPAVHLLYGAA
                     GLTFGAAFIEAFWSPLPTVPVVVKYGVGVGFWLVLLAYFVLLGRERHGA"
     CDS             164958..166478
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112782.1"
                     /locus_tag="MishRS11D_01440"
                     /product="hypothetical protein"
                     /protein_id="BBL73046.1"
                     /transl_table=11
                     /translation="MELERLELELRHRTPWEAADLGLPWLRRWRGPVYRAWFATFIPF
                     NLLLFLALWRWPLVAAMVAWWCKPLFDRVLLKVYAEAAFGQPPGLGAVWRSLPDLCRR
                     TGLVGALTWGRGDMARSFHLPVHQLERQRGKAAKSRRKVLGYKARGCAFWLTFLCSNF
                     SACLQISIILLLELLWPSEAPAVFDWQALFHGDSGLWESLLSHLAWVFGESLVEPFYV
                     AAGFALYLNRRNDLEGWDIELGFRQLARRVAAERRGQGLGRAAGLASLGLAGLLLAQY
                     PLDGHAAEPTAASGPEVPPSPAKQAIQAVLADPVFGHKVEDWEWHRRDEDDGASSRRD
                     APDLAWLHQIVEWIAEGIRLSGYVAAAVLAGGFGVLLYRYRGMWPGRAPNTRRVPSTL
                     FGLDVRPESLPEDIALAAGRLLDAGSVLPALSLLYRGALVALIHGHGVDFLPGDTEDD
                     CRTRVRGRIDPGAEAYFAGLLAAWSLAAYAHATPPPAQLQALCADWPRHFAGRGAV"
     CDS             166475..167671
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01450"
                     /product="hypothetical protein"
                     /protein_id="BBL73047.1"
                     /transl_table=11
                     /translation="MSRAWLWAVFGLSALAILGTVWVVEHYERVPTTRWEGPGKAALR
                     DPYLALERYLERMGRPLQRVGNALSLDALPPGGALLLDRARRIHLNPRRADQVLDWVA
                     RGGYLIVAAEAPSVDDPILKRLGVVWRRPPEPDEPAAEGEAGQCPAPPAPEASTPDTL
                     VVRWPGSERPLALDIGDWAGEPGLWPGESAPLWTAEPVPGKSGAVLLHYAHGQGQITV
                     LSDLSFFNNWRIGDYDHAELLWTLLRQYAPAGPVRLAARLKVPTLWEWLADSAWMALV
                     SGGLWITAWLWAIVPRFGGVVPAAEPERRGLGGHLAAVGRAVWREGGWGHWVEVLRQE
                     VKELTLRRHPHLAALPEAGRIEALARIGGVPPERVAEFLNPTAAEAPEDYTRLTQTAQ
                     RLIQRL"
     CDS             complement(167710..167844)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01460"
                     /product="hypothetical protein"
                     /protein_id="BBL73048.1"
                     /transl_table=11
                     /translation="MGDLRILLRRMSQRQTLPQAGDLESAATTTLALMVGLVVLASVL
                     "
     CDS             complement(167933..168487)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01470"
                     /product="hypothetical protein"
                     /protein_id="BBL73049.1"
                     /transl_table=11
                     /translation="MANFIEAYRAGLNIVERTKNNKREIDGVFEELNSQLFRVSDGKI
                     QISIKPLHETISFKELENYSALYLSNASNALGINDKLAGWRLRAVKGYVAICAKNQKT
                     PGSDTELAEWKQSRAGYPCEIILGSQTYVCEDKEALENALAEMLRDPIVGEKLFKLAN
                     LPVLETDPTLESGIVASQDTQPPA"
     CDS             complement(168489..169052)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01480"
                     /product="hypothetical protein"
                     /protein_id="BBL73050.1"
                     /transl_table=11
                     /translation="MAQRADFLAPNGGGLLRLFISHWPSRLWCHENSVDRHLLGMRLR
                     DQIDGLNPAKDGAVILLGDYNDEPFDDSLAGQLMATRDRAFVVKKPHLLYNPFWRHLV
                     RAEPYPSKAEDETGGGTYFHANGETTRWRTFDQIIFSSVFLGRGRWHLNEALTGILRI
                     PEHGAKMVDHQSIFDHFPVIGVIEKVD"
     CDS             169524..170522
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002678884.1"
                     /locus_tag="MishRS11D_01490"
                     /product="HflK protein"
                     /protein_id="BBL73051.1"
                     /transl_table=11
                     /translation="MSTPNPWGQSPPPPSSFPQLPTLPLGPILAALAILTGLWSAYYT
                     VPAESEGVLLRFGKYIDKVPPGLHFKLPFGIDEVYKVPTQRQLKMEFGFVSLGRTNPD
                     QAGQSPEQEKSMVTGDLNSALVEWVVQYRITEPETYLFEVREPGQTLRDLSESVMREI
                     IGDRTVDEIITIGRQEIEETALLRMSELAKRYHLGLSVNQVQLKNVDPPKPVQPSFNE
                     VNRAQQDRENAINLANGDYNKAVPRARGEADQKIRAAEGYRFKRINEAEGDAAAFGAV
                     LEQYVKAPEVTRARIYLETLGEVLPRAHQQIIVDDSVREILPLLPANSSIVPEPRP"
     CDS             170519..171496
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q73N23"
                     /locus_tag="MishRS11D_01500"
                     /product="protein HflC"
                     /protein_id="BBL73052.1"
                     /transl_table=11
                     /translation="MTPLKQVLVYAAVALVLLLGYLSVFTVEQTEQAILTQFGRPVRD
                     PITEPGLHFKLPLVQQVTRIDKRYLAWDGPMVEMSTKDKTYVQVGTFARWRITDPMRY
                     FLRLRDERSAQSRLEDILGSETRTAIAKHELIEVVRIDKDRQPRQDESVAAALAEIGG
                     IGALRPIHVGRLQIEKGIFDAAAPKLAEFGIELLDIRLKRINYNPQVLERIYQRMISE
                     RLQIAQRFRSEGEGEAARISGRKERDINEIESTAYKRVQEIRGEADGKATEIYARAYT
                     QRPEAAEFYQFLKSMETYRKVIGGGSTLVLSTDSELFGWLKRGVVKGKP"
     CDS             171556..171897
                     /codon_start=1
                     /gene="hypA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2RV76"
                     /locus_tag="MishRS11D_01510"
                     /product="putative hydrogenase nickel incorporation
                     protein HypA"
                     /protein_id="BBL73053.1"
                     /transl_table=11
                     /translation="MHELSLAQSLIELMEDEARRGGFSRVRKAWLEIGALAGVEETAL
                     RFGFEAAALATCAEGAELEILTPPGEAWCFDCGRGVVLQALPDGCPHCAGHRLQVTGG
                     TQFKLKELEVI"
     CDS             171901..172812
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388924.1"
                     /locus_tag="MishRS11D_01520"
                     /product="hydrogenase accessory protein HypB"
                     /protein_id="BBL73054.1"
                     /transl_table=11
                     /translation="MCTVCGCGEPDQPAHDPSHPHEHGHAHDHGHSHSHDHAHPHDHH
                     HAGAGHHHYGQGPAGVTLAGFSQDRIVRIERDVLGKNDGYARKNRAWFEQHGILALNL
                     VSGPGSGKTTLLERTLTDLRGDLALAVIEGDQQTTNDAERIRATGVKALQINTGKGCH
                     LDAHQVGHALDELAPADHSLLFIENVGNLVCPALFDLGEAGKVVMLSVTEGEDKPIKY
                     PDMFHRAALIVLNKIDLLPYVKFDVERCLDYVRQVNREAPILRVSATTGEGMEHWYGW
                     IKEQRRALLETRAAQLESALSALRAQL"
     CDS             complement(172853..173590)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036548.1"
                     /locus_tag="MishRS11D_01530"
                     /product="hypothetical protein"
                     /protein_id="BBL73055.1"
                     /transl_table=11
                     /translation="MEITGILMLAIQIGFAVHAMKRGYPLFWVFLIVFVPLIGCLLYI
                     VMVLIPEASQSRAAQQGGKVLRKALDPGKELRQLQEALERSDTVGNRVALAQEYLKRG
                     QFDAAVPLYEAALTGLYRDDPELLLGLGRALCGAGRFGRAREILEQLREANPGYDNAE
                     ARLLYARVLEEVGATEPALEEYAALLAKAPSAEIKCRYGKLLKQTGRADEARALFEEV
                     VKDAKGGSQHSYRLNREWVELARRELG"
     CDS             173869..175050
                     /codon_start=1
                     /gene="metK_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62EZ1"
                     /locus_tag="MishRS11D_01540"
                     /product="S-adenosylmethionine synthase"
                     /protein_id="BBL73056.1"
                     /transl_table=11
                     /translation="MSNNYFFTSESVSEGHPDKVSDQISDAILDAILDQDKHSRVAAE
                     TLCNTGLVVLAGEITTGANVDYIKVARDVLKDIGYDNTDYGIDYKGCAVLVAYDKQSP
                     DIAQGVNKAYDDDLGQGAGDQGLMFGYACDETPTLMPLPIYLAHRLVERQAYLRHSGV
                     LPWLRPDAKSQVTVRYVDGKPDTIDTIVLSTQHAPEMSDGDRMKKEAIEAVIEDIIKP
                     VLPEDMLKGNINYLVNPTGRFVVGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDP
                     SKVDRSAAYAGRYVAKNIVAAGLASRCQIQVSYAIGVAKPTSVMVETYGTGKISDERI
                     TELVLEHFDLRPKGIVNMLDLLRPIYRKTASYGHFGREEPEFTWERTDKAALLREAAG
                     L"
     CDS             175106..175579
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01550"
                     /product="hypothetical protein"
                     /protein_id="BBL73057.1"
                     /transl_table=11
                     /translation="MNWAEVLADKSLQDLPYKIELDRYGNIVMSPASNRHGRLQAWVG
                     SFLERYLGGEFMVECSVDTPEGVKVADVAWCSPEFLARHGYPTPYPEAPEICVEVRSP
                     SNAWEEMRVKIALYLGQGAREVWIVFETGEVRFFGPEGERERSEYPVDPRPELKH"
     CDS             175756..177180
                     /codon_start=1
                     /gene="ahcY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P61617"
                     /locus_tag="MishRS11D_01560"
                     /product="adenosylhomocysteinase"
                     /protein_id="BBL73058.1"
                     /transl_table=11
                     /translation="MNAAVQSETFTDYVVADLALADWGRKEIKIAETEMPGLMAIRDE
                     FAAAQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAAQG
                     IPVFAVKGESLEDYWDYTHRIFEWADGGYSNMILDDGGDATLLLHLGAKAEADASVLA
                     NPGSEEERVLFAAIKAKLATDPTWYSVRLAAVKGVTEETTTGVHRLYQMHAKGDLKFP
                     GINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMVAGKVALVCGYGDVGKGSAQALRA
                     LSAQVWVTEIDPICALQAAMEGYRVVTMDYAADKADIFVTCTGNYHVITHDHMVKMKD
                     QAIVCNIGHFDNEIEVAAIEKYQWEEIKPQVDHVIFPDGKRIILLAKGRLVNLGCATG
                     HPSYVMSSSFANQTIAQIELWTERDSGKYPIGVYTLPKHLDEKVARLQLKKLNAQLTE
                     LTPEQAAYIGVPVEGPYKAEHYRY"
     CDS             177266..178309
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01570"
                     /product="hypothetical protein"
                     /protein_id="BBL73059.1"
                     /transl_table=11
                     /translation="MEYCQFKDIIVQPFSRLLGGKPTPFKGGPVFPEDALAYVRHYRN
                     KKIMDEVDTLIDAPDSLPAIPGSYVYAGPLIRHFGHFMAECCHRLWAFHRFRPEVDGI
                     VYGVKPGQSDQLRDYPGFVGEALARFGIAPEQVKLVNQPTRFQNLIVPQQAAALWRSP
                     AKEYLDFLARLDPQALVADDIPEKICVGRAHLIKKGCICGEDYLEQLLGEEGYFILRP
                     ENYPLARQWQYYANAKQIIFTEGSAIHGLELLPRLQAGVFVINRRPKSILAERVLGPR
                     CDKLQVFDGISVIGIVQDTRQEPANALSRVDHIEGLLDALRDHGFAGLSGFDPEEFSA
                     RESLYLNQVATRL"
     CDS             178354..179211
                     /codon_start=1
                     /gene="metF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WGJ7"
                     /locus_tag="MishRS11D_01580"
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="BBL73060.1"
                     /transl_table=11
                     /translation="MRSQQHYPQAYSLEFFPPKTPEAETSLNNALAKLAPLRPKFCSV
                     TFGAAGSTREKTFETVVGLQTTYGLEAAPHISCVASTRDNMREVLNAYQNQGIRHIVA
                     LRGDMPSGMMSAGEFRYANELVAFIRQETGDHFHIEVAAYPEMHPQAQGIEADLKNFK
                     RKVEAGADSAITQYFFNPEAYFRFIDDCEKLGLDLPITPGIMPITNYTQIARFSEMCG
                     ADIPRWVRKRLEALGDDRAAIRAFGLEVVSDLCRRLLEQGAPGLHFYTLNQAEAVLGI
                     WKNLGLESA"
     CDS             179299..179772
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004406991.1"
                     /locus_tag="MishRS11D_01590"
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="BBL73061.1"
                     /transl_table=11
                     /translation="MSLFDFVRDIGNALFHSDEEAAGKIKAYIEADNPGIDNLEVLYQ
                     KGFVTLRGTSHSWDAVEKAILMAGNVKGVGKAISEIQVVDAPTPPPAELQSAGGGAAT
                     PVDYYVIQQGDTLSALARRFYGDGSQYMKLFDANREVIKDPDRIFVGQKIRIPQP"
     CDS             179838..180389
                     /codon_start=1
                     /gene="hemG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070443.1"
                     /locus_tag="MishRS11D_01600"
                     /product="protoporphyrinogen oxidase"
                     /protein_id="BBL73062.1"
                     /transl_table=11
                     /translation="MRILIVYFTREGQTGRIAERIAARLAGAGHRVDCRAGAAAIDPA
                     AYEAVIVGASIHYGHHSLAAHLWGFRHRKALAGRPAAFFSVSLTGGGPGARPLVARKY
                     LDAYLSRTRWRPPLTAIFGGALPYSRYTPFTRGLVRLFVRMAGGDTDASRDYDYTDWK
                     AVDGFAEDFLARAVAPESGATAL"
     CDS             complement(180564..180959)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01610"
                     /product="hypothetical protein"
                     /protein_id="BBL73063.1"
                     /transl_table=11
                     /translation="MESQAVKAGLAFAVLMIVGFILVGTTRETPQEKMQGAFLQTSNM
                     LATLALKKCGEAVKAETGSEPYTPSQTDGDHMSHVTLIWENIGSAKRAECRYVMDQGI
                     SLLQIDDRKVIENTAATGTAAPAQKSAHH"
     CDS             181104..181397
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01620"
                     /product="hypothetical protein"
                     /protein_id="BBL73064.1"
                     /transl_table=11
                     /translation="MSYPSDLSDEEWSLIEHHFRPKDRRGNASKHPRKRVVDAILYVV
                     EGGIKWRMLPKDFPPWQTVYDHFSRWNKAGVWEAALDEINARHRKKTRAANPA"
     CDS             complement(181581..182672)
                     /codon_start=1
                     /gene="thrC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F0KK49"
                     /locus_tag="MishRS11D_01630"
                     /product="threonine synthase"
                     /protein_id="BBL73065.1"
                     /transl_table=11
                     /translation="MTTSKRYTGLIEHYRDRLPLGPETRPVSLCEGNTPLIQLANLPR
                     LIGKEVEMYVKFEGLNPTGSFKDRGMTMAVTQAVAGGSRAIICASTGNTSAAAAAYAA
                     RAGIACFVLIPDGKIALGKLAQAMIHGAKVLQIQGNFDDGMRLVKEIADHAPVTIVNS
                     INPFRIEGQKTAAFEIVDALGRAPDYHCLPVGNAGNITAYWKGYTEYALGTATHAPVT
                     DRRPVMCGYQAAGAAPFVAGAFVEHPETVATAIRIGIPQSWDGAWNAQKESGGWFAPF
                     TDAEILATQKLLSEKEGIFCEPASATSVAGALHDIRSGRIPEGSVVVCTLTGAGLKDP
                     DTAIGQCDVQPTKIQATLDAVKGAILETL"
     CDS             complement(182777..183592)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01640"
                     /product="hypothetical protein"
                     /protein_id="BBL73066.1"
                     /transl_table=11
                     /translation="MKTQLFRAAALIAQVFAASLAQADASAPAHVQKAALYVGQVAPN
                     NNVYGSPAQLAYDNANVLHATTRCGSFTALLFKNTYAAVTDAALIALTGSNSPYADEW
                     YNAIKNQVSDPASGLALVKRATVGDLQAGDILSSIYTTNGDTGHAMTVAEVVKWQENI
                     APPHPIPGVAAVNKYRVKVYDSTKSVHGGYANNPYPDSRYQTQTTNSGAVVNDDGIGY
                     GSIVIYEDVADGRAVAWAWNVSPTTDSFYYAVEKPEGSTYDYRPIQMGVMTGL"
     CDS             complement(183731..184525)
                     /codon_start=1
                     /gene="thyA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3FR98"
                     /locus_tag="MishRS11D_01650"
                     /product="thymidylate synthase"
                     /protein_id="BBL73067.1"
                     /transl_table=11
                     /translation="MRQYLDLLRRILDQGVPQADRTGVGTLAVFGHQMRFDLAEGFPL
                     LTTKKLHLRSIIHELLWMLRGDTNVRALQEHGVTIWDEWAGPDGDLGPVYGKQWRDWV
                     AADGRHIDQIAALVEEIKRHPASRRQLVTAWNPGDLPAMALAPCHCLFQTQVANGRLH
                     LQLYQRSCDAFLGLPFNIASYALLLTILAQQTGLEPGEFIWTGGDTHLYSNHLEQARL
                     QLAREPYPLPKLRIQRRPGRFDGYEYGDFEVLDYTSHPHIRAEVAV"
     CDS             complement(184522..185322)
                     /codon_start=1
                     /gene="lgt_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I6F2"
                     /locus_tag="MishRS11D_01660"
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="BBL73068.1"
                     /transl_table=11
                     /translation="MLPYPQIDPVAISLGPLKIHWYGLMYVIGIGTVWYLCKRRTQQP
                     GFPWTAPQVEDLIFYAALGLVIGGRLGYILFYNFPAFLADPAMLFRVWEGGMAFHGGL
                     LGAFAGMFLFARRNGAGFFQVTDFIGPYVPIGLFAGRIGNFINGELWGAPTGLPWGMV
                     FPGAGPEPRHPSQLYEAGLEGIALFLALRWFGHMSPPTPAMSGMFLLLYGLFRFAVEF
                     VRIPDAQLGYLAFGWLTMGQILSTPMIVLGIALLVWAYRKPAREGATA"
     CDS             complement(185427..189281)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01670"
                     /product="hypothetical protein"
                     /protein_id="BBL73069.1"
                     /transl_table=11
                     /translation="MFEYRRVEAPYPGLRPFEPYEVEIFFGRENQTDRLLEILERERF
                     LAVVGPSGCGKSSLVRAGLLPSLASGVLSTGSDWRLAWLRPGAQPLLALAQALLGPHA
                     LGRELMGGAASSPQDANEVSAEAALIAAELRRGAPGWLDVLRGAAARRPVEAAPFNLL
                     VLVDQFEEVFTYAGTAGSVAGEAQTFVDLLLAARAGTEFQVFVVLTMRMDFLGECRRF
                     LELPEAINRAQYLPPRLSLGELVQAIVKPAQGFGGNVQKSLVEEIVDDFYKETDGLKE
                     ADQLPVLQHALSRLWIKAKELDPDRPIIQGTAAEIGRALDDHAERIFESFTLERQRLL
                     AERLFRAITESCGNGYVRRPQTLAEIAAWTGDTAQDFVPVIQRYAAPGVNFLHYGAAL
                     TGNSIIDLTHEALIRQWRRLENWLRDEYQRGEEYRKWSRRAKETGAWADGLSGDTGSV
                     PLQDLWKGGLKELEPAKDIWLESIEGLGPAWARRYSDCQDDNLEREFRWTGQFITQSH
                     EAAQQEFRAREFTELEEESSEQKRKIESLEAEKQKHAATIGQIAAKERSESIWRGNKK
                     LAWTVGVMASIILPVIVVVLALIAVFAWDRTQHDNFDAQTISASLLAGLREYANARGY
                     LQQSHTLDADIPVERRHARNLLAGYVEMMDWRTEQIYQFEGRTLTALAVNRDGKMLAV
                     AGKEGFLALFNTGSGTSRPLIDGQAPTGELRAIALDATGRWLYGGGGGDDDGFIIRAA
                     LYGKDKTVVWKVPGGVQSLALSPDGKRLASGGTDGKIELWSLPNGKPMGGLALERGNP
                     KINSLAFSPGGGLLAAAYGDQTARLWDLHSKQIRSILSNAHTDKVTAVAFNSDGGDLA
                     TGGSDGQVALWEVDKDGAARFVRSLHGLPGVAVTGVEFGGDGSQLVSGYEDGTLRLWD
                     VESGALRRYESRLGNNQALAIHSQDVYAVGGDTLRHWSLAPSEPPRQWLLKTRPNMDT
                     PYADNEKYDAPQPTAVAIAPGGDKLAMGSKEGSLQIYRLPDGLLLAEELRAHGESPIA
                     RLEFNAKGDRLASLSKDKAILWNIPVGGDGKLQKQKEINATAVAFSPNGRTLAKVDAV
                     GGICLLDLDTDRQRWCSQSQEAKPVSLAFTPDGKRLLSLGDGRLLLWNIADPGQSSLR
                     EIAQTQKRPTWVTINPDGRQVAVVGEDQSVELYDLDRPEQPPIRLEGHKKWVSRAIYS
                     PDGHQLATVGDDKTVRLWNLDRREPLFILRVPEAPENSGPSDFDFHCTIATGECWIAV
                     PLTSTRRVALYRLPYERMPDGG"
     CDS             complement(189274..190311)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01680"
                     /product="hypothetical protein"
                     /protein_id="BBL73070.1"
                     /transl_table=11
                     /translation="MPALTAQIFVSYAHADNQSFDAQARGWIAEFVDKLQKAIAMRPG
                     GSEVTCWMDYRLEPQRRVDATLLNHIRESRCILAFMSPRYLESEWCQKEMNAFLEWAG
                     AHANNRVFLVELLPTEQQWRQLHPRIENITEIQFWTSSLGQPDPIILGWPVPDPRGDR
                     PYWTGLNRLATIIARQIQMLPSLPPDTPAPPSTGFELPAPPAPPSGPLSIVINAEKTD
                     LELGKAAQKLLKGLNVHSTIALERRPREHFEKYRRYLATLLNNNHGVLIIYGLAPLSW
                     VHSQHLIARNLLAAQRTGTWSGLLDGPPEEKLHHGLGGPGLMELDCRQGLNVEPLKRF
                     VDALRNGGGHV"
     CDS             complement(190484..191260)
                     /codon_start=1
                     /gene="thiD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003100335.1"
                     /locus_tag="MishRS11D_01690"
                     /product="hydroxymethylpyrimidine/phosphomethylpyrimidine
                     kinase"
                     /protein_id="BBL73071.1"
                     /transl_table=11
                     /translation="MNHPPPPVVLNLSGHDPTGGAGIQADIETQCRLGCHPCTVITAL
                     TVQDTHNVLRVLPQAPEAFLEQAKLVLADLPVAAIKIGLLGSVDIAWAVAEVLELAGP
                     GIPVVLDPILAAGGGQDLAGDGLIEAVRTRLLPHCTLTTPNTPEAQRLTGLDEAGAQA
                     RALLDLGCRNVLLTGGHEDGPELVNRWYSAQGITGYRWPRLPGTYHGSGCTLAAASAA
                     GLALGLTMEAALREAQGFTWQALSRGFRPGGGQWLPWRGK"
     CDS             complement(191309..191833)
                     /codon_start=1
                     /gene="ymdB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010941194.1"
                     /locus_tag="MishRS11D_01700"
                     /product="RNase III inhibitor"
                     /protein_id="BBL73072.1"
                     /transl_table=11
                     /translation="MSQLAIIQADITQLAVDAIVNAANSSLLGGSGVDGAIHRAAGPG
                     LLEECRRLNGCPTGQAKLTGGYKLPARHVIHTVGPVWRGGQQGEPESLASCYRESMRL
                     AARHGLASVAFPAISCGAYGYPVEQAARIAISTLRQSLAEYPAIENVWLVCFGAAVLE
                     AYRAALAAAPDVAD"
     CDS             191940..192707
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01710"
                     /product="hypothetical protein"
                     /protein_id="BBL73073.1"
                     /transl_table=11
                     /translation="MLDKLRGLLESKPPAQKKLAERGSWNPNFITDPVRIASFLNDLA
                     HQRTALFLQLDDRGIESEDDQAQRMTTYLYKVGTERAALHTPDDPEDDQRLRAAGRFK
                     VITDIYNNILTFPTEIIAIQEEGGQSYYIINLPGRVYYPKNQKPRQIRIDRQRNIHAY
                     LRFFEPAKSYRALIDDLSAQGMGVLLSSEDQTLPYVRKGDKLKACSIGLGTRQYPCEA
                     RVNQVKRIGDKAIRIDCGFVSPGAEFLDAVAAILKGA"
     CDS             192883..195969
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01720"
                     /product="hypothetical protein"
                     /protein_id="BBL73074.1"
                     /transl_table=11
                     /translation="MQQKSSHNPPQEVIPPDGVALVAKTDTQGRIAYVNPAFVKISGF
                     TEAELLGLPHSVVRHPDMPGAVFADLWRDLRAGRPWTGYVKNRCKTGDFYWVEAHIAP
                     IWEGGTIAGYMGVSRKAPLAAIRDAEAAYRKLRGQAAGRFRVVHGRVVDAGWRGRGRE
                     AWGRLSVSAKLTLGCLAAMALVMALGVPILNGEVGGTLDRNGEAGLRTSVGLIRDIFE
                     LRLESMRNKATLLNHAFDALFPEGFSLGGTPDKPLLSLGKGPALNGDHAALDRFSQAT
                     GTVATLFAAKGDDFVRVATSLRREDGGRAVDTLMGKQHPAYASVSQGQAYSGRATLFG
                     KEYYTSYTPLRDGSGKVVGLSFVGIDLAAELADLKKRINAIKIGQTGYYYVLDGNPGP
                     DYGKLLVHPGKEGTNIAASKDSSGREFIREILERKQGTIRYPWMNQELGDTVPHEKVV
                     VFDSLPETQWVVAGGTFSGEFEALSTQIGHYVILGGVAMMLLLIGILYGLVRRSVIRP
                     LQAEVLPAFRALSAGKYDTRLELGGRDEIAQVLQGLETMQIQLGFEVSEAKRRADEMA
                     RVKMALDSVSTPVRIAQPDGEVVYANPALLAVLRRIEPILRTQNPGFDLERFVGGSIG
                     VLYPDPAAALARLAALRTGEEQILEIGGRTFRVVTGPVFDRDGERLGSVGEWQDITDP
                     LRAEREISAIVEHAGFGDFERRIALDGKEGFFLALAQGINRLLDSTQTTLAETSDILS
                     RIARGDLSRTIEAGYRGVFGQLSDDINTTIAQLRGVVAQIKDSAEAIDSAAKEIAAGN
                     LDLSRRTEQQAASLEQTASSMEQLSATVQQNAEHAHKASELAESSNAIARRGGELVTR
                     VVDTMDRIRDSSKQITDIIAVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEIR
                     SLAHRSASAAKEIKALIAASVEKVEEGGRWVAESGSNMDEIMAGFQQVANWVGGISTA
                     SAEQSSGIAQVAQAILHMEETTQRNAALVEEAAAASESLEEQAQGLVGAISHFKLS"
     CDS             196190..199915
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01730"
                     /product="hypothetical protein"
                     /protein_id="BBL73075.1"
                     /transl_table=11
                     /translation="MQPIRSRIAPVLWSFALLSNAVGAATPPLAVETDHREATRNFFN
                     ALFFASEDVAMGWTGGSIAGCKPGTIGADFQAASLLRINLFRALAGVPAGIVLDDAFS
                     VQAQAAALMMSAKNTLSHTPKQDDPHWPCLTDKGDAAAGKSNLSLGHAGPAAVFGQMQ
                     DQGGNNAAVGHRRWLLYPQTQKMGVGDVAGDGTSAHESANAVWVQDGHFGDPRPATRQ
                     DFVSWPPPGFLPYPLMFPRWSFSLADAKFDAAKVSVTRDGVGVPVTLEKVAEGSGENT
                     LVFKPNDPAIGDPTPAPAGDIRFDVKVEKVKLAGAELPPFTYSVTLFDPARYDTDTVL
                     PDISGPDHPVAGQAAVYDILGTVPGADGYEWLQAPPSPYATVQSAESGTDPDVETHTT
                     LGYNFVTDEFAADGSHAYVLRHFRPEAQTLTLKKLFLPGAAARLNFQSRLGRASAFEV
                     AKVQYSLDGGQAWHDLYIQAGQQDGSVPVENGFSPRSIDLDSLAGRPLRIRFRYDLAA
                     PGAGAFTTPSSGDAVGWYIDAVAFEDMEALDPVAIASAEAGPGFSFTGAAPGALVLAG
                     RGTLSGQPLEWGPVKAVRVFSSGANQTPVADAGPAQTATVNTLVTLDGSRSLDPDHSP
                     AALRYQWIQQSGPNAPLAAANTAHPSFTPAATGTYVFALKVDDTQATSAAATVAIKVI
                     PPNQAPIADAGPDQQGVVGKPVTLDGGASHDPDNGPKSLVYLWQQDAGPIAVKLDPVA
                     QPSFATQVAGSYAFHLKVNDGALDSAVDTVNVTVRESDQAPTANAGPDRSVVLGSTVT
                     LDGSQSRDPDNGPSPLSYAWEAPNGVVLGGANTAHPSFKPTQLGTYGFRLTVSDGVAA
                     YKSSDTVTITVTNAAPVANAGPDRSVLLGSTVTLDGSQSRDPDNAPNPLKYLWEAPPG
                     SNIALTGADTPHPSFKADQVGRFEFSLTVDDGNQKNFDMVKINVTNAAPVANAGPDQS
                     VPLGSTVILDGGQSRDPDNVPGPLQYQWQAPQGSGVALTGADTAHPSFTPTQPGSYEF
                     GLIVTDGNLQNLDKVIVTVTNQTPVANAGPDIGAETGATVTLDGSASADPDHAPGPLA
                     YHWLVPTGIVLNGSETAHPSFVPNEPGTYSFGLVVDDGAAQSATDAVTVTVSPPPPLR
                     LLSPQPGAGLKAKQKQAVTWQSNGIAGSIKLTLSLSKNGVKWTKLATPKNTGRYTWKV
                     AKAQAGAAVRLRLCAPAKLPLNGPHCDETDGPFTVSR"
     CDS             200042..201019
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112780.1"
                     /locus_tag="MishRS11D_01740"
                     /product="hypothetical protein"
                     /protein_id="BBL73076.1"
                     /transl_table=11
                     /translation="MNIPPSAESQAAAALLQTLRAELAQALVGQAGLIDEVLIGLVSG
                     AHVLLEGVPGLGKTLLVKALARACAGRFGRIQFTPDLMPSDVVGHTFFDMASGQFITR
                     QGPVFAHWLLADEINRAPAKTQAALLEVMQENQVTLDGAALPLPRPFMVLATQNPIEQ
                     EGTYPLPEAQLDRFLLKIRIDYPSLEDELRLTRQVTEGRTGGDLDVDAVATVLTPEQV
                     LGLQRVAARVVVDERVLAYAVAIVRATRDDPRLALGAGPRGGIALVRAGRARAVLAGR
                     GYATPDDIKAVALPALRHRVMSAPEADIEGLTADDLLRALLEYVPAPRL"
     CDS             201021..202331
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268797.1"
                     /locus_tag="MishRS11D_01750"
                     /product="membrane protein"
                     /protein_id="BBL73077.1"
                     /transl_table=11
                     /translation="MAGLLPHRPLLVALACWFGVAVLVVVRPGLLPVWGWGGAVLLGV
                     ALADAGLALRRGNPLTARREVRAVWPLGVAQTIGLRLAGGDGAGWVFDRPPVAFAAAA
                     RPVAFRVRGGEWTQVHYRLTPTERGEHRFDTVELRLLSPWRLWLTRHRTGETQTVRVY
                     PDFARIAEYSLLATDNRLSQLGVLRRRRRGEGSDFQQLREYRRDDALRSIDWKATAKH
                     RKPIVREYQDERDQRLMFLLDCGQRMRARDDALSHFDHTLNALLLLAYVALRQGDGVG
                     LATFAHAQPRFLAPRKSLDTVQHLLDATYDLQPTPRTPDYLMAAQSLAGRLERRALIV
                     LLTNLRDEDESSLVLALRLLGRRHGVLVANLRETALDAALARPIADFDAALGYAAAVD
                     YRRARRRQWAMLKAQGAQVLEVAPPGLPTALVNRYWEMKRGGLL"
     CDS             202381..203208
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01760"
                     /product="hypothetical protein"
                     /protein_id="BBL73078.1"
                     /transl_table=11
                     /translation="MSTPSTPEPIPEADETQNPYEAPQARVDDPGLEGLGELLETPRA
                     LEFTRGLGWLAGGWELFARAPATWIGIVILWMVIIGLILLGQSLVANLAVGLVNTLFT
                     GGLMYGCHALTLERDGLGVEHLFAGLFRRFLGLALIGLAGSAASAAILFGSFIAALGM
                     PTGFNILVHGEAVAMMPDPVRLLLALLMVSALMMPVMMALWFAPALAILHDVPPGRAL
                     VLSFQGCLRNLMPFLAYGLGGAILTVLAVLTLGLGWLALWPVLIASTYVAYRNIFTE"
     CDS             203212..203928
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003123273.1"
                     /locus_tag="MishRS11D_01770"
                     /product="RDD family protein"
                     /protein_id="BBL73079.1"
                     /transl_table=11
                     /translation="MDTPPPDTVRVVATPEGCELVLRLAGPAARARAFCIDAVIRFLV
                     FVAAATLLGRLGSMGMGLLLLVYFGLAWGYPVLFEVFNAGATPGKRLCGLAVLRDDAT
                     PVGWDAAFLRNALRFVDAAPVGYAVGLVAMGLNGDGKRLGDILAGTVVVYRGMKKPDP
                     GGPAPVEGVEPPPFPLGAGERRALLEYRRRAATLTPERALELAALAAPLTAGLSPEAG
                     RARLFRLADFLQGRAVQGRD"
     CDS             204198..204518
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01780"
                     /product="hypothetical protein"
                     /protein_id="BBL73080.1"
                     /transl_table=11
                     /translation="MAKLTDILKSDITKGVAIGLGVAAAGLLLTPALRPVTRGAMKGG
                     ILLFEKGREWMAEASESLEDLVAEVRAELAEQRFAEEAVVEEAGDIEDAMEVAAATAE
                     EAQG"
     CDS             complement(204651..205241)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_637786.2"
                     /locus_tag="MishRS11D_01790"
                     /product="hypothetical protein"
                     /protein_id="BBL73081.1"
                     /transl_table=11
                     /translation="MEIYHLQVLRTDASGMPLEWIGYQEAAKLYHLGQVAYSCGTHLY
                     TLHGGINAKTGRRSIIEVNSIIATYHQHGSGYGADPNYVPPLSNPALFRRDNNLCLYC
                     GQHFGQGDLSRDHITPISQGGADIWNNVVTACKRCNNHKAGRTPEQAGMQLLAIPFVP
                     THAEYIYLQGRRVLSDQMEFLKAHFPRKSPLHQRLR"
     CDS             205600..207813
                     /codon_start=1
                     /gene="priA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HUC9"
                     /locus_tag="MishRS11D_01800"
                     /product="primosomal protein N'"
                     /protein_id="BBL73082.1"
                     /transl_table=11
                     /translation="MPKVLRIAVQAPLRSLFDYLPPAGVDPAALRPGVRVQVPFGPRR
                     RIGVLLEIADASELDPARLKPVLAVLDPEPLLSADDLALLAWASRYYHYPIGEALALA
                     FAPLLREGQSAAPETVRVLCPAGPGGAGAEALVKRSPRQAELLRLLREHPAGLPPAIL
                     AGLDGGKHAATALVGKGLALWREQAAQVAAAGTGTVHSPAPPLALNPGQAAAVARVLE
                     ALGGFRAFLLDGVTGSGKTEVYLRLAGEVLARGGQVMVLVPEISLTPQLEARFRARFP
                     DPLAVYHSGLAAGERRRAWLAMQRGEAAILLGTRSAVFMPMRAPGLIVLDEEHDASFK
                     QHDGFRFSARDVAVMRAHLLKIPVVLGSATPSLESLHNVRQGRYQRLHLPERAGGAAP
                     PLFRLLDIRGQRLVEGLSSQLLSEIGQTLGRREQVLLFVNRRGFAPTLICHACGWVAQ
                     CGCCDANLVIHFGEDRLRCHHCGHEQALVRACAQCGDSELRPLGLGTERIEAALEERF
                     PEARVARIDRDSTRRKGSLHQLLDDIHAGRVDILVGTQMLAKGHHFPKVTLVGIVDVD
                     GGLHSTDYRAGERTAQLIMQVAGRAGREDRPGSVLLQTRQPGHPLLCSLIREDYAGFA
                     EVCAAERAAAGLPPFGYQALWRAESAEADRPARFLAGLAEFAGRMQAPSLQVLGPVPA
                     PLARRAGRHRAQLLLQSPRRGELHGAVEALLDAIPELLAGCRVQWSMDIDPVDVY"
     CDS             complement(207859..213267)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01810"
                     /product="hypothetical protein"
                     /protein_id="BBL73083.1"
                     /transl_table=11
                     /translation="MTPPSRTAVPGNPVPSPSYAEAARLYSAGRWTEAEAMALALLAD
                     NPEHWDARHLAALVAAQTGREAEAEAGFRAIIQAFPQFAEAQSNLAGLLVNLGRNAEA
                     EALYRRTLDLDPGHANAWINLGNLLLKTGREAEAEASFRLALERNPGLAAAHLGLGVL
                     MQHRHRLDEAETLIRRALDLQPDFPEAHHNLGRLLTELARPQEAAAAYRRVLELKPGH
                     AEAHNGLGVLMKQMGRFKEAEAEYREARRLAPHNPAVLYNLASLLSGRNDAFVETVEC
                     FDELLRIAPDHRYAQGMAAHSRAKLCDWTDHAAMMERLARGIAAGLPCATPFSLMNAL
                     DDPEAQRRCAALYAPPPFPGAERPLPRHRHPKIRLAYISPDFQNHPVAHLVVDLIESH
                     DRARFEVVGVSLGPKVQDAFRQRLERGFDVFIDGHGVSDADLTRRLRDLEIDIAVDLA
                     GHTRNARPGLFARRAAPIQVNYLGYPGTLGVDYMDYLLADAFVVPEAEESGYAERIVR
                     LPDTFQCAAYRQPAATTPTRAELGLPETGFVFCSFNNTYKIHPLQFDLWMRVLRRVEG
                     GVLWLLKPHPQVEDNLRREAQARGVAPGRLVFGGRLPPPDYLARYRRADLFLDTLPYN
                     AGTTASDALWMGLPVLTQAGRSFAARMGGSLLRAAGLPELIVHNAADYEALAVRLATE
                     PDALAALKAKLERNLRHQPLFDVPRSTRTLEAAYTAMWENWQRGAAPAHLAIELPPTS
                     DESPKPDESTMAKHKPKPTQAAQIYQEAARLYHANQLEAARTRLEQYLALRPDDPEAL
                     NFLAVLAARTQDYATAERLLLKLVAAQPTYREARRNLAVIYRDMGRIADAETAYRQLL
                     EIDPGDVGPYLSLAQLLRHRGRQPEALDLYQRALALNPTQPGQLNTIGNALSEGGRLE
                     AAEAAYRQSLALKPDNPEALNNLAVTLRKALRPDEAEALYRQALAFKPDYPEAWNNLG
                     NLLKQGGKPADAEAAYREAIRLKPDYAEAHNALGTVLRETKRRAEAEAMQRRAIALKP
                     DAATFYNELGNLLNDGNRYAEAEAAYLKALELKPDYAEVYGNLGVLYKVSVRLEESEA
                     AFRKALALRPEYPDAYSNLGNLLRYMGRQQEAEAAYRQALVLDPNRADIHDNLGSLYF
                     DNRLWNEALACFERTLALKPDYPDSAGMAVLCRDLVCDWRGQAELHQRLRRSVYAGYR
                     GSPPWTLLNVGGDPLEQRLGAEIHVRDKYPEQPAPQLPRHRHDRIRIAYISPDWRDHP
                     VAHLTADLLEGHDRTRFEITAVALGQPAADAWRTRVERAADRFIDAHGYSDPALAQWL
                     RDLEIDIAVDLAGHTRNARTGIFACRAAPIQVNYLGHPGTLGAGYIDYLLADDFVVPP
                     GDEGFYVERVARLPECFQSAARRPLDTPTPSRAELGLPEHGFVFCCFNNTYKIHPPVF
                     DIWMRLLRQVPDSVLWLYQANAEVESNLRREAGARGVDPARLVFGGRMPRPEYLARFR
                     QADLFLDTLPYNAGTTAADALWMGLPVLTLPGRAFASRMAGSLLRAAGLPELIAATPE
                     AYEALALRLATQPEALAALKAKLERHRATEPLFDLERSRLHLEAAYVRMWEIWQAGGV
                     AESFAIPPLPREVRPVRKLLYIGGDSRPGAFPAPDWDATRLDHADPAALAQVATASLD
                     AIVAPHQLQRLYPQEVPTVLGEFRRMLAAGAYVWVEVPDLGAIAHWIAGDKLEAEMPA
                     AAASPLDLIYGDRAAPHHTGFTAGTLERALRAAGFAEVAVEQAGTWGLRAIACVERPD
                     PGRLAALRSGLGMEPGGT"
     CDS             complement(213435..213875)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01820"
                     /product="hypothetical protein"
                     /protein_id="BBL73084.1"
                     /transl_table=11
                     /translation="MKPDALPLESAPSGRIPPTPAHSVNIETPGYHGSASVNPPPGWA
                     GPATWANPETTRQWVLDNVVQVMGAVLASDLRDPLALDALPDLPRAFEELEFKSALNP
                     AQPMRIVVRVQSRYQALCRGVFVAYQNTAFIAAGKLLLGQQNPQ"
     CDS             214116..219914
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205468.1"
                     /locus_tag="MishRS11D_01830"
                     /product="hypothetical protein"
                     /protein_id="BBL73085.1"
                     /transl_table=11
                     /translation="MLRAIWLWFCVVVPVWAGEADLPRVEVFSPRGTVKDVRQVAVRF
                     AEPMVALGDPRRPAPFTVDCPAPGAGRWADARNWVYDFERDLPAGVACRFTLKPGLRT
                     LAGAALAGERDFGFDTGGPAIRASLPEQGDEAIDEHQVFILGLDGEADPASLREHVRC
                     EIAGLSEQVEVDLLAGAAREAILAQRRRLGYAYYEVLWKNGAESLLRVEDKTLLEKAE
                     SQLVVLQCRRALPPEAGVKLVWGQGIRSASGVATAEDQVLAFKTRPAFSARLQCQRVN
                     AQADCLPMLPIRLSFSAQVKAEDLARTRIVDGTGKTYPPEPIDAAKTPTADEAVFKGP
                     FPEKAKLRVELPEGFQDDAGRPLENAARFPLPTATDEYPPLAKFSGDFGIIEREAGGV
                     LPVTLRNLEPTVAGRNLTVAPDGIPGQVKRFDQDDAEIARWIRRVGAAGRVRGQWLER
                     TGPDGKPIWREETGAESVFAAQDQAQAITLPKPLGGKEFEVVGIPLEKSGFYVVELAS
                     PKLGAALLGDSRPRYVATAALVSNLAVHFLWGREGSVVWVTHLDKADPVAGAEVRISD
                     YCNGQSLWQGRTGPDGIARIAAPETLGAPSDVAYCDEGWDAHPLFVSARVPGDLGFTV
                     SAWNQGIAPTDFNLPTGGYDGQALAHTVLDRALFRAGETVSMKHFLRRHTLQGFAALP
                     EAAVPTRLEIYHAGSDQKFEMPVRFDATGVAESTWAIPKDAKLGEYSLTLVAEDKRFT
                     AGMFHVEQFRLPTMKAAIQPPAAPLVNARSVPLDVFVAYLSGGGAGNTPVKLRSLVEP
                     KALRFADYPDYSFGGEAVREGLFEESDYDADEPATARKPAQTLALTLDAQGARRATLT
                     DLPVATQPQDLVAELEYQDANGELEAVTQRIPLWSAQVVVGVRTEGWASSRDQVRLRA
                     VALDLAGQPVAGQKIAVELYQRTYYSYRKRLIGGFYAYDNRSEVKRIAGGCEGRTDAQ
                     GLLLCTLAPDASGEILLQAKTQDGQGNPALAVASAWVAGEDDGWFQGGAADRMDVLPE
                     QKEYQPGTTARFQVRMPFREATALVSVEREGVAETFVTHLSGRTPVIEVPVLDHHAPN
                     VYVSVLAVRGRVGDGQSWLADMARKFHWPWPVEGGAPTALADLGKPAYRLGQAEIRVG
                     WNPYRLDVKVEPDAPVYKVRDTAKVKVKVKRADGGTPPPGTEVALAAVDEALLELKPN
                     PSWQLLEKMMDPRPIEVYTSTAQMQVVGKRHYGRKAVPHGGGGGRQAARELFDTLLLW
                     KGRLPLDGNGEAEVEIPLNDSLSSFRVVAVANAGLDRFGTGSGVLRTHQDVILHSGLP
                     PMVREGDRFSGVVTVRNASQRPIALAVEARVANAAGTALPEFPPRTLELAPGAAQELA
                     FELTVPVDAGRLLWEIAAREPSGASGDRLRVGQEVVPVHPVRVYQATLEQLDHPLTMA
                     VEKPAGAVPGRGGVRVEVQARLGDATGGVAAYMARYPYICLEQRISVAVALRDPARWH
                     TVMDALPAYLDRDGLLKYFPSDSLEGSDTLTAYVLAIAHAAGWELPEAAKERMTGALQ
                     NFVAGRVVRDSALPTADLSIRKLAAVAALARYGLARRESLDSIAIEPNLWPTSAVLDW
                     FDLLNRLETLPDRGRRKAEAEQILRSRLNFQGTTLGFSTERDDALWWLMLSGDVNAVR
                     MVLEVLDEPGWRADLPRLVRGAVGRQQKGRWNLTTANAWGVLALEKFSAAFESVPVTG
                     ETQATLAGTARGFAWNAESRRGSLNFPWPQEQAALGIRQEGTGKPWVMVQSRAALPLD
                     APLSSGFKLQRTVVPVEQRHPGVWTRGDTARVTLALEAQSDMAWVVVDDPVPAGSTVL
                     GTGLGRDSQLLTQGEKRDDGWTWPAYEERRFDGFRAYYRFVPKGQWTVEYTVRFNNPG
                     RFELPATRIEAMYAPEMFGEYPNAAAEVRPAP"
     CDS             219979..222123
                     /codon_start=1
                     /gene="pbpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002102274.1"
                     /locus_tag="MishRS11D_01840"
                     /product="penicillin-binding protein 1C"
                     /protein_id="BBL73086.1"
                     /transl_table=11
                     /translation="MNIIRKPLVFFLGSILLIAGLPVGVWLASWTIQAPGFDEVRALW
                     VPSEAYLLDRHGEVIHSLRLDPSARRLDWTPLADISPALPKAVVAAEDRRFYRHPGVD
                     VVAVAGAVADRVFHGRKRGASTLTMQVAAFLDAGLNRRDGRGIGQKLRQMALALALER
                     RWSKAQILEAYFNRVGFRGELQGIAATAQGLFGKRPSGLGEAESVLLAAFLPAPQADP
                     ARLQARARAIAQAGMFHVEHSELETLVDGLLKHKPGILPEPNLAPHLARRFLKKPGER
                     LRTTLEARWQRWVLEALRQQLAGLDGQNVRDAAAVVADNASGEILAYVGSAGGDSRSP
                     GVDGAAARRQAGSTLKPFLYGLAVAQGYLTAASVLEDSPVNLETTTGLYIPQDYDRDF
                     KGPVSVRTALASSLNVPAVRALGLVGVERFRDLLWDLGYAGLTEDGEYYGFSLALGSA
                     EVNLPEQVNAYRSLANGGLWRPLRLLPEASGPEPRRVLDAGAAFIVADILSDSAGRSL
                     TFGLDSPLSTRYWTAVKTGTSKNMRDNWCIGFSRRYTVGVWVGNFEGDPMRGVSGVTG
                     AAPAWLAIMNGLHAAEPSPPPAAPAGLAARDIRYEPAIEPPRREWFLAGTEAETLRLV
                     VAGTHAPRIESPPRGVVIALDPDIPPRHQRVWFKAKGGAAARFVLDGADLGPARSPWA
                     WSPVPGNHGLELKRGDGAVLDTVRFQVRGPRP"
     CDS             222322..223317
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01850"
                     /note="frameshifted, deletion at around 223272"
                     /product="hypothetical protein"
                     /protein_id="BBL73087.1"
                     /transl_table=11
                     /translation="MNAPSRSLPKTGFPGLVENWRSDMVSGFLVFLIALPLCLGIAMA
                     SGFPPMAGIITAVIGGVVVSRLSGSYVTINGPAAGLIVVILSAVQSLGQGDAMAGYRY
                     TLAAIVVASVFQILMGLLKAGKLNAYFPASVVHGMLAAIGIIIMAKQIHTMLGVKPEA
                     KEILETIAEVPHSFVEMNPEIACIGFTGLAILIAWSLVKNRYLKMIPAPLVVVAVGMA
                     LERYFDLDHEHVYGFLTDAQFLPHHEYTIGPKFLVTIPENVAEGFYFPDFGKIATPEF
                     WAAVLSICLVGSLESLLSATAVDKLDPYKRYSNLNRDLTAAAWVICWRAPSGVCR"
     CDS             223314..223994
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01860"
                     /note="frameshifted, deletion at around 223272"
                     /product="hypothetical protein"
                     /protein_id="BBL73088.1"
                     /transl_table=11
                     /translation="MIAEIVRSSANVNNGAKTGWANFFHGLFLASFVVFFPRLIHEIP
                     LASLASLLVYTGFRLASPKEFAKTLDLGKEQLAIFCATILGVLATDLLVGVFIGIFAK
                     LLIHILRGVDIRQLLKISYAVEQTHPGIYHVRVEGSAIFSNFIGLKSEVAELPEGRTV
                     VFDLSEAYLVDHTVMEFIDHYRHDYIGRGGRCEIHGLENHEPYSDHPLAARKRKTDDR
                     EGELSTPR"
     CDS             224213..225655
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01870"
                     /product="hypothetical protein"
                     /protein_id="BBL73089.1"
                     /transl_table=11
                     /translation="MRSFSYKYAQWRGWAVLLLVLLVFALLGGMIWRNLERFETMRAY
                     VSYAHRIQQVTSDLQAALTDYFIHHTKRLDAAQLSRLSAEIGDLAREDYHVAPATPTQ
                     LAELSAMVSDLANEGATTEQQEARLLQALNITGAMMDAETLERERLLEDIGKETRTEV
                     ELAFAVVAALLLFVGLFISHRILAPLHDLKELLLRLAREDFTPIGTQAIDPLLLPVFQ
                     SYNEMVRHLAELEEAKRHYAESLEAEVRSATRALLEQQASLARTERLAAVGELAAGIA
                     HELRNPLAGIQMSIANLRNELADPEQTERASLVMEELKRMGRLLNELLDQSKHTPAPV
                     CEFNLSTMVGELVSLVRYQVPPGVRLDFEGPERLICRLPECRLRQSLLNLVLNSAEVL
                     RNGEGRILIEVQAEEERVVLSVTDDGPGFGREMLESGIRPFATGRPGGTGLGLAMVQR
                     FARDLGGQLSLANIRPHGARVKLLLPYRCG"
     CDS             complement(225624..226877)
                     /codon_start=1
                     /gene="cca"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0E0XTY6"
                     /locus_tag="MishRS11D_01880"
                     /product="multifunctional CCA protein"
                     /protein_id="BBL73090.1"
                     /transl_table=11
                     /translation="MRTYLVGGAVRDILLGLEVKERDWVVVGETPDSLVAQGFRPVGK
                     DFPVFLHPETREEYALARTERKTAPGYHGFAVHAAPGVTLEQDLLRRDLTINAIAMDT
                     EGRVIDPYGGTRDLEARLLRHVSPAFGEDPVRILRAARFAARFAPLGFRVADETLDLM
                     RRMVEAGEVDALVPERVWAEWLKALNEPRPGGFFEVLRACGALARLFPEIDRLFGVPQ
                     PPQHHPEIDTGIHTLLVLAAAAELSPDPVVRFAALTHDLGKGLTPPEHWPRHRGHEQA
                     GLPALDGLCHRLKVPNAFRKLAEKTMRYHGHCHRALELRPGTVVDLLQRLEAFHRGDA
                     LEAFLLACEADAKGRTGFEQRPYPQAAWLRAARNAAAAVPVAPLLDKGYQGVALGEQL
                     RRERIRAVAQARREAFNHSDTAAAT"
     CDS             226945..227223
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012710062.1"
                     /locus_tag="MishRS11D_01890"
                     /product="hypothetical protein"
                     /protein_id="BBL73091.1"
                     /transl_table=11
                     /translation="MSGKPRVEIEYCTQCRWLLRAAWLAQELLTTFEEELGGVALIPG
                     TGGVFEVRCGERTLWSRKQEGRFPEAKELKQRVRDEIAPDRSLGHSDR"
     CDS             complement(227220..227660)
                     /codon_start=1
                     /gene="pilE3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010946364.1"
                     /locus_tag="MishRS11D_01900"
                     /product="type IV pilin"
                     /protein_id="BBL73092.1"
                     /transl_table=11
                     /translation="MNQPPHPSGFTLVEAIVVLAIVGILAAIAYPSYTEQVRSGRRAD
                     AEGALYGLQQALERLFTTHSSYATAALGLAPGSIFSDQVPADGPPNYQLQIADLTATG
                     YTLKAVPVGVQAHDRCGTLTLSSANVRGIANALPGLAVADCWRN"
     CDS             complement(227683..231783)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01910"
                     /product="hypothetical protein"
                     /protein_id="BBL73093.1"
                     /transl_table=11
                     /translation="MHSGFDGPPIPFRRGALGAAVLALSCGMPTARGEGSIADVPLFL
                     GNAEMPNVIMGVDDSSSMTAEVVMPYGVNDSYYFATNTYVQASLFPDAYNNPFGLATQ
                     GGGSNLYTTGVVPPLPEYADARSPAFNSQYFDPGTDYQPWADYDLVFNPSDPAAARWD
                     PVKSNRPTENIVPNYNNNAACPPPTPDFPNTFPLDSPIKCAGWGYTFYAGTGSTPFRG
                     KGYYLVNGAKTWDAPTLPADTPYFKWSTPNGSVNSGTWVTNPDSLRNPFKLNDPSNSL
                     PPLNKLGVQYYPATFYLPDTLDIRAAYPKYFSSYVHDLEHDAIVKGLDSASPPALQAL
                     YWDLDNGGGIDYLDKDTWNLGGQSRTRLKRYEIRCDSAHFSDLNQCASALRNFANWFT
                     YYRSRQLATRGAIGFALEHIKGMNLGIFRINAVIEAPPGVSNIKTPLPSLALKNLSNV
                     GDRNALLTNNDNGVYYYNFTGATPNRQAVKYMGMQFEQADTIQYSCQKNSGILFTDGA
                     YDYKANVTIGVGNVDNSLFKSGDGKNIFSGIDPYKDGASDTLADIAMKYYVGLDSATP
                     GLSPGQVPIPSACAKPGHDPGLDCNNNPHMNFYGVSLGVPGKLFKPDNPKLDPYALTA
                     ADWPSTTSAFTIADKEDDFWHATLNGRGRLFSAKNPVDLRDKLGEIINTIAQNSGSAS
                     SVATTSVYLSADTLVFMAGFDSGDWSGEVYAFKFADGRLSDPPVWQASAKLTSASYPY
                     RQQHIFSYNPQGTACGGGAVGKAIPFDWEFLNCDQQAQLDSGYDPDQTLPPDKLGPAR
                     VEYLKGDTSKEMRHGGPFRDRTDAKGSTERLLGDFVNSNPAFAGGQDFGYDLLPGTEG
                     TAYADYLANDKASRPPMLYIGGNDGMLHAFNATGGAAGGEEVFGYVPSTAYANLNRLS
                     SPAYIQDSSHHKFFVDGSPWVGDAYLGGRWKTLLLGTTGAGGRGVFALDIGHPGGFGT
                     ADVLWEFATTDNTRLPDLGYSLPQAVLLRTNDEEHPWVALVANGYYSQNGHAVLFVLD
                     LASGSLLKRFDTLAGGNAWIDKNGLSSPIAIDMNQDRKADYVYAGDLTGNLWKLDFTD
                     PKLENWDFAHHAGGRPAPLFVACVNNGTPCADADRQPITGKPQVGLAQGQLPGFMVYF
                     GTGRYFLQGDNDPTAPIGQQPQTLYGVWDGNSSTGTVPPVAKAKLARQTILGEARLGL
                     YKARFTSSNPVDYATQQGWYLDLIGPGGEVRGERSVSDPVLHDGKITYTTLAPTQQHC
                     AAGGSGWIMELDAFTGGAPAVDAPLFDVNKDGHIDGKDIGNGGAPTGLAFDALPSSTR
                     IVRDGGHIHRITNTSAGVDDEGRASAEVQKGNSADNPGRQSWRQIR"
     CDS             complement(231794..232354)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01920"
                     /product="hypothetical protein"
                     /protein_id="BBL73094.1"
                     /transl_table=11
                     /translation="MRRIASQAGGALIVGLVTLLVMTVIGAAAVQTTALEEKMAGNAR
                     SRDLAFQAAESALRQGERWLRNQALAYPGGEVPCTGTPADGLDGSGCYASDIQAIPVW
                     KLIDNADAWNDPARTTPYMGSLAQIAQPPSYIVEKLQFVDDPGNAGLTAGSPPVQNHY
                     YRITAHGGGGTPDAVAIVQSTYKTSH"
     CDS             complement(232374..233495)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037627.1"
                     /locus_tag="MishRS11D_01930"
                     /product="pilus assembly protein PilW"
                     /protein_id="BBL73095.1"
                     /transl_table=11
                     /translation="MSDPPRPGAGFSLVEIMVALATGLLLMAGIGQVYLATKQTYTVQ
                     EQLSRLQENARYALDRMGRDIRMAGSLGCTSQSPATVTNTLNANGNPFYDFGTRLAGY
                     EAKGSFPGERLAIPGNPQTSGATAQWNPRLPAALPTSMVLGNDILLVRGRADSGVPDA
                     LQSATPDTVTVAPSGDPGQPGLQPDDFVMVADCSSAYVFQNTGAGNLLGHAAGGNPGN
                     ATTTWSAIKTANLASLQNPHGSLPAEVYRVASTLYYLSRADNDPGTSLYRKPRNSGTN
                     TPGEAVVEGVENMQLVYGVQNGNGTLQYSPASSIADWNRVVSVRIALLLRSVEDNVRK
                     DPDAELYDLNGTWIDPADDRRLRQVFTATIALRNGIRVQ"
     CDS             complement(233492..233992)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01940"
                     /product="hypothetical protein"
                     /protein_id="BBL73096.1"
                     /transl_table=11
                     /translation="MSLNAARACQGFTLLEVLIAALVLGVGLLGLAGLQTLGLRGSLS
                     AVQRSVATQLAAEIIDRIRANPGALGNGNYDNQAGTNAIDCLWNACSDAQTADYDLSQ
                     WAAEVKKRLPDGSGVVCTDGSPDDGTPVSTGCGGGGTYTVKIWWDDDRTGDAEQYQRF
                     STSFSP"
     CDS             complement(233983..234558)
                     /codon_start=1
                     /gene="fimT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037629.1"
                     /locus_tag="MishRS11D_01950"
                     /product="pre-pilin like leader sequence"
                     /protein_id="BBL73097.1"
                     /transl_table=11
                     /translation="MLKAKIAGFTLIELVATVSIAALVLILGLPSFQDMIRANRMAAH
                     SNRFLGALNLARSEAIKRGQMVFLCKADTEAAQPACDSAPCSGGGCWEKGWLVLADAN
                     VPPNNLPDDADTLIRVFEPLPKTLTLRVGSHDADWVAFNSVGTGKGSGAGGQVDDTFN
                     LCQGDNAAQGRAIVLNSLGRARVRTGATACP"
     CDS             234780..234980
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_01960"
                     /product="hypothetical protein"
                     /protein_id="BBL73098.1"
                     /transl_table=11
                     /translation="MDTSEMVKRLRIGSALGVGFLLGRFLATEMGHHASEFFIGGFGL
                     GVVLTQGFYWALDRLAGRDGPG"
     CDS             complement(235022..235915)
                     /codon_start=1
                     /gene="purC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MIW9"
                     /locus_tag="MishRS11D_01970"
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="BBL73099.1"
                     /transl_table=11
                     /translation="MNATDTLYHSEATGLALRGRGKVRDIFDIDADHMLIVTTDRISA
                     FDCILPDPIPGKGRVLTAVSNFWFGKLGHIVPNHLSGLALADILPDPAVRAPLEGRSV
                     VVKKLRPLPVEAVVRGYLIGSGWKDYQATGAVCGIALPEGLRQAERLPNPIFTPSTKA
                     EFGQHDQNIDFAQTEALLGPELAARVRDTSLKLYTEAAAYALERGIIIADTKFEFGLD
                     AAGKLYLIDEALTPDSSRFWPVDQYQVGISPPSFDKQFVRDYLESLVWDKNPPAPHLP
                     PEIIAKTAEKYREAQARLTQP"
     CDS             235994..236821
                     /codon_start=1
                     /gene="djlA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q45885"
                     /locus_tag="MishRS11D_01980"
                     /product="co-chaperone protein DjlA"
                     /protein_id="BBL73100.1"
                     /transl_table=11
                     /translation="MTWFGKVVGGTFGLFMGGPLGAIFGAALGHQLDRKTAEAILLES
                     DAKPGERQRLQVAFLTATFSVMGHIAKADGRVNEAEIDFARAMMNRLELPEETRRAAI
                     RLYGEGKRPEFALDGVLDQFQAECQQRHALLRMFVEIQLESALADGVLNGPEERLLLR
                     LCDRLRFSRFEFHTMRARMEAERRFARPGGRGYQWGRREVAGGHEFSLAQAYTALGVS
                     PADNEDAIKRAYRRLMSRHHPDKRVAQGESESQVARANEKTQQIRKAYETIAKARKF"
     CDS             236839..237321
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83F37"
                     /locus_tag="MishRS11D_01990"
                     /product="UPF0234 protein"
                     /protein_id="BBL73101.1"
                     /transl_table=11
                     /translation="MPSFDVVSEVNLHEVANAVDQANREVGTRFDFKGTGAHYELKEA
                     VATLHAENDFQLQQMLDILRPKLTKRGVDIACLKIDEPKISGKRATQVVTLRQGLDAP
                     LAKQLVKLVKDSKLKVQAAIQGEQLRVTGKQRDDLQDAIALLRKAEVDMPLQFTNFRD
                     "
     CDS             complement(237268..238047)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KMX6"
                     /locus_tag="MishRS11D_02000"
                     /product="ribosomal RNA small subunit methyltransferase E"
                     /protein_id="BBL73102.1"
                     /transl_table=11
                     /translation="MRISRLYLPEPLAEGATLRLDEDSAHYLKTVLRLKRGFHLTVFN
                     GDGHEYAATVAEAHKDGVALAIGARRERDAESPLATHLGLGIARGERMDLAIQKAVEL
                     GVTRITPLYTEHCVVRLDEARKTHRHSHWQKIARSACEQCGRNRVPQVDEPVELEDWI
                     GGQAGLKLFFDPEGTASLKDLPPPEGGVCLLSGPEGGFAERERAWAREAGFVPVRLGP
                     RILRAETAVLAALAAAQVLWGDWGSVAEIGELQGHIDLGLA"
     CDS             complement(238050..239393)
                     /codon_start=1
                     /gene="bioA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZZ98"
                     /locus_tag="MishRS11D_02010"
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="BBL73103.1"
                     /transl_table=11
                     /translation="MNNPHWSARDLAVLWHPCTQMKDHEDFPPIPIRRGQGAWLEDFE
                     GRRYLDAISSWWVNLFGHGHPQINAALKDQLDTLEHVLLAGFSHEPAILLAERLTRLA
                     GLDRCFYADNGSSAVEVALKMSFHYWRNSGKPGKTRFIALSNSYHGETLGALAVGDVG
                     LYKDTYAPLLMTPHTVQSPDCYLREPGQSWAEHSAQSFAAMEAALAAHGHEVCAVIVE
                     PLVQCAGGMRMYDPIYLRLLREACDRHGVHLIADEIAVGFGRTGTLFACEQAAIRPDF
                     MCLSKGLTGGYLPLSCVLTTDAVYAAFYDEYAKLRAFLHSHSYTGNALACRAALATLD
                     LFERGNTLAHNRILARHMAEATAGLADHPQVAEVRQTGMILAIELVRDKASRTPYAWQ
                     ERRGLRVYRHALEHGALLRPLGNVIYFMPPYVIAPEEIRFLAQVAEAGIAIATQD"
     CDS             complement(239574..239786)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02020"
                     /product="hypothetical protein"
                     /protein_id="BBL73104.1"
                     /transl_table=11
                     /translation="MDLNSLLAGKQARIVAGGLAAAVGYVMMYPDLLGIPLENVTLLP
                     GVPFDLFGGIVFALGIFLIAKAMQAD"
     CDS             complement(239809..240858)
                     /codon_start=1
                     /gene="hypE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010948173.1"
                     /locus_tag="MishRS11D_02030"
                     /product="hydrogenase expression/formation protein HypE"
                     /protein_id="BBL73105.1"
                     /transl_table=11
                     /translation="MSDDFQPACPIPIGQYEHIVLAHGGGGRLMQQLLERLVQPAFAN
                     PYLAARHDSAVFEVGGQRLAFTTDSYVVKPLFFPGGDIGKLAVCGTLNDLAMAGAKPL
                     FLSAALIIEEGLPIADLQRVLESMAATARAAGVMIVTGDTKVVDRGKGDGLFVNTAGI
                     GLVGPGVDISPAQVRPGDAVLVNGDIGRHGIAIMAQREGLAFETTLESDCADLSGLVA
                     SLLEAGVEIHCLRDLTRGGLASTLIEIAQSVGLGIALEETAVPVREDVAGACEMLGFD
                     PLYVANEGRFAAFVPAAAAERALALLRAHPLGDNAQIIGRVVAAHGGAVHLETAFGVG
                     RILDLLSGEQLPRIC"
     CDS             complement(240875..241330)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02040"
                     /product="hypothetical protein"
                     /protein_id="BBL73106.1"
                     /transl_table=11
                     /translation="MNPPQPFLFRALNFALPLALLAGCASQPHQTLPTEYRRDAQNCR
                     AQSAKHVEVRMNMAGIATQELDGGMDEDQYLACMQKLGWKQDESTDPLLKAIAKCQAQ
                     SERPLQATPETGGTKLSGSLDRNAFRQCLKQRGFEGDVTIGPVTPANPQ"
     CDS             complement(241464..242558)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258618.1"
                     /locus_tag="MishRS11D_02050"
                     /product="hydrogenase formation protein HypD"
                     /protein_id="BBL73107.1"
                     /transl_table=11
                     /translation="MKHLAEYRNPDTAKKLTEHIAALVTRPWTLMEICGGQTHSIMKY
                     GLDRLLPEQVELIHGPGCPVCVTPLECIDKAIAIAQRPEAILCSFGDMLRVPGSERDL
                     LAVKAAGGDVRTVYSPLDAVKTARDHPRRQVVFFAVGFETTAPAAAMAAFQAKREGLA
                     NFSLLVSHVRVPPAMEALLGAPNNRVQGFLAAGHVCTVMGYTEYEPLARRYKIPIVVT
                     GFEPVDILSGIHRCLKQLEEGRHEVENEYRRSVRREGNQPAQALLAQVFRVIDRPWRG
                     LGVIPASGLGLSPEYADFDAENRFEVGGVSAPEPAECRSGLVLQGALKPDRCPAFGTR
                     CTPEHPLGATMVSSEGACAAYYRYRHAAHA"
     CDS             complement(242555..242803)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02060"
                     /product="hypothetical protein"
                     /protein_id="BBL73108.1"
                     /transl_table=11
                     /translation="MCLAIPGQILSLPATPEQPGRVNFGGIVKETSLAFVPEAQVGDY
                     VIVHAGFAISRLDEAEAAEALAEFAALAALHADEAELP"
     CDS             242954..246025
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142413.1"
                     /locus_tag="MishRS11D_02070"
                     /product="helicase"
                     /protein_id="BBL73109.1"
                     /transl_table=11
                     /translation="MKVLHCAWIPESGESFVQAGDFWLWAEQGGAGAARGGRRHPRHL
                     PKTELIAFLENPLGLTISSYERRFHFLARGLSLPTAEGLPIPAPEFEHGGDEEPPPAA
                     LELWELDAYRLTRPIRQLGELRFLAYYHGPEAKPGGDLLFWHYFTQSLKAVILRDRYI
                     PALVYRVSPEGGRELYAGWEIVSDDYERLIHEAAHRMPDACAIVGGAMYEKTGLLRHC
                     AEVLVKRLVAQAAEGSALERGLRGTLLEACVTEGEPVPWKAGEPVTLYRQWQAWRGKL
                     AARREESGFTLVLQLHEAFGERGAWRLELLVAPRREPSRQVSLAEYWRMDQKAQRAFG
                     LLCGGDLDKKLLLALGQAARIYPPLWEGLDEARPWGIALGLEDAFAFLHEGAWVLEDA
                     GFMVLVPAWWTPQGRRRAKVRLRAGGKHPTGSGRRDALDVSSLIAYRYDLALGDEVLD
                     EQEWQSLVESKSPLVRFRGRWLALDRDKMREMLDFWRRHQQGDNGMSLPDLMRKAAED
                     EDFFEIEARDNLAEMLDKLRDHSRLQPAADPPGFGAALRDYQRRGLAWIAFLESLGLN
                     GCLADDMGLGKTIQVLARLAEERVGGAKVAPTLLVAPTSVIGNWKREIERFTPGLRAF
                     IHHGTVRLRDAAKFQAICLDHDVVITSYALARKDEKVLAPIAWKRVVLDEAQNIKNPL
                     SAQTKAVLKFNAEHRLALTGTPVENRLLDLWSIFNFLNPGYLGRQSHFRQRYELPIQR
                     DNDPRSAETLKRLIEPFVLRRVKTDPDIMRDLPDKLENRQFCNLCREQASLYEAVVRD
                     VERHLNEAEGFNRQGLILSTLTRLKQICNHPTQFLRDGSPFSPLRSPKLERLRDMLGD
                     VVGEGESALVFTQFAEIGERLEKYLAEALDCPIYYLHGAVPAAKRERMIAEFQNPDTG
                     PAVFVLSLRAGGVGITLTKANHVFHFDRWWNPAVEDQATDRAFRIGQQKNVFVHKFIT
                     LGTLEERIDRLIEEKKEVASLIVGNDESWLSRLDNETFRELIALNRMAVLE"
     CDS             246079..246705
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011086354.1"
                     /locus_tag="MishRS11D_02080"
                     /product="dihydroxyacetone kinase subunit L"
                     /protein_id="BBL73110.1"
                     /transl_table=11
                     /translation="MNTESILRAAEAIQAALLAHEADIEALDRAIGDGDHFINMKRGA
                     AVVVAMRDELAALAPDAALQKIGMKLLSSIGGASGPLIASFFLAMAKTMQERGADGWP
                     QIAAAFAAGVAAIQSRGKADLGEKTMLDVLIPVSRCFTRLAEAGTEPAALCAELKREA
                     VQGMESTRDMIASKGRAAFLGERAIGHIDPGAKTSQVMICTVCDLAST"
     CDS             246738..247727
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528089.1"
                     /locus_tag="MishRS11D_02090"
                     /product="dihydroxyacetone kinase subunit DhaK"
                     /protein_id="BBL73111.1"
                     /transl_table=11
                     /translation="MKKFINAVDDVLVESLSGFAAAHADLVRLQLDPHYLCRAQKAQN
                     KVAIISGGGSGHEPLHGGFVGYGMLDAACPGHVFTSPTPDQMLAAAEAVEAGRGVLFI
                     VKNYAGDVMNFEMAAELLPFDHATVLTSDDVAVEDSTYTSGRRGVAGTLIVEKVVGSL
                     AETGADLAACQALGEKVNRRTASMGVALTSGTVPAAGRPTFDIGPDELEMGVGIHGEP
                     GRRREALRPADAIVGDVLAALIEDLKPEPGSRALLLVNGFGGTPLMELYLLYHAAARG
                     LAERGVAVERSLVGNYVTSLDMAGASLTLCLLDDEILAHWDAPVHTPALRWGR"
     CDS             247731..248573
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142412.1"
                     /locus_tag="MishRS11D_02100"
                     /product="hypothetical protein"
                     /protein_id="BBL73112.1"
                     /transl_table=11
                     /translation="MTTKQGKTWWGRRFLEGLETFTESGRLARGRQYAATQRIAEWGI
                     RGSRVEAKVKGQASPYYGVYEEPVYRTLVEFTPIPDAAWNEAIGQIGGKAGFVCRLLF
                     NEMPDEIERPLAGLGLSLLPQGRKDVAAACSCPDAEKPCKHVAALYHLLAAKLDHDPF
                     LLFELRGLSRADLALRLKATPLGAALAAALTENLGEPEPARAFFHRPEPVALPATVSP
                     RDFWRGAKRLPQGVESPPPAALSGILIRKGGDYPPFWDKELSFVEAMDGFYEQVRKKA
                     KDWM"
     CDS             complement(248730..249119)
                     /codon_start=1
                     /gene="queF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9F719"
                     /locus_tag="MishRS11D_02110"
                     /product="NADPH-dependent 7-cyano-7-deazaguanine
                     reductase"
                     /protein_id="BBL73113.1"
                     /transl_table=11
                     /translation="MSTLPSKALETFDNPQPGRDYTIRIDVPEFTCLCPKTGQPDFAT
                     LLLEYVPDQLCVELKSLKLYAWSFRDEGAFHEAVTNRILDDLVEATRPRFMRLTAKFN
                     VRGGIYTTVVAEHRDPAWVAPVVVALP"
     CDS             249292..252801
                     /codon_start=1
                     /gene="smc"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I3I6"
                     /locus_tag="MishRS11D_02120"
                     /product="chromosome partition protein Smc"
                     /protein_id="BBL73114.1"
                     /transl_table=11
                     /translation="MRLEKIKLAGFKSFVDPTTLPLPGNLVGIVGPNGCGKSNIIDAV
                     RWVMGESSAKHLRGDTMADVIFNGSSSRKPVGMAFVELVFDNGEGKAPGEFAKYPQIS
                     IKRQVTRDGQSVYFLNGSRCRRKDITDLFLGTGLGSRSYAIIEQGTISRLIEAKPDEL
                     RSLIEEAAGISKYKERRHETELRMGHTQENLDRLMDVRDEVAKQLESLKRQTKKAEKY
                     LALRDEERRHKQQLLALRWLKYDQQGQSLKATLAGYETRFRELYGAGHALAETLELQR
                     AQHDTLQTQLGEQQARFYELGSEINRLELALQHAKQTRDNLLQEQERLGAEKTLALRD
                     LDQDQAQLAALREELAAVAVSLEQTQAAEQAAASRRAEAEHALQAARLAFEQSSGELG
                     RSHSQAEIQRARLKQLEQQQRQLETRRERLDHEREELEDTLQAEGLEDLRQETAELEA
                     ERAELQARLPALHSAIQADRARSKQCQEDLNARRAELHALQGRISSLETLQQHAMGKD
                     RAGLKHWLAEHALDQAGRLAEHLDVAPGWETAVESVLGTHLEALCVATAAPYLPHLAA
                     IGDEALGLIETRAAPQTSPAPKAARLLDRVRSPWNLGPLLGSVYCADDLDSARALSEA
                     MAEHESVVTPDGVKLGPGWLAAPKGDDGKAGVLKRERDLRELKARRDDCQAQALTLEH
                     ALAQAETSIRAAEQERERLQTDERRLASEHAKLKAELSAAEARCEQASKRLRQLELET
                     EDLEAQRAENGEETAEARGLLLDAEDRLAELGPKATEQASRRAALESQLQETDAALRA
                     ERERRNALHSRRESLASNENLTLKHLERAQSLYGQALERLETLSQRLAETATPVEAEE
                     IERDRLIERRTAADRNLNELRRRDQETSAEIRRLNEARLQNERDLEALKEKLEQAKLE
                     LSTNEVRWQTVREQFEELDARPDEVIAGLPPEAEEKAWQQRVTELAEEISRLGAVNLT
                     AMEEYQAQDERMKFLDQQHQDLSQSLATLKEAIDKIDKECRARFKDTFDQINAGLQRM
                     FPKLFGGGQAYLELTERELLEAGVSVMARPPGKRNSSIHLLSGGEKALTAAALVFAIF
                     ELNPAPFCLLDEVDAPLDDANVGRFSQLVKEMSERVQFLFISHNKATMEIAQHLAGVT
                     MKEPGVSRIVAVDIDAAVEMAAM"
     CDS             252828..253769
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WFG0"
                     /locus_tag="MishRS11D_02130"
                     /product="methyltransferase"
                     /protein_id="BBL73115.1"
                     /transl_table=11
                     /translation="MEQLSLTGFDEAQQIGRETTLVSSLQGFQLQYEHPHGRLYQGDS
                     IAWLSSLETASIDLVFADPPYNIKKADWDSFDSQEQYIEWSMRWIGQASRILKPTGAL
                     YVCGFSEILADLKHPASKYFKHCRWLIWHYKNKANLGNDWGRSHESILHFRKSDQFTL
                     NIDDVRVPYGAHTLKYPSHPQAETSAYGKGGNKPRENWMPHPKGAKPKDVIDIPTTCN
                     GMGEKTPHPTQKPEELLRKFVLASSNQGDLIIDPFSGSGTTVVVAEQLQRRWMGCDLD
                     AQYNRWAIERLENVRRMSKEEWISHDRKTAERRESIR"
     CDS             254240..254725
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02140"
                     /product="hypothetical protein"
                     /protein_id="BBL73116.1"
                     /transl_table=11
                     /translation="MRVPVKDFDGTELFKSNYQHDLLISEAGELKIIGSVKTSSKDRI
                     DKIFVDKFLYNKLTETNLPHIAIFLNDVQRKNSKHENKYGINSTFLPGHFKAYTFKLN
                     SLDGVYYCDIRPSMLEDPTLSKHIKTIDHFFYSDLRHLLNKHGADLDEVAIDTNQEDD
                     H"
     CDS             254799..255608
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02150"
                     /product="hypothetical protein"
                     /protein_id="BBL73117.1"
                     /transl_table=11
                     /translation="MDRDTIRIVLLVIGLLVIAGIYIWGRHRQKLLDFLQRRGEYDEL
                     GYDPGQEAPPPKSRYQDPDDDEFESLGYKGRKPAAPEPAAYGLDDDLDNDLLDFGESK
                     PAPEPPPAKSKPEAAAKTPPEPKKTTGSAPIPVLIQVSVVASGGRRYFQGDDLRDALL
                     DLDLIHGSMGIFHRYDRKFRETLFSVASLVEPGTFPMDNMEAFECPGVVLFFQPDRVS
                     NPIAVFDDLVRTSHKLANRLGGAEWDEKRQPLTQDKIAHMRGLLEDACEDS"
     CDS             255605..257629
                     /codon_start=1
                     /gene="ligA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87RJ4"
                     /locus_tag="MishRS11D_02160"
                     /product="DNA ligase"
                     /protein_id="BBL73118.1"
                     /transl_table=11
                     /translation="MNTPESARHRAAELRGQIEFHNERYHKFDAPVIPDAEFDALMRE
                     LIALEHDHPELRTPDSPTQRVGSAPLKAFAEVRHEVPMLSLDNAFTDGDVADFERRAQ
                     KPLHGVALDYLVEPKLDGLAVSLIYENGLLARAATRGDGQTGEDITHNVRTIRAVPLR
                     LAGAGWPARFEARGEVFMPKAGFEALNERARRLGEKTFANPRNAAAGSLRQLDPKITA
                     ARPLAFFCYGYGAYPTAELPATQSELMARFKSWGLPVNPESHVVQGSAACLDYYRDLR
                     ARRAGLDYDIDGVVYKIDRLDQRETLGFVARAPRWAIAHKFPAEEATTRVTAIEVQVG
                     RTGALTPVARLEPVFVGGVTVTNATLHNIDEVRRKDIRVGDTVVVRRAGDVIPEVVKS
                     LPELRDTEVPLFELPTHCPVCGSEVETAEGEAIARCSGGLYCPAQHKEAIKHFASRRA
                     MDIDGLGDKLVDQILDKGLIKTVADLYRLQVDELAGLERMGRKSAENLVAALDKSKHT
                     SLPRFLYALGIREVGEVTAQTLAAHFRELPAIQAADEETLQTVPDVGPSVAHHIHTFF
                     RQPHNLEVVAALLAAGIDWEPMPELPPAAELPLKGQTFVVTGTLESLSREEAKARLQA
                     LGGKVAGSVSKNTRAVIAGADPGSKLAKARELGVEVLDEAGFLALLDGAA"
     CDS             257746..259212
                     /codon_start=1
                     /gene="ubiD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z3C3"
                     /locus_tag="MishRS11D_02170"
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="BBL73119.1"
                     /transl_table=11
                     /translation="MKYHDLRDFILALEAQGELKRIRLEADPYLEITEICDRTLKAGG
                     PALLFEQPKGSQHRLLGNLFGTPRRVALGMGQESVDALREVGRLLAFLKEPDPPKGFR
                     DMFDKLPLFKQVLNMPAKLVKHPPCQEIVLGGSDIDLGRYPIQTCWPGDAGPLITWAL
                     VVTKGPHKERQNLGIYRQQVISPNKTIMRWLAHRGGALDFRDWQAARPGEPFPVAVAL
                     GADPATILGAVTPVPDSLSEYAFAGLLRGSKTEVAQCLTSDLQVPASAEIVLEGFLYP
                     GETAPEGPFGDHTGYYNEVDEFPVFTIERITQRSDAIYHSTYTGRPPDEPAVLGVALN
                     EVFVPILQKQYPEIVDFYLPPEGCSYRLAVVSMKKQYPGHAKRVMFGVWGFLRQFMYT
                     KFVIVVDDDVDARNWQDVVWAITTRMDPARDITLIENTPIDYLDFASPVSGLGSKAGF
                     DATNKWPGETQREWGTTIQMTEAVKRRVDAIWAELNIL"
     CDS             259237..260811
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02180"
                     /product="hypothetical protein"
                     /protein_id="BBL73120.1"
                     /transl_table=11
                     /translation="MISNEITSYLDNKYLNKAEYHMGRLHLHSLPSYLTVVMGNGCNI
                     DCRHCYQWKNRDNLFRDAQLGADLRRELTAFYPYLSTLRIQGGEVFALRGFEDLLDDI
                     GALVQRPIVSISTNATLIDEKWARRIVAMPLQSMTVSLDAGTAATFERVRRGAKFDQV
                     VANIERVQRLKQSHNSPYPVLDSFFVIMRSNFREIPQFLDLMIDLGIKRVSFQTMLVD
                     ARNQEREPDIVDEVLCDAGEVAELHAILRDVLEYQARYFHRIAWSGLNSLFAAHKLPA
                     DFLDEQGCTLTPDQDDSETDASGPGNRYAHLIPPEIHPEFGPFPGLHHTGKTGHTGTE
                     TCRNPWSTMFITENGDVSLCFLSDPVGNLYQTPLMQIWNSPAAIVKRSHLLHGKYLEG
                     GCSKLWCEWREGDSGFRPDAESWRRLLQLTSALVARTRPKDIKKPVSPAQAWIKNPDH
                     KGLQAVRRLLDERDSRVKELEALIVELWDKNGLLHEAGQKHIDHLENRIKQLESQLRK
                     PHDYPSPGKHAASDGP"
     CDS             260765..261535
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q97IC0"
                     /locus_tag="MishRS11D_02190"
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="BBL73121.1"
                     /transl_table=11
                     /translation="MITPAPENTPPATGLDRPGISATPAISASLICCDLLNVERELRH
                     MEEAGTDYLHIDLIDGHFSPSMPLGLDLVRQARRKTRLPFDVHLMVENNEFFIREMLD
                     IGAERIAFHYESAFHVDRLLCLVRERGVEAGLALMPTTPLSVLDYCVDRLDFVLLMLI
                     NPGFAGHKDETQVPYALRRVADCRRHLRGFGLDIPIEVDGRVGFDNIPGLIAAGATDL
                     VAGTRSAFHPGGTLAENIHRMRQAATAGFSNRPGPACG"
     CDS             261888..264305
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010968934.1"
                     /locus_tag="MishRS11D_02200"
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="BBL73122.1"
                     /transl_table=11
                     /translation="MPKHPIPRIHPIHGLPILLSLTLSAAGLAQTADVPNPGFRAQEW
                     QKSLDEAEKATAEPNIPDGKLADWRDRLLDLIAQAREAVHTVEPDIQTLRGDLEALGP
                     APAAGAAPEAANVVARRKELNAGIASLEGVVKEADLASIRAGRLLAGVKATQRTRFTG
                     RILTRSPSPLSPAIWGKALPELGSALASLYRGLVDKATPAAILAIGRPLALGMALAAL
                     LAFPLRAGLIRKFGYIVVEDEPTYMQRLWTALFTGLVRTLLPTAAALAVYLGLLYTDW
                     PGEAMADVLRVGLLSLTALFFVTGFARSALAPDQPDWRLVPIHDPGARTLNRTVTGLA
                     ILFALDRVLGELANQYDVSVELVSTQKSVFGALISLALLKLLGRGIWPEDPARPGWNR
                     VRYGLMLLIAAIPASAMLGYVALSRLLATQWVLTLGLYATVALLNRIAQEAVEHALNP
                     ASPQGQRLRAALALGEEGAEMLAFWVVGLMRCSILLLAALALPLLWGVPGKDIAAWLG
                     NAFMGFKLGNLNLSLGEILVALLSFTGLLLATRMLQKALDQRIFPKTRLDPGVRNSIR
                     SGLGYAGFALALMIAVSILGLDLSNLAMIAGALSVGIGFGLQNIVNNFVSGLILLVER
                     PIKAGDWVVVGEYQGYVKKISVRATEISTFDRASVFIPNSSLISGTVMNRTYADKTGR
                     VLLPIGLAYHADPHKARRVLLDIALGHPDIRDNPPPSVFFQSFGDSALNLELVAVLHD
                     VDKVKQVTSDLCFAVHEAFQREGIEIPFPQRDIKLSLDEEQLRRYLRSDHRGQETPKP
                     PMAQTST"
     CDS             264561..265475
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114741.1"
                     /locus_tag="MishRS11D_02210"
                     /product="hypothetical protein"
                     /protein_id="BBL73123.1"
                     /transl_table=11
                     /translation="MHNSLDALFKTANTVILGKPRQIRLAVCCLLARGHLLIEDVPGV
                     GKTTLAHTLANLLGLDYQRIQFTSDLLPADVLGASIFDAKNHSFRFQPGPIFHQMILA
                     DEINRSTPKAQSALLEAMEEHQVTVEGETRPLPEPFFVIATQNPIHQIGTFPLPESQL
                     DRFLMRITLGYPDGRSELALYKGEERHSLLGKLPVCLPADELRGLQEAIRAIHAADAL
                     LGYVQALVRFSRESGLYEIGLSPRAGLALLGAARAWAYTEGRELVLPEDVQAVLAPVC
                     GHRLKPVGSGAVTAEAVVGPMLDQVAVI"
     CDS             265545..266498
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114742.1"
                     /locus_tag="MishRS11D_02220"
                     /product="hypothetical protein"
                     /protein_id="BBL73124.1"
                     /transl_table=11
                     /translation="MPSPTLKQRFDLQRFFRGDKAVPGPIVLTHRLIFIVPNKRGLGL
                     ALLLFILWLTSINYSSNLGFILTFLLVAIALLGMLHGYRNLAGLSIRPKPGQPVFAGE
                     QARLELAVVNSGYLPRYAVWCRCKGAEPVRIDIPAETTANPTLGLPATRRGWLEPGTV
                     RVYSEFPLGLFHAWSLLNFQERVLVYPRPAPTPMDFPVSGGYGRFNRQPHSADDFHGF
                     QAYQAGDPLRHIHWKGVAKGHDPQVKRYAGGEAEDLALVFEETPGGDTESRLSRLCRW
                     IVDAEAAGLRYSLSLPGTRIAADCGAAHSRLCLETLALFQP"
     CDS             266495..268477
                     /codon_start=1
                     /gene="tgpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HZX3"
                     /locus_tag="MishRS11D_02230"
                     /product="protein-glutamine gamma-glutamyltransferase"
                     /protein_id="BBL73125.1"
                     /transl_table=11
                     /translation="MTAIPLRDTLTAAFEKLLLFSLVFVALPHVNNLHPTVFGFFALL
                     AAWRYATVERPGLRPGKWTLGLLMLCAMALVYVHYHRFYGREGGSALFLVGLGLKLME
                     MKTRREVYLVIFLGFFVAMTQYLFSQTIPMALYTLVAVGLSVGVLIGAGGGPALAPVE
                     AFKRSSALVAQAVPIMLVLFMFSPRLPGPLWKLPDDERHAKTGLSDNLEPGSISHLGR
                     SAEPAFRVDFQSAPPPNALRYWRGPVFWHTNGIRWDVAVDKPLHRDQEPRFSGPSYRY
                     AITLEPHQRRWLFALELPGGFPSDVAQTADYLLLTKDPVHDRRRFELVSQPDFRTGPL
                     SPLERAQGLQLPGPPDGRVQTLVEAWRGESARPGDLAQRALRYFREEPFFYTLNPPAL
                     EDHPIERFLFETRRGFCEHYATSFVYLMRVAGIPARVVTGYQGGAWNPVGRFLEVRQA
                     DAHAWAEVWLPERGWTRIDPTAAVAPERIEQGIDLDAASPEGDVMFNPVGEALAGHAQ
                     GFRDWVRQGRMLWASVDHAWNQWVLAYDPEQQRRFWDSLGIVDWGKLALWMGGLLGLC
                     GAAAALLFWPRRKLPPDPAVLAYRRFLGKLARRGVVKRMGEGPLDFSRRAMAERPEVS
                     ATIGQITGIFLGLRYGKTARAEDLARLRRLVREFRV"
     CDS             268575..269228
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02240"
                     /product="hypothetical protein"
                     /protein_id="BBL73126.1"
                     /transl_table=11
                     /translation="MYYSSSSRSRGYRNSGSRPYDPNDNFRLKSRKGSRKTKLIFVLA
                     VFLALQSLYLLVSYIRMSIAEADTLELTLSERKQQQELDILRPQAQKLRADIETLGKG
                     GLPELTRLEFDKVLTMDQDYVKNVVFTVSGKGNDRVYEYKMVMHNGSLNLIHPQVDIL
                     FFDPQGIQVGMSRLGVQNDGVTPTLEVMERGEIRSFSSQIQLSDNAKPGYFRLRIWK"
     CDS             complement(269236..270000)
                     /codon_start=1
                     /gene="cysE_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003100615.1"
                     /locus_tag="MishRS11D_02250"
                     /product="serine acetyltransferase"
                     /protein_id="BBL73127.1"
                     /transl_table=11
                     /translation="MWEKLKAEYGCIFERDPAAQSYFEIFTIYPGIHAVLVHRLSHRL
                     WNHGLKWPARFLSTLARWWSGVEIHPGAQIGRRFFIDHGMGVVIGETATIGDDCTLYH
                     GVTLGGTSWRKGKRHPTLGNGVVVGAGAKILGPITVGDGARIGSNSVVLKSVPAGATV
                     VGIPGHMVSPDRKAQEERRQNIASKLGFDAYGMTPDMPDPVAHAVNHMLDHIQALDGQ
                     IEALKRMLKQQGLEVSEPPLPELEPCGLRQGGEKAE"
     CDS             complement(269985..270734)
                     /codon_start=1
                     /gene="trmJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZX37"
                     /locus_tag="MishRS11D_02260"
                     /product="tRNA (cytidine/uridine-2'-O-)-methyltransferase
                     TrmJ"
                     /protein_id="BBL73128.1"
                     /transl_table=11
                     /translation="MKRLAHVRIVLVGTTHPGNIGAAARAMKNMGLSDLALVAPKVFP
                     SGEATARASGADDILAGAKVCSNLEEAIADRELVIGASARLRAIPWPQLDPRECAGRV
                     AGSPVKTALLFGREHSGLDNEELERCHYLLHIPCDPAFSSLNVAAALQVVAYELFLAS
                     AAEPKPLQAPMSPLATAEQMESFYQHLDTALHEVRFLHEKKSSPSLMRRLRRIFNRVR
                     LEQKEIHILRGILTAVQLQLKRQGSSTCGKN"
     CDS             270891..271709
                     /codon_start=1
                     /gene="suhB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010958026.1"
                     /locus_tag="MishRS11D_02270"
                     /product="inositol monophosphatase"
                     /protein_id="BBL73129.1"
                     /transl_table=11
                     /translation="MDPMLTIAIRAARAAGDIIVRAMDRVDLLNITPKGRNDFVSDVD
                     RQAEREIINILQRAYPGHGFMGEEGGVQGPAHADHVWVIDPLDGTTNFLHGFPQFAVS
                     IGLLHKGRIDKGVVYDPIKQELFTAARGAGATLNNRRIRVTKQVGMVGALLGTGIPFK
                     DQSYLDAYLGMLKDLLKDAAGIRRAGSAALDLAYVAAGRLDGFWEIGLKPWDMAAGVL
                     LIQEAGGIVTDLEGGDKHFETGGVLAANPKLHQVMRGLIAPHLTDGLRHRSAQD"
     CDS             272074..273876
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141343.1"
                     /locus_tag="MishRS11D_02280"
                     /product="potassium transporter"
                     /protein_id="BBL73130.1"
                     /transl_table=11
                     /translation="MHDPLFLQHLLIYLGGAVVCVPIAKRLGLGSVLGYLLAGLIIGP
                     SGLGLIGRGEEVLHFAEFGVVIMLFLVGLELAPKRLWELRGPILGLGGLQVLTTTGLL
                     AGFALVFDLGGPAALIAAMGMALSSTAIALQILAERNALATPAGRLGFATLLFQDLAV
                     IPMLALIPLLGDGTAGGGFDWPGAAKALGVILGIVVGGRFLLLPLLRFVAVTQQREIF
                     TALALLLVIAIALLMKGVGMSMALGTFLAGVLLAESEYRHALEADLEPFKGLLLGLFF
                     IAIGMSVDWTAIREHWQTLVLLTLCFVLVKLGVLAGLARLFGIPKAQRLFFAIVLSQG
                     GEFAFVLNNTALAEGIIPADIAGLLAAVVALSMMTTPVFLSLHDRWLEPYLAGRGKPD
                     YDAPEDEGNPVIIAGFGRFGQIVGRLLTANRIGVTVLDHDPVHIDTIRKFGNKVFYGD
                     ATRIDLLRAAGAEKAKLMVVAIDDVEHSLQLIDAVREEFPHLTLLARVRNVQHAFELM
                     ERGVHFQREIFESALLLGEHALVRLGYGPYAAKQAALKFRAHDLRSLVKRYEARGDEE
                     ELISVVREARQQLEEAMNADREAYQLQVARDYWK"
     CDS             complement(273945..274862)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02290"
                     /product="hypothetical protein"
                     /protein_id="BBL73131.1"
                     /transl_table=11
                     /translation="MIERNRSSSASIPAWLAAILLAAPPGHVIAEEKKPLDIRDPGAD
                     LANFPNSAFTLPRGGFYLEMAPAFFSAESSRLSAQYNWEYMLRYGLFDAVELRLYSQG
                     FSVQGSPNSATGFSPLTLDTKIHLWDEIEAYFLPAAGLEVMVQTTWLGSSAFDAGTEP
                     SFSFNFDQGLPWDVDLEYNLGAARFQDPDDPTDQVWDFTLSWALQRDVVEDVAVFVNG
                     YHNSSNLPRTGRLAEKYVRVCPNSGPCRTEELVQQYADDAEDYVQHMIGGGTLWTVDD
                     HIAVFGNIGVGLTSSTPPVTAYFGFAWTP"
     CDS             complement(274991..278947)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02300"
                     /product="hypothetical protein"
                     /protein_id="BBL73132.1"
                     /transl_table=11
                     /translation="MATYHFSSLSNNQTLAFKPAVDTLVFDIAGLDAATGTLAPSGAN
                     LLVTYAGKTLVLANTTLDQVSSARFSFANGSKLLIGDNSSGTAGDSLSNALVGTAFGD
                     YLDGRGGADSMTGGDGNDTYVVDSTGDVVVETNTSATQIDTVLSYLAAYTLPANVENL
                     RLVGAGGVNGTGNGLNNLLYASSGNNALNGGAGTDTASYLYAAAAVKVDLGKTGGQAT
                     GGSGTDTLANIENLTGGAFNDSLYGNSGGNVLDGGAGADRLYGGPGNDTYVVDHTGDM
                     VQDYIPGLGAGGIDTVQSYLADYTLPYFGGGDYGIEILRLMGTGNLNGTGNGGDNTLY
                     ANAGNNSLNGAGGIDTLSYVFSSAAVTVSLAQTTAQATGGSGTDTIRHFENLTGSAFN
                     DKLTGNAGDNGLDGGSGADTLSGGDGNDTYVVDNSGDVVVETNASADQTDSVRSSLTA
                     YTLPANVENLQLLGGGNLNGTGNALGNVIYANAGNNRLDGGAGSDTASYANAGAGVVV
                     SLAVATAQATGGSGSDTLLNFENLAGSAYADTLTGNGAANVLTGGGGADRLGGGDGND
                     RLVVSDLGFALADGGAGTDTLVLAGTGLYLDLAAQGGKLAGLESIDLGGGANTLVLTP
                     ATVKSLSTTSETLVIDGSAQSLVSGGGGWVQGANATANGHSYRTYTQAGATVWVGTDI
                     GTNNLNIGTPPRLDLGGLNGNNGFRLDGAAFDYAGTAVGAAGDINGDGYGDLAVTTAY
                     SGMSYLVFGKAGGFAASTDLSTLNGGNGFALYGGEFAIAGAGDINGDGYADVVVGDYS
                     GGTPTGYVVFGSGSGFSSLLDLSTLTGTNGFRFSDSAAVDPSAVVVGAAGDVNGDGYA
                     DIIVGEKNASPLGRDYAGSSFVVFGKASGFSAGLDLSTLNGATGFRIDGVAGQHSGVA
                     VAAAGDINGDGYADLLVDTVRPYGSAQAKQSYVVFGKATGFGSSLDLSTLNGGNGFRL
                     DAGDGYTGAVAAAGDVNGDGFGDVIVGSGDSAAVVFGKSAGFGSNLDLSTLDGSNGFQ
                     FTGLGSYGALATVAAAGDVNGDGYDDVLIGAKRYDPASQGYQAESYVIYGKATGFPAS
                     LDAATLNGANGFRLDGADRVGPAGDINGDGFSDLIIGDPTASPNGNSQAGSSYVLFGG
                     NFTNAVAKLGGTGNDSLTGTSAAERLVGGQGNDTLAGGGGSDIFYGGQGDDLIKVSDL
                     GFRQVDGGGGSDTLALGGAGQNLNLAGFRNRIDGIEKIDLTGGGDNTLTLLKRDLVNL
                     SNTSNTLQVNGNAGDHYHFSDAGWTQKADVTLVGVTYHVFDNGAAHLLLNAALTAV"
     CDS             complement(279104..281110)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02310"
                     /product="hypothetical protein"
                     /protein_id="BBL73133.1"
                     /transl_table=11
                     /translation="MDLKSNPFLRALAGLVLALGAGEALAAIANGALHTTPGDASSNS
                     SGELFLNVWDATAAKSYSLDLGTTVEAFLGDPSAIKSWPLDQRFKDFAAAGNPLVYNI
                     AANNTYGTVSAGAVGAVPSSYGVLASVLNDPTAIAKAESLTGTAGVNVSQLSSVIQAR
                     ANTLNLSAAAQNGLNPGDISAMTDFQSNLSEVTDMSDPGAGDPYSAYFDTRWGIDLSG
                     QFGFSDAASVRGGADQNLRLYFFGLKGPGINKMQATDLGQGSLVATLDIANATLSFGA
                     GGSGGGGTGQGCEQLSWAGVIADGGTVTAYSTEQSADCAAAAKVLTCDNGSLPDSDVY
                     QYSSCANTYCTLPWDATQKIADGASVTAYQTSLSPNCASVSESRVCSTGKLSGSYTFQ
                     TCQAPTACVLPWGGTVAHGQSVTAYRVKVDSDCAENAEVRTCNNGKLSGSAAYPACSA
                     PTPHTDCSLPWGGTLADGQSVTAYSSATNADCAAVAETRACANGVLSGSATYPTCGAP
                     TTKADCGLPWGGTLADGQSVTAYSSATSADCAAVAETRACANGTLSGSYPYAACSTPT
                     GPYIQLSFPNGGDVLTVGKKQTIAWQFGLTGANRNVNVQFSKNGGGKWKSLKTGVKLG
                     RGSVVWKPLKAQATETGLIRVCAPKTKKAAAVCGMSSGPFAVRR"
     CDS             complement(281183..282583)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02320"
                     /product="hypothetical protein"
                     /protein_id="BBL73134.1"
                     /transl_table=11
                     /translation="MKTTRFNLLGGAGLCLLLSTPGAEAAIADGAAHAIPTDTHSGSS
                     GELFLNVWDPVAAKSYSLDLGVTAEDFLLDASGRVWHLDPRFKALAAAGNPLRFNIAA
                     NNTYGGIAAPGVGAAPSGWGFAITALNDPVSLGLLMGLNDKSASLAISQISAAIQTRV
                     DHLNLNAAAANGLVPGDFTTMADFAANLSETTDSTNDAYGAYFDYLWGIDIAGNFGFS
                     TAATVRDADGAKDQKLRFFFLGLKSPGVNKLKTTDLGGGTAFFSLNPANATLLWSHGG
                     RGDNLTPVAVPGPAMRVEPGATVVLDGSASYDPDYSGDLGYAWTQASGPAVMLGPGAG
                     PAKAVFVAGQAGDIYLFQLAVTDAGGRIGKAYKRVVVPNHRPVAVIDGPATVAPGGTV
                     NLDGGASYDPDAGDGIVAYQWVQNAGPATGLGGSALPALSFTAGAKGSVYQFSLVVTD
                     NHGLASVQKKIRIKAQ"
     CDS             complement(282606..284150)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02330"
                     /product="hypothetical protein"
                     /protein_id="BBL73135.1"
                     /transl_table=11
                     /translation="MPTPAFPKTLFATLLAAFAGAASALTPGDGDPDIVLYVPGSQAN
                     DKFFAPALCSSNIHTYFQNYTSDPSKATNNDYWAIYCSTDGSKVSGIVGTKKLWISRR
                     RLGASYVGLDALVKGTKLTYLEKPSTAACTAFSGSFTSGGTTFNYDYSCTTVTPNITA
                     TGSVSDVTPDAFRGGDNVPTGQAEIVASGIPNRNAIAGHIIGAPVTLLLRNALQYAQV
                     LSGALPSQCAVPGSTTSANMDETAACMPSLGKQQLASLFSGAVSDWNSFSVNVSGTAI
                     SLEQVAARWASNGGSASYLKAPDDTTVHICRRENGAGQQVALLATILQNPCLGNSAPR
                     LVQPGSFTDVQLATSLGAEDSCLTDFNNGTTNFLPTAKGNRWAIGIQTTERNVSRSAN
                     YRFIKIDGAAPTVEQVALGKYPLWSEYGIQWMNNVTADQGNLLRALVKYGQRPDNVNA
                     RNQADIHSFGTAGYVALSANGYAPDPVFNAANPVTPYTHKRAGGGIDACTVPVVNPDY
                     GTAELR"
     CDS             284667..285218
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02340"
                     /product="hypothetical protein"
                     /protein_id="BBL73136.1"
                     /transl_table=11
                     /translation="MLFRTFSPPALAVSLMLGVAATAEAASSCLGGPSTTLRLAGPAI
                     ATPKTFTPASLAAYPPSKVTVSYFSGASGMVTKTFVGVPLYDLIQAAGLVVDANRKND
                     KLRKYLAATATDCYQAILSYAEIDPGYGGQQAMVAYATVDATGTQTPLDDTEGAMKLV
                     IPGDKFGGRQVFHLESLTARSAP"
     CDS             285272..286624
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02350"
                     /product="hypothetical protein"
                     /protein_id="BBL73137.1"
                     /transl_table=11
                     /translation="MTATRLLPALVLASASHTALALDNDTPLPNATGAASTHSALGVI
                     EAGNPFFQALGSNGRSCDSCHKPENGWSVTPAALKQRFDASQGTDPIFRTHDGANRPD
                     AKVKTLKDRLGAYSLLLSKGLIRFGLALPAQAEFQLAAVSDPYGYLTPVSTELSLYRR
                     PLPATNLKFLNAVMWDGRETVDGKPIAFDLRNQANTATTGHAQGSPLPEAQRRAIVAF
                     ETRLFTAQVEDLQAGALTPAPLKGGPIPLSKQRFYPGINAFGGDPRTGAAFDPTVFTL
                     FNPWNKLIDTDPTDIRAAIARGQKLFNTRGFVISGVAGLNGSPDFGSPATLVGTCSTC
                     HNVPNVGGDSGVHYMDTGVADAANRSGDLPLYTLRNKTTGATLATTDPGRAMITGLWS
                     DIGRFKVPGLRGLAARAPYFHNGMALALGNVLDFYDGRFHLGLDNRERLDLILFLRSL
                     "
     CDS             286621..287031
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088962.1"
                     /locus_tag="MishRS11D_02360"
                     /product="preprotein translocase subunit TatC"
                     /protein_id="BBL73138.1"
                     /transl_table=11
                     /translation="MNPSAVTEDQIAELVRRFYAKARADAELGPVFARSVVDWGEHHR
                     IVEDFWSRTLLGTRRYQGHPYAAHTRLGLKPEHFERWLALFRQTALEVLPAAVAEHAI
                     ARTEHMASSFKAGLFSFGDWVEPRHGKPARRSAE"
     CDS             287036..287338
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02370"
                     /product="hypothetical protein"
                     /protein_id="BBL73139.1"
                     /transl_table=11
                     /translation="MPDTKRTDGERGLEAILADYGFAMGCLVQDKVEQTGREAEVRRL
                     LAQGFRFIFSFEPDLAQARLVGEVSAALYHPETGATVPILRLSLTTRPRGVAGVRH"
     CDS             287335..297987
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02380"
                     /product="hypothetical protein"
                     /protein_id="BBL73140.1"
                     /transl_table=11
                     /translation="MTGRTRRDRRAGRWHLRRAVRGLLLCGGIGAARAELPVPAAAWA
                     TAGQATREVVGNTMTIHQQTDKAILNWQSFDIGLNNAVHFKQPGPAAVALNRIGPGDL
                     PSRILGTLDANGQVYLVNPNGFVFGPGSQVNVNSLVASTLNISDAAFNSGLTKVINQS
                     QGSEPVAALTGTGQVYRQDAQGRPLLDAHGQPLKITIETQPGSRIASNAAGGRILLVA
                     PAIVNQGTVSAPDGQVVLAAATDKVYLQEAGSDSKLRGILVEVKTGGDIQNLGKLVAA
                     RGNVTALGYLIHQQGRVSASTSVSLNGTVRLLAREGAAIERDSNGTLHLVPQTTRRAS
                     DLGDGLGLQATVELDAGSTTRVDLDASKGKAVDEQAQTPSRVEIAGGKIVMAAGSALV
                     AHGGQVDFTASAHPAHPLLATTADNPSRIVLEPGSRIDVSGSRKTVLPMSRNVVSVEL
                     RDNELRDSPLQKDGILHGQTVQVDIRKGTPLADISGAIARIRRSVQERNANGGTVNLD
                     SEGDVLFGQGAVVDVSGGAVRYLDGWLKTTQLVSGDQVYDISQADPNRHYDALLGRFS
                     LLHPRWNITQTWDLPGPVGQGRFEQGYTEGRSAGTLDIQARDLSLDGTVKADTVADRY
                     QREMSERPAGGTLSIDLAWSGQRQQAVEFRNLGAPLKLSASAPVPGFGADGTPPTLVL
                     GNELFRGGVQKLKLSSGGRIAIAPGTDLELPAAGSLDLDGGAVSVEGNISAPSGSIAL
                     ATQQIAGAAETLSGDLQLGAAARLDTSGLWVNDQPGNRQTLDPVALPIAGGSIALHAV
                     GGLDLAEGSRISADGGAWLAKNGKVTAGAGGSIALGVAGNTPTALTLGASLSAHGLSE
                     GGSLAITANAIRVGADPAPAEAAATLLNLAPDTLAHGGFGHIALTANGGDLSIAPGTA
                     LDLRLETWELDRAYPAQATGTPLAGFSHAVLQSEAFRAPVDLTLTLDHDAKVGAYDPQ
                     HSLSLGTGASIATDPGGKIALVSDTGIRIDGTLSAPAGTIQLTINPIGATLDRGYDPD
                     QAIRLGPDARLLAQGAVVAQPNNAGLALGQVEAGGTVALTANRGYVLMDRDAVIDVSG
                     TAAPLDIPKDNQGGYARRWIGSDGGDIALTAAEGIVADGEFSAQAGAAPGASGGSLGL
                     TLDARSRGFATDNLPADALPIPTGERTLHLADTATARLAAGAALDGGIPASLDGQAYL
                     GTDQVERGGFASLALKVAVAAPGTPGFHAEFPKQGRLQFEGDVSLKLAKSLTLDSPIL
                     AWNRGQPGDTGTVDLSAHSATLGSSLNRTGAYGTRSGDGRLNLEADWIDLTGSTELQG
                     FQQAGLHSRNDIRLIGLNPNAEGDLLGQFAAAGEIDLAARQIYPSTLSQFTLQIDPEQ
                     NPDGLIRILPGDAQAKAPLSAGGQLSLAAARIDSQGVLRAPLGQIKLSAGQSLDLAAG
                     SLTSVSAQGLVIPFGRTQGGLDWIFPLGADDRVISSPPAKSIQLKGQAVRVARGAKLD
                     LSGGGDLQAFEFIQGPGGSTDQLDPNDPGYTDGSFTYQEKYAILPQLGSAYAPYDPIE
                     FQASGLKLGDSIYLGAGSGLPAGRYVLLPAHYALLPGAFLVTPQTGTTDLPMGSHYTR
                     LDGSTVVAGYRYTADTGFRDARTSGYTVEPGRIARTRSEYEVHRANAFYPQRAQDRDQ
                     TTPRLPLDAGGLSVTADQSLQLAGTLSANAVGGGRGGRVDIAASRLSIVPTEASADSV
                     DDGSVALAADDLNRLNVESLLLGGNRSGGDDGATRLKLTAQSVTVAPGTSLQGQEIIL
                     AAQDRVEIGAGATLQAQGKAVAGDGVWQIGAADGTYTGSALVRLSTGPQIDLKTDPLA
                     DAAHTGSLAVDAGAVLSATGSMGLYGTVDNQLQGSLKMDGGSLALGAERISLGSAPAA
                     TPGLILGDALLNSLKVDELRLTTSGSLDVYGDATVNAQSLVVESAGLRGWGAAGQTAR
                     ITADQVSFTNPDGAAATDPGTGLGDLAVTAQHIQIGSGDQAWNGFRTVSLAASDAFLA
                     AGDAAWRVDSDLSMAIGKFAALAGAHLALDAGTHRVTLNPLAGGKPASVAEGLGARLD
                     IQAGSISVATPIVLPAGSLNLAASGDIALNSGALLDAGGRAVTLGGKTLYAPGGSVAL
                     SSTAGNIDLAAGARITVAADAGGGDAGSLKFSAGQGRVNLNGGLSAQAGQAGAGGSFS
                     LDALNLGLAHFSALNIQLQAAGFNESLSLRLRQGDIAIAQGDTVRAHSLNLTADNGTI
                     TLSGSLDARGDQGGAVALNAGQTVLLTRTARIEASATASDGDGGTVVLDALGDGSRAS
                     GVQIEAGANIDVAAGGSGQGGTVRVRAGRVGADDAAVAIAPGTVGGAATLEVEAVRVY
                     RDIPLTNANIAAWYADTSAYMDAAANNPDLQTRLGGFQLTPGLDIQASGDLNLDLGGS
                     LAGHTWTATGTANVWTTRLDDIAGPVGGLTQIGSDGTARTLAAGASSLLSSDGSYYFD
                     ADPASPTFRQLFVRVFPSGGGNRYDPGQIKGDLVEANGWDFSFPDSQGNAWRFGPDQV
                     PGYLTLRAAGGLTIGQNLSDGFVTYNAQSLANFFQIDGTAPNWLDTLMPQTGFSWSYR
                     LAAGADLGSADPAATTGAAYDLVIGAGASVRTGTGDISATASGDIRLTDSRSTIYTAG
                     RPTDAQRYGSFGFDLTRKAFYAEYPVDGGDLSLSAQGDIIGAATSQFMSDWLVRTGGW
                     NPDDGIDAKDRPTAWGIAFDNLVVAGSADAETQNLKSGFRQNLGALGGGDITVQAGGT
                     VRDLSAMLPTTAKPTGPVGDDGQITQNTQRVRGGGDLRVVAGGDIAGGVFYVEQGTAQ
                     LTAQGAVTGGSQYTAGPVFALGDARFEVRAAQGIAVGAALNPFTLTASAYTDKTAYFS
                     TYSARSSLNLQSSAGTVALNNDASVIQQNYLLYDATTPNGRPVLSDIDAARMLTLYPG
                     SLQAYALGGGLVVGHSFDLFPAAQGDLEWLADGDIHFDQGEQVFINQSDTDPALLLPV
                     SAPQASLNEASKRLDIFNLANTDFLHAAVPVHQDDPDPVLIASEHGDIVSDHASLLVT
                     AEPATISAGRDIVGLGLELQNLRANDISEIRAGRDIRFPILRDPVTGDLDSGLDGLPI
                     SAAGPGQLQVLAGRDLDLGTSAGITTLGNLTNPALPAGGASIAAWAGLGRAPDYQAFI
                     QTYLQGRYAGPLTLYMRALLGDPNLDTTTALARFQALPAVRQRELILAVLFRELKAAG
                     IAAARTTDPARRAAAYRRGGQAIATLLPGQDYQGDMKLFFSKIQTLDGGDIQLMAPGG
                     LIDVGLATAFSGNKTAADLGIVAQRSGRIEALSEGDLQVNQSRVFTLGGGDITLWSEA
                     GNIDAGRGAKAALSAPAPTYSFDAKGNLVVVFPAAVSGSGIRAQSGSTGTDIGADDTA
                     ASPLTGIFGDSARAARFGDVTLVAPRGVVNAGEAGIGGKNVAIAATAIIGVSNIQVTG
                     NLTGAPPPPPSLAAVLTGANTLAAGANTAAQSALDENLAATRAQVQTPATGPTGPVQQ
                     SSLHAQVVGFGQCSLGDIRRGSDGCR"
     CDS             298104..298919
                     /codon_start=1
                     /gene="modE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204316.1"
                     /locus_tag="MishRS11D_02390"
                     /product="ModE family transcriptional regulator"
                     /protein_id="BBL73141.1"
                     /transl_table=11
                     /translation="MSHPVPESTLPALVQGELTLIGGLNERLFRLLAAIASTGSITQA
                     ARAIGMSYKGAWELIDRANNLSPELLVDSSPGGRAGGGTRLTPAGQELLNLFQRLQEE
                     HRTFLDRLNRELAANPNFRFLHRRFGMKSSARNQLFGNVKRVVPGAVNAEAIIALKGG
                     DELVAAVTHKSVEALGIEAGREVVALVKAPQVIVVKDFGGYRLSARNQLAGVVERVQR
                     GAVSAEVVIKLAGGDALAASITNDSVDQLDIKEGEAATAVFKAGAVILGVAER"
     CDS             complement(298974..300662)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02400"
                     /product="hypothetical protein"
                     /protein_id="BBL73142.1"
                     /transl_table=11
                     /translation="MLALWLAVPALAADEIKPLEPIDTSSPRTTLRGFLEFMEEAYAK
                     GDGLVNDYLASSRLYLSPAEVAIIAKARYDLLSAERALDLSQVPPAMLDEAGRRLTLQ
                     LKEVLDRIELPPWEAIPDAQAMAAAEFKRWTIPGTEIRLVRMETGPRAGEYLFGPETV
                     QRIPDFYAKVKQLPYRSGIHGGLYDFVYYRPTGVVLALRAIVPPRWILGVPGWAMASF
                     LDQPVWRWIGIVGVFGFGFALAVLSFRLSQRWVGRTGAAERWTELLRPLSLVLIIPVA
                     VLVLTQMLRISGEVNAVLTLSLWSVFYLALTWLVWVAGGALAESLIESERLITSSIDS
                     QLIRLVLRLVTLVLAVVILVVGGDRVGVPAYSVVAGLGVGGLAVALAAQQTLANLLGS
                     FIIMFEKPFAIGHWIKVGDIEGVVENVGFRSTRIRTFYDSLVSIPSSELVNSTVDNME
                     LRQYRQVKTTLGLTYDTPPAKLGAFVAGVELILRADPDTRKDNIQVAFNDFGASSLDI
                     LLNFLIRVSSRREELAVRQRILLEILQLAETSGVGFAFPTQTLHIESLPQGKLA"
     CDS             complement(300800..301789)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011086271.1"
                     /locus_tag="MishRS11D_02410"
                     /product="hypothetical protein"
                     /protein_id="BBL73143.1"
                     /transl_table=11
                     /translation="MIPPMIPAHSSTNTLSEDHAMHRKLRTALFATLALIPLAAHPAP
                     DSPAVPSFPTPDAAAQSLLQAARSSDPKGLDALFGAEGAALLSSGDPAEDQRNREAFV
                     AKATARLATEAAGPDQATLYAGEDHWPFPIPLVKTADGWRFDAVQGREEIINRRIGRN
                     ELYALGVVSAYVEAQFEYANSDHDSETVAEYAQKLASAPGQHDGLFWEEEPGRPPSPM
                     GPLVAEARAEGYGKGAGQSVPYHGYYYRILTRQGPDAPGGKYDYIINGNMIAGFGLVA
                     FPAEYGQSGVMSFIVNHQGKIYQKDLGPKTAELAQAIKEYNPGPGWELVATGE"
     CDS             complement(301789..303747)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02420"
                     /product="hypothetical protein"
                     /protein_id="BBL73144.1"
                     /transl_table=11
                     /translation="MTASKPSIGDRSDLYRAMLIALALSPTGCGGEDRTAGAKPPAQT
                     PPAQAAANPPPAAAQPVAAPTQPPPPAAPVQALSDLESLVAPIALYPDPLLAEMLVAA
                     TYPLEVVQAARWLEAKPNPASLKDKTWDASIQRLVEVPQVLKMMNDHLDWTTRLGDTF
                     LAQPEALMNAVQDLRRRARAAGFLKDTPEQKVTVKTEAAGPAAAPAAGTPQAQPAVVK
                     KEVVYIEPAKPDTLYVPQYNPQQAYSAPLAPPPVSAAAPATVVNNYYPSAVPATTTTT
                     TTTASSADPWLTFGAGALVGGLLTWGIMEWSHNDDYWHGGYYGGYYPPVSHYYGGTVC
                     RNGTCWNSGGGYDRGNVNYNKNVNISGNEINIDRSRSISQDQLANWKQEREGWTPDAR
                     HRRGQQYPAAARERWGDIQQPGLAGDRLGAAQTLPANVRGFGQGATRPASLPAGQRPS
                     VEQVRQRLGQDTQLEQKFGAKPAQPNRPAAVVDIPKRLDQGNRPNAWEGLADTGNGRQ
                     TRAEERRGAASREKTQTKAGERPRREQAERQPTQATAGPARNKLQERRAEPAQRPAQG
                     PAGQRDFSQFRDNQKRAEAARPNAFEGARDNARMQDFSKRGAASRQNLAAAGGGAQGG
                     GGRNFQGGGGGGGRFQGGGEGGGLKGRR"
     CDS             complement(303931..304803)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004522262.1"
                     /locus_tag="MishRS11D_02430"
                     /product="hypothetical protein"
                     /protein_id="BBL73145.1"
                     /transl_table=11
                     /translation="MTPSLIRECPIDTWETAPDGQNWTECLETGQVLYLPRLAFAVGE
                     AERRFLAEGWTDGKAKNISLRGTELRGAVGAPDAVAALQTMLARFSDGAERLVHGLFP
                     GYRPYLRRGFASYRTVRAEGRATSWRKDDSRLHVDSFPSNPTGGKRLLRVFANINPEG
                     KPRVWRVGEPFEPYARKFLPLTRRPWPGSAWALERLGLTKSRRSEYDHLMGQLHDLGK
                     ADLDYQAQVPQETFAFPPGSAWIVYSDQVLHAVLSGQFMLEQTFYLDVEHQARPETAP
                     LKVLERLTGRRLVS"
     CDS             complement(304915..305643)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WGI7"
                     /locus_tag="MishRS11D_02440"
                     /product="cytokinin riboside 5'-monophosphate
                     phosphoribohydrolase"
                     /protein_id="BBL73146.1"
                     /transl_table=11
                     /translation="MTHTLPPCADPGRSLSLLGKVEGAEKLLLSGPRDRAADLESAVT
                     FFLEFLRGFESFDLEAPCVTVFGSARFPEEHPYYALARATGRALAEAGYAVMTGGGPG
                     IMEAANRGAKEAGGLSIGCNIKLPREQQPNAYLDKFIEFEHFFIRKLMLVKYSRAFVI
                     LPGGFGTLDEAFEVITLIQTGKLEAFPVVFMAREFWGGLGDFARDILLGHGCVDAEET
                     YFLHGVDYPEDTVRIIRAAEAALG"
     CDS             complement(305861..306385)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141342.1"
                     /locus_tag="MishRS11D_02450"
                     /product="NAD(P)H oxidoreductase"
                     /protein_id="BBL73147.1"
                     /transl_table=11
                     /translation="MTILIQFIHPYPERSRANHAVLDALRDLPGARVNDLYALYPNFY
                     IDIQREQALLMEADVVLFQHPFYWYGCPALLKEWIDVVLEQDFAYGAKGLALRGKRWL
                     HSVTTGMPATAYAPDGINGIAVADLLKPFELTARFCGMTWLEPMVFHGAYAADEAQMA
                     RHGRALRRRLETLA"
     CDS             complement(306508..307257)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010938322.1"
                     /locus_tag="MishRS11D_02460"
                     /product="rhomboid family intramembrane serine protease"
                     /protein_id="BBL73148.1"
                     /transl_table=11
                     /translation="MFPLRDENPTLGRPLALLLIIGLNIFSWVFIQGLGADEPLARSL
                     CELGLIPGDLLGRVPPGTVIPLNEHLGCELEDEGSLPTLFTHMFLHGGWFHLIGNLWF
                     LWVFGDNIEDCMGPLRFVVFYLLCGLAAAAAQILSDPATTAPMVGASGAIGGVMGAYA
                     RLYPHARIHTLIFLGFFFTTVSVPAIGMLGYWFILQLAGGMPGLHGAGGGVAFWAHVG
                     GFLAGLVLVGPMQRPGYLAEHRRRFFGGYRW"
     CDS             307500..307691
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02470"
                     /product="hypothetical protein"
                     /protein_id="BBL73149.1"
                     /transl_table=11
                     /translation="MDFQNPAEWAIRAAVATMDGRCLPKRGFAAHWSGKDREILAGTA
                     ANRPWKSPLDLGLASAGGF"
     CDS             308090..311542
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02480"
                     /product="hypothetical protein"
                     /protein_id="BBL73150.1"
                     /transl_table=11
                     /translation="MIGVFGWVFYRHERLQHRTIQENQLAAIADFKRQQIEAWLGERR
                     RAAMTWRKGSIFGEVVVQWLAGNGKDRSQERQIEKRLWTIKEFLGYTSVALLDGEGRV
                     RLRVGAEPALSPQFVELSRMAMASGQVQFSDLYRMVKGAGSEVNMDFIAPLSGLDSER
                     PAAVLAFTTSANEFLFPLIQSWPLPSGSAETVLVRREAGSVLFLNALRHHRDAAFNLS
                     FPLSNQALLAVRAVEGQQGIATGQDYRGVRVLASITGIAGTPWRLIAKVDVGEIDAPA
                     RRDAAIVTGTCLALMLAAGTATALAWRRRRYALESAYQEERAKRAILSMRLDDLARDA
                     TDIILLTDGDGNIRDANQRAIDAYGQSHEALCGLSLLDLVPPELRAAAKAEWNKAVDQ
                     GQARFETLHRSWQGGDFPVEVNTHRIGYGDVLLMQSVIRDISERRRVEAEIRRLSELG
                     RVLSRCNPCVLSQVGPDGFLGETCRLVVRHGGFAMACAYGGMGRNGEPMLLAYFGNHP
                     GALPVAQTHRGTVREVADEVRCARDGGPAWFPDARGLVFRLPWLGETPLTGFGCYAAV
                     PIAGEPGLAGALLLFGGQPEPFSQHVEPFLERLAENTTRGLELLAQREALRSSRDRLG
                     AMLDNIDGVVWSLDPYTFDLVYTNPSIARMTGYAAEVMLAQPGLWRDMLLPGDRIRLM
                     DDLNQAKLTGALGGDYQIMRLDGHRRWVNIQGRMVFDANGRPQRLDGIAFDITERRLN
                     EIANEAIQLISAVFLKHRQASEPYRQVAELLAQRLEFPMVCIDLYNPLTERMESLGCS
                     VPQAVGESITATVSARGTSWYETDLARNGGDPGCEGLRQLGGRSFIAMPLWIGNEPLG
                     GLLLADTAPRPDIGSWQIYLCLIASRLAMEMDRRRRTRGLDRQAQEFRQLLDSLFIYA
                     GILTPEGMVIDINRTALETVGLRLEDVQGRPFEDTPWWSASEASQQRLREALTEAAQG
                     RTVRYDTQIQYRPGDCATIDFGITPIFDAEGQVTYLVPSALDISERCRVQEEARRQGA
                     WLRAGIDRVPIGLMIVDPRSGHLQKANQTLCQFLGYREEALLGMAWLDLLMPLDHETH
                     RQGIESLLRGAVEAYTAREHYRHCNGDALPFLVEIRYGRYADADLDALMATLVPSAME
                     GPPP"
     CDS             311539..313074
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02490"
                     /product="hypothetical protein"
                     /protein_id="BBL73151.1"
                     /transl_table=11
                     /translation="MKPMFLPCCVTVLAALFGGPVQAAPVDVILALDHSGSMKRTDPN
                     RDSVQGVELFADLLGKDDRLEFMGFAGRAETLLPLTAGSGPAVRERLSRLAQALPMNG
                     QRTDFGEALRLAYEDLIVAAAPPDTRRMVVIFSDGQLDLGDAAANNTAQALILALLPE
                     FRAVGIKVYCVAFSAEADLAFLGRIAEATGGRALRAERVADIYKAFIRLFEETDQPLS
                     VPVRDGRVAVDKEVRELKLLVERDSERERIRLVDPSGKEFDGQDKALGLEWRHHGPFD
                     RITVPRPAVGTWRMLGASGEKKAYLDSDLDLGMEVHPPIRVGRPVEITVRLSYRGQPV
                     SDQRLLEGLKVEVTGHGETGMSLEPLAWLPDARTGRPGEFHGLLRFAAEGGYRLAALA
                     ENPVFQRRREMSVTVLAAEPAAIPPAAAAPREEGPSPPAPVPAASAPVPGPPPPTAGN
                     PSLGGLGWIVALNLILVALVGGGVWFWKYRSGRDKQQTLALRAARKSTEHGVPPRRPG
                     PMP"
     CDS             313071..313973
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02500"
                     /product="hypothetical protein"
                     /protein_id="BBL73152.1"
                     /transl_table=11
                     /translation="MNQNDYVWIYILAEALLVSLGLMGFFGYRWWRLRSERRLLIQIC
                     GQVAEHLAESIEAVQKDPLRYPEFRQAEAACLSALLPPFADLRLADVGAWDDIFANIH
                     ALFDLLARRLTALSAEAHQGAGKPTDDDMERADTQEWDAAFAEFLSQHNQGLTLLAAT
                     RDVTADIKRKCEDVRQAHHNLRVNLESVAKMDRGGQLQPLLADIEKSNFELQQLAFSL
                     ERAQGHMAPQLEALGQQVRNLQLTVQNYRKSLPKIVRERDRLAEEKGDLAKQLEAKVK
                     LVDRLNRNYETLRREYTKLYQATR"
     CDS             313997..314782
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011250556.1"
                     /locus_tag="MishRS11D_02510"
                     /product="CDP-abequose synthase"
                     /protein_id="BBL73153.1"
                     /transl_table=11
                     /translation="MNRIDLLDYAHSKPAFDIPTCLFQDGHHAIYWLGIEQDTAFRCN
                     VYLIEDGGEGYLVDPGGRPGFSQIKRRVEQIMPTGRIKGMVLCHQDPDVAASMVDWLD
                     LHPDIKVYSSTRTHALLPHYGKPKYPAVDIVEKPVLEFSSGARLRFIEAPFLHFPGAF
                     ASYDTASGFLFSGDIWAAVGMDWTLVSDDFNTLSFKMEMFHTDYMAGNKASRGFTRKL
                     REVDIMAILPQHGSIIPRAHVAEAIDYLNDLPCGLDLLYLSGQ"
     CDS             complement(314881..316242)
                     /codon_start=1
                     /gene="gcvPA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83B08"
                     /locus_tag="MishRS11D_02520"
                     /product="putative glycine dehydrogenase
                     (decarboxylating) subunit 1"
                     /protein_id="BBL73154.1"
                     /transl_table=11
                     /translation="MPFIPHTQADIQAMLAALDVHAIDDLFDEIPASLRADIDPAPTP
                     GLKEMEIARLMRERARLNRPLLCFAGGGAYEHHIPAAVWTVAGRGEFYSAYTPYQAEA
                     SQGTLQTLYEYQSMMAGLTGMEVANASLYDAASGLAEAVLMAVRANRESQSRRVLVPR
                     SLPPVYRAVLASIVQAQALELIELPYDPATGCTDLAGLDAHAAGDIAAVVIPQPNGFG
                     GLEPVDALTDWAKSHRALAVALVNPTALGLLKPPGEWGAAGADIACGNGQPLGIPLAG
                     GGPYFGFLCCRKALVHSMPGRLVGRTMDLDGKPGFTLTLQAREQHIRRGRATSNICTN
                     QGLMVTAATIYLALLGPEGLKQVALACHHQTRALLATLTGIAGVERVFAGPCFHEAVY
                     RTPLPAATVLEGLAERGILGGVDLSGAYPELGAAILTCATELRTEADIAAYAEALRAV
                     LAD"
     CDS             complement(316276..316662)
                     /codon_start=1
                     /gene="gcvH2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HTX6"
                     /locus_tag="MishRS11D_02530"
                     /product="glycine cleavage system H protein 2"
                     /protein_id="BBL73155.1"
                     /transl_table=11
                     /translation="MSHFPDDLKYANTHEWAKLEDGDTVRVGISDFAQSELGDVVFVE
                     LPVVGRKVKAGEAVAVVESVKAASDIFSPVSGEIVATNPALADTPETLNEDAYAAWLF
                     VVQADATAELDQLLSAAAYQEAVEPG"
     CDS             complement(316797..317720)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010943285.1"
                     /locus_tag="MishRS11D_02540"
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="BBL73156.1"
                     /transl_table=11
                     /translation="MLCLYPRPPPAMTATEPHRPPIFIVGCGDIGQRVARLELAAGNL
                     VAALARSEASARTLAALGIRPIQGDLDHPATLTQLPAALATLYYFAPPPPTGGDDPRL
                     RALLAALPAPPERVVYISTSGVYGDCQGAWIDEDAPLQPRTDRARRRLAAESALLAWS
                     GRQGVPCVILRVPGIYGPGRLPVERIRQGIPVVHPAEAPYSNRIHADDLAAGCCAAAR
                     KGRPGTAYHLSDGHPTTMTDYFQRVADALGLPRPPLVGLAEARRTFSPAMLSFLEESK
                     RLDNRRMLEELGVVLRYPDLASGLPACLGEE"
     CDS             317849..318583
                     /codon_start=1
                     /gene="minC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZW11"
                     /locus_tag="MishRS11D_02550"
                     /product="putative septum site-determining protein MinC"
                     /protein_id="BBL73157.1"
                     /transl_table=11
                     /translation="MAAKNPDPQQPSAALDIRAGAITLPILKLFTADLIAVNVQLEEK
                     LRRAPEFFRYAPVVLDLAELDPDREKIDFPALLKLLRKLDLMPAGVRGGNPAQHSAAQ
                     AAHLAVLADGKDIAPQAAAPRPAAKSPEPPPKAQPATKLVEQPVRSGQRVYAQGGDLI
                     VRAQISAGAEIIADGNIHIYGRLKGRALAGVQGNPEARIFCADLQAELVGIGTQYKIS
                     ENIDPALWGKPAHIHLVDNALVIDPL"
     CDS             318595..319428
                     /codon_start=1
                     /gene="minD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KK56"
                     /locus_tag="MishRS11D_02560"
                     /product="site-determining protein"
                     /protein_id="BBL73158.1"
                     /transl_table=11
                     /translation="MESGELGVARIIVVTSGKGGVGKTTTSAALSMGLALKGHRTAVI
                     DFDIGLRNLDLIMGCERRVVYDFVNVINQEASLNQALIRDKRCENLYILPASQTRDKD
                     ALTQDGVERVLNELSETFEYVVCDSPAGIERGAYLSMYFADDAIVVTNPEVSSVRDSD
                     RMLGILASKSRRAELGQEPIKEYLLLSRYSPQRVKLGEMLSVEDVQEILSLHLLGVIP
                     ESKAVLNASNSGTPVILDEKSDAGQAYSDVVRRYLGEHVPHRFVEEEKKGLFGRLFGG
                     G"
     CDS             319431..319727
                     /codon_start=1
                     /gene="minE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HYZ5"
                     /locus_tag="MishRS11D_02570"
                     /product="cell division topological specificity factor"
                     /protein_id="BBL73159.1"
                     /transl_table=11
                     /translation="MGLLDYFRSSKPTSAAIAKERLQILVAHERSQRNRPDYLADLQR
                     DLLEVIRKYVNVDQDAITVTMEQDDSREILELNIILPEEAEQKRTPPRPQGKFP"
     CDS             319893..321581
                     /codon_start=1
                     /gene="aarF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P9X3"
                     /locus_tag="MishRS11D_02580"
                     /product="putative protein kinase UbiB"
                     /protein_id="BBL73160.1"
                     /transl_table=11
                     /translation="MILETLSAMRDLGRLHDLASILIRYGFGDVVRRLGMEPVLERAG
                     RALHWTRFEELLHLDPPQRVRKAMEDMGPTFIKFGQILSTRVDLFTPEWIAEFEKLHD
                     RVPPLPFEALRPQLEEDLGAALSEVFAQIDPNPLGTASIAQVHRAVLPDGQQVIVKIR
                     RPGIRPTIEADLRLLERLVVIIEREFADARRFHPQEILRQFKLSLRNELDLLTEARNT
                     ERAANNFAGDAQIVVPKVFWEYCGERVNVQEYIDGIPGRSLQTQHIAGFDRKLVAQRG
                     ADAVLKMVLIDGFFHADPHPGNFIYLSGNRLAFIDFGMVGSLAEVRRAQVVDLLNAIV
                     VRDAPAMVDVLLDWTDEGNPSTERLISEVGMFIDKYHGVALRQLRLGDILGDMTALMR
                     EHRLTLPPDLTMLFKALITLEGMGRQIDPDFDIVSQVAPRLSQAMLERHKPEVLMRHA
                     QRNLSSVLALLGSLPADIRRVMRLLRAGAVKVNVDMPELAHFGGLMDRAASRLTVGMV
                     TASLIIGSSIVMTVNGGPLLFGLPALGVLGFTAAGVGGVWLLASMWRTSHGDER"
     CDS             321565..322461
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003812407.1"
                     /locus_tag="MishRS11D_02590"
                     /product="phosphatase"
                     /protein_id="BBL73161.1"
                     /transl_table=11
                     /translation="MAMSARCRPEAVNLDRAMPRHDLHTHSTASDGAYAPAELVRQAA
                     LAGIEVLALTDHDSTAGVAEARSAAAGLAIRIVPAVEVSVTWQNKTLHIVGLNIDPEH
                     PALQAGLARLRAIRDERAVEIGRRLAKHGIPGVFEAVSALAGTGMVTRTHFAQYLAGQ
                     GLAGDAGDAFKRYLGHGKPGYVATQWADLAEAIGWVRAAGGIAVVAHPRRYQLTGSWL
                     RRLLTEFKAMGGEGIEVASGVAVPNDVQASADLARRFGLLASVGSDFHSPDHHWLKLG
                     RLPPLPAGLVPVWSRWPAGPDS"
     CDS             322482..323051
                     /codon_start=1
                     /gene="tag"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010941230.1"
                     /locus_tag="MishRS11D_02600"
                     /product="DNA-3-methyladenine glycosylase"
                     /protein_id="BBL73162.1"
                     /transl_table=11
                     /translation="MPRCPWAERSPLEQQYHDLEWGSPLHDDRRLFEFLILEGAQAGL
                     SWVTILRKREAYRAAFDQFDAERMARYDELKKAELLADAGIVRNRLKIESAIGNARAY
                     LAVREQFGSFDAYLWRFVDGRPRRNAFQDMAEIPTRSPESDAMSRDMKRRGFRFVGTT
                     ICYAFMQAVGMVNDHRVDCFRWRELDGGG"
     CDS             323145..323975
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704890.1"
                     /locus_tag="MishRS11D_02610"
                     /product="lytic transglycosylase"
                     /protein_id="BBL73163.1"
                     /transl_table=11
                     /translation="MALFRYVLLGGLLAGSASAQAQDFIQQAAGLRARAALYEHGRGV
                     GQDYAEAYRLYCKAALLGDSMAAYNLGWMYFNGRGLPRKAELAVGWFKRAAKAGDAYA
                     ARMVAHYGAVQAAEDPACQPEPPPPVVTATLKRKNPHRGVVADWVERIAPVYSIDPEL
                     VMAVIQAESGFNPAALSPKNAQGLMQLIPATAERFGVKDIWDPEQNIRGGTAYLHWLL
                     RHFSGKVEWALAAYNAGERTVEQYQGVPPYKETQSYVKRILASYQKTTHPIPPPLGKS
                     "
     CDS             complement(324033..325100)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388356.1"
                     /locus_tag="MishRS11D_02620"
                     /product="phosphate ABC transporter substrate-binding
                     protein"
                     /protein_id="BBL73164.1"
                     /transl_table=11
                     /translation="MNNKLLIASALAAGLALTQGADAAEAGRDYISIVGSSTVYPFAT
                     VVAEQFGKGGKFKTPKVEATGTGGGIKLFCGGVGVQYPDIANASRAMKKTEFETCQKA
                     GVKDIVEVKIGYDGIVAAQSKKSKDKLVELTRKELYLALAKRVPDPAKPDGDALVENP
                     YKTWNEINPKLPKTKIEVLGPPPTSGTRDAFAELALEGGCAQIPWIKAKKETDDAWFK
                     NVCMTVREDGAYIEAGENDNLIVQKLEANPTAVGVFGYSFLDQNSDKLLAAPVDGVAP
                     SYEHIASGKYAISRPLFFYVKKAHAGMIPGIEAYVTEFTSEKAFGEEGYLADKGLIPL
                     PEAERKHVAAAAKKMTPMTMK"
     CDS             complement(325191..326771)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02630"
                     /product="hypothetical protein"
                     /protein_id="BBL73165.1"
                     /transl_table=11
                     /translation="MGTAAAADTELLDVLLKNGTITKEQYHALGQKGAAQNSPDLLEI
                     LQKNGAITKDQYSNLSKKQSATAAAPAKAEDKDAAHVKLGEKGLEIESNDGNFKAKIG
                     GRIQVDTQVNFNDNHNGQADHANTDLDNGVGFRRLRLYTEGIMWKDYEYRFEYDWARN
                     GGGVNGITDAYLKYLHFKPFTITIGQMNEGKSMESVMSNNYLTFIERSLPNNAFIESG
                     PNSKYQVGIMAETFEKAFNMPWTLRGGITTESVGAPAPGNSSNNTSAGNTNRNGFSGN
                     TSYQLVGRGTLAPLYSKEDGYVLHTGVWGSWRSVNNNYNADGTYRNGGWQYLSQPDTD
                     IDRTAWINTGNLTKGNKDAPGSFRADEVAMFGAELAGSYGPVHMEAEYMQAQIAGQGY
                     SNQDLLQGFYVQGGWFLTGENRPYDEKKGTWNRVIPHSNFLFGDGWGAWEIAARYDTM
                     DMNTKHINGGSINAGTLGVNWYLTPKVRFMTNWVHIFGTQTGSAGKCTTSATGNDTIG
                     CFNGLSPDIWETAVRLDF"
     CDS             complement(327104..328201)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02640"
                     /product="hypothetical protein"
                     /protein_id="BBL73166.1"
                     /transl_table=11
                     /translation="MQKRNKPRDQDGIYQRPDSPYWWAAWKIGSRTARRSTGIKVADD
                     PRGHEAKRIRAGFIAQTPLPTPQELPTTTHTFAEMINRYLDGPGSKHTPGTRRNQGGM
                     LRAGLFDAFKTTPLTEINGAAVDAFIQQRRAAGTADATIRNQIAFMSSVTNWAIERLE
                     WAIPNPWRSRKPAPNAPRDRWLTPEEIGQLIAAAEAYGRAHPRKAYLPDYIRLCLNAG
                     LRREEALRLTWDRVDLDNGVLHLGRADQKNRKVGAVPLNRTARLALANRKAERQPDNR
                     VFPHTDPYQDLQRAIRHAGLEMPHTTVHDLRRTCGSILAQNGVDIHRIARILRHADVT
                     TTYRTYAFLAQEDLADAAAVLDQPPKLRVVK"
     CDS             complement(328374..328592)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02650"
                     /product="hypothetical protein"
                     /protein_id="BBL73167.1"
                     /transl_table=11
                     /translation="MNSEPFMTCTCGAQTPLSAMPRHLPTDHFECGQCRTLLIRRHAR
                     PTVYPSGFVLPGKVSVERVEFGLLGDVA"
     CDS             complement(328589..329464)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02660"
                     /product="hypothetical protein"
                     /protein_id="BBL73168.1"
                     /transl_table=11
                     /translation="MAGKTLYTAGYGAGWTPETLDAAMIERGAVLVDIRRLPWSTQST
                     EWTRGRLLARFGKMRYAHFKSLGNLNRKGDPIALVDADNGIRSLAAILDWPGIDAMVL
                     LCGCRDVRTCHRKVVAELAAERLGDRFALRIEHLEPPVSASPGWKCLSIRQPWAWAIL
                     HGGKDIENRSWKTDYRGPVLIHAAKTLTQAEYTGACLDIGIMAPRLDVPRHEDLERGG
                     IVGAARIVDCVDRSESPWFGGGFGFVLADPRPLPFLPLTGRLGLFDVSEADLAPIAAA
                     LVRANYREIELERMA"
     CDS             complement(329468..330739)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02670"
                     /product="hypothetical protein"
                     /protein_id="BBL73169.1"
                     /transl_table=11
                     /translation="MSDLIKTLSTGSPLQEPFHQALETASLDQLREALQAKGIKAANR
                     KAIEARIPIKEMREIEARHIEQAGIFQPSNGTEGDSFMSAFCFRCGQWGAKGCDIQAR
                     TMAFGPEDPEYPREWTYDGQGDPTCTAFVAAVAGQPVRIFAPKGDGFDAFVADWCGSC
                     SRYRGDRCPIYRAAAAREASDPEYPKEWRYDGNRPVCTAHEPAQDGQGAAPAPGTSEP
                     KPPPEPAPAAPQGLPTPEQLVRETLHAIRNNLQALTDLGWTQGDIANALADMMPGGSK
                     VEALRRIDRLDSGERFPASVLLGELIAAATQQLRLAMVPWNATPEDQQKDVLGRVRQD
                     CEKAARSALRTYASENRTNFMASVDGVAFKSNGIKVSLTVGKNEYAHLLADRAGDEVL
                     IVLPENFDMYSGTGSAMRTDPDQRELFGAEA"
     CDS             complement(330798..331115)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02680"
                     /product="hypothetical protein"
                     /protein_id="BBL73170.1"
                     /transl_table=11
                     /translation="MPKHTTPAQRAEFSLDSVAATAALQLRNGTLPKTPEPCFIGLAE
                     LLKAALIGHAHAIPADAMAELASIHTLAFVYAIHSGEIAVEFAQITPEQADLLKTPTI
                     HRA"
     CDS             complement(331127..331732)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02690"
                     /product="hypothetical protein"
                     /protein_id="BBL73171.1"
                     /transl_table=11
                     /translation="MNPTAKTSVSALEAFRRFQNELLTQEALVARLTTPFREDSENVR
                     IQKGIDLHKYIETGNPRTMQLAWDRDSVDAAIEESDLVGEHELWISGPLGDTHVHAKA
                     DLVNGLEIRDFKATGLPFKADDYEASYQWRLYLALTGCERFVYRVFEVPDDLPYRVVE
                     SHTFPLYPYPALLDDCLALVGDFRLWARGVPEIQARIAPPI"
     CDS             complement(331729..332181)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02700"
                     /product="hypothetical protein"
                     /protein_id="BBL73172.1"
                     /transl_table=11
                     /translation="MNAPAKKTPWNPSRTATARVSNPLPVPERCPYCGGPVGIVNHRE
                     IYGREYGDWPWAYLCRPCDAHVGMHPFTHIPLGTLADRETREARKSAKAPFEALHRSR
                     LMDRDAAYRLLAERLGIPQAECHFGWFDAALCARAKQAAESILREYRP"
     CDS             complement(332178..332468)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02710"
                     /product="hypothetical protein"
                     /protein_id="BBL73173.1"
                     /transl_table=11
                     /translation="MNVQAVIETLNQAIADTAAELGCEPDNEAILRAIAKLRADRDAL
                     LEALEKVILEIGDWAMPKGENGMVAVRPNHPLCLAANMARAALAQARREETP"
     CDS             complement(332465..333406)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02720"
                     /product="hypothetical protein"
                     /protein_id="BBL73174.1"
                     /transl_table=11
                     /translation="MALKRITKAAEPLAVLTAIVCLYGQPGAGKTSIGGTAARPLLLD
                     FDRGSHRSAFRPDTVQVESWADVAHMTRDDLAGYSTLVVDTAGRALDFLAAAMPSTEG
                     KIQLKRPSGGLTLQGFGRLKDDFVSWLRKVNTFGLDVILICHDKEEKDGDQRIIRPDI
                     TGGSYHEIVKAADFVGYVAKLDGRNTVLDFNPTAQWIGKNSAGFPPLAVPDFAADPEW
                     FAGIMARMKAALGGIAQRQKEAVDKLAGFRGQIEFAKNAGELDVWNALIEEAASLGKP
                     LSLQAWTALKKAAEEQGLAYDKDAKAFQAKAEQREAA"
     CDS             complement(333624..333824)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02730"
                     /product="hypothetical protein"
                     /protein_id="BBL73175.1"
                     /transl_table=11
                     /translation="MSIAGRFKLWLCRQRLKTAEAEYEGARRQALHWELKAHELETAL
                     WNARRIVAGVETEIMAKARAAR"
     CDS             complement(333821..334237)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02740"
                     /product="hypothetical protein"
                     /protein_id="BBL73176.1"
                     /transl_table=11
                     /translation="MATPFTHRAELALMTEYMMRGPDGLPRSRQARFEEAQAHYRQGM
                     TMAAALALLPQDEADEFKARLDKAVDAVADTDEADADWPFVLGSLKATLDNLKARAAG
                     IQAQADIDAAMEKVREEMAFDRMLAEAAAGHGRKAA"
     CDS             complement(334294..335361)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02750"
                     /product="hypothetical protein"
                     /protein_id="BBL73177.1"
                     /transl_table=11
                     /translation="MKPGKSIVELAQELARRASAKKDLVADTRAMRIEVVGEDKPAVA
                     LHIEGVGYAAPLPLAHQQIGQHAGIPSRYYDRMLAEAPGLLADNLNHWFQREPARRMV
                     RTLDNRARAFLSDRYRRIDNEQIAEAVLPELLDAAQPVEIVSSEITDLRLYIQALFPR
                     IEGEVQKGDVVQAGIVISNSEVGLGAFQVRPLVYRLVCTNGMIAETGGIRRNHVGRRV
                     ESNGEDASIFQDDTLAADDRALALKMRDAVRDSMNAASFGNLLARMREATEGPRIEKP
                     VKAVEVLQKAVPITQGEGESILERLIRDGDYSRWGMLNAITHLANDDAVGYDRAVELQ
                     QIGGRLLTLNTSEWHRIAVAA"
     CDS             complement(335447..337972)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02760"
                     /product="hypothetical protein"
                     /protein_id="BBL73178.1"
                     /transl_table=11
                     /translation="MSNITVSRREAGDGAKPYVVLIDGQPWLDRQNHPRRFGDSKRAW
                     NAAYKRFARQLAGAIQAQAEAAALEAQAPEAVPAPSRPYGCIDPADKLTHADVRRIGL
                     KPGPAPLTPEQVEAAYAARAEARAHARAGQVQAAPLQDGPGAELRRQAAELRCGAGYA
                     DDYRAYLADLDAAAALEARARRLEMQAAAPAPGPAAIPTEPDHDTGAQPMTPNTATPH
                     PSMASTIAAHATLMERVKAEQTQALAQEQETAPEAAFAQAEQLIANRLAAHIDEIESF
                     EEFKSFARGYFSQGMYNKLYYTNTLRAIWDAQHPQRPEPAPQAPAQAAHGADDDMAGI
                     RKALDIIKRGDPMLEPAAQEETVGAGASAVMLDEALGGDPTDEEIEENIEAQEREETL
                     AIMAGEVKADPAPVHSKARWHEGFADGEAGREPTHDVADYRSGWNHGAVCRAQREAAR
                     AMREPPRPAPETANQGHIAFLETQLREIDPENPALAASQAWWDRGGVCGYSNEDFDVL
                     SRLSSALDAARKAVAAVVKEITPALVAVYNGSDMTEGEFAALAGQLPEAATVGDVIDA
                     ARSLRGLEEQADTGLAPAPEAAPSCEGDAWEAIEEAKTAEPAPVVEEAPAPTPAQTTA
                     FSQGYSDAMEGYEKPDLIESMPVFNEGYMEGWNAAQSRQATEAKLQERLAAMPVQAEP
                     AQPAPLNFDELLAAHQFLVEQAVKLADRLAAAEARIGKLEAAPVSRPAPQPAPKAATQ
                     AKAAETPATPRQAPTPAAAKAIEDSAPYKRGFAAARKGGKADADWFQGYGLGTADKAE
                     GRASREAEMAGRSLRSGYVAGFTGANETTNTRWVAGYKAGLPG"
     CDS             338414..339922
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02770"
                     /product="hypothetical protein"
                     /protein_id="BBL73179.1"
                     /transl_table=11
                     /translation="MTRQTIERKIARLRAGKQPRVLDLFAGCGGLSLGFEAAGFELAA
                     AVEFDPDAARSHGLNFHPGKEAHSQARDILTTHPEDLARELGLGPVAEAIDVIVGGPP
                     CQAFARVGRPKLREIDAHPQAFKHDPRARLYLEYLSYVEAFQPLVVLVENVPDVLNHG
                     GQNIAEEICEVLEQKGYLCRYTLLNAAFYGVPQTRQRMFLIAYRGEIADRVVFPESTH
                     WVELPPGYEGSRAVALKLLNDGNISGDANDYTDPPEATPELIPAVTAEQALGDLPPIY
                     ARDLLKSGELRRGARRFDKPMPYGAHTKLSAYARLMRTWPGFQALPEGLKDHVIRYLP
                     RDYELFARLNPGDQYPQAWKHAHDMLAERVQELRGRGIYIFEGTPEYERLKEQIIPPY
                     DVNKFPNKWRKMEADQPARTLMAHLGKDGYSHIHYDSAQARTISVREAARLQSFPDGF
                     VFNGTMNPAFRQIGNAVPPLMAKALATTIIKQIREGVRAGETETCPKAAVCV"
     CDS             339984..341021
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02780"
                     /product="hypothetical protein"
                     /protein_id="BBL73180.1"
                     /transl_table=11
                     /translation="MDAAVFVNVLFPTLPGRIDAIRDRVKITLEVYGPGEAGIHSITR
                     KILKQQKNWRLNGELIVNPPEEPGRYDPLQKGDYAILDFVGDPEPHTARMYLVARALP
                     QDAALHAALDAKYGAAFSPRKGMEPIDLEDLAQLLGGLSLPEGHPVLDFIDSDTLEDA
                     AQGGVEALRKLRKRRKARGVSREEFGRAKRAAEQVGRLGEEILNGWLETEQHAGRIQG
                     YRWESDANAIAPYDFVLVEDGADIRRIDAKSTTGDFKNPIHVSLAELFEMAEGGLPYD
                     LYRLYSVSENSARLRIAKGLRETAARILEPFRRLPSGVTVDGVSIAPETLGFGEEIII
                     SFSANDEGIDE"
     CDS             complement(341310..341894)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02790"
                     /product="hypothetical protein"
                     /protein_id="BBL73181.1"
                     /transl_table=11
                     /translation="MKMDITKIRWLNARHLAAHRCGSKRAFAEKLRKSDAQVAHIIGQ
                     KPTRNIGHGIAKQITDAFEVGDGWLDIPHPEIWDEQAAADILDRDADKRGSKRGRKKK
                     TTSPSTQQKQLGSSEEDLAQRLDEFLSSLPEEILPLGKRGKMRNIITATMKMEDGKVD
                     SVVRFVDGIEQKNTKEVIEQPTSDKKRRMTGVVA"
     CDS             341985..342347
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02800"
                     /product="hypothetical protein"
                     /protein_id="BBL73182.1"
                     /transl_table=11
                     /translation="MDFKNFISGLTPTELDEYACRAGTTALYIRTHLVKPRKIPRPPL
                     MQGLLAASDGVLTGADLMAHFNILGEKNQASEATPPEDRRTNPSNAASQKTGEAGGST
                     TRRTAPTAGSGEVIERAA"
     CDS             342423..342629
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02810"
                     /product="hypothetical protein"
                     /protein_id="BBL73183.1"
                     /transl_table=11
                     /translation="MSRPPIPDPEKHQYELFVKVQEADWLIINGIAKKKGIPRNVVAR
                     ALIRKALTGTMSTVDKILDDALSA"
     CDS             342645..342833
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02820"
                     /product="hypothetical protein"
                     /protein_id="BBL73184.1"
                     /transl_table=11
                     /translation="MASGIDESRERAVGITLDAVDMELLTAKNRNKSPEELAAELLGQ
                     ACQEIADRIFDDEIGPRH"
     CDS             343152..343892
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02830"
                     /product="hypothetical protein"
                     /protein_id="BBL73185.1"
                     /transl_table=11
                     /translation="MSILEYLDRPIAFHRCFVTITGSITASLMLSQALYWQKRTQETD
                     EWFFKSREEWTEETGLSRTEQETARAKLKSLDLLQEELRGLPARMYYRANVARLEALL
                     CQQVGGKPANTEAGNLPTGRQKSRQHLKETETTTETTQRDIPPPPSGKPRNPPGQPIE
                     LPAWLPQAAWAEFRQHRKEIRSPLTPLAESKAIQKLDELRRQGHDPVKVIDQSIGNGW
                     TGLFPLKSETPQRNPSKPGRDDWMEGAV"
     CDS             343889..345745
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02840"
                     /product="hypothetical protein"
                     /protein_id="BBL73186.1"
                     /transl_table=11
                     /translation="MKPSEISALLAEQAESVAKHLLPEGKRDGREWRCGSVHGEPGQS
                     LGVHLSGPKAGVWADFASGQGGDLLDLWMTVGKTDLPKAMREAARWLGVAIDPPRFAK
                     GGHRRAFVKPSKTPVEAQKGSAPWAWLTETRKLPEPTLRAFRVGGHGRSALFPFYDPA
                     GELAMVKWRDTAWTKETGRAKSGVTEKDMRPALFGWQAIPPGARWVVIAEGEIDAMSL
                     HAYGAPALSVPFGGGTGAKQDWIEHEFDHLERFDEVFLCLDSDGEGRKATLEIADRLG
                     RHRCRVVELPGGHKDANECLKAGVAGREMLDAFAAAKTLDPGELRRAGEFLDGVLAAF
                     YPAGAAEIGFSLPWPKCPTLLFRPGEVSLIAGVNGHGKSEGVGHLAVDIMRQGARVCV
                     ASMEFKPARWIARIVRQISGLDTPSADYVRAIMTWLDARLWAFDVVGAAKHKEMLRVF
                     AYARQRYGVRLFVIDNMSKLDIGLEDYDGQRAFVESLCGFAKAHDAHVFLVAHVRKGE
                     DDGKPGGKFDVKGSGAITDLVDTVLIWWRNRKKEERLKRSDLSDAERQELEEKPDALC
                     VCEKQRNGEDEPRIALWFHRPSHQFLPFRNSKPVEYVPFSTREPAAEAEGGW"
     CDS             345748..348264
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02850"
                     /product="hypothetical protein"
                     /protein_id="BBL73187.1"
                     /transl_table=11
                     /translation="MAAKKTYQEFLRGKIRLAEFGGFDVAPSEINPILKPHQRDIVRW
                     AVKGGQRAVFAAFGLGKSVIQIEVLRLVKAKVGGTVLVVLPLGVRQEFRRDGQMLGVE
                     FKFIRRNEEIWPDADSGFYLTNYESIRDGKLDPNRFTAVSLDEASVLRSFGSKTYQEF
                     LPLFARVRYKFVATATPSPNRYKELIHYAGFLGIMDTGQALTRFFKRDSTQANNLTLY
                     PHKEREFWLWLNSWAVFLQRPSDLGYSDEGYSLPPLKVVYHEVPAGDLVGHERDGQGL
                     LFPDAAMGLKEAAGEKRDSVEARIARMVDILKADPGSHYILWHHLEAERRAIKAAWPE
                     ATEVYGTLDLDERERRVVAFSEGRVKYLATKEEISGSGCNFQRHCHKAIFTSIGYRFN
                     DFIQAIHRIYRFLQTEACEIHIIHTEAEREILRSLQEKWTQHNELAANMSDIIQEHGL
                     NTLSIADTLARTIGVERVEVSGKHGRFRVANNDCVDEARRVEENSVGLIVTSIPFANH
                     YEYTPTYEDFGHTEDNAHFWEQMDFLTPELLRILQPGRLYCCHVKDRILFGNVTGQGV
                     PTVSPFHAEAIFHGIRHGFQYLGMITVVTDVVRENNQTYRLGWSEQCKDGTKMGVGSP
                     EYILLFRKPQTDRSKGYADVPVQKSKDAYTRARWQVDAHALWRSRGDRPLTADDLAGM
                     GPDRLAKAFTRFSLEHVYDYEFHVRIGEELEARGALPSSFMSLAPGSGHPAVWHDINR
                     MRTLNGNQSAKGLQNHVCPLQFDIVERLIERYSNRDERVYDPFGGLMTVPYCAVKMGR
                     RGGASELNPAYFLDGLQYLQAAERDHAMPTLFDLLEAEAA"
     CDS             348261..348455
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02860"
                     /product="hypothetical protein"
                     /protein_id="BBL73188.1"
                     /transl_table=11
                     /translation="MNGERQFVITREWAETYKTPAGGWTKAQLAAIGVAWPPPRGWLK
                     EVVGMAIDEAARHAFEEGCR"
     CDS             348452..348883
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011816488.1"
                     /locus_tag="MishRS11D_02870"
                     /product="protein ninB"
                     /protein_id="BBL73189.1"
                     /transl_table=11
                     /translation="MSRALFVLQPAPHPARARALEAVRTAPEGYVVEVRQKTRSLEQN
                     ALMWSMLAEISQRVCWHGEWLTAENWKDVFTAALKREKVVPGIGGGFVVLGQHTSRMT
                     RREMGDLIELMHAFAAEQGVAFPWETPPRPMPDARDGEVPR"
     CDS             348880..350199
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q72BW9"
                     /locus_tag="MishRS11D_02880"
                     /product="cytosine-specific methyltransferase"
                     /protein_id="BBL73190.1"
                     /transl_table=11
                     /translation="MKFLSVCSGIEAASAAWRPLGWEALAYAEIEPFPCAVLAHHYPD
                     VPNRGDMARFQEWPDARPDVLVGGTPCQSFSVAGLRAGLDDPRGQLMLAYGAVARQYR
                     PRWLVWENVPGVLSSHGGRDFGTFLGMLAELGYGFAYRVLDAQYFGVPQRRRRVFVVG
                     RLGDWRRAAAVLFERHGLQGHPPPRREPGEGVAGTLASRPTGGGGLGTDFDLGGGLVS
                     GTLTASYGNSTGRDMAEMPGALVARPLTAHQRRMDGTVETFVAHSLRAEGFDASEDGT
                     GRGTPLVPMAYRTSPNCGAWDTGDRVDALTTGTDPASHVLAFQERGRKGGRSLEIMGD
                     IHPALLAPDGGGRGGERNILAGTGVRRLTPRECERLQGFPDDYTRVPYRGKPAADGPR
                     YKALGNAMAVPVMRWIGERIQAVEAMGRPADAPRPMARRKGHATSKP"
     CDS             350219..350782
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005166765.1"
                     /locus_tag="MishRS11D_02890"
                     /product="hypothetical protein"
                     /protein_id="BBL73191.1"
                     /transl_table=11
                     /translation="MSNATIETPFQDAFREVVGIEGRYSDNPADSGGETMWGITAATA
                     RAAGYAGPMRSMPPAEARRIYKAGFWDRLGLDAIAAVSAHVAREVFEQGVNMGLDRAG
                     RNLQTVLNVLNRAGSDYPDLAVDGRVGPATVRAVSELRRTRGADGIAALIRGLNAQQG
                     AFYIDLASRRGKDEAFVMGWLLNRVAA"
     CDS             350779..351219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02900"
                     /product="hypothetical protein"
                     /protein_id="BBL73192.1"
                     /transl_table=11
                     /translation="MRASHPGGNALRAGHAPRPKPRDREHREQAALFGWVELAKARHP
                     GLGLLFAIPNGGDRHPAVAAKLGAEGVRAGVPDLCLPVPRGGFHGLWIELKAPQGPGA
                     RPGALEPGQLDWLDALNAHGYKAVARWGWEAARNTLIDYLEGKP"
     CDS             351336..351923
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02910"
                     /product="hypothetical protein"
                     /protein_id="BBL73193.1"
                     /transl_table=11
                     /translation="MIDRVGFVGVVAVRDGVIAKGHGTLAACRRLLAEGKDIHPAPGR
                     ERGAPPFPRGQLPVQDCTGWTDAEFRAFVAADNQLGLLSGWDDDLLRLNLDGLELDGF
                     DLGDIGFSGDELERLLALPDRATPPEPGFQPALDPGTDHRQVTDAEVDRAQARADGRF
                     SGGDARRKAELLCPNCAESFHMNADDLALILRDAQ"
     CDS             351920..352741
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02920"
                     /product="hypothetical protein"
                     /protein_id="BBL73194.1"
                     /transl_table=11
                     /translation="MNQPIPFDLFQATAGALTARQYTYARTMPHCPNWYTLRKDWPDD
                     GEFVRVVEAMRRYGYPERYGRKTFTRFDVNGFKYWTMGDPIETTILINRAYIEAGSPY
                     DTLAHDYDDLFAAPDAARENRALADLLPDLRNRKVLDIGCGTGLLAELKPLGGYTGLD
                     PSGLMLAKFRAKAPHLAKGLVHAGFEAFHTPERFDFAVALFGSPSYIDPGHLGKVKDL
                     LAPGGEYFLMFYRPGYVPATHVPMGGGVPWHGHNHETIDGERLDFGNYVIVRGRA"
     CDS             352738..353856
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113632.1"
                     /locus_tag="MishRS11D_02930"
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="BBL73195.1"
                     /transl_table=11
                     /translation="MRIYQNRTVWKAALDRFRWLYDEFGNIVVNFSGGKDSTVCLNLA
                     LMVAEEKGRLPVDVLFIDQEAEWRTVMADPRVNPLWLQVPFKIFNATSTLEPWLHCWE
                     PGREWVREKEPISIKDNRFGVDRFGGMFNAFADHHFQGGPYINIAGVRCEESPARALG
                     LTSYATYKHITWGKKENARKHQYTMYPLYDWSYTDIWKAIHDNGWAYCRIYDYMCMYG
                     VPIMEMRVSNVHHETAVKTLYYLQEIEQDTWNRITARIGGLNTAKTLREDFMAPKALP
                     WMFRDWREYREHLLENLIADPDIKATFRKEFDNADKLFDREIHDALWKYHVGMVLKNN
                     HHPEAMRLFQASHGQYTQGSHHKARKRREKPPDPFAIA"
     CDS             353822..354475
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001164761.1"
                     /locus_tag="MishRS11D_02940"
                     /product="hypothetical protein"
                     /protein_id="BBL73196.1"
                     /transl_table=11
                     /translation="MRNHPIHLQLREYVEAAPDRMAAIAELRAILHGLSGIAHPIDWV
                     RWIPIDKVSPNDYNPNSVAHKEMGLLHTSISHDGYTQPVVVIWNPDRDRFEIVDGFHR
                     YYTMKTHPDIHATTGGLLPCVVIDKDINDRMASTVRHNRARGRHSVQGMSAMVFKMLE
                     EGWSDAQICNELGMEAEELVRLKHITGFSKLFKDTQYKRAWVTKNQIKLANKLGVKP"
     CDS             354479..355204
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02950"
                     /product="hypothetical protein"
                     /protein_id="BBL73197.1"
                     /transl_table=11
                     /translation="MASNRTQPTPQHPWERQPGESETAYAAFRRYRDMPVGERSIQRS
                     VGEDASTQKVRRHKAWSAEFSWVERAAAYTDHLDRIARQERERAIRDMERRHAHSAQA
                     IHAVVNAKLAAWNRTPEAREAAAEALTPYQLARLLDTATRVERAALGHVPDPPPKKPD
                     RAPLLAELAEVKARAREDGDWNLYFRAMQEERLLTGEGTPIAARVENGDWKADLQAAG
                     MDPDAVFEEAVRLAMAKLEGDLP"
     CDS             355201..356676
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011023725.1"
                     /locus_tag="MishRS11D_02960"
                     /product="terminase"
                     /protein_id="BBL73198.1"
                     /transl_table=11
                     /translation="MSAPARARNRMMEAAVREARRRLRDGGRERNLLARLSPPQRQYL
                     ESQADIVIFGGAAGGGKTFSLLADPVRHRDVKGFRALVFRRTFPEINLPGGMWEASES
                     MYRDLGGLPSYGAKSWSWPSGASIKFTHMQREADKFNYLGAEITMIGFDQLELFTESM
                     FFYMLNRNRSLCGVKPYLRATCNPDPDCWVAGFIAWWIDPDTGFPLYGRSGVVRWFYR
                     VQDAIRWYGSREEAETAHPDLAAEGPPFSVTFIPAKLDDNRVLLEKDPAYRSKLMAMD
                     RVSRGRLLDGNWKVRATAGSYFDRAEVERVDGPPDDMDAWTWVRAWDLAATEPNRENP
                     DPSWTAGVLMGYRAGDRKVLIAGLEHVRKRAGGVKSLVLDTAWSDGHTVRVTVPKDPG
                     QAGKGQAEDFVAMLAGEGFMVAARPPGKAKEVRARPFAAHWQHGHVQVLAAPWNDEFF
                     AEMERFPSGAHDDIVDACSDAYAELVGEGRGFFDLLAEESH"
     CDS             356686..358464
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02970"
                     /product="hypothetical protein"
                     /protein_id="BBL73199.1"
                     /transl_table=11
                     /translation="METYRPSSGGLLVPTAAFRELYPEPIQQAALQDGPMPPGTRRPV
                     GDGLENILAGLGTGRDKAFHTGWTFPRLLTRQDLENMYRVSWLAKRIVNAPADDMTRE
                     WRAHSFDDGRGTENRRMEQAEKWFGVRHKVNEALRWARLYGGSLIIVGTADTQAQPRR
                     MAEPLEIDRIPRGGLRYLMVADRWRCPSSGKIEADPASPHFGMPASYLLADTGYEIHH
                     SRVVRFDGERLPWSSWRQNALWHDSALQHVLDALKGCDTTVAAIATMMFEANVDILKL
                     SSLDAKLSRKDGEALLHKRFRMAATMKSFNHLFMLDETETYEKKSNSFANLDKIMQEF
                     YAYVAGAAGIPLTRLFGRSPGGLNATGDSDLENYYGRIASDQETELRPRLETLDAILY
                     RHELGAIPDDAGFGFNSLWELTDKEQAEVEEKRANRDRAYVDMGAVTPGLVARELKDR
                     GTYRAMTDDDLLDIEEGPDEEGDTGSEGQQTGDAALALRPTRAMAEEAKRGLAWRRKH
                     GRGGTAIGIARARDIARRRNLSPETVRRMHSFFARHEPDTRAEGFRPSEGGYPSHGRI
                     AWALWGGDAGKAWADRMMARLDKRDD"
     CDS             complement(358486..358728)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02980"
                     /product="hypothetical protein"
                     /protein_id="BBL73200.1"
                     /transl_table=11
                     /translation="MAGVRQGYRILRLIVDLWHPSSLAISAQVFPSARASLIRALEMG
                     FLFGTYTRVPPWVSDNCASIALVFKSCAMVATRDVC"
     CDS             358802..360169
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_02990"
                     /product="hypothetical protein"
                     /protein_id="BBL73201.1"
                     /transl_table=11
                     /translation="MAGTMPAMDSEAPTPQAHEAIPGSPPGGVPPARPAGSPFPVAGG
                     GRPMPAPETVLAFDRLPLARRETTPEGYLVAPGVLSRTGIQTYYAYELGLDGGGMDPM
                     RRVRLHRPPEEVFDPGSLATFKNLPVTVGHPPNGVDAANWRKTAVGDCRGGLREGDTQ
                     VGTVTVRDAKAVAAVRDGTTELSCGYTFALDLTPGTDPVSGQPYDGIQRRIRGNHVAL
                     VDAGRCGSACRIADALPPTPEPGDNPMPDPIRKTVVDGIPIELNDTAAAAVDKLLKER
                     DAAKTAADAALKGKADAEQALADATKAHQDAVGKLATDHAAKVAELEKDVLTPAQRDA
                     MVRDWAEMLADAKRLAPMVATDGKTCVDVRRAVVKDVGDRNATAQGVIAAILAGKALE
                     VADADTVRAAFNAVKALPIAHAHDNRLDGFTQALAGVKVGDGPPVADARMMFHQSMAD
                     YAIEH"
     CDS             360182..361234
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03000"
                     /product="hypothetical protein"
                     /protein_id="BBL73202.1"
                     /transl_table=11
                     /translation="MSRPSLDNPGGLQRAIGYPGMVVAGEVHAIRDFVNDGTVPVDFG
                     VAVAFGSADGNCKAPSALTDRLLGISVRHVTMPATYGGGNTVRYAQYKAVPVLQEGPI
                     HAIAAQAVNRGDRVAALLNGAATTATKPGGNTGNGTLTLDATTPTLSGYQVGTYTVRC
                     TATATNGGTFTVTGPDGASKGTVAVGSTFNNEIKFVVADGSTDFALGDGFDVVVAGGL
                     LGSVEPAAMPSSSAAKSGGNTGTGTLTLDGTTPLLAGARPGVYTVRFTAAAANNGTFR
                     VFDPDGAVLGDVAMSGGAGSFANQVKFALADGGTDFSVGDGFDIAVGGDRIAFPNAYW
                     ETTTAKGALGIVKVVR"
     CDS             361253..362290
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011976025.1"
                     /locus_tag="MishRS11D_03010"
                     /product="hypothetical protein"
                     /protein_id="BBL73203.1"
                     /transl_table=11
                     /translation="MPTPPQQRQAAIAAYTEQRRMALDAAPGVLPQVFSQHTPSPLMR
                     VGDSAEALSFVVAQLAHTEATVFAKQYTPMQYEELLPLSYEAGEYATEIRYEIMDAVG
                     ATRSGSGKGAVNLVDVAYADKTFPVVADNIGYDYTQEELRQTAYLRRPISSARMDAAM
                     DIYRRKLNAVGLFGDTQRNLTGLFNNPYVPQASAPTGNWAAATPDQILADINTALLAV
                     WNNSANNDHADTLALAPSAYSQLLRPRATNSDMTLLRFVQENNLTTQRTGRPLKIAPA
                     YGLDTAGVGGTKRLMAYVRSPLRLVMHVPLPLRFLAPQFVGLSVQVPGEFKYSGVENR
                     YIKSSYYMDGL"
     CDS             362293..362565
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03020"
                     /product="hypothetical protein"
                     /protein_id="BBL73204.1"
                     /transl_table=11
                     /translation="MAKVLLQNPTERDIHLNLTTDNGAVATVTIPASRMEGTAETARR
                     VPGQAEADDSFLEQAMKGNPANKAFFDEGLLRIVKPEGPAPTKKAA"
     CDS             362568..362951
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03030"
                     /product="hypothetical protein"
                     /protein_id="BBL73205.1"
                     /transl_table=11
                     /translation="MTPAEFLARFPEFDGLDGIAGPGIQAAIDDADPHFDVERWGDLY
                     TQGLGNFVAHTLLMRKKRHDAMRNTNDTDPPPDAIGYKAGDTEVKFSEKLILYRVEKS
                     PYVSTEYGQQYLYLRDIVGAGALAV"
     CDS             362948..363295
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03040"
                     /product="hypothetical protein"
                     /protein_id="BBL73206.1"
                     /transl_table=11
                     /translation="MSFVYPRTLAILRPVQPAPAGLAPYGGQAADGESLVAEGVPASI
                     QQIRAGSGNPAKLPGDAKVPDFKILIPKRAVAKGVIKARDIVVDELGTRYQVMGPYWN
                     SLGYNLTASLLQA"
     CDS             363297..363725
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03050"
                     /product="hypothetical protein"
                     /protein_id="BBL73207.1"
                     /transl_table=11
                     /translation="MAKQVFFLEDSHYGLSDYRKGDAVWLSDSDAEGLIGAGRAALCP
                     GTANIATAGTVASTPVVVDVSGSPGPVTVTVVPGAGNTSKAEYSTTPDAASAPNTANW
                     QTWPPGTVSAIATDVFLGRLAALRFTRVGGSGTDAYEVLA"
     CDS             363743..364363
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03060"
                     /product="hypothetical protein"
                     /protein_id="BBL73208.1"
                     /transl_table=11
                     /translation="MAALPAFAWAARPSAQSYAGRLIRVTDYGVGHGSLWFSDGSAWR
                     LVGPTEVYNTTTDVVGAYAGATLVAQAMFPAGLLRVGDALGLVIRTLKSGTADAFARN
                     IRFGGTGDIGIDSSVFSLGYGSTNTHTAENPRLKIASATAIRVTTIGSTTSFSGGTSA
                     VGATDTTIPDIAANNNYLSITFNKNSGSAGETLTIKELTITHHPGP"
     CDS             364369..364623
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03070"
                     /product="hypothetical protein"
                     /protein_id="BBL73209.1"
                     /transl_table=11
                     /translation="MQNVKTLQERDALKPVLAVQVEADGSWDCYLPGDGLPSMPPPAP
                     VAACSPWQLRRYLNQTGLRSAVDAYVAAAGQDTQDRKISM"
     CDS             complement(364646..365728)
                     /codon_start=1
                     /gene="tnpA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002213218.1"
                     /locus_tag="MishRS11D_03080"
                     /product="transposase"
                     /protein_id="BBL73210.1"
                     /transl_table=11
                     /translation="MTPPQERETVTALIDEATAAGARLERACGVLGLSARTVQRWRSG
                     DGVQADRRPARVYVPPHKLSEAERAKVLAVANSPEFGHLPPCQIVPRLADRGEYLASE
                     STFHRILKAENQLAHRRAERPGQPRGKPRALCATAPNQVYCWDITYLPAAIRGQFFYL
                     YLFLDLFSRKVVGWQVYGEESSALAGELLRDVCRREGVAPGQVVLHSDNGGPMKGSTM
                     LATLQSLGVAASFSRPAVSNDNPYAEAVFKTLKYRPDHPVRPFDDLAAARRWAEGLVR
                     WYNHEHRHGAIRFVTPAERHAGQDADLLKRRRAVYEAARARHPQRWTGGLRNWRPIPA
                     VHLNPERSAAPAKTQSEVHATPPKAA"
     CDS             complement(365725..366123)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03090"
                     /product="hypothetical protein"
                     /protein_id="BBL73211.1"
                     /transl_table=11
                     /translation="MNHLTLKGWMKKKLPEAVRGAVKRERRPGDWRPEERLAALQESH
                     GLEGEALNAWCRERGLFAHQLDGWKRDFCRDPGGTGEASTNARELRVLKERNQSLERE
                     LARKDKALAEAAALLVLQKKYRALLGGGEE"
     CDS             366454..367356
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03100"
                     /product="hypothetical protein"
                     /protein_id="BBL73212.1"
                     /transl_table=11
                     /translation="MAALAVAATYPAGTGQPSVTGQAVSVYPGWPLPDRLDADLAAGA
                     AHVSVYPPGGSRNTTRYRPEAVELGLNPHTLTLQPAAMGGLPIGQGVVGTSLIVAGTA
                     PNKLRVGGTVTVPQTVTAIVEKRAYAYAVRAEDSLESVAEGLAQAIAAGVPGGPGIPG
                     TVAVGREVVLPPGHGYDAYRVGTGSPTVTALRQQEERVSLIVWASTPAQRGRIADALD
                     AAFADTPFLALADQTAARCRFAGRHLDDGQQLRRLYREDLMFTVDYSTTRADFAHEIA
                     SVGIGSKAPPNIGADADFSIRIDV"
     CDS             367366..369603
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03110"
                     /product="hypothetical protein"
                     /protein_id="BBL73213.1"
                     /transl_table=11
                     /translation="MPLVQDNHFNAAGLNVPDVFVNIIAPPDRITGVSTNVLGLVGVA
                     SWGPVGAPISAGSGSADRLVGPIVNRKHDLATAVKIAALQGVNNFKLVRVTDGGDTQA
                     AVAVQTDCIAYTAKYSGTEGNRITVAHAAGRKPGTTRVTVNRAGYTPEVFDNIEGSGN
                     ALWVAMAQAINQGQSGIRGPSEWLTAAAGAGTADPVLTAYALAGGTDGLADGMITAVE
                     VADAGSHYTGFPTVALSNAGSGSGLVAAVHMKAVAVSSVVSAGHGYAPGDTITLRQGG
                     ASSVAAVLAVTHTKVVSAAIVDGGTGGTDGTQTVTGTTGTGTRFQASVTVSDGAITDI
                     VSITTAGDYTANPANIDSEHVTGAGLSGAALSVALGVLTAAITTAGDYPAFPPGSPAT
                     QASTSGDGSGAMFSISWGVGSIAITAGGKNYPNTVTASLSGGSPSVAATLGDVTTQNW
                     ADVATSRLVGVDGSNRTGMYGLRGAGALTFALVDCDDPATWSEQLAFALETGSYAFAA
                     LPAGMYADVAGAVAGKGGAGVVDYGLHVWHGDWCYFNDTANGVRRLVSPATYAAGLRA
                     ALGPEQSILNKPLNGVVGTESTAANRVYSGAELSDLVEAGIDVVTNPIPAGDAYGSRL
                     GVNCDVNTAQRSDAYTALTHFLAHSFENFGGRFVGRVQTPREVQEVDDAFDFFLGGLV
                     DLGMIGDIDNPGKRDKAYSIAVDTSRAGLGYQAVNLKVVYLGIVRYFIVNLEGGSTVV
                     LNPAA"
     CDS             369616..370050
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03120"
                     /product="hypothetical protein"
                     /protein_id="BBL73214.1"
                     /transl_table=11
                     /translation="MTAMQRTTGRDFSLALQSTYGTFSPSPGLTVEYTEEPLADSTPK
                     SYVDGAPRTLVTHKGHRVTFKFDRSGPAAERMWSRVEADYFAGVAQADWTATMRIRNP
                     NGSVATKSYTLGALEKLSQSPAGGDATVEQTLQFFFGLLATG"
     CDS             370054..370443
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03130"
                     /product="hypothetical protein"
                     /protein_id="BBL73215.1"
                     /transl_table=11
                     /translation="MSEPKIAIKPESGETTVTDALGRRLTLRKPGRVRSFKFFEALGA
                     QASVNPMCVQMFQFALFLTAIDGKPVEPCHTLIDMEALADVLGDEGCGAIDRAAQEAW
                     GQSQEEALTAAIKKWRAMLDSGKPPGS"
     CDS             370452..370610
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03140"
                     /product="hypothetical protein"
                     /protein_id="BBL73216.1"
                     /transl_table=11
                     /translation="MPWDCAFGDDDPAQVAAFLRREDVRAGLAILLSELETGLRYNWN
                     THRYEKPK"
     CDS             370607..371095
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03150"
                     /product="hypothetical protein"
                     /protein_id="BBL73217.1"
                     /transl_table=11
                     /translation="MTRTFAPAGFAAFLRARPQAIAAARRKVLDTGSMLILETAKGKI
                     GEYQPAAGPFAAWAPLAETTLEGWDSPWGVHYPGKVELGYAPPDNPLLRTGELRNSIN
                     RAIFGNGAAAVGSDSPIAVWQERGTHRIPARSFLGAAAFEMEHHIHDMAGKALVAALT
                     GK"
     CDS             371106..371363
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03160"
                     /product="hypothetical protein"
                     /protein_id="BBL73218.1"
                     /transl_table=11
                     /translation="MNEAYLQTLVREAVGEVLDQRARIDQETHSDHHAWIQAKIEAEK
                     ERAEAWRDIRRTAIGWAVTAVLGTALAWFAGAFGWKVGGGQ"
     CDS             complement(371394..371684)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03170"
                     /product="hypothetical protein"
                     /protein_id="BBL73219.1"
                     /transl_table=11
                     /translation="MATITFDTHKFIQTLQEAGFDPKQAEAVSKAFREATGEGEFATK
                     RDVELVRQDVRELELRLDARFEKMDGKLTLVQWMLALVVAAEVVPLLANLFR"
     CDS             371793..374195
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03180"
                     /product="hypothetical protein"
                     /protein_id="BBL73220.1"
                     /transl_table=11
                     /translation="MFEAYRIQSSLILKDETLPTLQRMAAEFDKLDKKVKAVQKNMDM
                     IAKLTDPLHRTAGAVQMISRHLSTAETRSARLLANLTGISRLKFKPGDYGFGGLNFGE
                     GAASVGGGGRRGRSGGGAPMPAMEEPFYAPTLYQGGGPVVPFARPPQQPPPAMPSWPV
                     GMMAGGAAGGGRGFPPGGMPPRLGAPDWIPGNGRGGNPWDRWDRSEPFDTGFREPGGG
                     VPPGMPPQPPRGPFFGHGRNAHQDMMGGLVLMGGGAAGMGALDAALDAAKEYNLELAK
                     FRTLGLGEATNRRADEFARNARPWGTSKAELMSSLRESIGLFNDFDLAKALSPKIAEL
                     NAANSLLFGGKIGKIDDKATLALMRFIDRRGGNADRESFLRNLDLAQKMVTGSGGFLQ
                     FSDLANFSQMGGTAFRGLSDEGLLKMASLIAEQGGARAGTSLMSMYQNLVAGRTPKKT
                     MALLESLGLGSADEVKSGTVGGKKSTTTTFKLKPEYSQVLQRDPVEFYKSIVLPLLAK
                     KGIASEEKILETINDMLSNRTGSGQAGIMTTQLLQVLRDYDVTKRAMGARDTVRTARD
                     AAYGSDVDLSRSWKDFTLAAGIPALGDYQKAVEGVSGALNTGTKFLDSHQTATKVMTE
                     ALGVLFGAAMIGGAWKLTKAAAGFVGLAPDLAAMATTAPAAAAGLGAVAAWIGRLPAM
                     AATLGVGFVAGKSITDNSPWLQGKINKATDYWMDKFGGSPEVTGAISRQEHEERRRLN
                     TTPPPKGGTANPPGDVYLDGRKVGKVIAPHLGKEAAKPQSAASRPDGRRNLQPVAGNV
                     GR"
     CDS             374192..375148
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03190"
                     /product="hypothetical protein"
                     /protein_id="BBL73221.1"
                     /transl_table=11
                     /translation="MSAETRNPKVRLGDFEFQRFEVPDAIHTGGTQILAVHPLIGGNR
                     VVNAMGQSYANIEWSGTLTGPDAWNRMAALDAMRKSGKRYTLTFHGLRAPVVIEELRR
                     TIHTVALIDYEISLLNVTGAKVPPQETTQDAVGKDVAEAKALGKRVDDGILTDALDAL
                     DGAVRKVSDFANAAQDTINSVMQPIGAVVNRVQDLITTTTNTVINVTTLGGILPTNPI
                     AQKVGGLVGGVTKYTHLPQLYQLQSVMGRMSTNVRSAATAGKTVTVAGGNLYQVAAKE
                     TGSAADWSALAKANGMTDPKIEGIKTLVIPKNPGATGGVLAK"
     CDS             375145..376269
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03200"
                     /product="hypothetical protein"
                     /protein_id="BBL73222.1"
                     /transl_table=11
                     /translation="MNNGQASTPIPRGIVKLNGEIVHGWIEFETEANSFYEADTFSLS
                     FAIDAPDGKPAAWFIDQAEILVELLVVVFDGAAANADILEPATSIFYGRVDDLDYDPA
                     EGVVELSGRDLTGKLIDTKTTGKWQNLPASEIVRIIAGKNGLTPVVTATAGKAGAYYE
                     IDHVTLTHARSEWDLLTYLAEKTGKVVSVQGKALHFEDKPEAGASNFLIEWVRPSDVR
                     AYPVGNVEKLHFSKSLTVARDVAVKVRSWNAKKKTAINVTAKATKTKTTALSDAAQPE
                     GDAQVYSYSIPGLTQEQALQRAQELLRQISAHELKLAFSAPGTHALNIRTLIEVRGTG
                     TRFDTLYYPDRITRRLAPDDGGYSMEVSAKNHDPNSEVLV"
     CDS             376266..376445
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03210"
                     /product="hypothetical protein"
                     /protein_id="BBL73223.1"
                     /transl_table=11
                     /translation="MKRLDQNTHIIVWTGVIGLASLIVLALVPEAREQAGMGLAASIG
                     VLATMARQAKDAADA"
     tRNA            complement(376565..376650)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="MishRS11D_t00030"
                     /product="tRNA-Gly"
     CDS             377016..377384
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03220"
                     /product="hypothetical protein"
                     /protein_id="BBL73224.1"
                     /transl_table=11
                     /translation="MTADIDHWFGQDIGASVTGDLQPVTGVDRGRQRIVRRLMTVPGT
                     YIAHPDYGAGLPRYVGAVPDIPAIRALILEQMELEAAVAQDPAPQVAIQPVADGIAVA
                     IRYLDAPERVPVVLAFDVDR"
     CDS             377389..378519
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03230"
                     /product="hypothetical protein"
                     /protein_id="BBL73225.1"
                     /transl_table=11
                     /translation="MALNTKAFDTLVSEFAVNVQGRTAALIDFAVGSILRAVGEAASL
                     VVLWLQGLVLQVLALTRFATSTGTDAESWAADFGFEKIPATHATGSVTFARFTTGRRA
                     VIYPAALVQTADGSQTYAVVADTAHPAWSPADSAYVVDADASGVAVPVQALAAGAAGN
                     AAAGQVSVIVGQGIPYIDTATNAAPFTGGADIEGDGAFRARFVLWFNSLSKATGTALD
                     YAIGQVQSGLKWKLVENQNLDGSPRPGHLYAVVDDGTGDPSDELLAAVRAAMEGVRAL
                     SIQYAVFPPEVLGADVSLMLEIAAGFDPGEVQVAVRDAVLAYLGGLDLGQELRWTKLV
                     QIAYDAAPGGVTNVRTILVNGQMRDLEASDRQVIRAGTVVVG"
     CDS             378521..379351
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03240"
                     /product="hypothetical protein"
                     /protein_id="BBL73226.1"
                     /transl_table=11
                     /translation="MATGDKADLLQRLQAVLPPWFGNAGTPILAGVLAGIAGGLSFAH
                     SLIAYARAQTRLGTASDFFLDLASIDFFGGTLPRRRAEADDTFRARIKAAMFPERVTR
                     AAIARVVRELTGAEPRIFEPWNTGDTGGYGVAMGYGVAGAWGDLGLPYRAFIDYTLPD
                     LRGIPGVSGWAGYHGGWGAGALAYAALEEMPGYLSPEALGAAVQRNKAFGTLVWMRHA
                     VDVVTPAPPSHDFSAFAAMPGWSATGPGPPGDDFLFSGPCGHGLAWAWGDGSLVHVET
                     "
     CDS             379352..380446
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03250"
                     /product="hypothetical protein"
                     /protein_id="BBL73227.1"
                     /transl_table=11
                     /translation="MDRQFAHYGAIPLDTDFLKAQRNAMIGLGKLAEAVLGPGTWVHG
                     LDCTPTPTPGLSVLVGQGEIYALGNVDDTDMGRLAADTTNQIVKQGLAMGDTTLTAFS
                     APGSSGQARNYLVQARYVDADTNAVVLPYYNAADPSSPWSGPNNSGNASATARQGVCV
                     VSLKAGTAATAGSQATPAPDAGNVPLWVVTLVYGQTAIAAGDISRHPDAPYISGLKDS
                     GGFAIAGKVGKLDTDIQNVSNGVPLLVTFGNTQYGARYWSGADKAFVAPVDGVYAISA
                     NVIWQNPASGVPCWLEVYVNGVTVERGSEVPGSNANISTPIVSDLSLLAGDKVSIKAN
                     IYGDSAPIGLSSHADRYSYFTFRFAAYPPA"
     CDS             380465..381220
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03260"
                     /product="hypothetical protein"
                     /protein_id="BBL73228.1"
                     /transl_table=11
                     /translation="MTVQTADYLKSRFQDGDIPSGQDFADLIDSIFRPVTIAADRVAY
                     ANDGHPGIANVQQALDTLLYVAPQASITNSVGTVEIGSTVAAVTLDWTVNKTVIGQSI
                     AAPGPGAIDPALRTLALSGLHLTADTTFTLAVDDGTHTASVATPVLFRHRRRWGVSAQ
                     AVPDAALIDALAGAEFAAGRTQSRSFSPSGQYVYFAWPSSFGTPTFLVNGLLNTAWVK
                     TTVGYTNPSGYTANFDVYRSQFLQSGGQQVVVQ"
     CDS             381217..382386
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03270"
                     /product="hypothetical protein"
                     /protein_id="BBL73229.1"
                     /transl_table=11
                     /translation="MSAIQGTHVAAPIVPGDTADIFPSHVDIYGQGGYRAVADDAARD
                     AIPAPRRSAGMLIWHEADQAYYRLASDLTSWEAGPGGGGGGDFIPSAALDTDSTMAAN
                     SDSRVPSQKAVKTALGLKLDASAYNDRFKGLYSTPSALQTAHPTGAAGDYAQVDSGTG
                     GAPHIYSWDVSDDAWVLTSADGTGAANTDQLPEGSAHLYFTAARAVAACTGVFQAAST
                     ILSAIAGFTASTGFLKFASGTPSVGPISASDVSGLGSAATHAADDFATAAQALALAGY
                     DLPFCFEGSPGAGARLAAILLVRPVWLPFDLDGSIFRVDGAAGDYALAVQHLRDGEVL
                     VAGTATLHPGGTATLLLDGDVDGQPGDEVWISAPATPDAGVTSVRGTIKAEAVLP"
     CDS             382383..382790
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03280"
                     /product="hypothetical protein"
                     /protein_id="BBL73230.1"
                     /transl_table=11
                     /translation="MMGHRVITGSAPHGGGGGEGAPVPVFQFADYFSPDSWSNAFPDG
                     EGGWVVNVSISAASAVVGIDATGSYDPAGGTLEFLWSFPPPFAFDDPTASAPSGLWPA
                     NSGQYSGVTFLTITSTASGLSTVLTGTLQINWF"
     CDS             complement(382939..383319)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03290"
                     /product="hypothetical protein"
                     /protein_id="BBL73231.1"
                     /transl_table=11
                     /translation="MSKEILAKVAGIYDDGYCTTVSFANDPDNPTDYLILQATNYPSK
                     QDIDLGQDGIHMQINDQQNGGYNCINSIIIADKLIYINLFSDVSEKQKIEQEIVIKLL
                     TPEEDIKTIKAGLEAMIRRLKAIS"
     CDS             complement(383332..384159)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03300"
                     /product="hypothetical protein"
                     /protein_id="BBL73232.1"
                     /transl_table=11
                     /translation="MVAASNNTGGVTTLFNYGPFGEPNTTAGFRFRYTGQQLVGGLGL
                     YYYKARFYSPALGRFLQTDPIGYGDGLNLYAYVGNDPLNGVDPSGLAMENLGKAITNG
                     LTEDAPIVRMGQAFGALAAYGVGTATGDSALANAALQGMADNRQANVDTLGMLLTIGR
                     GGPRGVDPFHHNANVTIRDAQGTIIRHERIVSGNMTPVEQALGFPRNTLASHTEARAV
                     RDIPLESGQSMTITGQLPPCPSCKGAMNRAVQESGATIKYQWRQDGQTQTWQAGNRR"
     CDS             385724..385933
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03310"
                     /product="hypothetical protein"
                     /protein_id="BBL73233.1"
                     /transl_table=11
                     /translation="MFLGYFWERLRYQHSLPELNTYQSNNMVKSGHLRLLMDAYRVCL
                     NLIGVGILFQNMVPCFFMQTRILTC"
     CDS             385927..386103
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03320"
                     /product="hypothetical protein"
                     /protein_id="BBL73234.1"
                     /transl_table=11
                     /translation="MLNGTAMTANKKFGYGWKPVDEIWRINEKLKKQLGSNAAFIPRI
                     SLDPIISKGLKLCK"
     CDS             386714..387640
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03330"
                     /product="hypothetical protein"
                     /protein_id="BBL73235.1"
                     /transl_table=11
                     /translation="MSYKYALICMHGMGNLTQNEFMGDIAKVRRKLAHIMPAQELSNV
                     YIPPGGIFYSFITQGQEDKVWEKMNTQGGLDTGWIRRNTVNRLRRFIISGLSDATAFT
                     GFNGSGTASPYRQAQEVIGHALENVFQVCGSVPVILLSHSLGCQIMSSYLWDAQLYWR
                     NTREGENFPIDSRSVWYNRAPAADDYDGFMALRTLKTWFTTGCNIPIFVSGFDDVRAV
                     ETHSHGYDFTWINYFDYDDILGYPLAPLSVLFDAGKPTRHGQPYASAVTDIQVNATDG
                     VMGAILSSWNPMSHTQYWGDGTVMTTLANSLK"
     CDS             complement(387924..388244)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03340"
                     /product="hypothetical protein"
                     /protein_id="BBL73236.1"
                     /transl_table=11
                     /translation="MRHETIDGQEVEICVISADGTEVEEALRPDERGLLGRIDAALKA
                     HAGFCAAYPGARLVRVDSNRGLGDRDEGRSYLRYQHQGGITELWGNAADGVGVDLERG
                     IVGA"
     CDS             388855..389850
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004185574.1"
                     /locus_tag="MishRS11D_03350"
                     /product="glycosyl transferase"
                     /protein_id="BBL73237.1"
                     /transl_table=11
                     /translation="MKIALISDAWRPQINGVVTTLTKTCQMLGGLGHVVEPITPDRFK
                     TWPCPSYPEIRLALCGDAKLAKLLDGFKPEAIHIATEGPLGMAGRKYCLEHGLPFTTS
                     FHTRFPEYVNLRLRVPLEWSYGYMRWFHGAARRTMVATPSLMSELKARGFENPVLWSR
                     GVDADLFSPDAAIHLEERRPIFLYAGRVAVEKGIEDFLRLDLPGTKYVVGDGPQREEL
                     ARQFPEARFVGYKTGRELAGYIAAADVFVFPSRTDTFGLVLLEALACGVPVAAYPVQG
                     PSDVLTDAKVGCLSEDLRSAALGALSLDRGDCRRFALGFSWDRCARQFLSNLQPF"
     rRNA            390120..391645
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="MishRS11D_r00010"
                     /product="16S ribosomal RNA"
     tRNA            391750..391826
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="MishRS11D_t00040"
                     /product="tRNA-Ile"
     tRNA            391834..391909
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="MishRS11D_t00050"
                     /product="tRNA-Ala"
     rRNA            392118..395005
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="MishRS11D_r00020"
                     /product="23S ribosomal RNA"
     rRNA            395097..395202
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="MishRS11D_r00030"
                     /product="5S ribosomal RNA"
     CDS             395279..395701
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014537487.1"
                     /locus_tag="MishRS11D_03360"
                     /product="very short patch repair endonuclease"
                     /protein_id="BBL73238.1"
                     /transl_table=11
                     /translation="MVDTLTPAERSELMARVRSKDTRPEILVRRLVHAMGYRYRLHVR
                     RLPGSPDLVFPRLRKVLFVHGCFWHQHPNLECKIARLPKSRPEFWRPKLEGNRRRDKR
                     QQEALLDLGWRFMVVWECETWDIPGLIEKIQMFLAEDE"
     CDS             395707..396888
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5F7G9"
                     /locus_tag="MishRS11D_03370"
                     /product="cytosine-specific methyltransferase"
                     /protein_id="BBL73239.1"
                     /transl_table=11
                     /translation="MRAVELFAGAGGLGMGISRAGFEPLAVIEWNRHCCHTLRQNQAR
                     RLEPVAHWPLVEGDVRAFDFRAIRGGVDLVSGGPPCQPFSLGGKHRGYLDERDMFPQA
                     IRAVRELQPKAFMFENVKGLTRASFIPYLEYIRLHLSYPEMTPRPGEDWAAHRARLEK
                     HHSGGRHDGLHYHILTRGLLNAANYGVPQRRERIFLVGFRADLGIEWSFPEPTHDLDA
                     LLWSQWRSGEYWERHRIAQRHRPEGGKAKARALALAEAPRSLPWRTVRDAIEDLPDPE
                     TQPTAVGVHANHRFQPGARSYHGHTGSPLDEPAKTLKAGDHGVPGGENMLLRPDGSVR
                     YFTVRESARLQTFPDDFRFEGSWTESMRQLGNAVPVELAAIVAGSIKAHLVQAATPDR
                     A"
     CDS             396888..397649
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03380"
                     /product="hypothetical protein"
                     /protein_id="BBL73240.1"
                     /transl_table=11
                     /translation="MPGYLEFEFDLPAALLRNLVEVFGAMEAAPLLPGNLVGIPETQG
                     VYQLLLRGDLVYIGKTDAEAGLRKRLERHARTIQHRVKLDPAEVAFKAVRVFVFTAMD
                     LETQLIKHYGQIAPLPWNNSGFGSNDPGRERDTTNLKPEGFDAQYPVDIDRGIELGLP
                     FPATAALACALLKECLPYTFRVENAGRGSRKPHPDLVNTQVVPPPKPYTTRQFIEAIL
                     KRLPPGWQATALPSRVILYKEARAYAFGTVIARSD"
     CDS             complement(397613..400951)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03390"
                     /product="hypothetical protein"
                     /protein_id="BBL73241.1"
                     /transl_table=11
                     /translation="MSWERAFKADLARRLAASGQPCPDSLASAVFAPEYRATTPPGLA
                     ARDALRLAALDRDGGEGFDLWEPDPDLGGYHQLRLYSGRERGLDEIMPLVQSLGFRVL
                     DQSSFRLELGARRWCLRGFAVRPQAPGVDPLAYKAQVLEALDALLAGRVDNDALNGLL
                     LSAGLSWREIDVFRAYRNYYFQLGSHFGRFRFHQALLAHPGVARLLFRYFAARFEPDG
                     RWDTPGQREEEALSPLRQELSALLDGVADSAEDRILRDVFNLIDATLRTDYYLPKAPD
                     QHAIAFKINSLGIINMPAPRPLFEVYVHSRLMEGIHLRGAKVARGGIRWSDRPDDFRS
                     EILDLMRTQMIKNALIVPLGAKGGFVLNSSEPRPEERERLAQTAYATLMRGLLDLTDN
                     PAVEPPHRRIAYDAADPYLVVAADKGTARMSDTANRIAAEYGFWLGDAFASGGSWGFH
                     HKKLGITARGAWECVKRHFREAGLALDRPFSVVGIGSMDGDVFGNGMLLSENIRLLAA
                     FGSREIFLDPDPDPAVSFRERLRLFELAAPGWEAYDRALISPGGGVFPRDAKDIPLSP
                     AVRAWLGLRHASVDGEELIRLLLAAPVDLLWLGGIGTYVKAGSERHESVADRANDAVR
                     IDAGQVRAKVVGEGANLGFTQKARIEYALAGGRIDTDAVDNSGGVDLSDHEVNLKMLL
                     ALLRQRGLVEDESERNRRLADLSGAVVESVLAHNAAQSLCLSLDRQRCALDAEPFLDV
                     ADRLANAGLLDRAVESFPSRKDILARGGGLTRPELAVLMAYAKLALKRALLDRPEFPG
                     EWGRDHLSAYFPGPLREEFGAYLPGHPLAREITATQIANTVIDQAGVGFLAWVEELDS
                     ALLARAAAAYARFDHLVGGAALREQIRQLDGSWTSDRQYDGLLRLERLLAEACRRSLD
                     RNSIPAVEAGLGGLREYLDYLAATPGSTPTGTLAELIAAGFTQAQARLLVHAERLGEF
                     PALLEWAESQGLALAEAARLSDAIAAQLGLPRLITLLAAVQPRDRWERQAKLAWLDRF
                     QTAPVRFGACLARQGVPEPAALFAAPALQTRLARFQRLARELTDAAATSVVPFAALGA
                     ALEALREACDGDVQSERAITVPKA"
     CDS             complement(400986..401417)
                     /codon_start=1
                     /gene="rsbW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010942074.1"
                     /locus_tag="MishRS11D_03400"
                     /product="anti-sigma factor"
                     /protein_id="BBL73242.1"
                     /transl_table=11
                     /translation="MCEEGCCIHLDIVVPNQTRYLGLIGNIAEQLARVLDGYSGDRDA
                     LAYHLNLVLTEAMVNAIEHCPENQPRKTVRVCIYIADKELNIHVHDQGQGFDLDAVPA
                     PDFDDPCERGRGIFLIRTLMDTVAYRKTDNGNVLEMYKKLE"
     CDS             complement(401432..401767)
                     /codon_start=1
                     /gene="rsbV"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q74D91"
                     /locus_tag="MishRS11D_03410"
                     /product="anti-sigma factor antagonist"
                     /protein_id="BBL73243.1"
                     /transl_table=11
                     /translation="MQIATAKHDGKTVLSLKEERLDAHNSSDLRDQILKLLENGDTQL
                     IVDLAGVRFIDSSGLGALLSGYKNASLRSGSFVLAGLQPRVQSMFELTRLHRVFDIYP
                     SVEGALNKA"
     CDS             complement(401904..402185)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03420"
                     /product="hypothetical protein"
                     /protein_id="BBL73244.1"
                     /transl_table=11
                     /translation="MACQGQAVESKGARSSPPTMPGGGNTRPASAHGAAKDKAAAKAG
                     PNRKSARENMPDLPYMKQASTPDPPIRSAMVYILLEGRGRLNSTAPRPV"
     CDS             402073..402795
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03430"
                     /product="hypothetical protein"
                     /protein_id="BBL73245.1"
                     /transl_table=11
                     /translation="MSLAAPCADAGRVFPPPGIVGGDDRAPLDSTAWPWQAIGRLNQP
                     HGGYCTATLIAPDAVLTAGHCLTDRRTGQRLAARDLVFVADLRRDDDLGYARGRTLDH
                     APPADLGTAPGLEALAGDWAVVRLEHPLPIRPVPIRPLPDAGPSPRLQRAGYGQDRPN
                     LLSLHDGCRVSGRLAEGRVLVCDCDGTHGDSGSPLLLREGGRAWIVGVLSAVGVGGGG
                     NYAVHAAVFQGALAGSVPPRRP"
     CDS             402939..403850
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010895705.1"
                     /locus_tag="MishRS11D_03440"
                     /product="D-hexose-6-phosphate mutarotase"
                     /protein_id="BBL73246.1"
                     /transl_table=11
                     /translation="MDTSYLSDLQKRFGLSGTVDFTERHGMPVVEVNNAQGSGVLALQ
                     GAQLLTWAPKDQAAVVWLSPQAKFACGKSARGGVPICWPWFGPHAEESAFPVHGFART
                     AAWEVIEVATLEGGANRLGFRLLRKDADDLLWPHCTPLEVRYTLGAALEIELGTRSRS
                     PNPLVLGEALHTYFAVGDVREVRVLGLDGVEYIDKVDGGRRKRQAGPVTVGGEVDRVY
                     LGTESTCLIEDLSLNRRIRIEKSGSRATVVWNPWEDKAAKLGDFAAGGHLKMLCVESA
                     NAADAAVVLGPGEEHRLWVRYSVEPLA"
     CDS             403870..404625
                     /codon_start=1
                     /gene="truC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010943781.1"
                     /locus_tag="MishRS11D_03450"
                     /product="tRNA pseudouridine synthase TruC"
                     /protein_id="BBL73247.1"
                     /transl_table=11
                     /translation="MIDILYQDDWLVAVHKPAGLLVHRSAIDRHETRYALQMTRDLLG
                     RRVYPVHRLDKPTAGILIFALEVDMARRLTGLFAGGGVEKLYTAVVRGHTAGRGVIDY
                     ALAEEADPMTDALAQPGKPAQPALTHYRRLATAELPFPVGRYASCRYSWLAISPKTGR
                     KHQIRRHMKHIFHPVVGDTSHGDGRHNQFFRGHFGCHRLLLAAVRLGFVHPATGVGLA
                     LAAPLDPEFRAVLAGLGWNPAAPLDFPLHPDGP"
     CDS             404630..405472
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03460"
                     /product="hypothetical protein"
                     /protein_id="BBL73248.1"
                     /transl_table=11
                     /translation="MSQPPNTRIMALYCDFENVALGVRALKSKAFDIQKVLERLLLKG
                     NIVVKKAYCDWERYKEFKAAMHEAAFELIEIPHVRQSGKNSADIRMVVDALDLCYTKA
                     HVDTFVIISGDSDFSPLVSKLRENNKLVIGVGVKESTSDLLIANCDEFIYYDDLVRET
                     ESKEQRKAKRKPKAASAKAAKAPAEPVAEPAKPPDKRQQALDWVVETVEDLFEERGDE
                     GKVWGSMVKQALKRRKPGFNETYHGFRSFADLLEEAQARKLLALEFDEKSGGYIVQGL
                     ARED"
     CDS             405895..406626
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03470"
                     /product="hypothetical protein"
                     /protein_id="BBL73249.1"
                     /transl_table=11
                     /translation="MIASMKALTFVQEKTIMKSLFLKAAVLTMATGLSGTAQAISLLI
                     DDFNTDQLVSDVAGGSPSTQAENNFSGTSLVGADRTVTVNAIDNPGIGGTARLNAEFT
                     NGLPGDGILGISANSASLGGTVQITYNGFASTDFTLAGTSIAMDVVSVDTGVSVSVLV
                     NGTSTSGTVPFAGSGVFDVGFNEFSDPSVFTHVTSIVFTFSGSTPYDANFQLLRVFNN
                     PEPATLFLLGAGFAGMAARIRRKSI"
     CDS             407112..407858
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03480"
                     /product="hypothetical protein"
                     /protein_id="BBL73250.1"
                     /transl_table=11
                     /translation="MVDNFKNPNPANEAFLNQPTDTSAWSTDDAASGAIGGYRDLYLK
                     NPSGGSDGTFTCLSAGKDSADCAPYIGTTGLVIYNAGDVNANAQVLWNGTNGATEADS
                     ATPAMGLTGVNLYENSLNPAIHDAQGFYLDLNYLTAGVDLTITVWSNSGAVSASSTLH
                     NLLDCPLSSPPCGSLYKFFSFSSFTGGAVDFADVNAIALSISGPLGYYLEATSLETRT
                     DPGVPEPATLALTGLGLVGMGWSCRRNAKR"
     CDS             complement(407916..409286)
                     /codon_start=1
                     /gene="der"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z4P6"
                     /locus_tag="MishRS11D_03490"
                     /product="GTPase Der"
                     /protein_id="BBL73251.1"
                     /transl_table=11
                     /translation="MGRPNVGKSTLFNYLTQTRDALVADYPGLTRDRQYGRVKRGGRR
                     NFFVVDTGGIVETELGIDEQAMRQVRVALEESDLVLFLVDGRDGLNVGDEAIAAHLRR
                     IGKPVLLAVNKLDRPGQTLAANEFHALGLGEPHPLSASHALGIDALLDAVRDKLPAED
                     PEDSADAAPGIHVAVVGRPNVGKSTLVNRMLGEERVVVFDQPGTTRDSIHIPFERQGK
                     PYTLIDTAGIRRRGRIAETIEKFSVIKAMQAIEKAHVVVYIIDAREGVTDQDATLLGM
                     VLEIGRGLIVGLNKWDGLAHDHKEEIRRQIDLKLGFVDFAEKYFISALHGTGVGNLFD
                     AVEGVYAASMLDMSTARLTRLLQDVVAAHQPPLVRGRRIKLKYAHQGGSNPPTIVIHG
                     NQTDEIPGSYKRYLGNAFREALDLHGTPVRLEFKGGDNPYQGRRNPLTERQIRKRRRL
                     MKHAKK"
     CDS             complement(409310..410497)
                     /codon_start=1
                     /gene="bamB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZX20"
                     /locus_tag="MishRS11D_03500"
                     /product="outer membrane protein assembly factor BamB"
                     /protein_id="BBL73252.1"
                     /transl_table=11
                     /translation="MRLTLLLLSLGVLSGCAEFSAFKDLAESVQGLISGTDNADPPNE
                     LQPLEPKVKLTVLWDATIGDGYDEQVVNLVPAVTEDRVYAADRKGVVEAHNRLKGDKL
                     WSVETEFAFSSGPVAAGDKLLFGTSNGELVALNALDGSLAWKTTLTSEILALPRVESH
                     TIVVRTSDGRVIGLDEQSGGTRWSYERSIPPLSVRSLGSPTLADDLVLDGFGGGKLVA
                     LGLADGKPAWEAVVALPHGRSEVERLVELDADAYIKGDTAYVTGYQAGVAAVDLHGGD
                     VAWRQEQVYSSHGLAGDRRGLFLTDANSDVWELDIHSGNDLWKQTDLHMRRLTVPALV
                     KDYLVLGDFEGYLHALSQDDGGLLGRVRLDDDQPIRAAPVVYDDIIYVYTAGGVLAAV
                     ALE"
     CDS             complement(410497..411129)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003106650.1"
                     /locus_tag="MishRS11D_03510"
                     /product="hypothetical protein"
                     /protein_id="BBL73253.1"
                     /transl_table=11
                     /translation="MEDLSEEERLEALHRWWKTNKQSAFVGVLLGLAMVGAWNMWQNN
                     RRGAIEQASNLYQQLLKASEARQTDPALKLSERLIEQYGSTSYAEYARLFLAKAKADK
                     GDLAGAKQALEEELAKSHDDNLKALARLRLGRALLAGGETDAALKLIEPVTDQQAGKL
                     AGLYEELKGDLYAAAKRPADARLAYGKAKELGENSPLLELKLNDLPGTAN"
     CDS             complement(411146..412417)
                     /codon_start=1
                     /gene="hisS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E771"
                     /locus_tag="MishRS11D_03520"
                     /product="histidine--tRNA ligase"
                     /protein_id="BBL73254.1"
                     /transl_table=11
                     /translation="MAENIQAIRGMHDILPDQTPRWHHVEAVLRRVMAAYGYREIRMP
                     LVEKTELFKRSIGEVTDIVEKEMYTFEDRNGDSLTLRPEGTAGCLRACLEHGLIHNQA
                     HRLWYAGPMFRHERPQKGRYRQFNQLGVEAYGMPGPDIDAELILLCRRLWRELGLGHK
                     LELQINSLGTAEERLAYRAKLVEYFRAHYEKLDEDSQRRLETNPLRILDSKNPDLREV
                     IEGAPVLAEEFGEESKAHFQGLLERLDEAGVAYGVNPRLVRGLDYYCRTVFEWVTQEL
                     GAQGTVCAGGRYDGLIEQLGGKGSAAVGFALGMERLIDLLDEPERFEAAAQPHAYLIS
                     VGALAERKAVALAESLRDALPGLRLQEHRGGGGFKSQFKRADKSGAQVALILGDDEAR
                     DLNIGIKHLRTDAGQTTLAQAELVPFLQKLI"
     CDS             complement(412473..413219)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002227268.1"
                     /locus_tag="MishRS11D_03530"
                     /product="type IV pilus biogenesis/stability protein PilW"
                     /protein_id="BBL73255.1"
                     /transl_table=11
                     /translation="MNVRRSTVWVFASLLGACSSSPQTIQTLPQPAPAKYSPQEASKI
                     YVEKGVKYMEAGSYEVALQDMKRAIDLDDDNSEAYNSIGVLYERIDDYPNADTSFKKA
                     LSLKPDNYGARNNYGRFLCNRGKTQDAFEQFDQIIGNKLYDQPWVALTNAGICARKAG
                     KKAEAEGYLRQALDAAPNFPPSLLEMAKLSRENRQLMSARAFLERYFAAAGPNPEALK
                     LGIEIETALGNEETAQEYATTLRQRFPGGK"
     CDS             complement(413216..414256)
                     /codon_start=1
                     /gene="rlmN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZV93"
                     /locus_tag="MishRS11D_03540"
                     /product="dual-specificity RNA methyltransferase RlmN"
                     /protein_id="BBL73256.1"
                     /transl_table=11
                     /translation="MEAFCAGIGEKPFRASQLLQWIHQRGVDDFASMTNLSKVFRAKL
                     ADTCEIRAPEIVLAQKSADGTCKWVLQTDAQNRVETVFIPEEGRGTLCVSSQVGCALE
                     CSFCSTAKQGFNRNLSVAEIIGQVWTAQRELGEGRITNVVLMGMGEPLLNFNNVVSAI
                     SLMLDDFTYGLSKRRVTLSTSGVVPALDRLAEVTDISLAVSLHAPHDELRDVLVPINR
                     KYPIRELLAACKRYIGQDGRRKVTFEYVMLDGINDTPAHAKALVRLLSHVPSKVNLIP
                     FNPFPGTDYCCSTPENLKRFSEILQQAGLITTTRKTRGDDIDAACGQLVGKVNDRTRR
                     QIRLHQVATAAP"
     CDS             complement(414309..414740)
                     /codon_start=1
                     /gene="ndk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EEU0"
                     /locus_tag="MishRS11D_03550"
                     /product="nucleoside diphosphate kinase"
                     /protein_id="BBL73257.1"
                     /transl_table=11
                     /translation="MAVERTISIIKPDAVAKNVIGAIYSRFEQAGLKIVAAKMLHLSR
                     EQAEGFYAVHRERGFFNDLVGFMISGPVMVQVLEGEDAILKNREIMGATNPKDAAPGT
                     IRADFAVSIDENAVHGSDSPETAAQEIAYFFQPNELCPRTR"
     CDS             complement(414849..415172)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004191333.1"
                     /locus_tag="MishRS11D_03560"
                     /product="iron-sulfur cluster assembly protein IscA"
                     /protein_id="BBL73258.1"
                     /transl_table=11
                     /translation="MSIILTEPAAAQVSKQLAKRGAGLGLRLGVKPAGCTGFAYVVDY
                     ADAVEADDAVFEQHGAKVVVKQGDLAYLDGVEIDFRREGISEAFKFHNPNIKATCGCG
                     ESFAV"
     CDS             complement(415253..416377)
                     /codon_start=1
                     /gene="nifS-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010943206.1"
                     /locus_tag="MishRS11D_03570"
                     /product="cysteine desulfurase"
                     /protein_id="BBL73259.1"
                     /transl_table=11
                     /translation="MVYLDHNATTPLDGRVLEAMRPYLQAFYGNPSGLYKLGRLSRSA
                     IDTARQQVAALVGADPAEVIFTSGGTEANNLALKGLAFGLPHGLAVAGATEHPSVSEP
                     LRFLEQLGWRVATLPVDRDGQPDTADLDSLPFDSFRFASLMLANNETGVIHAIGPLAA
                     WVAERGGFLHCDAVQAAGKIPLDFKRSGAHLLSLSAHKLYGPKGVGALVVDRSVPLEP
                     LLHGGGQERDQRGGTENVAAIVGFGQAAELALAELEARSALLLRLRQYLEAGLRELPG
                     IKIFAERAARLPNTVQFALEGLDGETLVMNLDRQGIAVSSGSACASGGGEPSPVLTAM
                     GIPADLAKGAIRASLGQDNTEADIERFLAVLRSLACTLRG"
     CDS             complement(416390..416875)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003380601.1"
                     /locus_tag="MishRS11D_03580"
                     /product="Fe-S cluster assembly transcriptional regulator
                     IscR"
                     /protein_id="BBL73260.1"
                     /transl_table=11
                     /translation="MRLTTKGRYAVTALLDLAYHSEKRPVTLTDIAKRQHISLSYLEQ
                     LFARLRRAGMVEGVRGPGGGYQLSRDAGQISIADIIAAVDETIDSTRCGGKGNCQNSQ
                     PCLTHDLWMGLSDQIRQYLDSISLQDVLQRKNVRQVAERQDKQAATFGLDIPLQRDLM
                     M"
     CDS             416999..420619
                     /codon_start=1
                     /gene="oplaH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015039974.1"
                     /locus_tag="MishRS11D_03590"
                     /product="5-oxoprolinase"
                     /protein_id="BBL73261.1"
                     /transl_table=11
                     /translation="MTTWQFWIDRGGTFTDIVARRPDGVLLTHKLLSDHPERYADAAL
                     QGIRDILGLASTAPLAGIEAVKMGTTVGTNALLERKGEPTALAITQGFADVLRIGYQN
                     RPDIFALDIRRHAPLYGKVVEIEGRHDAGGRELAPLNLEAAERDLRAAYDAGYRALAV
                     VLMHAWRVPDHELALEALARRIGFTQVSLSHRVSPGLRLVGRGDTTVVDAYLSPVLRR
                     YVERVTGGLVGGDAAPRLLFMQSNGGLVESGHFQGKDSILSGPAGGIVGAVATAGAAG
                     FGKIVTFDMGGTSTDVAHYAGELERALETELAGARLRVPILHIHTVAAGGGSILSYDG
                     LSFRVGPESAGANPGPACYRRGGPLCVTDANVRLGKLRPEFFPQVFGPAGDLPLDVAS
                     VERGFAELAAAVQAATGRDATPEAVAEGFIEVAATNMAAAIKRISVQRGYDLADYTLC
                     CFGAAGGQHACRVADRLGIARILLHPLAGVLSAYGMGLADYRVLKEQAVVAVLDEALM
                     ERLAALLADLESAGRRELAGQAVAPERIQARPRLMLRYEGTETTFPVAFGELAGLEQD
                     FEAQHRQRFGFVYPDKRLLVETAVVEVIGLNPRPDSVVALPAAGSSPPAPIARVPMYS
                     GDRHHDTPVFRREHLAAGTRLIGPVLLIESTATTVIEPGWCGEITSRGDLVLTRAVAL
                     AQESAGDAGVDPARLEIFNRQFMSIAEEMGYTLQNTAHSVNIKERLDFSCALFDGAGD
                     LVANAPHIPVHLGSMGGSVRALIENHGHELRPGEAWLLNSPYHGGTHLPDITVVTPLF
                     DEAGRSILFYLASRGHHADVGGSTPGSMPPFSRSIDQEGALSPGLRLVEAGRMREDAV
                     RAWLADGPYPARNPEQNLADLRAQVAANAKGAEGLRRLIGRYSLPTVRAYMGHVQDHA
                     EAAVRRAIERLTDGEFAVEMDSGAVIRVAVAIDRERRAARIDFTGTSPQQPDNLNAPA
                     AVCQAAVLYVFRTLVREDIPLNAGCLRPLEIIIPAGSLLNPRPPAAVAAGNVETSQQI
                     CDALYGALGVLAASQGGMNNFTFGNARHQYYETVCGGAGAGRGFDGADAVQTHMTNSR
                     ITDPEMLEWRFPVRLESFAIRRGSGGAGTWRGGDGVARRIRFLEPMTAAILSGRRHHA
                     PFGLKGGAAGAKGCNNVVRQDGTVEALDFRAEVAMAAGDVFVVETPGGGGYGPADTGP
                     GP"
     CDS             420616..421755
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03600"
                     /product="hypothetical protein"
                     /protein_id="BBL73262.1"
                     /transl_table=11
                     /translation="MNTNSAILVAAVRNEGPWLLEWILYHKLIGFDDILIFSNDNDDH
                     GDILLDRLAALGLIRHVSTTDHIPEDQSPQEFAYQSAMRSDYVRSFRWVCVLDADEFL
                     CFKRHARLPDFLRDHEWCSVIYINWFLMGSGHRFRRGPEPVIQRFTKGIANPFIKTLA
                     KTQVIAGWKDPHLPELRVENTVFTRQVPAHGNSGEAAPHYIYQPDRAIVQVNHYVVKS
                     LEEFLIKRGRARGAASIGGIRRGAVESQRDLLFFVAHDWNGIEDTTLAGRYGTLVGEA
                     MRGFVERFQIGDILRGIETRYVEKVRQAIAAAGIDPGIPCGQTSPSALILKRELGDQV
                     DDGLLACFDGDWYLRRYPDVAAAYIHPLLHYVLYGRQEGREWRSL"
     CDS             421740..422372
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P48636"
                     /locus_tag="MishRS11D_03610"
                     /product="putative cytokinin riboside 5'-monophosphate
                     phosphoribohydrolase"
                     /protein_id="BBL73263.1"
                     /transl_table=11
                     /translation="MAVLIIDGSDVMRRVCVFCGSRSGARPGYQEMAGQLGRLLAGRG
                     VELVYGGGNIGLMGVVADACLAAGGGVIGVIPRSLVGREVAGRAVEHVGLTRLEVVDS
                     MHARKARMAELAEGFIALPGGFGTFEELFEILTWAQLGFHRKPVGLLNVADYYRPLLA
                     LCDQAVAEDFLRADDRGLLLDRAEPSALLEALAAYRPVAVEPWLHEEREL"
     CDS             complement(422367..422987)
                     /codon_start=1
                     /gene="gmk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z2H9"
                     /locus_tag="MishRS11D_03620"
                     /product="guanylate kinase"
                     /protein_id="BBL73264.1"
                     /transl_table=11
                     /translation="MCKGTLFVVSAPSGAGKTSLVKALRKGMDGFTVSVSHTTRAPRP
                     GEKDGRDYRFVERAEFERMIAAGEFLEHARVFDNHYGTARATVEAALEQGGDVLLEID
                     WQGARQVRTLLPDSVSVFILPPSLAALEQRLTGRGQDDPATIARRMGDAISEMSHYGE
                     YDYLVVNDDFAVALRELRAIVIAHRMRRARQAEKHRGLIADLLKAS"
     CDS             423376..425433
                     /codon_start=1
                     /gene="phuR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037788.1"
                     /locus_tag="MishRS11D_03630"
                     /product="ligand-gated channel"
                     /protein_id="BBL73265.1"
                     /transl_table=11
                     /translation="MHRALAPFTLSALIPLAHAEEAAQPLEEVVVSAPLEQKLSEVAR
                     PATVLTGDELDLKVGSTIGETLKSEAGVTSQSFGPGVGTPVIRGQSGPRVRVMSNSLG
                     NGDVAQLSPDHANSIEPVLADRIEVLRGPATLLYGSGAIGGVVNILDNRVPERRAEQP
                     VSGVFEQRYNSVSDQSISNLKLEGGQDLFAFHLDGFYRDGGNLHIGGPAIAENAARQS
                     DAALQGVDIQNSEGVIPNTSARAKGGTVGFSLVGEQGFAGASINYLGNNYGIPPDGAG
                     GPDTRINMKQTRYDFKSELKNPLAAVEALRLRFAHVDYTHTELSGGEAATLFNNQTYE
                     GRLELAHAPIGPVKGVLGFQAVSSDFSAISMEDPVPLVPNSQIQNYGAFAVESFAYGP
                     GTYELGLRGESASVSPQGGPNRDYAPISASGSGQWKINEAHAVSFAVTRSQRAPQVQE
                     LFSHGIHDATHSYESGDPNLKLETSYNLDLGYRFKASWMSAELNLFQNWVNDYIYQQQ
                     TGGVFNDDLGVFQASCSSPGACFPVVQSAQADATFKGYEAKATFPLMENRYGMVDLTL
                     FSDFTRGEFVAGGDVPRMPPLRYGFQVDYAYDDHWSSNLRLTRGEKQDHPGANDTETN
                     GYVLLNLAVQYEVQAFEGAKLRVFAQGNNLLDDNLRNSTSYLRNFAPEPGRGAELGVR
                     VSY"
     CDS             425437..426219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03640"
                     /product="hypothetical protein"
                     /protein_id="BBL73266.1"
                     /transl_table=11
                     /translation="MVAGIESSLYALAAGLVVSLMAFSGAFVLWLPPERLRRWVPNLV
                     ALAVGVLLGDAFIHLIPDAVARQGDVGGVCLAVLGGLFLFFVLEKWVRWRHDHAPAEG
                     PEVDSAQPMARMNLIGDAVHNFIDGILIAGSFWADPWIGATTTLAIVAHEIPQEIGDV
                     GALIQGGYRPAEAIRYNFYCSLTVLPGIAATLLLGHYAEASLALLLPMAAGGFIYIAA
                     SDFIPALHEPAADTGWGQVPAFALGVGFMQSVVVLEPLIATH"
     CDS             426240..426911
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011269410.1"
                     /locus_tag="MishRS11D_03650"
                     /product="hypothetical protein"
                     /protein_id="BBL73267.1"
                     /transl_table=11
                     /translation="MASAAPLSAPMAWPQAIETAQPADLALIYRPEVNLCVLRRPVAS
                     GLEGFVARLLSGPWRFERELRIGTEAPSFQSLLPEEVLALPGAGAWLADVGFLVELFR
                     DLFEPEGLGLRLRVLETAMCPRFHVDHVPVRLVCTYGGLGTEWLPDAAADRGKLGQGA
                     CGQPDEVSGLVLDPGSVRTLPAYAIGLLKGNRWEGGEGRGVVHRSPTPTPQQPRRLLL
                     TLDPL"
     CDS             426955..427938
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010931290.1"
                     /locus_tag="MishRS11D_03660"
                     /product="cobalamin biosynthesis protein CobW"
                     /protein_id="BBL73268.1"
                     /transl_table=11
                     /translation="MTDTAPIPVTLLTGFLGAGKTTLLNRILQEPQGQRIAVIENEFG
                     ETGIDNELLIQAGEQIVEMNNGCICCTVRGDLLRILGDLADRREVGDIRFDRVVIETT
                     GLADPAPVAQTFFLEENIREDYRLDAILTVVDAKHAPAQLDRHHEAQEQVGFADRILL
                     SKTDLVDAAALADLETRLRAMNPRAPIQPVHFGKTSLRDILDIHGFDLDAILGIEPDF
                     LNDLGHGHDDEVHSFVYRAERPFDAAKLLALMDLLISEFGADLLRYKGILHIAGNPNK
                     IVFQGVHRLLDESLGAPWRDDEKRESVLVFIGRNLPREQIVATLKTCHAHG"
     CDS             427931..428911
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03670"
                     /product="hypothetical protein"
                     /protein_id="BBL73269.1"
                     /transl_table=11
                     /translation="MAEITRLPILVLTGFLGSGKTTLLNRLLRDGPRTAVLINEFGQT
                     PVDHELLERQDLPLMTLSGGCLCCQIKGALAPVLKNLWLAWGKPGAPRFDRIVLETSG
                     VASPEPVLDTLLRDRWLAGHYALQGVVATLAVPAAAGQIDHFPEAKAQAAWADALLLT
                     QADLGTPADLALLESRLDALAPAVPRFQAAHGAIDPAALLAALAGGGRKLPGGGEVPG
                     HGFRSLSLHLRTAVSWPLLREVLENLLDRHGARLVRIKGVVHLRERFEPVALHGAAGR
                     LYPPAALAVRAGQDGLGRLVFITAGPLDGLDRELLEGLRGHLAEGSLRWH"
     CDS             complement(428935..430053)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03680"
                     /product="hypothetical protein"
                     /protein_id="BBL73270.1"
                     /transl_table=11
                     /translation="MKNDTYEFSRSLLDSLNDGLYVCDTERRIVYWSKSAERITGWRS
                     QEVIGRKCSDNLLCHTDKDGRQLCGEEFCPLHRSIITGKSATYPVLLFAKAKDGRRVP
                     LVVSVSPMRDGDGTIVGGIETFHDFSESYANLERAQRIQSLSLAHDLPADPRVAFSTF
                     YLPHDLVGGDFFSIRPLDGDRYGFFLADVMGHGFAAALHTMHLNSLWVRASDTLATPA
                     EFARRMNLELGKVAKDESFATGLCGMLDVAAKRLRFVSAGGPPMLLCRATGAIEELRV
                     SGFPFGVVGEAQYEELEVALAEGDSLLLFSDGAVEVQNDQGRLLGTEGLLAILQSLDY
                     PRAGLRIEALQAALLKYSNAIRLDDDVTFLEIRLAAQA"
     CDS             430250..431479
                     /codon_start=1
                     /gene="pfk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7UES2"
                     /locus_tag="MishRS11D_03690"
                     /product="pyrophosphate--fructose 6-phosphate
                     1-phosphotransferase"
                     /protein_id="BBL73271.1"
                     /transl_table=11
                     /translation="MSKPKKVALLTAGGLAPCLSTAVGCLIERYNEIDPSIEIIAYHG
                     GYKGLLLGDSYTITPEVRANAGLLLKFGGSPIGNSRVKLTNVKDCVKRGLVKEGEDPQ
                     KVAADQLVKDGVDVLHTIGGDDTNTAAADLAAFLAKNGYGLTVIGLPKTVDNDVFPIK
                     QSLGAWTAAEQGARYFWNVVAETGANPRMLIVHEVMGRNCGWLTAATAQEYRKLLDGA
                     AWLPGIGLSRDCYEVHGVFIPEMEIDLAAEAARLRAVMDKHDCVNIFISEGAGVEAIV
                     AEMQAKGQEVPRDAFGHIKLDAVNPGKWFGEQFAQMLGAEKTLVQKSGYFARAAASNA
                     EDIRLIKSCADLAVECAMRREPGVIGHDEDNGNVLRAIEFPRIKGGKPFDIDTPWFGQ
                     MLEDIGQAKGGKVHVSH"
     CDS             431558..432880
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003404998.1"
                     /locus_tag="MishRS11D_03700"
                     /product="ATPase"
                     /protein_id="BBL73272.1"
                     /transl_table=11
                     /translation="MKIERLILENFRGVGKALELPLEPDLTVLAGVNGSGKSTVLDAL
                     AILLSWVVARVRRAGGSGQQISELSIHNGAGYARIRAESSVPENLSWQLVKTRKGHAQ
                     PAKATELEALSKYTRLIQQQISETQSQCNIPIFSYYPVNRAVLDIPLRIRQSHDFGLL
                     DAWDGSLVGAVNFRHFFEWFRNRQDFENEKTTELLQEIFESSFRLLENGNLVAFQDIQ
                     LTAVRQALQVFLPNFERLTVHRKPLRMTAVKNNHEVQVDQLSDGERCLIALIGDLARR
                     LAIANPNMANPLKGEGVVLIDEIDLHIHPAWQRTILKNLTRTFPNCQFVVSTHSPQVL
                     GEAEGRQIRLLVQDEENGLTYSTPQQAKGLSSNEILDELMRPDGDTLARNSEIQRQLD
                     DLFLLIDQDKFKEAKVAIARMKQELQGDIPELVRADALLFMLEPDDQA"
     CDS             432877..433524
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03710"
                     /product="hypothetical protein"
                     /protein_id="BBL73273.1"
                     /transl_table=11
                     /translation="MRAIVKSPEPKELTEYRCQPDAVYDGPLFTPVKQAIRAQLLREQ
                     GYLCAYCMKRIGVWEMKVEHWHCQDHYPHEQLDYQNLLGACQGHEGEPYSQQTCDTRK
                     GNRDLKYHPAHPGHRIESQISFLGNGKVGSADTDFDGQLNGVLNLNLPRLLGNRLAVW
                     NAVHDRLSRKAGSRTPAEIQKLIDDWSVSDQGGQLREYCAVAVYYLRKRLRAMRA"
     CDS             433681..434550
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03720"
                     /product="hypothetical protein"
                     /protein_id="BBL73274.1"
                     /transl_table=11
                     /translation="MSWNQLLRAWWVLPLLSPATVAALTADIQGVRLQPEMEAASCVA
                     IAGDYPGVRIEADQPGQTARICHNASRVNSISIANATLIATAPLQKEIVIRFEHDFPS
                     GVNGKITARTKLQGYFATESGVGVPTGDKLNLRSLFAQGKSEDPIAEAFDFTVGEELD
                     SAMFEHSAKKQYLAVGPRSLRGILKINFKKPGHKVTFPDKCVISLDTGYTLADKLDTM
                     DFPAEEGAAPGGETPAGEAAPPSPAAPQDLEPVTPPKPKKEKAPPPSAPALNLPPLHN
                     PPGLEPLPDAKTP"
     CDS             complement(434635..437304)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q89DV4"
                     /locus_tag="MishRS11D_03730"
                     /product="UPF0182 protein"
                     /protein_id="BBL73275.1"
                     /transl_table=11
                     /translation="MVMALAVFVLAGVLLASGMALTDFIVDYWWHSELGYGGYFWLKL
                     LYRYILSGSVTLFFFLIFFLNFLAASRFLGVDEDAFARLGRGETSRYRKLLALFQTGS
                     MQVYIPVSLILAIAIALPFYDQWQQALLFVFGPEAGIDDPVFGNDVSFYLFSYPVFEL
                     IQFELLMAAIILTLGVGVLYLLEHQLLPGRQKPWPTGAKLHMAGLVMLTTLVLCWDFV
                     LDRFKLLYTDAHEPQFFGPGFVDFHYHLPLIWLSVASLFGLGIAALHYLNRRNRLGLA
                     LVVGLAALFLVSVGLRKIDSIPQGIDKFIVKPNPVKTERGYMQNNIDATLAAYDLKNI
                     KIIDMVPGLPEEDVLDPELRAHLYNIPVWDPEFLDDVYQQMQGIRPYYHFTDVDVARY
                     LINNQLYQVNLAAREVNITRLPQAAQNWENTHLRYTHGYGVVVTPAAQDGETPMRWYL
                     RDLNLQTKEGFSIEKPDIYYGEEDLTYAIVPNKLNIVGIPSFDEESSFNYTGGGGVPI
                     SSLFRKLLFALYFRDRNLFFSINIDDKSRALFHRNIVDRVKSLTPFLQLDHDPYIVVT
                     SKRLHWIIDAYTTSDWYPVSKRSSARFNNDREDQDFNYLRNSVKIVIDSFSGHVDYYV
                     ADPNDPIIQGYRKAYPGLFKDINTLPPALKEQLRYPKDQFTAQMKIYARYHQTAPELF
                     YEQAETWDFAKVNGNVMKPFYFTTTLQDYLDNQQSFILINPMTPIARSNLSVLAVAGT
                     PTIGANIAPTQGYSKQIALYRFSREIQVDGPAQVSALIDQDPQVSRQFSLWDQKGSQV
                     LRGRIIVLPVGHSVLYVQPVYLSSTSGTRIPELTRIILSMGNVVVMDASLEQGIIKLE
                     QRLREVRRQSLDVKPQSAPLPPPQPGEPAFKAM"
     CDS             437652..439487
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03740"
                     /product="hypothetical protein"
                     /protein_id="BBL73276.1"
                     /transl_table=11
                     /translation="MPLSDADLVHLRTIVARHGGEPTELLQILREVQAYLHHVPHEAM
                     VFLYEVLQVPPAQIQGVVEFYSFLSTTPRGHYDLRVSDSITDQMLGSRALAADLCERL
                     GVRLGETRADGAVSVDYTSCTGMCEQGPAGLVNGLALTRLDRARIGRIAELVEAGAPL
                     EAWPEEFFAVADNVHKPGLLLENGFEPGAALAKLFERGRDATFAELEQSGLRGRGGAG
                     FNTAWKWRFCYEGPDEDSFCPMDKRSEVQRFVICNADEGEPGTFKDRVLLNSHAHRVF
                     EGMTVCAALVGAKRGFLYLRGEYLHLYQPLLAVLEERRRLGLLGQTIQGREGFDFDIK
                     IHLGAGAYICGEESALIESLEGKRGNPRNRPPYPVTHGYLGQPTVVNNVETFLSAAMI
                     ALHGGAWFAAHGTEKSKGSKILSISGDCARPGIYEYPFGTTVAEILADCGASDPFGAQ
                     VGGPSGTFISDKEFGRKLAFEDLATGGSFIVFGQGRDPLEVARNFTHFFAHESCGFCT
                     PCRVGTALLRNIHDKICAGHGTPYDLAELADLGKIIKGASHCGLGQTAANPILTTLER
                     YPGLYEARLKETVFQPGFDLDGALEVSRRLTGRDDAHAHLEQANQ"
     CDS             439497..440228
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03750"
                     /product="hypothetical protein"
                     /protein_id="BBL73277.1"
                     /transl_table=11
                     /translation="MKPYHISIDGQAVPYQPGQTIMEAATAAGIYIPHLCHNPEFKPH
                     GSCKLCTVKVNGRSAAACTMPAGEGQEIQNNTPELNATRRAITRMLFVEGNHICPGCE
                     KTGNCQLQAVGYYVGMLDTHYPHFFPTRRVDASHPDVMLDLDRCIVCELCVRASRDVD
                     GKNVFGLAGRGLQTRLVVNSASGLLKDTDFSAGDKAAQVCPVGAILIKRKGYEVPIGE
                     RIFDHHTIGEVSLEHDQAVLGADHG"
     CDS             440221..440763
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012582501.1"
                     /locus_tag="MishRS11D_03760"
                     /product="hydrogenase"
                     /protein_id="BBL73278.1"
                     /transl_table=11
                     /translation="MANKLKVATTSLAGCFGCHMSLLDIDERLLDLCEVAEFDRSPLT
                     DIKHCSETVDIGLIEGGLCNAENVHTLREFRKHCRILVGVGACALNGGIPALRNHIPL
                     QECLEEAYLHGVGVEDAQVPNDPELPLLLSKVHPIHEVVKVDYFLPGCPPSADVFWKF
                     LTDVAAGKEPELPYELVHYD"
     CDS             complement(440842..441003)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03770"
                     /product="hypothetical protein"
                     /protein_id="BBL73279.1"
                     /transl_table=11
                     /translation="MLKPLRRLLPALLRLFHIGHAPGFAGWASPPHRPAWDNGIDYDI
                     PTFLRRRAG"
     CDS             complement(441215..442270)
                     /codon_start=1
                     /gene="phbC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037305.1"
                     /locus_tag="MishRS11D_03780"
                     /product="poly-beta-hydroxybutyrate polymerase"
                     /protein_id="BBL73280.1"
                     /transl_table=11
                     /translation="MLRPDQIVQEAFDFNRRIAAGMTTLGQIGQIETGVSPREAVHRE
                     DKLTLYRYHPRVADPAKVPVLIVYALVNRPYMADLQEDRSLIRGLLDQGLDVYLVDWG
                     YPDAADRFLELDDYLNGYLRRCVDFIRRAHKLPAIDLLGICQGGTFSLCFTALHPEKV
                     RNLVTMVTPVDFQTPDNLLSLWTRELDTDLMVDTLGNVPGELLNWGFLSLKPFRLTGQ
                     KYVDMAEILEDPVKLKNFLRMEKWIFDSPDQAGEAYRQFIKWFYQENRLVNDTLEIGG
                     KKASLSRVTMPVLNVYATEDHLVPPSASIALEKHVGSRDYTAFAFKGGHIGIYVSGRA
                     QKEIPPVIAKWIGARAH"
     CDS             complement(442289..443407)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03790"
                     /product="hypothetical protein"
                     /protein_id="BBL73281.1"
                     /transl_table=11
                     /translation="MSSKASTDPGDWTAVWADAQQKYWQSWLDLSQQATATLTRPPEP
                     PPNPWTQAFDFWAKLMPQAAPPENRDWIGKLTALNKGYLQMGEHLWKTLSAGQNPPPD
                     PHAWWEMVSQGFKSMQDGFAAPSRDSQDPWAGFATFWGMPIDNWRRVCSAYSAMPGDI
                     ETALRGFMGPGAGTPETALSRWLSLPTLGYTREAQEEMQRLGQLWLEHSQALREYAGG
                     ALAKVSAKAGESLMAKLHELTAQGKTPESLREFYNLWVDCGEEAYAALAPTPEFTQAQ
                     ARMVNTLLAAKRQEQKMVDEFLSAFNMPTRRELDTSHKRIHQLQRQVWRLQEDLEEAG
                     IAALREEVAGLRRELEALRAESNPSKGGKSPRAAQPTA"
     CDS             443680..444048
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03800"
                     /product="hypothetical protein"
                     /protein_id="BBL73282.1"
                     /transl_table=11
                     /translation="MNADLFGQWVETNRAAWVPVVRWQEVTAETTQKAVAQGLAVAQD
                     YVEFGTRNAQLLGEVKDPSRWALEQGKLASEFGQKMVSRTADYLKFALETQDAFGQIA
                     ETLAKTAAGTNNGGDSKTTL"
     CDS             complement(444110..444547)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03810"
                     /product="hypothetical protein"
                     /protein_id="BBL73283.1"
                     /transl_table=11
                     /translation="MKKASLILLAPLLFAAFAAQAETPAPAAPVTATPPTPAATPATA
                     PAHKAKSACYPDIQALCAGVQKGEGRIQKCLDEHADQVSAACKAEHAQKKAENQAIKA
                     ACKTDIKQFCADNKRHGAWLGCLKSHAAQLSPDCAKTLNDAMD"
     CDS             444688..445866
                     /codon_start=1
                     /gene="atoB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I2A8"
                     /locus_tag="MishRS11D_03820"
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="BBL73284.1"
                     /transl_table=11
                     /translation="MEAVVIVAAARTAIGKFGGSLANIPAARLGAHVIAGLLARTGLE
                     ARQVDEVILGQVLAAGAGQNPARQAALYAGLPYETPATTLNKVCGSGLKAVQWAAQAI
                     RCGDAGIVVAGGQENMSLAPHLLPHSRDGQRMGDWSLADSMIVDGLWDIFNDYHMGCT
                     AENIAQRFGLTRDEQDAFATASQHKAAAAIAAGRFRDEVVPIEVPQGKKPPLVFDTDE
                     FPRSGTTVEALAKLKPAFRPEGTVTPGNASGINDGAAAVLLMAESTAERLGLTPLARI
                     AAFGCAGVDPAVMGLGPIEATRKALDRAGWGIDALDLVEANEAFAAQAIAVNRELGWD
                     TAKVNVNGGAIALGHPIGASGARILVTLLHEMARRDAKKGLATLCIGGGQGIAVAVER
                     "
     CDS             445903..446649
                     /codon_start=1
                     /gene="phbB-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004193701.1"
                     /locus_tag="MishRS11D_03830"
                     /product="beta-ketoacyl-ACP reductase"
                     /protein_id="BBL73285.1"
                     /transl_table=11
                     /translation="MSGRIAVVTGGTGTIGTEICKHLGAAGHRVVALCLPGTPDCVPD
                     TWEAARKAEGYDMKVVGCDVADYEETSQAFARIEADIGPVDILVNAAGITRDATLRKM
                     DPKQWREVIAANLDSVFNTTRCAFPGMMDRGFGRIVNISSVNGMKGQFGQANYAASKA
                     GIHGFTMSAAREGARKGVTVNTVSPGYIESPMIMAVPEEHRAKIMAEIPVGRFGKPAE
                     IGRLIVFLTADESGFITGAEIAINGGQHMQ"
     CDS             446741..447223
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_637650.2"
                     /locus_tag="MishRS11D_03840"
                     /product="hypothetical protein"
                     /protein_id="BBL73286.1"
                     /transl_table=11
                     /translation="MQPERIIKKYSNRRLYDTEISAYVTLDDVRRLVKAGVKFKVVDA
                     KTDEDITRSILMQVILEQEERGRPIFTQEMLEQIIRTYGDAMQGFMTSYLEQSMAVFL
                     KQQQAVQEQMANLIQTAPASIYADLAQHNLKLWQTLQEGFRKAYSQEWPPNPRGPDGT
                     "
     CDS             447371..448456
                     /codon_start=1
                     /gene="thiO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205267.1"
                     /locus_tag="MishRS11D_03850"
                     /product="thiamine biosynthesis oxidoreductase ThiO"
                     /protein_id="BBL73287.1"
                     /transl_table=11
                     /translation="MSLNIAVLGAGLMGRLLAVELARAGYRVAVHERGGPDGQTAAAH
                     IAAAMLAPWAESVVSEPVIVELGRASLERWPRIIAALSRPVFFQQAGTLVVWHPQDRD
                     QAAQFSARLRTLDPALRGGGRVREVSGTELQTLEPALGQRFAQGIYLAGEGQLDNRGL
                     LAALLAQLEASEVALHWHTETAPDQVRADWILDCRGLGAKPEWRTLRGVRGEVVRVQS
                     SEVGLTRPVRLLHPRYPLYIAPKPGGIYVIGATQIETEDTSPASVRSALELLSALYAV
                     HPAFGEARILELAAHCRPALPDNLPEIRWDGGRLIQVNGLYRHGYLIAPAVMEATLAL
                     LRRVAERGGADLESWCAAQPFPSLYRR"
     CDS             448480..448683
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199938.1"
                     /locus_tag="MishRS11D_03860"
                     /product="thiamine biosynthesis protein ThiS"
                     /protein_id="BBL73288.1"
                     /transl_table=11
                     /translation="MSIRITINQKPYDLPEDATLAEALARFGAAPPFAVAVNLQFVHR
                     HLYGETRLHAGDAVEVVQPVAGG"
     CDS             448705..449517
                     /codon_start=1
                     /gene="thiG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q73"
                     /locus_tag="MishRS11D_03870"
                     /product="thiazole synthase"
                     /protein_id="BBL73289.1"
                     /transl_table=11
                     /translation="MNSPTETADALILYGQSFAGRLLLGTARYPSPKILEQAVRAAAP
                     ALLTVSLRRQAAAHHETGGQAFWQLLARLGVPILPNTAGCHSPEEVYATAMMAREIFD
                     TEWLKLELIGDDYTLQPDTLGLVAVADKLLREGFKVLPYCTEDLVLCKRLVEVGCQAV
                     MPWAAPIGTGKGPVNPYALRLLRERIEVPMLIDAGLGLPSHACQVMEWGYDGVLLNTA
                     VALAGDPVALAQAFAQAVAAGRLAYLGGAMAEHDSAQASTPVIGTPFWHQHA"
     CDS             449531..450166
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268173.1"
                     /locus_tag="MishRS11D_03880"
                     /product="paraquat-inducible protein A"
                     /protein_id="BBL73290.1"
                     /transl_table=11
                     /translation="MRPATQTPAQHHQHWIACHDCDALYPVPKLGLGQKALCVRCGAV
                     LLQRKRDTLGRSLAMAFACLVLFTLANSFPLLGLNIEGRVEYGAVISGVFELKHQGFS
                     AMAALVFGVSILAPGLKIAGWLYVLLPLRLNRRLPGMTTVFRWIALLGPWAMAEVYML
                     GILVAVVKLADLATIEPGLSLYSFAAMIVAMAATDAMLEPHEIWERLESLK"
     CDS             450163..450810
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_008719782.1"
                     /locus_tag="MishRS11D_03890"
                     /product="hypothetical protein"
                     /protein_id="BBL73291.1"
                     /transl_table=11
                     /translation="MNPPLVSARRAGFWNCDACHLLVRARPLAHGCHARCPRCGAELR
                     SRKPNSLSRTWALTIAAYILYIPANLLPVMTVVMSGHGEPDTILSGVKELLESGMWPL
                     ALLVFFASITVPVLKLLTLTYLLISVGRKSHTRPRQRTFLYRLTESVGRWSMIDIFVI
                     SILVALVKVGALATIEAGAGAVAFSGVVVITMFAAMSFDPRLIWDALEQSDEPKP"
     CDS             450794..452494
                     /codon_start=1
                     /gene="pqiB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010940385.1"
                     /locus_tag="MishRS11D_03900"
                     /product="paraquat-inducible protein B"
                     /protein_id="BBL73292.1"
                     /transl_table=11
                     /translation="MSQNHNEPSPPSADIPPEALVEESRSLPLVWLIPLVAGLIGLWL
                     AYKTLSEQGPLISITFKEAVGLEAGKTKIKYKDVEVGLLQTVELSGDLSKVVATARMS
                     KTVASHLGADSRFWVVKPQLGLGGVSGLDTLIAGNYIAVEFGSGKPGKDFIGLEHAPK
                     ISADTPGRVFILVSYDAGALKEGAPIYFRNIQVGRVVETRLADNKQSVRTEIFIDAPF
                     DQLVHDKTRFWLTDAIDMSMDAQGFNLKVGSLLSMLVGGIAFDTPDVADPGSQESVAG
                     TEFTLHPNFTDVGEGAHSHKQTFLLYFDDSVRGLRRGAPVEVRGMRVGTVTDVRLDLD
                     FQTKKFRIPVTVELDPEDFASGDAVKKYLASYRDQIAQGRRPVIEGLVAQGMRARLKT
                     GSLLTGQLYVDLDLYPDVPPKTLAYGGPYPEIPTLPSLSDELQKSAMDIMASLKKIPF
                     EKIGNELLGTVQGTNRLVNTPELQQTIRDLDAAMKQVETLAKTADTHVAALATGMEQS
                     LGSVKKALGQLEPGAPMTVNLNKALEELSSAARSLRNLSDYLDRHPDALLKGKSGATP
                     "
     CDS             452491..453093
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03910"
                     /product="hypothetical protein"
                     /protein_id="BBL73293.1"
                     /transl_table=11
                     /translation="MRRSLLILAYAVLLSAAGCGSTPPTRFYTLAPLAASGAKTEAAG
                     LGLALGLGPVELPKSMDRPQIVTRSGANELKLAEFDRWAEPVQDNVVQVLAENLSLLL
                     PGQKVVVYPWNRSQEIDYQVAVRVVRYDRADSGDVVLKARWSVSSPTNDNELLAREAS
                     YTAHPAGPDYRATVEAMNHALNDLSRDVAAAVKGLRGASL"
     CDS             453406..454014
                     /codon_start=1
                     /gene="fabA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9A246"
                     /locus_tag="MishRS11D_03920"
                     /product="3-hydroxydecanoyl-[acyl-carrier-protein]
                     dehydratase"
                     /protein_id="BBL73294.1"
                     /transl_table=11
                     /translation="MREAVRAGGFRTITGIEATSGNIMISKEPELKQRQHSYTREELI
                     QCGRGEMFGPGNAELPLPPMLMFDRITHINSEGGLYEKGSIIAELDVCPDLWFFDCHF
                     MNDPVMPGCLGLDAMWQMIGFYLGWMGGKGRGRALGVGEVKFRGQVLPTNRLVVYRIN
                     LKRVIMRKLVMGIADAELECDGKVIYEASDLRVGLFTSTDAF"
     CDS             454029..455246
                     /codon_start=1
                     /gene="fabB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072970.1"
                     /locus_tag="MishRS11D_03930"
                     /product="beta-ketoacyl-[acyl-carrier-protein] synthase I"
                     /protein_id="BBL73295.1"
                     /transl_table=11
                     /translation="MKRVVVTGIGVVSSLGNNRSEVTDALRQGRSGIRFSEEYREMKF
                     RSQVHGPIKLDPDELIDRKIRRFMGDGAAYNYLAMQEAIGDAGLEESEVSNPRTGLVM
                     GSGGPSTSNLLLAWDSYREKGIKKVGPYMVPRTMSNTNSACLATPFKIKGVNYSISSA
                     CATSAHCVGNAAELIQLGKQDVVFAGGGEEVHWTMTVLFDAMNALSSKYNDTPEVASR
                     AYDADRDGFVISGGAGVLVLEELEHAKARGAKIYGELIGYGATSDGYDMVQPSGEGAV
                     RCMRQAMEQVAGPIDYINAHGTSTPIGDIRELQAVKEVFGAEIPPISSTKSLSGHALG
                     AAGVHEAIYSLLMMEGRFICASANIDNLDPGADGVPIVRQRIDNARIDIAMSNSFGFG
                     GTNASLVFQRYGG"
     CDS             455236..456114
                     /codon_start=1
                     /gene="ttcA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KKM7"
                     /locus_tag="MishRS11D_03940"
                     /product="tRNA 2-thiocytidine biosynthesis protein TtcA"
                     /protein_id="BBL73296.1"
                     /transl_table=11
                     /translation="MVDSATLALGEKQRYEFNKLQKRLRRQVGEAIADYRMIEAGDKV
                     MVCLSGGKDSYTLLDILLSLQMSAPVRFEIVAVNLDQKQPGFPEHILPKYLESRGVPF
                     DIIEQDTYSIVKRVVPEGKTTCGLCSRLRRGVLYRYAAENGITKIALGHHRDDILETF
                     FLNLFYGGALKAMPPKLLSDDRRHVVIRPLAYCKERDIAAYAEVRDFPLIPCNLCGSQ
                     ENLQRQAMKAMLAEWEKRHPGRVETIFTALGNVAPSQLADRALFDFAGLERLRGTGAA
                     SAGEVDTAAGLEVLFL"
     CDS             457117..458016
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103436.1"
                     /locus_tag="MishRS11D_03950"
                     /product="NAD-dependent dehydratase"
                     /protein_id="BBL73297.1"
                     /transl_table=11
                     /translation="MRIFVTGGTGLIGRALCKALSESGHHLTVLSRDPAAAKLKCGPG
                     VEIVDSLEVWTPASRFDAVINLAGAPIADRRWSESRKRALWESRVDLTRRLVEAMGRA
                     DQKPAVLIGGSAIGVYGDRGDETLDEASDCRGEGFSERLCAAWEAETLNAAALGIRVC
                     LLRTGLVVAPRGGFLARMLPLFKLGLGGRIGDGRQWMSWVHLDDHIALTRFLIDSPHL
                     AGVFNATAPRPVTNAEFTARLAAALKRPALLPVPAGPLRLGLGEMAELLLGGQRVLPG
                     RAREAGFEFRFETLESALRDVLG"
     CDS             complement(458100..459569)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142005.1"
                     /locus_tag="MishRS11D_03960"
                     /product="phenylacetate--CoA ligase"
                     /protein_id="BBL73298.1"
                     /transl_table=11
                     /translation="MPNPFFSTSLDDRLAQHAALDGPTTLLDWFRATAPEVPAYRRFL
                     AGHGLAPESVATFEDFARLPLTNKPNYMHAHPLPERCRGGSLLDCDRVAVSSGSTGQP
                     TFWPRSVRHEFDIALRFEQVFRDSFQAHERPTLAVVCFALGNWVGGLYTASCLWHLGQ
                     KGYPLLVATPGNKQEEIFRVVRELAPHFEQTVLLGYPPFVKDVIDAGLAEGIDWPRHR
                     IKLVFAGEVFSEEWRSLVGQRTGSTAVCYDSASLYGTADGGVLGNETPLSIAARRFLA
                     QHPQAARELFGESRLPTLVQYDPLSRYFELHEGTLVVSGDNGVPLFRYHIADKGGLVG
                     HAELLAFLADHGAKLEDYGLDPARPTRALPFAYVFGRADFTVSYYGANIYPENIAVGL
                     EQPDIQAFATGKFVLEVRETPAGDSELRVTVELLPGIAADAGKAARLAESIRAQLLRL
                     NSEFANYIPAERQTPRVELKPFGDAGYFPAGVKHRYTRR"
     CDS             complement(459668..460759)
                     /codon_start=1
                     /gene="potA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3MRF7"
                     /locus_tag="MishRS11D_03970"
                     /product="spermidine/putrescine import ATP-binding
                     protein PotA"
                     /protein_id="BBL73299.1"
                     /transl_table=11
                     /translation="MNPTPIVQFQAVVKRYDGKTILPGLDLAVNEGEFLTLLGPSGCG
                     KTTALRLLAGFETPDAGEVRLDGGCVNALPPHRRPVNTVFQSYALFPHMTVFDNVAFG
                     LRMAKTPRADIPPRVAEALAGVQLEDLAGRKPHQLSGGQQQRVALARALVNRPRVLLL
                     DESLSALDYRLRKEMQRELKALQTRLGLTFLFVTHDQEEALSMSDRVAVMRAGRIEQI
                     GTPREIYQHPVSLFVAGFVGESNRLDAVVTALPGPGRIAARVEGLDCVFGSGRTWAVG
                     DKVHVLLRPEHLRLEPEAAAPGRLRGTITAQTYKGMGLDTVVELDGGKRVLASGFLGG
                     EDQTGGYKAGQRVAVAWMAGAETVLPAEA"
     CDS             complement(460764..461984)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03980"
                     /product="hypothetical protein"
                     /protein_id="BBL73300.1"
                     /transl_table=11
                     /translation="MPNRYDAPANDHAPDAMSLQYFDDVPIMPYTRLLGGGSPHEGGP
                     VWPDWERQTTARHCRKGQPCDHPPIELPIEDILAEPVAWAGPIVPHFGHQISEFSLRI
                     LPTLAEWPEAVFAFAANPLRKITSPATAPGFFRDILAWFGVAPERTRVLAKPTLAPRL
                     CVAPQAEQLGRIGPAPDYLDLLDALARQRLGRPVRRGRLYVSRAGQSARFAGERYLET
                     ALVAAGVTVFRPEKVALAQQLRRYAIAEHVIFAEGSALHGTQLLGRTLGRVSILCRRP
                     GSRVAEVFVQPRAQSLEYLDFGAKLIHGLDEAGKAADSRGITVLDEALLLDGLERLGI
                     PIRRHWDSARYQAACVADTKEWLAHFARGRRLAVPGARERVLACLAACGFAALAPAID
                     APPPRPARAASTSR"
     CDS             complement(461995..463380)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_03990"
                     /product="hypothetical protein"
                     /protein_id="BBL73301.1"
                     /transl_table=11
                     /translation="MIIGPRGPRPVAAALALLALSGCTLLQTTLTLPERAVSRILPQK
                     DGDTADPVELQQQLMRFSDDFLASMLGASESLRRNGQKLDPIELRTLQLQYTDNIQAV
                     ATGQNAFADLLDMAALVALTRMTVEDHWIPGEYRESARPLLNACREGEKQIWQIADGV
                     LAPGQIAELRKAIAAWHRDNPTPEAFRTVRALGFSSMIAKASRPTDASRFPSVFKLLD
                     IDPLSGLDPATRELAQTRLFAERALFLAQRLPNLVRQQTELLALQTAGLPELREAIAA
                     STQLAAAADRFSQTTERLPDVIGHERAQILAALADQQRGLTALAAETRQAFTAGTQMA
                     AGTDQALRTFGAVAAQLTADTGPPRPDAEPFRIADYTAAAARIEQAAARLTGLLDAFG
                     HSTDPARFERLAAGFDRLGAKARTEAQAVVDYAFQKALCLIAILCGAVLATALAYRWA
                     AERLRRPPQDR"
     CDS             463431..464015
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04000"
                     /product="hypothetical protein"
                     /protein_id="BBL73302.1"
                     /transl_table=11
                     /translation="MRVVKLIGILALGWALGGTAWARGGGGGHGGGGHYGGGHWGGGY
                     RGGGYWGHGYYGGRPFRGYSSFGFYFGPGWGWPYPGPYYYPYYAYPPAIVAVPAEPPV
                     YIERGAAGSAGPRPWHYCPDPPGYAPYVKDCPAGWQAIAPAPMGQEPGYWYRCDDPRG
                     RYPYVRDCPSGWRKAIPEPAATNPAPNPNPMEPP"
     CDS             464012..464527
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04010"
                     /product="hypothetical protein"
                     /protein_id="BBL73303.1"
                     /transl_table=11
                     /translation="MNPPSRALPWIVLPLLGACATTPSGPSVLVLPGTGKGFEQFRGD
                     DYQCRQFALFQTGGKTASQAALASGVGAAVIGTAVGAAAGAAIGGGQGAAVGSGVGLA
                     TGTLAGTGTAQAAGEDAQERYDIGYIQCMYAKGHRVPVPGHILYEDRQSTYPPPPDTA
                     PAAVQPPPPSP"
     CDS             464716..465378
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189255.1"
                     /locus_tag="MishRS11D_04020"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL73304.1"
                     /transl_table=11
                     /translation="MRLLLAEDDPMIGKSVQIGLKKEAYAVDWVRDGIAAELALGNDV
                     YDLLLLDLGLPRKSGLEVLAGLRAKKNTLPVLILTARDAVADRVKGLDGGADDYLVKP
                     FDLDELTARIRALLRRRGGRAEPVIEHGALRVNPVSHEVSLDGQPIALSAREFALLSA
                     LLERPGVPLSRKQLEDRIYGWGEEIESNAVEVYIHALRRKLGPDWVRNVRGVGYLLPN
                     QP"
     CDS             465375..466670
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004526222.1"
                     /locus_tag="MishRS11D_04030"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBL73305.1"
                     /transl_table=11
                     /translation="MKSIRRKLIATLLGAIITALLLGASAIYFTAREEAGALFDYHLR
                     QIALSLRNPAFGAVWMPPVDADEEDFDFVIQVWDATGVRLYYSQPHVELPGFMDGGYA
                     TVETREGAWRVFAIRSRSQVIQVAQPMRVRDHMALEAALRVLLPLLLLLPVLSAAIWV
                     LVSRGLEPLNRLARAVATRTPKALDPLPEAQAPQEARPLVRSLNDLLVRLGDALAAQQ
                     AFIADAAHELRTPIAALQLQAQLVERAETEEDRRAALDDLKAGVGRAVQQLLTLARQD
                     PDLAAKPFEPVLLGELARQVVAEHLPLAEAKHIDLGVVATDDGLKVQGDPAALRVLVA
                     NLVENGLRYTPEGGRVDLSVWRAEGRPLLEVRDTGPGIAEADRARVFDRFYRGEATHE
                     PGTGLGLSIVKTIADRHGARVGLENGAGGGLRVRVVFAA"
     CDS             complement(467272..467580)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04040"
                     /product="hypothetical protein"
                     /protein_id="BBL73306.1"
                     /transl_table=11
                     /translation="MRNRTLPFGLIPALLGSVLMFATADLPAQETATTTPASESTTTQ
                     TTTEPTSTATDTSAAKTAAACTKRCIDISGNYQSCKNVNNIPMYTCTSPNNICSGACF
                     "
     CDS             complement(467676..471032)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04050"
                     /product="hypothetical protein"
                     /protein_id="BBL73307.1"
                     /transl_table=11
                     /translation="MARIHSPARRRRPATTDGPASHRAVLSCLVLALACTATAEAQTC
                     SDWAARLASAEGQVEVHTDTGHWQPVVVDQRFCAGDKIRTQTQSRASLQLANQTYMTL
                     DQRSTLVFRTVEAEKPSWVELIAGTLFARSRTPRSLDIHSHFINATIKGTEFLVSAEP
                     DRGEVMVIEGEVEASNPQGKVTVTDGQSAIAHAGQAPQASLTAHPEDAVQWALYFPPL
                     LDAASLAHARQPALAGAARSYAEGRVADALARLQQIPPAQRDPDTTAALAGVLLSVGR
                     VDEAEPLLAAPRGKPVPASFTALRSVIALARNHKAEALKLADAALAADAQSTYGWLAR
                     SYALQAGFDLEAALAAAERAAAISPDNALVQSRRATLLASLDRWTEAQAAAELATRLD
                     GGQSRPWVVRGFAELRRGDLDAGKSSFEEAARLNPADPMARLGRGLALIREGDLAEGT
                     ADMEIAASLDPGDSLIRSYLGKAYYEQKRGKVAEKQFDLAERFDPNDPTPWYYNAIMK
                     QTVNRPVEALHDLQRSMKLNGNRAVYRSKLALDEDLAARGAALGRIYGQLGFQPRAWI
                     EGWKALEDDPTDYTSHRLLSDTYFALPRSDIARVSELLQSQLLQPINITPVQPLLAES
                     SVFLLGGLGPADLSLQEFNPLFQRNRFSLLASGMVGSNDTYSDEVVHTGLWDDFSYSL
                     GQFHYQTQGFRPNNNINSNLYNAFVQGRVTPWLNVQAEYRHQEVGRGDLDSRFAPDAF
                     QQFVIDNYKQASETDTYRFGLHANPSEHGDFLASYIHLDRSATEGYLSNSNFDQLTHN
                     HGDTGEAQYIQRYENVKAILGGGYYQLDTTSQLKIRPVGSANSTSQGNGYLYTHIRYP
                     QQMNWTLGLSVDALDNGSAPTTAQVNPKFGLLWNISPDTVLRMAAFRTMKRNLLTGQT
                     LEPTQVAGFNQFFDDLNGTDATRWGLGLDQRFNLDVLGGVEFSRRELALPSDLTESHW
                     RETQYRAYLLWTPHSRWNTSLEYFREQFDNSSGSAALNTRTQTLPLTISYFDPSGLYT
                     NLKATYFHQDVDLPGGWQSEDVPFLDLGLGYRLPNRWGLAEIQFQNLLDRNYHYEGLQ
                     DRRPPQIGGIPAFLPFPPEFTVFARFTLAL"
     CDS             complement(471047..473314)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04060"
                     /product="hypothetical protein"
                     /protein_id="BBL73308.1"
                     /transl_table=11
                     /translation="MTGRKRRTRPQFQLGWLPLLTALGGALFSLSPLRGPLEEGIGLG
                     LLYALRGPASPPGEVAILGIDHESAQRLQAPDDPHNWPRHLHANILRNAQRGQAELLA
                     FNIFFANASADPGADRAMAEAMRGLGRTVLTDYVKPRQLRSGLYVESLVEPTPELADA
                     ALATAPFLLPRDTLSASSAFLTFFGDEERRATLPTLLMLAYIQRTHCAELGAWLGSAD
                     PELARIAAQSPPCQTRPKEFEPTLRLLIEQLRARPGLEASLEQALLNSRFPAATRRLL
                     RSWAGVLAGGEVRYFNHYGPSHSFPILSYQDWVGDPPESTLAALAGKIVLVGYLEDFQ
                     PESTEGLFYTPFSAISSVELAATALANLLEDKWVRPAFSPVGEGLWLLFWGGVLGLCA
                     MRRSAARGFALILGLGGLYLAAACALFGLRGDWLPLVAPLGLQLPIALLTWGWLNYVR
                     RAERERAMQSVIHRFIPVDVFSQLSRHEDSATLPNYGRMAQGICLATDAGRYTALAET
                     LEPMALARLMNAYYAALFEPVTRHGGWVSDVVGDAMLAIWIARDDDPGAQEARANALA
                     AASAIRLAVRRFEKTHELVFPVRLGIHYGELRIGYVGTAERGEIRAVGDTVNTAARLE
                     GLNKLLGTHSLVSERTLEDLPDAGVRPLGAFLLPGKSKPISVAELITDPEAGPCPELR
                     QRFADALALFNEDRWQEAHAAFTLLNLHFPDDGPTRFYYKTCQSYLAEPPQGSDTPGI
                     AVEKPPPAELFNHKK"
     CDS             473875..475749
                     /codon_start=1
                     /gene="thiC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P9E7"
                     /locus_tag="MishRS11D_04070"
                     /product="phosphomethylpyrimidine synthase"
                     /protein_id="BBL73309.1"
                     /transl_table=11
                     /translation="MNALAHELPHLAVAAKRASIQPFAASEKVYVQGSRPDIRVPMRK
                     ITQSDTPTGFGAEQNPPLHVYDTSGPYTDPEVQIDLRQGLPALRAGWIAERGDTEALS
                     GPSSAYGRQRQSDQALAGLRFEHIQPPRRARPGANVTQMHYARRGIVTPEMEFIAIRE
                     NQKLEALAEMYRFQHPGEAFGAAIPKIITPEFVRDEVARGRAIIPANINHPESEPMII
                     GRNFLVKINCNLGNSAVTSSIEEEVEKMLWSIRWGGDTVMDLSTGKNIHETREWIIRN
                     SPVPIGTVPIYQALEKVNGKAEELTWEIFRDTLIEQAEQGVDYFTIHAGIRLPFIPLT
                     AKRVTGIVSRGGSIMAKWCLAHHKESFLYTHFEDICEIMKAYDVSFSLGDGLRPGSIA
                     DANDEAQFAELKTLGELTEIAWKHDVQVMIEGPGHVPMHMIKENMDKQLELCHEAPFY
                     TLGPLTTDIAPGYDHITSAIGAAMIGWFGTAMLCYVTPKEHLGLPNKQDVRDGIVAYK
                     IAAHAADLGKGHPGAQSRDNALSKARFEFRWADQFNLSLDPEKAVEFHDETLPQEGAK
                     LAHFCSMCGPHFCSMKITQDVREYAKTHGVDEAQALAAGMEEKAGEFVKAGAEIYRKA
                     "
     CDS             475769..476155
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04080"
                     /product="hypothetical protein"
                     /protein_id="BBL73310.1"
                     /transl_table=11
                     /translation="MTVGENFADAALLKTESRVENADQFYGLSAECAVKSALVLLPAF
                     SADSRLDESYRKHVNVLWNHINLQSLQRAYPSLVDLLDKNNPFEDWSVDQRYCADGYL
                     SAQTMENHRNAARRLLGAVGLSGVRK"
     CDS             476239..477489
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04090"
                     /product="hypothetical protein"
                     /protein_id="BBL73311.1"
                     /transl_table=11
                     /translation="MIRDALGKLVVTIPDNAMSDSAEWDALADELHRALGIYSPGSKR
                     ILLRHSDLVVPEDILDSPDRVRFPDASKTWLIDRLQTNQDWLRKPLVEQPPLPAAVAF
                     SIKGGVGRTTAFALWAWYLAKQSKNVVLVDLEAPGVAGVLLDEDHMPDYGLVDWLVEC
                     LVGQPNEALLRECMVDCALSNDEPGRIRVLPAFGRKTQDYVNKLGRIYMPTFRAETGE
                     FSGLAERLLILLQQLAGLFDKPDAVLLDARAGLHDIGSAAVTRLGAKVFLFARDEYQS
                     WQAYKKLFQHLRMAQSVEWGMPENDLRWRLSMVAAQTESTDAARLRFVERSYETWQEF
                     YDTDEIEEEEKKKLGREPQLFNPEDTGPHQPAFIGFDPRVRSFDLIDSQARPSWQAVE
                     QAFGKFFPNATTRLLQNNLAQETI"
     CDS             477492..478970
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011390741.1"
                     /locus_tag="MishRS11D_04100"
                     /product="hypothetical protein"
                     /protein_id="BBL73312.1"
                     /transl_table=11
                     /translation="MIRSLLQFDANTFRQALINLPPTQAKETLDAPQLSEIYVPPKHG
                     KALSPEYNIVVGMRGAGKSFWTAVLNDEKTHRFVADAARVQGLANIVVRVGFGLDPSD
                     KDFPNRASIESLLSRNYRPDAIWQAVLLRHALIYLNRDLPFNTGWEAAVSWVETHSGE
                     VDKYLAECDQALQEQGKVLLLFDSLDRLADDWKKIRGILSAALKLCLECRSRRAIRFK
                     FFLRPDMVEENDDIWSFADSSKLLHAKPELEWRPNDLYGVIFLHLANSVIVGEEFRNI
                     LSQKTSVQWQIMDGAYLFPRNIDEELIRGIVEAITGPWMGASAKKGYTYTWIPVHLSD
                     AKRRLSPRSILLAFKEAAEWTDANRPNHNLALHYEGVQQGVVKASEIRVRELKEDYPW
                     VEPLLRALKGSAVPLTFDELREKWTEACVQESLDAASTNQRLPPRRYSNDPSPGRKLD
                     SLVDDLVELAVLYRTEDKRYNMPDIFRVGFGIKRKGGVRPPR"
     CDS             479539..479754
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04110"
                     /product="hypothetical protein"
                     /protein_id="BBL73313.1"
                     /transl_table=11
                     /translation="MARERVRPGGFYIADNVLWHGRVARECLPDAVPGWTEAIREHNR
                     LIFTDSGFDAFVNPTRDGMVVARRKTG"
     CDS             479857..480387
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04120"
                     /product="hypothetical protein"
                     /protein_id="BBL73314.1"
                     /transl_table=11
                     /translation="MLQPRPPGQRSAPYGGDRGDRDGERTDYLKDREADFLLIEFGKL
                     QDEILSATQEKWRLEHTVILLNILLLAFGYIAPAQVDPHYFALPFAITLLGGMRTLML
                     WLHLKRAGNYLTKVEEVFGVHPKLGWELRLEKLDESRPYTLSLVGMTVVFWMGLLALT
                     LILAVGYHLGYWQPGA"
     CDS             complement(480437..480586)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04130"
                     /product="hypothetical protein"
                     /protein_id="BBL73315.1"
                     /transl_table=11
                     /translation="MTPVEIGLTLMLLATAGGSVAYCAHHAKRLAQMESQDSESTLPL
                     RLEVR"
     CDS             480743..481639
                     /codon_start=1
                     /gene="oxyR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036068.1"
                     /locus_tag="MishRS11D_04140"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL73316.1"
                     /transl_table=11
                     /translation="MNLRDLKYLVAVADLNHFSLAAERCCVSQPTLSTQLKKLEDELG
                     VALFERNNRSVRPTEAGGRIIAVARRVLAEVESMEEIAAATRDPYAGMFRLGGFPTLA
                     SYVFPAAVPAIAQTLPKLKLLLIEEKTDVLVEQLRTGRCDAALLALPVNDPALVSMRL
                     FDDPFLLAVPPEHPLAARERVDLRDLADLRLLLLDEGHCLRDQALNLCYRHGGHEEVD
                     FRATSLETLRMMVRAGTGITLMPWTAAREDHTGIRYLPFAEPQPRRLIGLVWRKTTAR
                     GPLIGKLIELLREVSRAWAAPG"
     CDS             481778..482554
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04150"
                     /product="hypothetical protein"
                     /protein_id="BBL73317.1"
                     /transl_table=11
                     /translation="MANIIGQVLGSIRGLFGGSPGVPPAPAPVAAEAQPEAAQLTGVA
                     KYLAQLAAEEAAAQGPVVVEFDTGVGRYVAALAENPAPAQGTGVQRYLANLAAETAVS
                     GETEADRAAAAAYRARAGGKTGVANYLGGLGLPEVPVVVKKTRVEQYLANLAASSAPV
                     PAAAEATPAEAAVPAEAPEAVAEPEAAVAAEAPAASGLVDLSTGAKQCQASTLKGTQC
                     RNTSGLERIQRTIEGKAYQFLACAHHVGESFKPYGGVLGG"
     CDS             482612..483256
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707003.1"
                     /locus_tag="MishRS11D_04160"
                     /product="membrane protein"
                     /protein_id="BBL73318.1"
                     /transl_table=11
                     /translation="MPVPHRLRPDAPLPMPAYWTPAFLAACVGSAIAPYDLVTWCLEI
                     PPALAIFLALRATRRRFPLTPLSYAALFILCGLILLGAHYSFARVPGFDALGGGRNGF
                     DKLAHFFQGFAPALAFRELLLRGGVVARRVWLDYLVPALCLALSAAYELVEWGVAWLL
                     GGRAEAFLAIQGDVWDAQSDMAAALLGAVLAVALLGRGHDRQIARLARERCYPS"
     CDS             483360..484340
                     /codon_start=1
                     /gene="dusB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HUW1"
                     /locus_tag="MishRS11D_04170"
                     /product="tRNA-dihydrouridine synthase B"
                     /protein_id="BBL73319.1"
                     /transl_table=11
                     /translation="MHIGPYRLSNRLILAPMAGVTDRPFRRLCRRYGAALAVSEMVSA
                     NPALRDDPKTLLRTDHVGEPGPHSVQILGNDPAEMAEAARINVDRGAQIIDINMGCPA
                     KKVCNKAAGSALLQDEALVGRILAAVVGAVAVPVTLKIRTGWHPEHRNAPAIARIAED
                     SGIQAIAVHGRTRACGFAGEAEYRTIREVKRAVGIPVIANGDIDSPDKAAAVLAATGA
                     DAVMVGRAALGRPWLFRAMAARLDGLRPADAPAPAEVHAVMLEHLRELHALHGEYRGL
                     RIARKHVAWYLQYLPCPPGFLPLFNGLDSAARQLALIDTLFDPHRAGVAA"
     CDS             484337..484630
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04180"
                     /product="hypothetical protein"
                     /protein_id="BBL73320.1"
                     /transl_table=11
                     /translation="MTVDPASIPPAPDAAIPPGPGAAPILSEQVRLALRHYFAGLDGY
                     AATGLHAMVISEVEKPLIETVLEHCGHNQSRAAQVLGLSRSTLRKKMNQYGIE"
     CDS             484663..486225
                     /codon_start=1
                     /gene="purH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q74FJ9"
                     /locus_tag="MishRS11D_04190"
                     /product="bifunctional purine biosynthesis protein PurH"
                     /protein_id="BBL73321.1"
                     /transl_table=11
                     /translation="MNNPVTRALISVSDKTGVVDFCRELAALGIAILSSGGTARLLLD
                     SGIAAIEVSQHTGFPEMMGGRIKTLHPKIHGGILGRRGVDEAVMAEHGIGPIDLVVVN
                     LYPFEATVAQPGCPLAEAIENIDIGGPAMIRGAAKNHDAVGVVVDPLDYPLVLRELKE
                     NGGALSAATRFRLAIKSFRHTAAYDASISTYLGKIEGGEPFPDPLVTRFRHGQALRYG
                     ENPHQRAAFYVDPGAAPGTVATARQIQGKELSYNNIADADAALECVKQFAESPACVIV
                     KHANPCGVAEGQSLLEAYDRAYATDPTSAFGGIIAFNRALDAETARAIVERQFVEVIL
                     APGIAPDALPILAAKANVRVLETGAWPAEPKPEWDYKRVAGGLLVQDKDLGRVERAGL
                     KLVSRRAPTEAEIADLLFAWNVAKFVKSNAIVYAKDRQTVGVGAGQMSRVYSARIAAI
                     KAQDVGLQVAGSVVASDAFFPFRDGVDSAAEAGVTAVIQPGGSVRDAEVVAAADEHGL
                     AMVFTGMRHFRH"
     CDS             486310..487545
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WF32"
                     /locus_tag="MishRS11D_04200"
                     /product="glycolate oxidase iron-sulfur subunit"
                     /protein_id="BBL73322.1"
                     /transl_table=11
                     /translation="MNRPDLAADTDLCVKCGLCLPHCPTYLQTQDENESPRGRLSLIQ
                     GWARGALAATPELVRHVDNCLLCRACEAACPAYVPYGGIVDRFRGEVGELGKSSAAKL
                     KTAALRKLLVGGGVRHRAESLMAGALGGAVLRGGGFLLEAAGLGEVAAGLPASAGATD
                     WSGVHPASGPAETGRADLFLGCTANLLDAETVSATLRLLNRLGVRVRVPEAQACCGAL
                     HGHGGDARTAAALMERNLAAFDGEDAIVGFASGCGAMLRDYRERAATEAAARFAGRVR
                     DIGEFLAGLPWPDDLALLPLEAKAVVHAPCTLKNVLKADRHAAVLLRRIPGLEVVPLP
                     AQVRCCGAAGSYSLEHPEMAGALRDEVLDRVAAERPAFLATSNPGCAMHLRAGLKRRG
                     LGGVEVLHPVALLARCLPG"
     CDS             complement(487658..492442)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04210"
                     /product="hypothetical protein"
                     /protein_id="BBL73323.1"
                     /transl_table=11
                     /translation="MANKFFWSTVTETNNNATIGSFDPSADIFVFDHDSSSNEISAAQ
                     VTISTVGNSPTGDVTFSYNDNGTTKTVTITGLSLSELTTTTSDAFGNVRFNDQSVLIV
                     GDNISNTPGATTLDNAANTLTGGPGNDQLVGLGGNDSLVGKGGDDLLIGNGFGTTGTD
                     ILVGGAGNDTYVVDNSADVITESSGAANGTADLVQSSVSFTLAANVEQLTLLDTSYGV
                     SVGAINGTGNTAGNNILTGNSSANTLSDNNGTAKDTLVGGLGNDTYIIGNTSDVITES
                     GGTSGGIDLIQTAKTYSISSLADIEQLTLTGSANIDGTGNAANNTLLGNSGNNNLNGG
                     TGADSMAGGTGNDTYTVDNLGDTATESLNSGTDLVQSSVNFTLGTNVEQLTLTGSAVS
                     GTGNTAANTIIGNASDNTLSDGGIGLADSMVGGAGNDTYTVNNTGDIINETANGGAGT
                     DSVNSSVTFTLATGVEKLTLADSGGAINGTGNAAANTIVGNSLANILSDGGVGSPDSL
                     DGQLGNDTYLVNNSGDIISDSGGTDTVQSTKTYDLSANATTVDKLTLLDSGGAINATG
                     NSLANTITGNTAANTLDDGGSNAADSMAGGAGNDTYVVHNSGDTISDSSGTDTVQSSV
                     DFTLAATSGIEILTLTGAGNIDATGSTAANTLNGNGGDNVLTDGGTSADSMAGGAGND
                     TYFVNNIGDKITESSGAANGTADWVQSSVTFTLTDNIEKLSLLGTTSAINGKGNSSSN
                     TIIGNGGNNILDDGTATPNAGGADSMDGGDGNDTYLVNHSGDTITDSNGTDLVQSTVT
                     YDLSTKATTVDKLTLLDSGGAINATGNALANTITGNSLANTLSDGGAGAADSMAGLAG
                     DDTYTVNNAGDTISDSAGTDLVQSNVSFTLTATSGIEKLTLLSNANAINATGNALANT
                     ITGNSLANTLSDGGAGAADSLIGGAGNDTYVVNNTGDAISDTGGDSADLIQSTVTFSL
                     SSASVSGVEKLTLTGTSAINGTGNTAANTIIGNDGANTLSDGGSNSADSLAGGKGSDT
                     YIVNNASDTISESGTSTAEGTADLVQSFVTSFTLSSNVEQLTLMTGAVNGTGSGDATN
                     NLITGNSSANTLNDGGGDGNDTLNGGAGNDTLVATSSGIDTLNGGDGSDLYQVSVDNS
                     STTTTINISDSGTVTSDVDTVEATLATGETFTLENINSIEKLTLLGPANSSGTGNLLN
                     NTITGNTGANVLVGLAGNDILYDGASTAANSSAADSMNGGVGNDTYYVTNSNDKVSEA
                     ASDIGDQSADGSGTDIVFASVSFTLDDAGTIEKLTLTANSITGTGNFQDNTIVGSTGS
                     NTLLGGAGNDILDDGITASGSADSMNGQDGNDTYFVHHTGDTVVDSSGTDTVQSTVTF
                     TLANSIENLTLLDVGGAINGTGSTAANKIIGNSSVNTLSGGSDTASDTLQGGGGNDII
                     TVGGGKDTVVFEANAVANGLGDSVSGFTVGSGSSADKLDFNNFFGAATNITVLPAVAE
                     GSSGAVAIATGNVLQVIDTGGNLDATGIAALFGTGKPFEAALASEKFVMITADTSGDA
                     KGWYIDVGANAIVDASDVSQVVTLVGVNNLATTPLVSANIVA"
     CDS             complement(492950..493750)
                     /codon_start=1
                     /gene="speD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I5R7"
                     /locus_tag="MishRS11D_04220"
                     /product="S-adenosylmethionine decarboxylase proenzyme"
                     /protein_id="BBL73324.1"
                     /transl_table=11
                     /translation="MEIDKLQLHGFNNLTKSLSFNIYDICYAKTEQQQRRYIEYIDEM
                     YNAKRLTQILTDVNAIIGAEILNIARQDYEPQGASVTMLISEGHVPDTITNLEAPGPM
                     PDSVVAHLNKSHITVHTYPESHPYGGISTFRADIDVSTCGRISPLKALNYLIHSFESD
                     IVIMDYRVRGFTRDISGQKHYIDHEITSIQNYISDVTAERYQMIDVNVYQEKIFHTKM
                     ILKDFHLDNYLFDTDKDALTLEERTAIQKQLQREMAEIFYGRNYKLRR"
     CDS             complement(493854..494270)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003401957.1"
                     /locus_tag="MishRS11D_04230"
                     /product="peroxiredoxin"
                     /protein_id="BBL73325.1"
                     /transl_table=11
                     /translation="MKARVKWVENVLFLGESGSGHVVAMDGPPESGGKNLAARPMETL
                     LIGMGGCTAFDVVHILRKGRHEVRDCEVRLEAERADTDPKVFTKIHIHFVVKGQGLTD
                     KAVARAVELSAEKYCSASIMLGKTAAITHDYEIAED"
     CDS             494395..495051
                     /codon_start=1
                     /gene="clp"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P22260"
                     /locus_tag="MishRS11D_04240"
                     /product="CRP-like protein Clp"
                     /protein_id="BBL73326.1"
                     /transl_table=11
                     /translation="MPIPSASPPADEALQRLLQHCHRRRYPSKATIIKPGDAGDTLYY
                     IVEGSCTVSMHNKETGEDIVLAYLNRGEFLGEMGVFMGSMVRDVTVRTREASQLAEIG
                     YQRLHHLLTADLAEHAIAILSSLGRQVSTRLLDTSRKVRSLALLDVSGRIAHALIELS
                     KQPDAMTHPDGMQIRVTRQELGRLVGCSREMAGRVLKNLEEQGLVTVKGKTIVVLGAR
                     "
     CDS             complement(495341..496450)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010925698.1"
                     /locus_tag="MishRS11D_04250"
                     /product="glycosyl transferase"
                     /protein_id="BBL73327.1"
                     /transl_table=11
                     /translation="MKTIHIDLGRHLYGGGRQVVHLLEGLAALPGEPVLVCREGSELS
                     RAVRNPAVRVRALPFRGDLDLAWTGRLRRLIREEKPDLLHVHSRIGGFLTALAGTLEH
                     IPMVHSRRVDNPPHWIDLKFRFPLFRRIVTISEGIRQVMLAHGVPAAQLVCVPSAVDT
                     GRYRPGGGRGAFRCELGLAEDCVLVGVVAQMIPRKGHEVLFDALPAVLARHPAIRVLL
                     FGKGPLEPELRRMVRTRGLEGNVMFAGYRTDMHRVIPCLDLVAHPAWMEGLGVALLET
                     AACGVPLVAARAGGMPEIVHPGVNGYLIEPGDSHALTGYLLDLLDHPERRREFGEAGR
                     RLVLERFSVERMVAGNYAVYREALDQGGSDGSIRR"
     CDS             complement(496447..497496)
                     /codon_start=1
                     /gene="waaC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004194964.1"
                     /locus_tag="MishRS11D_04260"
                     /product="heptosyltransferase I"
                     /protein_id="BBL73328.1"
                     /transl_table=11
                     /translation="MNQTPPRSILIVRLSAIGDVILASGLIPALRLAYPDARLAWLTD
                     APQADLLRHNPRLDRLHLWPRRRWRELRQGGEYRQLLREVAGLVRELRAERYDWVLDL
                     QGLLKSGVWAYAAGGKRRIGLGSREGSRFLMTEVLDRNVDSPLIGKEYRKLARFLGAD
                     GFALDIAVSAADRAEAAAIKASSGITGAYAVIAPFTTRPQKHWFDEHWAELARKIRAE
                     RGWPVLMLGGPTDRAHAAALRALAGDALTDLVGQTGLGLCAALIENARGLIGVDTGLT
                     HLGIALKTPTLALFGSTRPYLDTGSSTARVLYQALDCSPCRRRPTCGGTYDCMRLHSP
                     DTVLAALAPLLETAA"
     CDS             complement(497493..498176)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011339247.1"
                     /locus_tag="MishRS11D_04270"
                     /product="hypothetical protein"
                     /protein_id="BBL73329.1"
                     /transl_table=11
                     /translation="MLLSLKYNFLFVHIAKTGGTSVRDSLWFYKWADPYRIPQFLCSR
                     LSALTGHRIGAKFPRHAKLVAAQEMLPREVFERLFKFAFVRNPWDLQVSSYHHIRRER
                     PQLITHVDSFEGFLRWKFDPERPPQYHADMSTERQSDYLIDLHGRNLADFVGRYECLA
                     EDFAEACRRIGIACPKLLHARKATDRGRDYRSYYTDTTAQWVADHYQADLALFGYRYD
                     DPQAFHFDP"
     CDS             complement(498183..499334)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011056097.1"
                     /locus_tag="MishRS11D_04280"
                     /product="glycosyl transferase"
                     /protein_id="BBL73330.1"
                     /transl_table=11
                     /translation="MTPEQRLAVLISFSGAGGVERMVLNLLPAILRQGIAVDLLAILR
                     QPVPDLVRIEGSGLRLFDLGVGHTTLAVPALVRYLKTERPTALLAAKDRAIRAAVLAK
                     ALSGVETRLVGRLGTHLSAAQAGKPAWQRWLRTQPMRWVYPKVDRVVAVSTGVAEDAV
                     RLTGLPASRVVVVRNPVITPDMADKAAEPVDHPWFGDKTCPLILGAGRLTRQKDFDTL
                     IRAFGRVRTRRECRLVILGEGKLRGDLERRVRELGLETSVALPGHVRNPYAYLAKADL
                     FALSSRWEGSCNVLTEAMALGTPVVSTDCPSGSAEILGGGRYGPLVAVGDVEKLAEAM
                     LYALDHPTAPDSLKAAVAEYNAEHSARRYLEILGFAPRDANTPATANAA"
     CDS             complement(499357..500322)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04290"
                     /product="hypothetical protein"
                     /protein_id="BBL73331.1"
                     /transl_table=11
                     /translation="MSAIDFPPVSLIIPNYNGSALLKANLPAVLRAAADYPGTASVIV
                     VDDGSRDGSAALVRGGFPQVTLVEHPVNRGFAEAIHSGVAAAPTELLVFLNSDVTPAP
                     DFLAPLAGHFARPGIFSVTPLVLDEQGRCNEVSWRCYHIRGGRLRAVQWTPPDTFSHP
                     WQTLFASGGSMMLRKSMFTALGGFLPIFKPFYSEDFDLGLRAGRRGWISLLEPRSRVV
                     HDSGSGSIKTNIAAKRIRAIRIRNHFLLEWMHLPARDIWLRLLPGYLWRSASRFVTFN
                     WVYLLGLAGALARLPEALRLRAAIQASATLDFWSLMADIEHSKHH"
     CDS             complement(500309..501502)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04300"
                     /product="hypothetical protein"
                     /protein_id="BBL73332.1"
                     /transl_table=11
                     /translation="MALRLPRLNGDLFPLLLLLSVYGFALSLLLGRGSYKPCLYLCGY
                     ATLGILASTRPPRLDRDILAVVGLGALLLGQGLAMAGDKLWGSAHTALFGATLLVFAL
                     RLLPDRLAQGRPPPHAAIAASLLLVAVLAHAIAYPLKLNQAGLYSNLHYLALFSVTTL
                     PLLFYFAATIQNRLRWLCILALAVDFWLLLKTQSRPGYLALLASALASLPFLSRRCQS
                     LALGSILLLPLGLYFSGLFGFAARVDDLAANFLKEERMIIWRETWAMQLRSPPLEWAF
                     GHGFGAYFWNYQPISSYHDKEDFTFPHNYFLEVLYSHGLLGLTLVVLAYASFFWKLAI
                     TTWRCQDQTGTRFGIMLISVASAELVQSFLTLPLFSRHQLYPFGLLLGASLYYFRKYT
                     PHERH"
     CDS             501721..504303
                     /codon_start=1
                     /gene="clpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZUP3"
                     /locus_tag="MishRS11D_04310"
                     /product="chaperone protein ClpB"
                     /protein_id="BBL73333.1"
                     /transl_table=11
                     /translation="MRMDKLTGKFQAALAEAQSLALGKDQQFIEPLHAMVALIDQDGG
                     TVRPLLAQCGINVNPLRTVLGQALERLPKVEGVGGDVQISNDLLRLLNLTDKLAQKRG
                     DQFITSELFLLAALEDRGQLGDALRKAGLNREVLEQAIEKLRGGQKANDPNVEEQRQA
                     LQKYTIDLTARAEQGKLDPVIGRDDEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIVEG
                     LAQRIVNGEVPEGVKGKRLLALDMAALIAGTKYRGEFEERMKAVLTDIAKQEGKVILF
                     IDELHTMVGAGKAEGAMDAGNMLKPALARGELHCIGATTLDEYRQYIEKDAALERRFQ
                     KVLVDEPNVEDTIAILRGLKEKYEVHHGVTITDPAIVAAAMLSHRYITDRNLPDKAID
                     LVDEAASRIRMEIDSKPEEMDRLERRLIQFKIEREALKKEADEASRRRLEELQERIGE
                     MEREYAELEEIWKAEKAALQGSTAIKEKLEKAKLDLEAARRAGDLGRMSELQYGEIPR
                     LQKELDAAVQVGAQEAKLVRNKVTDEEIAEVVSKWTGIPVSKMLEGEREKLLQMEAQL
                     GRRVVGQGEAIKAVSDAIRRSRAGLADPRRPNGSFLFLGPTGVGKTELCKALAEFLFD
                     TEEAMVRIDMSEFMEKHAVARLIGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKA
                     HPDVFNVLLQVLDDGRLTDGHGRTVDFRNTVIVMTSNLGSDRIQELAGEENYQSMKAA
                     VMAVVSRYFRPEFINRVDEVVVFHPLAREQIRAICRIQMGYLERRLAERDITLAVGEA
                     ALDRLGEAGFDPVYGARPLKRAIQQQLENPLAQSILAGRVGPGDVVRVDAADGEGIVF
                     HTGG"
     CDS             505126..506493
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113486.1"
                     /locus_tag="MishRS11D_04320"
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="BBL73334.1"
                     /transl_table=11
                     /translation="MDTRKLLCFDPTGTDNGVLDALRARGWDIITVTRLDEAKNLIDA
                     HGFHLGMVLFGSREQADISPIQSLLAMRYPMEWIALLPPQALHNREVCQLIAQGFYDY
                     HTLPLDPERLQFTLGHAYGMALVMKRLRAQTPSHGDEGIIGCSPKFTKLFADIERAAG
                     LDVPVLVRGENGSGKEIAARAIHRRSMRGDRPFIVVSCGALPSNLMMSELFGFEKGAF
                     AGAYRTKEGSIEAASGGTLFLDEVGELPADLQEVMLRFLREKTIRRVGGDRDIPVDVR
                     IIAASHTDLAKAVADGHFLEELYQALSPFVVNVPSLRERRDDIELLAKYYLDLFVNEK
                     YRHISGYTPEAVTSMQRYEWPGNIRELINRVRRAMVMCEDRWITPQDLGLNVVEPGTT
                     KFQGNVMTLDEAKAEAEKEIIQVTLRATENNISRAARQLAVSRMTLYRLMDKHRIRNT
                     AAGRG"
     CDS             506820..508358
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04330"
                     /product="hypothetical protein"
                     /protein_id="BBL73335.1"
                     /transl_table=11
                     /translation="MPFALDVQSATAWLDQLPLGNIRECCQRFLPVQQALNVYPMPLQ
                     LRFELLERCHPMVQGLERGLMPHFIDAVFPMEEKARKIASLAARFHLEAALGYRQLVE
                     AAAFQEAFDAPCRLFIYRRCLEHLLQSMLRSAQVYEAPSSSVLSSFRRLYRHAAAAEV
                     LDATAELEGRPPVVLRDLFLRFFLFGLAVPRGLPQDETQRLFDGLALLAKQGSPVADE
                     AGLRSAFCFDPEELDILVPVAPGVPAPAGLPCVSAERALSVLRETLRASVAPESHPLR
                     RVLPRLGDRLPCLEAAGGRRVSLATGFKAVVPMLKDIEFRRSKPGRRAETWAGNELEL
                     APLDSTKLHTAPRFTGRTLAEAVVASETAEKNRMVEVVPSELPGFYLLDSGRWMLRAG
                     SLIGLNSDDEWVQLGVLRSGQIRDGRFWHSFELLGANPRLIRARNERLKDGVRNAVWL
                     EASEPDGQVGLLTEPCKWRGGDGVMLDFPGGKRRVCIVKLVEASPSFYRYTLTESGAE
                     EAMA"
     CDS             complement(508381..508860)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192119.1"
                     /locus_tag="MishRS11D_04340"
                     /product="MEKHLA domain-containing protein"
                     /protein_id="BBL73336.1"
                     /transl_table=11
                     /translation="MTAPPPYPSEDNHYLAEHVALLRDSHRHWTGRPLLDPRLTHEEA
                     ARYLFAAPFVVVSHDTAPDPLFNYANQTALALFAMDWEEFTALPSRLSAERINQEARA
                     ELLARVAERGYIDDYQGVRIGRHGRRFLIEAATVWNLLDPRGVICGQAACFKHWKFL"
     CDS             508777..509010
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04350"
                     /product="hypothetical protein"
                     /protein_id="BBL73337.1"
                     /transl_table=11
                     /translation="MAVAVAQKGDMLGQIVVVFAGIGWGSGHGWGPGGLGGGIQGCGS
                     AQDYSHYRTGRRQDWEKMDTEGGTLEDSSEGCD"
     CDS             509249..510067
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004539164.1"
                     /locus_tag="MishRS11D_04360"
                     /product="spermidine synthase"
                     /protein_id="BBL73338.1"
                     /transl_table=11
                     /translation="MFGFRKGVRDTEPVRRYGGTLVYCGRDTEGLIEVVDSYGVRALH
                     FGTPPRQSAMALAEPERLELSYVRAMLAGLMFTPGPRRVLALGLGGGSLAKFLARNFP
                     DCRIEVVEFRAAVVEVAHRYFGLPEAPNLAIHIGDAREFVRREALAGASLYDHIFVDI
                     YDDRGLSASVNERDFFAACARLLEPSGVFALNLWGSDRDSYREAVDLLRQYYGSHTLR
                     LPVIGRGNIIGFGFGPDVPKPDLERLRPVSRGLEARLGVEFPRLLRSMVPMGWR"
     CDS             510436..511233
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04370"
                     /product="hypothetical protein"
                     /protein_id="BBL73339.1"
                     /transl_table=11
                     /translation="MLYGLFELLRQALNEFRGLSEDFYRWVAVAVILACLVEALFWLS
                     GRLVLRDWRPGWILGGVAGLWFPLTCLIFLSLPATAYLKPAAETILKTWQTGFTHDDA
                     WNQESFRQQYWAVQALKTPDGQPLENFSGYPSPEQGGTKIPASHRESQSAIATIDSNR
                     VAEHFQTRLPLLAQLLWADERPLPEVLRGDMEKFFRDNPGTAYDHFKAVQLAGTEMQR
                     LLEQKIGRIVLMARLGLAGLLLLLWLPLFALAVYDAWKRLEPTTLKE"
     CDS             511314..514523
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04380"
                     /product="hypothetical protein"
                     /protein_id="BBL73340.1"
                     /transl_table=11
                     /translation="MSNNHLIIGLGGTGGKVIKAFRKGVYEEFRNVEPIGPDGKHHVV
                     HIGYLYVDSSANDLAASERWRTQGDIGALIALNERHRLSIAHNDLQTRLRDREHFPVT
                     HRYIGNPQLWTDIFSQMNVQQAAGGQMRRLGEALFEPQCQAFVDRVKTLCNELSGTSG
                     VQGVSFHVCCGLAGGTGSGAFLHVIAQLRRHFANSREFPIFLYLLLPEPNSEWASNGE
                     RTNYYANGYAALQELNAYLLSDPKDGPNKGGPLFTPYDLTANTGSAHRFENIAAGGRT
                     HLLDRLQGCFVLSNINERGLVIGVKNEEIHNLIAQLAFQRIFLIDSADAGQYRPLRDA
                     ITLENTIIDDEGQTTDPTQKVRSTRFLSFGLKRLLVPEEEIREHFAASFASQAALQML
                     YNNWPAETATAFVDEKKKTAFKLDVQKQDKLAGWKLSDEQITLSKGILATEISNQRWK
                     PIQETWNDIAPHLKTDAWEGGSGNGIDPRLDRLETAFQDYYNDSFRGVGVDKLYEAVG
                     RDVGLPDRHVAEICDTVEQWMFGQWQDGTYSVTELETFLDDLIEDLERRLGTIPARLE
                     AIKKSLGGLNERMDDNSSRWAKMGILGRAMGRPGDIFNAQADLLTEVYEKRTLIQAWT
                     FAEKLLRRVVAELRDRLRPSLAEFRVGLSQVNDFFQRRRGQTCQDDAASNVETANVVK
                     FYEPAGVRRFCRSLLELEQMQRSWAGVLRRKAVDTAAENKQRKSGREKGFAMMVQHFI
                     KETDAMRVFEDVARQNAEQAHDERTGPNNRHFGVNIVIKLAEQFADREKLRDYIKTLV
                     RSSLTFMQWRGVEFGGGVGPNSMLAVSLPRCDERASFREELKALFRDSFEGKVEIIDS
                     GRRSNEICLIAFKYVFPLRYLEPVWQLKERYDYRLNVGSRERALLEVHIEDHQPALPG
                     LFRPAPGEAGKRVLPALQIAAALGVFEQTYNDATGQQERKLKLLDADGRPRFFYYPDV
                     LLGLFDAPPRPATETAVLSALIGQLTQEQSEAVEKRVRDALAAEQYRIATAREELKQK
                     LLAQLENVQRNRNHNERDPIYLKMDEACGAAIQRVMAVR"
     CDS             514537..515208
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04390"
                     /product="hypothetical protein"
                     /protein_id="BBL73341.1"
                     /transl_table=11
                     /translation="MALRQGRCRNYGVCHFADDRLLQAVEAGAEFVCGNPECRSPLAE
                     STGQGGPPDGVVRRRLVLGAGVVLLAGLGSGLGYYLSRPAVGGMAAAEVSGFAGGGVT
                     AIRKPMEQWIDEFAAPPAQAPETMPPGKLRRAWEAVGRIKARSLDIDALKQAGQLVGS
                     ESGLLNPVEGARLTPEQRSLVGQENQDRRTLFAFVAEYSNPATEYERVANEYARNRWR
                     EWSPK"
     CDS             515245..515562
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04400"
                     /product="hypothetical protein"
                     /protein_id="BBL73342.1"
                     /transl_table=11
                     /translation="MVNPFIDKSSLVLAIVAFTIIVVVVSIAWIVTNDGKDRYARIEY
                     VEGSYRWGAEYASASGKSVVKHHDSIDFHDENGIKRGDIVRPRESSSKTMDQWIEEAG
                     IHR"
     CDS             515563..516015
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04410"
                     /product="hypothetical protein"
                     /protein_id="BBL73343.1"
                     /transl_table=11
                     /translation="MDGAMKAPANMSMLLLLGVLPWLVVAEAMDAECDDQQGSDYLEY
                     QKVADRMKGRENDVVRIKRSGRVIGNEDGLLYLVQNHGINIVISDYDMEILNEENSDR
                     RKLFSLIAKCAVPQVDYHDVANRYARKIWKEWPIIDYGYTDRSVVEHR"
     CDS             516031..518232
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267838.1"
                     /locus_tag="MishRS11D_04420"
                     /product="serine/threonine protein kinase"
                     /protein_id="BBL73344.1"
                     /transl_table=11
                     /translation="MAKKAGRCKNYGGCAKAEQRAIIDADEFNFVCPECGSGLSDYVP
                     PKPTGPNWPLLVGLGLVAAGAVGGTGYWLLSGKDKSEAAPVPTPIVANPLPASARCVP
                     QPLLLPGKRSLYERVLTRPGAVLAAQPGSGQGEAQAPLTRFYVYQRQTLGGEEWLQVG
                     GSAECKPEGWLRGASAVAWKQQITVVFDNPAGRERVWLFKDDAVLERIAKSADPGAAL
                     VAAQGGSDAPIVSAEPKNYIDFNQKFYLLPITDFREIRNVTGKPMRLLRVHAISQKND
                     GGGGKPEQRGAAVMFVIDSTFSMMRYIDAAKEAMRQIFHQLSESPVGREIHFGLVTFR
                     SSTRAVPELEYVKKLVVDPGLPESSGNPEAFMAGIEEVKEARKSSAEFDEDAYAGLME
                     ALKKDIAWQSYRAKYVILITDAGALNPGDLDRDGQPLSETGMKAGEIRQIAAQDRNVT
                     LYAIHLKTVGGKKYNDHAKAAAQYRELTQNLYTKGPLYYPVENADNIGGFNGVVDCLT
                     QSIIAHYAKVVSRDQGESAYHCPPQTDNEELNRVFRSIERDTATLGNALRLEYLGQTS
                     GDRIPDDFAGWMNDRDLLDPVRPNVEVKVLLSRNELSNLALTVKAILDAARAGQKSTG
                     EFFNVLKQYVSALTRDPDRAQKLSLAEMGLLGEYLEGLPYQSHVMSMTPERWAGLGPT
                     EQDDFIREVENKLERYKDYESDNRRWIALGGPDPAVEDGDKVYPVPLDALP"
     CDS             518236..518973
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114657.1"
                     /locus_tag="MishRS11D_04430"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL73345.1"
                     /transl_table=11
                     /translation="MVMVAAPCLEFELRRTRGVGDEGFRVETARATLGAGEILALTGP
                     SGCGKSTLLEMLGLVLEPGPGSHLAWRVDTEQPPLDIPALWRHGREDALCGLRAHRLG
                     FILQSGGLVPFLDVRGNIGLPRRLVGLSEDGPEVDRLVDTLDIRHLLAKKPGQLSVGE
                     RQRVAIARALAHAPPLLLADEPTAALDPARAEAVLGLLVDLVRDGRGMAVIVTHDRDL
                     IQRLGLREMRAWVDAGGRLARFDHHAA"
     CDS             518963..520426
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04440"
                     /product="hypothetical protein"
                     /protein_id="BBL73346.1"
                     /transl_table=11
                     /translation="MRPEFAPVHPNPTPRSRRGLALRLGFQDLRHDWRVSAALALSIV
                     SVLAPLLLLLGLKAGVLYTLREILLKDPRNLEVLIFENTRLSPAWFEQLRADTERVRF
                     VIPGTRTLSAVVDLENRNGLQLRQVDIVPTAVGDPLLPLGLAPPDRIDAILLTHPAAA
                     QLAVSPGERVKVWITRTLDGIDQRESLELTVAGIVPEASLARPALFTRLEFLEAVEDY
                     KEGYAVPALLFGREARAPPSAVCGSAWGGPLPSWPLWPDAPDDLFPTGSESTPSPPVQ
                     PAATVPARAASSLLAGKHRAGPRTTYAKARLYARRPEDVIPLADRLRASGLETRTRMD
                     DLARLQATDRLLGRVLAWIGAIALVGGACAFGGASWITLERKRGSLALLRLMGLTGGE
                     ILAFCLYQALLLGGVAFVIAGALYAAGSTALNHYGAELFAELLGYGGVAGALCRLGTG
                     DALTAAAGTLGFTLLASLLGVFHAQSIQPAECLRENG"
     CDS             520419..522179
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005771465.1"
                     /locus_tag="MishRS11D_04450"
                     /product="hypothetical protein"
                     /protein_id="BBL73347.1"
                     /transl_table=11
                     /translation="MADWGLGLLLWLAGGLAFGADGLDALNDPAKPLPDDVALPMPCG
                     GKMVFRRVETVGGGALGEQKLRLGEENPGAVLGPKEGAVDAYLAGAFPIAGNPARRYF
                     LLGKYEVTRRQYEAVRRSLAHKDGPLDCQGLPEENFPKTGLSWFDAVAFADGYTQWLL
                     ANAQDQVPKDGKSLGFVRLPTEVEWEFAARGGNAVNEADFRGPNFVKDGELYRYVQHQ
                     GTESANGKVQYIGLLSPNPLGLYDILGNVDEMAFDLFHLTKHSHWHGRAGGFVVRGGN
                     FDTNAGDIRSSLRREEPYYTDKQPRRAETTGFRVAVAGPVISEQNLRAIEAEWASLKD
                     EAAPSRAAQPQPAPPTTAVPDPRLAQRLGEAEAALQHCQAAKAAVVPAGPAPVQSGAV
                     VSACPDPLGKLSNESRSDLLADISDLAIHTNHPLLRRRLDHVWDETARVIEFQNEDRR
                     RAAREALRTAAMICQKLRDDEYNVIEPWENRKKAHCLRDTKGQDCLNDETKILKLKDR
                     VANNLGFYADAVLELARSYPMEILGAEKDLLLTRIEQRKYQDFMPFVKLLYGHAQRYA
                     ADGKQNREAWYRDCAAVRLE"
     CDS             522203..522877
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04460"
                     /product="hypothetical protein"
                     /protein_id="BBL73348.1"
                     /transl_table=11
                     /translation="MKQPRSTINALAVALATLALSACATVPRSPSEQRLETQSEWFSS
                     SHLQGCLLGAALGGGGCALAGGNTATCVASALAGCGLGLTAAEYMTQKRQQYANQEQF
                     LQSVITDVRQDNQRVSSYVATQQQVVNENLAKLAQLEQDYAQHKISLDEAKKRKAVLR
                     KTQALLEKKLDDLRHVDKQWQDRYAVATDPRIGQEVQTLQQQVNAADQEVRGFTQKLD
                     VSTVSG"
     CDS             522882..523358
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04470"
                     /product="hypothetical protein"
                     /protein_id="BBL73349.1"
                     /transl_table=11
                     /translation="MRYQYFAGFALVAGLSGCATTRDCDPRYDPGFFGSVNCHASDAY
                     QGRIDEGKKILADEQELKQQLAQQSAEVEKTKQDTEAALAKAQADLDGMERELGDIGG
                     ALKQAGKANARLTRRIGQYQTDIKAMKAKVKKGNPQIAERDRLKRELAALQAAIPR"
     CDS             523422..523901
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04480"
                     /product="hypothetical protein"
                     /protein_id="BBL73350.1"
                     /transl_table=11
                     /translation="MTQKTGRCKNYGICANADSRKLLQADDTNFICPECGKTLVPVAD
                     PGKAGGGQGYWIIGGVAAAVLAIAMGVGYLLLSPDRQEPIAPAPVSTPTPEKRVVEVR
                     PPLQQSESDTERRYPGPTPEPERDLDGKTDPATGRDDPVWAPKPASDWIKTFPINRR"
     CDS             524097..525473
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04490"
                     /product="hypothetical protein"
                     /protein_id="BBL73351.1"
                     /transl_table=11
                     /translation="MKDRAPEIKALVNAGKVQRQGYKLLGLKALTVKEKELINEENQG
                     RMVYIEFIAKHSDPPQSFDEVVNVLAQEWGSERRPNPSSGRPEKVGIIEVGGKGIRGL
                     AVGFHEAENNPDCQSDTDDDGEQEQAMKCLLKDAISPLNPSGIEKNAIRDTAIAVEQM
                     LGMVMAKGVDVEDIYIVGSSSVNDAEHKTELKREIEKRVNLPGKMDFVTFDQEARYNF
                     EGMIAMLPAKWRDKRKEQAVILDIGSGNIVGSYQDADGRLVPFSLTRLLGTKKFSDLV
                     ESEITRKKPTDDGPTPIVVSNQDWSIMSEKIRDEVLRPEIRALIDRKPGIFSHDRIYL
                     AGGINWALFTLQRPYDTRRFPNISLDNINDLRKRAVGVKQGMSVCLNNQGINDPKVAK
                     QVREDMLKVCDVFSTRNIISGMDIVKVFADELGFKNRAGKVFFFRNSMYAWPLGYLHE
                     KCRQDGKC"
     CDS             525467..526672
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04500"
                     /product="hypothetical protein"
                     /protein_id="BBL73352.1"
                     /transl_table=11
                     /translation="MLKEMCPILNQFCNKEIVMKKLSKPEICTVIGRLACLSLFFTNA
                     GCSGVGPQIASVQSSQWITCFPAEKLQAEKPPTCELSAVAKAEKILVFANDKAIPDGS
                     PVFAERFDGSKVDDKPDYFKIPDTYIKSSKYEGMATTPDGAWVIATTAFDRFDPNKPD
                     WNAYNRILAWPAGHHDQPQVLIGKTEQDIDQFRKQIKKTVTEGGDKLGYFKIEGIAAI
                     PAKSPQDNTGRLLFGIRELGESYDKFNYARKLVEVGYTIANNQISLGSDYKLKYQFDV
                     SPEDQAAGVPQEVGLSSVEYDPANKRLYLLTSFEQGEEPSKKLGSYLWVLDEKVLESE
                     PGRQARPVLIKDATTGKPVKFPHKAEGLAVLGGDRIVVIFDDDRVTKFDGEPDRKLNE
                     SLYQVIQLQ"
     CDS             527092..528315
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04510"
                     /product="hypothetical protein"
                     /protein_id="BBL73353.1"
                     /transl_table=11
                     /translation="MPLGVWAILLMAALGGLAWTTWVPKPEPSMVYGQGLSTTGSGVY
                     GGSGLGYVNGSEKPDNNRKFNPDLSGLIEVAGPEVRAWVANLSKACLNGQTAIGTCFT
                     QLPSVKMGVTPDRGLREILMAVGTLRDRLGTGYSVGPEQIRVVGHEGLGATEDGARLK
                     AGLESESGGTVKMDFLDRQEVAALAFAAALELFPLPHYKPEDIVFLEVGKSASFGAYR
                     AAGESEARTTTFDLEWGFKNYADEVAYRGFVEGFAQASKRLENDFLMPIVREMVERKP
                     GIIHRRAMYLAGQGVWAAAMLLHATPEMGKIGPRDLEKARRRLAEPGVWREVCADSQY
                     RFDAYAQSLCQTLSQDEVLAGIDLLRAFAEEMKFGSKEVYVLRDTAYLWPLGYLKARY
                     GLAKTGGVDNLTRHD"
     CDS             528332..529168
                     /codon_start=1
                     /gene="potB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015705059.1"
                     /locus_tag="MishRS11D_04520"
                     /product="spermidine/putrescine ABC transporter permease
                     PotB"
                     /protein_id="BBL73354.1"
                     /transl_table=11
                     /translation="MRTQPPAFAYFLPLWLTLFTLLPLLMVAAVSLMRRDESGLIAPV
                     FTLANYARLLDPLYLRVFGHSLALAALATVLCLLVGYPFAYLLSRVRAGWRPALLTLV
                     IVPFWTNSLARVYAMRGLLAAKGPVNALLLALGWIDEPVRLLYTGPAVAIGLVYVLLP
                     FMVLPLYSSFEKLDHRLIEAARDLGAGRFATFWRVIVPLTAPGIAAGSLLVFLPALGM
                     FYVTDVLGGARGLLVGNFLKDQFLDARDWPFGAAASVLVIALLFVCLALYGRVRGGVG
                     HG"
     CDS             529161..529919
                     /codon_start=1
                     /gene="potC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010937407.1"
                     /locus_tag="MishRS11D_04530"
                     /product="spermidine/putrescine ABC transporter permease
                     PotC"
                     /protein_id="BBL73355.1"
                     /transl_table=11
                     /translation="MARVYLALVYGFLYLPMAVLVAYSFNPSKYATRWEGWTLDWYRN
                     LALDEGLKQAALHSLAIAGLAASLGTVVGTLGAVGLYRYRFRGRALAQGLLLVGMMSP
                     DIVVGVSLLVLFIALRVELGFWTLLLAHTGFCLPFVVVTVLSRLQGFDRGLIEAAQDL
                     GAGEAAALARVVVPLCLPAIAAGWLLSFTLSLDDVVVSFFVTGPEFEVLPLRIYSMVR
                     LGVKPEVNALASLLFALSLLLVSLSQWLLHRGPR"
     CDS             529916..530944
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CLM0"
                     /locus_tag="MishRS11D_04540"
                     /product="putrescine-binding periplasmic protein"
                     /protein_id="BBL73356.1"
                     /transl_table=11
                     /translation="MRLWLALWLGGFAAAARAEAPELRIFNWSDYLPDEVVERFTAET
                     GIAVTVSTYDSNEAMYAKLKLLDGKGYDLAVPSTYFVDKLRAAGLLRPLERAKLPGFA
                     HLDPRHLNQAFDPGNVYSLPYLWGTTGIAVDARKIDPASVDGWADLWHPRFKGALLLP
                     NDMREVFGLALRTLGLSGNTTDPRQIEAAYTELRGLMPNIRLFNSDSPLVLLATGEID
                     IGVVWNGNAYHARQENPDIRYIYPKEGCILWMDNWVIPKGAEHPDNAHRLLDFLLRPE
                     IAALVTGKIGYASPNAEAVRRLAPELRDDPTVYPGEAVLRKGEYQTDIGDAVTLYTDY
                     WERLKAGE"
     CDS             complement(530951..531376)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04550"
                     /product="hypothetical protein"
                     /protein_id="BBL73357.1"
                     /transl_table=11
                     /translation="MGVGVWWLALAGQALAGDGDPGSLAPEIQAPKVPDKASPVFSED
                     EQKRIQELRRWLLRRQQERKLQEPGPLDALKQARAAAPAFPDLAAADPAPRPKGNPVL
                     HIGRGPDGRIHHRYIFNESGPDQLQSAVPEYSPALRRSR"
     CDS             531693..532307
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04560"
                     /product="hypothetical protein"
                     /protein_id="BBL73358.1"
                     /transl_table=11
                     /translation="MHMMKKILWVGISTVAFAFSGGATAAAKASKLGDTTWNLTGAYN
                     VSYAFSCNVGGQGAGRKRIKLPGQANLSLNVQFNPDKTFTVTGDTLGLGAFAGDWKGK
                     GRKLSFMIDDQNDSYIFQQSKVFQEETKQLSGSGSAGGGTYNYKFSPVKYAFVGSLNP
                     KGNMLRLKESATFKVTASASFAGRSNSCSYSWSVMREYSGGQAQ"
     CDS             complement(532390..534282)
                     /codon_start=1
                     /gene="parE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q4ZZ01"
                     /locus_tag="MishRS11D_04570"
                     /product="DNA topoisomerase 4 subunit B"
                     /protein_id="BBL73359.1"
                     /transl_table=11
                     /translation="MNDNYDASSIEVLSGLDPVRKRPGMYTDTARPNHLVQEVVDNSV
                     DEALAGFAKTIDVRLMADGGIEVRDDGRGMPVDIHPELGVSGVEVILTKLHAGGKFSN
                     KNYRFSGGLHGVGVSVVNALSDKLEVEVRRGGKVSAMAFARGEKVQDLRIIGDAPKRD
                     TGTTVRFWPEAHYFDTPKVAVPRLKALLRAKAVLCPGLRISLNDEAAQETETWHYQNG
                     LPQYLLDRIGARECVPEEPFVGSLESRQEAADWAVAWTLDGDIVAESYVNLVPTPQGG
                     THVNGLRTGLTEAVREFCEFRNLLPRGVKIAPEDVWERCHYVLSVKLQEPQFSGQTKE
                     RLSSRECAAFVSGVVKDAFSLWLNQHPAVGERIAELVIESAQKRLKASRQVTRKKVTA
                     GPALPGKLADCSGQDINLSELFLVEGDSAGGSAKQARDKEYQAIMPLRGKILNTWEVE
                     PGAVLASQEVHDISVAIGVEPGCADLTGLRYGKVCILADADSDGNHIATLLCALFVRH
                     FRPLVAAGHVFVAMPPLYRIDVGKQVYYALDESEKKGVLDRIEAEKIKGKINVQRFKG
                     LGEMNPAQLRETTMNPDTRRLVQLTLEELAEQETTDERLDMLLAKKRAPDRKAWLEAK
                     GNLAVV"
     CDS             complement(534493..536907)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04580"
                     /product="hypothetical protein"
                     /protein_id="BBL73360.1"
                     /transl_table=11
                     /translation="MSIRLSQLFNRSRSGAFLCLLLAGTGWAQAELAFKEITGLTRVG
                     NLYAGQPISADMDGDGKSDLAVASDNGVSVLLGNGDGTFQTPRYYALGYTPASIAASD
                     LNGDGHTDLATMDAEFSWISKSSVSVLLGNGDGTFKTRQDYAVGSFSPTVVASDLNGD
                     GTPDLVIANEDSRSVSVLLGKGDGTFQPRQQYGAGIDFGPDSVAASDLNGDGYTDLAT
                     VSDFYSTISVLLGNGDGTFKANRDYVAGYYGSNPHSITLADLNGDGKPDLATMLNPGE
                     STRKSPAVLVMLGNGDGTFLAPQYYAVSPSLWSTNNVGSVMASDLNGDGHPDLVTANP
                     TASTVSVLLGKGDGTFMTHQDYAARSNVSLTFTVSDLNADGHPDLAIANDNDGSVSIL
                     QGKGDGSFKELHPKDVYAVGHRPTDVHLSDLNGDAHTDLATTNSLSGTISVHLGTGNG
                     TFRARRDYAVVPYGTSLGSLTMSDLNGDGHLDLAASHGKDVSVVLGKGDGSFTPRQDI
                     AMVNPPYYYGWISLLKVSDINSDGKPDLITMNQDFTYFAKNSVSILLGNGDGTFKANQ
                     DYAVGKYPNSIAVSDLNGDGHPDIAVTLYYHPRHRVSVSTLSVLLGNGDGTLKARQDY
                     AACDGPFDIKVSDLNGDGHPDFVLQCSTGLSVLLGNGDGTFKARQDYAACKGPEINVA
                     DLNNDGHPDLAATCKKLLVLYGKGDGTFQSHRNYAVKSPRSLKVADLNGDGKPDLASL
                     SGSSSLSVLQSKGDGTFGARKDFDTGHLPCNLAFGDLNGDGKPEAVTANCQSDTVSVL
                     INTSKP"
     CDS             complement(537122..538033)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011404256.1"
                     /locus_tag="MishRS11D_04590"
                     /product="hypothetical protein"
                     /protein_id="BBL73361.1"
                     /transl_table=11
                     /translation="MSISFRDYPDIKSALDERSLNPQVRTAFQHALRGREWLSCLDLG
                     AGAGASLWRLLNADLKADLAITAVDPDRDLLELALRRLAVLLRARDFEVATPGPDHIQ
                     ARRGGRSISIEFVAAGPEDFNRQEPTRQFDVVVAHHVTDLLPTQAMADRIASWLKPQG
                     VFYAALNYDTGTTVFPAYHDADLEQRILAAYDAAMETRRMRDQPAEDAKPGGRLHGAL
                     LESHLDILAQGASDWNLTPLRRTYRDQDDLCLDAVLAHIRAEADRSGGIGPHALDSWH
                     RDRRLEIDRRRLGLIVHQVDVLAQRGA"
     CDS             538187..538648
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04600"
                     /product="hypothetical protein"
                     /protein_id="BBL73362.1"
                     /transl_table=11
                     /translation="MRVGDLMHTKVFTVEEEALIERVFFLMHYEKIRHVPVVNKKSEV
                     IGIVSDRDLYKALGPKNNSNVIEESGDKAAALHVVPQKVRHIMHRAVLTINPNEQISD
                     AAAIMAKHRIGALPVVKDNKLVGIITTTDLLRYFSKVKLPDGGPAAGPDEA"
     CDS             complement(538713..539840)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010902730.1"
                     /locus_tag="MishRS11D_04610"
                     /product="oxidoreductase"
                     /protein_id="BBL73363.1"
                     /transl_table=11
                     /translation="MVYPIEPSHALSARNPYRAPRPPYGKNNRSPGAAPAQAVFHTAR
                     HSVSVRDTEVPAPKPGELLIKAHCSAISPGTESLIFRGGMPEGWGLDTAPSKSGGEFR
                     YPFKYGYALVGEVVEVGAGEDRDWLGKRVFAFHPHQDYIAIDQRQCQRLPEGMPAERA
                     LFLANLETALNLVQDAGPLAGERAMVFGQGVVGLLTTALLGQFPLSELITADPLPLRR
                     ERSKELGAGLAIDPSKGRELAVLEECLFHGDHNGLDLAIEVSGHIEALNQAIALTGFD
                     GRIVVGSWYGRHAGPVDLGGHFHRRRIRLVASQVGTLNPALSGRWSKDRRLKLAFDWL
                     DRIQPERLITHRFPLSECQQAFEVVGDKLAGALQVVFEYRG"
     CDS             complement(539935..541248)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2S2E8"
                     /locus_tag="MishRS11D_04620"
                     /product="GTP cyclohydrolase-2"
                     /protein_id="BBL73364.1"
                     /transl_table=11
                     /translation="MVKNLVKTRIPTGYGEFNLYLYNEHGKEHLALVKGEVSGQALVP
                     VRVHSECLTGDVFGSRRCDCGDQLKHTLQYLGRLPCGILVYLRQEGRGIGLRKKMEAY
                     NLQDAGMDTVEANIHLGHQPDERDYGIAARILQDLGPQSIRLITNNPHKVDELTAHGI
                     QVEARIPIEVGHHQDNLDYLRSKAEKMAHLLTFREETPEHRDLAFIEPLLDQLSLARA
                     AANEAGPFVTLAYAQSLDGGIAAEAGTPAAPTSRPALTLTRHLRAQHDALLVDIDSLP
                     AGATPPAIRQDQGTDPRPVILDSQLRTPPEALAQGGRPPLILTAATPDPARAASLAER
                     GAEVVAVGTDTGGGIDLPLALRALRARGIHTLMVEGGAATIRRFLRQRLVDYAVIAIT
                     PRLGGGPQAIGGPGLAGEAPALGITDCQYQTLGSDIIAHGPVGYG"
     CDS             complement(541391..542509)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011124950.1"
                     /locus_tag="MishRS11D_04630"
                     /product="homoserine/choline kinase"
                     /protein_id="BBL73365.1"
                     /transl_table=11
                     /translation="MTPSPCGPAATPPDLGSPPFQAAARFASEPIATVEPLGRGLINA
                     TFLVTTATRRFVLQRINARVFPDPVAIMANLRILTDHLRSPATRVPAPALRLPGILAT
                     LDGADFHRDGTGEYWRALDYIEDSRTLARLDHPAQAEAVGRALGRFHVLAGGIDPASM
                     RDTLPGFHIAPQYLARFDAIAARPRPADGAALRAALDFVAARRDGLGVLEQAKRRGEL
                     VPRIVHGDPKLDNVLFDPTGGHAVGLVDLDTVKPGLIHYDLGDCLRSCCNRQGECEHG
                     GPARFDLDFCRAILKGYGAEARALLGPADRAYLYHAIRLLPLELGLRFLTDHLNGDVY
                     FRVDAPGQNLERARAQFRLAESVERQETEIRDLIAGLA"
     CDS             complement(542506..543108)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704977.1"
                     /locus_tag="MishRS11D_04640"
                     /product="Smr domain-containing protein"
                     /protein_id="BBL73366.1"
                     /transl_table=11
                     /translation="MPPEDFELFRQEMADVEPLSTPRPAPPSKPRAAPTPGQDYRREA
                     AQREAGLFDENQLPTVFVEPLHPEAILSFKRGGIQNGVFRRLQRGGYDIEAMLDLHGL
                     NVEQARHEVHRFIQDCLRHDVRLALISHGKGRNNKEQRPVLKSFLARWLPMFPEVMAF
                     HSAQRYHGGAGALYLLLRKSERQKHKTREKLGLVSGKPEP"
     CDS             543459..545009
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225610.1"
                     /locus_tag="MishRS11D_04650"
                     /product="haloperoxidase"
                     /protein_id="BBL73367.1"
                     /transl_table=11
                     /translation="MHTSFPPRLSALALGVAALLSGAEVRADAVTDWNEYAVQATKGF
                     DGTTGTGVALNSNLSTRIEAIQGRAVFDAVNAIDHFSPKSYYHPAGHTGSAAAAAAQA
                     AHDVLLGQLPNPTVAGVDARWAQTRSWLDAKLAQYLAQLGVAAGDPGIQAGKDAAAAA
                     IAARKYDNAAAAATYGADLVPTANPGPGLWRQSNAGAVYNDPETGAPTGFDASGTAIQ
                     GRPGIDLNWRDVTPFSLTTAQKIKLVAAVPLSPEVGSPEYVQELDYVKNHGQDSAHPG
                     LRTGDQAAQALYYKQDAEIFVFEAARIAATARRYTLDQNAKLFALLGNAVADARFAAF
                     DSKYQQKFWRPITALNADASGAVNDYGAWHPLAATPAHPSNTAGHSATGAAGFEVLRA
                     FFGDKVLPGKAGAATLTTLPWLVGTNNGTGNTQSRTVATFSQAQLENGASRLYLGVHF
                     GFDNLQGQLLGLAVADAILLSGDPAAAGLRARGGFPASRRNLQDTLLAAPEVYGYFGA
                     ATQVPPTP"
     CDS             complement(545103..546050)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04660"
                     /product="hypothetical protein"
                     /protein_id="BBL73368.1"
                     /transl_table=11
                     /translation="MRITPAIVLPLLWLGAGFPAAQAAALAGPASGYNAFLFGDFTSA
                     NSDTEGNLAAGGAVNVSNYSVASHINGNPSASPNPARLVAGNLTASNGGVGNGQNGAI
                     YAAHASLSSFTATGGVFSQTLVDFAAARTQYQTLSTYWDSLTANGSAANNYGSLTLTG
                     SNTVLNVFDLDGGAITNTNSVDIYAPAGSTVLINVGGTGQTFQNGQVTLHGIDPTHVI
                     YNFFDSRSLNLAGSKNPNGSILAPWASVSGGYGQMYGQLLAESFNGNIEFHNFLFAGS
                     LPDPVAVPEPATFWLFGPALLWSLGKTARRGTPARPPRA"
     CDS             complement(546248..547006)
                     /codon_start=1
                     /gene="comF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011035643.1"
                     /locus_tag="MishRS11D_04670"
                     /product="amidophosphoribosyltransferase"
                     /protein_id="BBL73369.1"
                     /transl_table=11
                     /translation="MIVRAAWARVRQLGQGVGADRWPRIIQEWLYPPTCLLCGDPGGA
                     GLDLCPACAADLPRIAVACPRCASLVAADAPRLCGRCQIRPPVYSAAHAPLLYDSHNE
                     VGFLVKGLKFARRQACARLLGTLLADSLAGRADPPEALIPVPLHPRRLRKRGFNQALE
                     IARFVSARLEIPLAPDACRRVRDTAAQSSLGSAKQRRLNLREAFRAAPDLAYRHVAVI
                     DDVLTTGTTATELARTLRRAGVEKVEVWTCARAG"
     CDS             547021..548028
                     /codon_start=1
                     /gene="bioB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P2N1"
                     /locus_tag="MishRS11D_04680"
                     /product="biotin synthase"
                     /protein_id="BBL73370.1"
                     /transl_table=11
                     /translation="MRENSTSNFKGWHDHPVAEIRHDWRVEEVEALFALPFNDLVYRA
                     QTVHRQYFDPNQVQISSLLSIKTGACAEDCAYCPQSARYDTGLPREELMPVEQVLAAA
                     RTAKAQGASRFCMGAAWRSPKDRDIERVCAMIDGVKALGLETCVTLGMLSDGQTRRLK
                     DAGLDFYNHNLDTSEEYYSEIISTRTYQDRLDTLERVRQAGISVCCGGIVGMGEGDRD
                     RAGLLVQLANLPKHPESVPINMLVQVEGTPLAGIEKLDPFVFVRTIAAARIMMPEARV
                     RLSAGRTDMSDEMQALCFLAGANSIFYGERLLTTENPVAEGDRRLFRRLGLQMSGLGV
                     Q"
     CDS             548028..549221
                     /codon_start=1
                     /gene="bioF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I617"
                     /locus_tag="MishRS11D_04690"
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="BBL73371.1"
                     /transl_table=11
                     /translation="MADFREELRARLAAIERDGRYRRRRMLEGPQGVDVVVGGRPRVN
                     FSGNDYLGLANHPEVVAALRRGAEDYGAGAGAAHLVSGHGRAHHALEEELAGFTGRER
                     VLLFSTGYMANLGAITALAGRGDTVFEDRLNHASLLDGALLSGARLKRYPHADAAALR
                     TALGAGDASTRLIVSDGLFSMDGDVAPVAELATVARDLDAVLMIDDAHGLGVLGGRGG
                     GVLELAGLGQDAVPVLVGTLGKAFGTFGAFVAGCAELIEYLIQRARTYLYTTALPPAV
                     AEAGRAALRLARAESWRREHLRRLIQRFRAGAGQLGLVLMPSASPIQPVVLGDNASVV
                     RAGTALFEAGFLVGAIRPPTVPVGTARLRITLSAAHREEHVDGLLAALADLAAQPGFR
                     AGAAP"
     CDS             549218..550012
                     /codon_start=1
                     /gene="bioH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A1JSF8"
                     /locus_tag="MishRS11D_04700"
                     /product="pimeloyl-[acyl-carrier protein] methyl ester
                     esterase"
                     /protein_id="BBL73372.1"
                     /transl_table=11
                     /translation="MSRRTPGLYTETFGTGPDLVMIHGWAMHGGVWRDFAGRLAERVR
                     VTLIDLPGHGRSGDLADFSLDTVADALVAAAPARAYWLGWSLGAVLAVASAERHPGRV
                     RGLVLMAGSPRFIAAPDWPGVAPSALERVAQELEANYGATLKRFIGLQTFGLDNARQL
                     VKQIGAALDECEPPAIEALRGGLNLLREADLRAALAHAAGPALAVLGAHDRLVPKEAG
                     AALRALVPGMEVCLLPAAAHLPFATHPDAAAAAILDFIARHERPSR"
     CDS             549993..550784
                     /codon_start=1
                     /gene="bioC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I615"
                     /locus_tag="MishRS11D_04710"
                     /product="malonyl-[acyl-carrier protein]
                     O-methyltransferase"
                     /protein_id="BBL73373.1"
                     /transl_table=11
                     /translation="MNAHPDKRWVGRSFGAAAAGYDGVAGLQRGIAERLLSRLAADGA
                     PPAVVVDVGAGTGYGAARLREAYPGSRLVLLDIAEGMLRTARERIGPGACYLRGDAEA
                     LPLAEASVDLVFSNLAIQWCADLAGVFREFRRVLKPGGRVLFSTFGADTLAELRRAWA
                     VADPGHTHVNEFTDAAEVGEALAGAGFVRAGVERETRRLHYADVHALMRELKGLGAHN
                     ITADRPRHLTGKRTLRRMLDAYAAQGGEGGIQAGFEAVYGRASKP"
     CDS             complement(550803..552989)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04720"
                     /product="hypothetical protein"
                     /protein_id="BBL73374.1"
                     /transl_table=11
                     /translation="MFSRHKLLALALGTLPCLAQADLPDYGKPGPMAVVSGEYRLPAA
                     LDPLVTSERITEVWAAVFRPASAPKKPWPLVVFLHGNHGTCGHFDDTLGIRIDDDATY
                     TFTGDCPPGYVVTPNHRGYDYLAKNLASWGYVVVSINANRGITADFGPSEDPGLNLRR
                     GRMVLRHLALLSQWNKGEQPAPSSLPFPLEKTMDFSEVGLMGHSRGGEGMRAAWRLYR
                     DDGSPFRVEIHSPLTVRAIFEIAPVDGQTFRELDAEDVSSMVLLSACDGDVFDLEGVH
                     VFDRALLGLADGFTVPARPHPKGTFNVLGGNHNFYNTEWQQSDSSGCAGHPALFPDTK
                     GSPAQRLAALNTLIPFFRGTLGKKPDSARLAVFDPRTPFTGPLSTIGGLERGFAYSTA
                     YTDRWTLEDFDARKPVSTAGIPHFAQGAKITHQAAPPEHDQRLRVARIDWPFGAGSDI
                     PHVDIALADPGFGIDISAYRYLGLRLTTACHLGSCAPDWLDAPQLDASLSLLDADGNE
                     SNRIALKDVIDLRRPVGTDFGFPWYSPLFPGAGLHSLFQHAYLPLAGLQGIDLTKITT
                     FRFNFDRSRGGRLLLDAITVQNDPLDLPAPPTPLAQPATPLAAGIVDSAPALPTPAAT
                     VQDGNRVVGVARRDAGTAPSAASRPTQGGWVDLTLNSDHPFPITDSLPQATLGQARSL
                     YVRRSVDGHSVVATFSASDYDRQPGDAPLSVRVGSQRLWDFGTKPR"
     CDS             553244..553918
                     /codon_start=1
                     /gene="bioD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8PCW4"
                     /locus_tag="MishRS11D_04730"
                     /product="ATP-dependent dethiobiotin synthetase BioD"
                     /protein_id="BBL73375.1"
                     /transl_table=11
                     /translation="MRQTGFFITGTDTGIGKTWATLSLMRALRARGLCVLGMKPVATG
                     AVWRAGRWVNEDALALQAAASMALPYEQVNPYAYGPPVSPHIAAAEAGRPVEIEHIVK
                     VFKGLPAADHVLVEGVGGWAVPLDGRKRVADLALALDLPVVLVVGLRLGCLNHALLTQ
                     AAIVSAGAEFAGWVANRIEPDFASAGQNIETLTREFASPPLAVLPCGGLEPPLVPWRV
                     SCPGPG"
     CDS             554095..554583
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04740"
                     /product="hypothetical protein"
                     /protein_id="BBL73376.1"
                     /transl_table=11
                     /translation="MAMVESEQDDSGGGRRLILRPNASLSRRDARRLLFAAALVMAGI
                     AIGFASLGLWPVLPFSGAEWLLLAYCFRLGFKASALQEVITVTEATVLLEKGRNQPEQ
                     TYRFQRAWVALDWVKSPIPGHPSSLFLRLHGKAIEIGRFLAESERERLAHELRQILRD
                     GK"
     CDS             554627..555814
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04750"
                     /product="hypothetical protein"
                     /protein_id="BBL73377.1"
                     /transl_table=11
                     /translation="MKNLRRLFAGLGALAAGQARADYALNLPQGVTELSRDVYDLHML
                     ILWICVAIGVVVYGVLIYSLIYHRKSKGVVPATFHENTKLEIVWTIIPFLILLAMAIP
                     ATRVMLNMYDLDNSREPVDMTVKVTGYQWKWRYEYLDEGIDFFSTLDQKSNEARQLGA
                     KSDLGKVEHYLLNVDHPLVIPVNKKVRFVFTGADVIHSWWVPDFGWKKDAIPGFITDG
                     WVKVDKVGTYRGQCTELCGRDHGFMPIVVEVKSQEDYKKWVAAQKGTAYEPPAAAPAP
                     VKEEAKAAAPVSAPKVDDAAVRAELMAKGKEVYEANCMSCHQANGEGIPGTFPAITHS
                     PVATGPIMAHVTTVMDGKGKLMPAFENILKPAEIAAVVTYQRNALGNGVGDMIQPSEI
                     PVD"
     CDS             555855..557450
                     /codon_start=1
                     /gene="coxA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I726"
                     /locus_tag="MishRS11D_04760"
                     /product="cytochrome c oxidase subunit 1"
                     /protein_id="BBL73378.1"
                     /transl_table=11
                     /translation="MSAVTASHDDEHHDHHGPAKGLLRWVFTTNHKDIGTLYLLTSLV
                     MFMVGGAMALVIRAELFEPGMQFVDPTFFNSMTTMHALVMVFGAVMPAFAGLANWLIP
                     MMIGAPDMALPRMNNWSFWLLPFAVVMLASTLFMEGGAAAAGWTLYPPLVLQTGAALP
                     FTIFTVHLLGISSIMAAINIIVTILNMRAPGMTLMKMPLFVWTWLITAFLLIAIMPVF
                     AGAVTMLLTDKFFDTSFFNAAGGGDPVLYQHLFWFFGHPEVYVLILPSFGVVSQIIPT
                     FARKPLFGYSSMVYATASIGFLSFIVWAHHQYTVGMPIEGELYFTYATMLIAVPTGVK
                     VFNWLSTMWQGAMTFETPMLFAIAFVVLFTMGGFTGLMMSISPADLQYHDTYFIVAHF
                     HYVLVSGAVFSLLGAAYYWMPKFTGRMYDERLGKLHFWLTTISVNVTFFPQHFLGLAG
                     MPRRIPDYALQFAEFNAWSSVGAFVFGFSQLIFVYVVYKGCRHEGDKATDEVWEGASE
                     HGLEWQLPSPPPYHTWETAPEIK"
     CDS             557604..558143
                     /codon_start=1
                     /gene="ctaG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074204.1"
                     /locus_tag="MishRS11D_04770"
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="BBL73379.1"
                     /transl_table=11
                     /translation="MSQRKKSTKGLIAAMVLVVVGMFGFGFALVPLYDVFCELTGLNG
                     KVKTEAAAPVDYKVDEARRLTIEFVTSVNGNTPLAFRVEKAKMDIHPGQSYTVNFYAK
                     NLTDRKLVGQAIPSIAPGVATPHLKKSECFCFTEQPFEPHEERKLPVRFTIDPALPDT
                     IVNMTLSYTFFDITNKQPD"
     CDS             558180..559055
                     /codon_start=1
                     /gene="cox3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038909.1"
                     /locus_tag="MishRS11D_04780"
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="BBL73380.1"
                     /transl_table=11
                     /translation="MATKTSYYLPHHAYWPIMGSVGLFTLLAGFSNLMNGHGSGSTFM
                     IIGALIVVAMMFFWFGEVVKESVAGVYSHQVDVSFRMGMIWFIMSEVFFFAAFFGALF
                     YARQYSIPWLGGEGALGESQELLWKGFEAIWPTNGPDTLGGKEGGHFEPMAAWGIPAI
                     NTLILLSSGGTVTWAHWGLLANNRGQLIKGLIATVALGFLFVVLQAFEYHEAYSDMGL
                     TLGTGIYGSTFFMLTGFHGLHVTIGAIMLTVVLLRSAKGHFSPENHFAFEAAAWYWHF
                     VDVVWLGLFIFVYWL"
     CDS             complement(559120..559989)
                     /codon_start=1
                     /gene="hslO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HTZ6"
                     /locus_tag="MishRS11D_04790"
                     /product="33 kDa chaperonin"
                     /protein_id="BBL73381.1"
                     /transl_table=11
                     /translation="MSEYDSLQRFLFEDLGIRGELVRLDASWRSVQERHPYPPKVAEQ
                     LGQALAATLLLSATIKFQGSLILQAQSGGPIQTLVAQATHHRGLRGLARWQGEVAGRS
                     LAELFGEGRLVLTIQNEGNEPYQGIVPLEGANLAAALQSYFALSEQLPTRLWLAADGQ
                     RATGLFIQELPAQRRSQEDWDRITYLADTVTEAELLKLPRQELLYRLFNEERVRVFES
                     EPVAFRCGCSRERIEGLLAHLAQDAIESIAQERGMIEVDCEFCNRHYSFDPIDVRLMY
                     SGQPKPPSSTTRQ"
     CDS             560057..560701
                     /codon_start=1
                     /gene="msrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8DKH4"
                     /locus_tag="MishRS11D_04800"
                     /product="peptide methionine sulfoxide reductase MsrA"
                     /protein_id="BBL73382.1"
                     /transl_table=11
                     /translation="MFGSKKAVMPEPHQALPGRAGAMAVPEAHYVNGHRIAPPFPEDM
                     EIAEFGLGCFWGAERKFWSIPGVYATAVGYAGGFTPNPTYEEVCSGLTGHTEVVRVVF
                     DPARVGYGTLLKVFWEAHNPTQGMRQGNDIGTQYRSAIYTHGDAQLALAEQSRQVYRA
                     ALAQAGKPAAITTEIGPAPVFYYAEAYHQQYLAKNPEGYCGLGGTGVVCPVDAA"
     CDS             complement(560864..561049)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04810"
                     /product="hypothetical protein"
                     /protein_id="BBL73383.1"
                     /transl_table=11
                     /translation="MLIHTIRHSPRIMRFRSTNSQRRFCRASAANAAGVGILVKGLEF
                     IAADSRIPVVRAANAAI"
     CDS             560958..562247
                     /codon_start=1
                     /gene="roxS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003094421.1"
                     /locus_tag="MishRS11D_04820"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBL73384.1"
                     /transl_table=11
                     /translation="MAADARQNLRWLFVLRNLMILGECLIVWISIYGLDFPLREAPLW
                     GIVTLLCAFNWWTWLRLGSEDPIAEFELFIQLSVDVLAITAILYFTGGATNPVAWFFL
                     LPLIITATVLPQSYTWYMVIFASGCYTVLMGFYEPLPEIHAMTLQNDAGHMMHALSEN
                     HGLELHAFGMWFGFVFSAVLVAYFVVEMANTLRERDRRLAEVREQSLRNERVVALGTL
                     AAGAAHEMGTPLGIMAILIHEIEGDCDCEGGADLMAKMKILREQVDRCKKALSVMSAS
                     AGEIRAEAGHVMPLTAYLEQTVEGWRHQSPGTRLDYQSAGPIPAPGILAELTLTHALI
                     NILNNAAEVSPAGIELEARWDRERATLRIMDHGPGIAPAVAERLGKAPVSTKEQGLGV
                     GLFLAFATIERLGGHMDMAARPGGGTCTTIILPLVPG"
     CDS             562264..562848
                     /codon_start=1
                     /gene="roxR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003106283.1"
                     /locus_tag="MishRS11D_04830"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL73385.1"
                     /transl_table=11
                     /translation="MEEQIEEELEAALDEADSHLPTLLLVDDDPTFCGVLQSALAKRG
                     FEVHTANDVEGGAALAERVDPEYAVIDLRIGYESGLVLVRRLHELDANTRIVMLTGFA
                     SIATAVEAIKLGAVHYLTKPADADEIVAALHKDAGDASVEIKEKPLSVRRLEWEHLQK
                     VLVEHSGNISAAARALGMHRRTLQRKLEKRPVKE"
     CDS             563054..563506
                     /codon_start=1
                     /gene="pilE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010947632.1"
                     /locus_tag="MishRS11D_04840"
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="BBL73386.1"
                     /transl_table=11
                     /translation="MNVKAQVQKGFTLIELMIVIAIIGILAAIALPAYQDYTTRAKLS
                     EVVSMAEPAKVAVAETAQTLGGLANVTATNTGYTFANATNYVSAVTVGAGGIVTATSK
                     VPNANGDLLFTPAEATAGSGLLTWACTSTTISDKFLPANCRTGYVAGQ"
     CDS             563745..564377
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003688173.1"
                     /locus_tag="MishRS11D_04850"
                     /product="fimb protein"
                     /protein_id="BBL73387.1"
                     /transl_table=11
                     /translation="MELILILAGVDVCLGPLLTLIVWDVKKPKLWLDMAIIVLIQLNA
                     MGYGLRTIYLARPVYMVFSVDRFDLVAVPDISMEEMKKFSYEEYKTLPLTGVKVVAAK
                     MPTDVTEKNELMFSALAGGADLPQSPHYYAPYAELAPEAARKAKPLDALTQRDAATRD
                     KLSAYLSSHDLDPAKVKFLPMRAKAHDQTVLVDADTGAVLGIVNIDPWVQ"
     CDS             564458..565051
                     /codon_start=1
                     /gene="hisB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MK23"
                     /locus_tag="MishRS11D_04860"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="BBL73388.1"
                     /transl_table=11
                     /translation="MNHRTAEVERNTSETQIRIRLDLDGGGKGVFDTGVPFLDHMLDQ
                     VARHGLIDLDIRARGDLHIDAHHTVEDIGITLGQAVERAVGDKQGIRRYGHAYVPLDE
                     ALSRVVVDFSGRPGLSYDVTFPRARIGDFDVDLFGEFFRGFVNHAKLTLHIDSLKGQN
                     AHHVAETIFKAFGRALRMALEADPRMQGTIPSTKGTL"
     CDS             565065..565709
                     /codon_start=1
                     /gene="hisH1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HU42"
                     /locus_tag="MishRS11D_04870"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH 1"
                     /protein_id="BBL73389.1"
                     /transl_table=11
                     /translation="MSSVAIIDYGMGNLHSIAKAVQHADPSAAVVVTDRRGAILEADR
                     VVFPGVGAIRDCMAALESRGLAQVLREAAATKPLLGICLGMQALLDASEENNGTACLG
                     LIPGRVLRFADTLRDPAGHALKIPHMGWNEVFPQGDHPLWAGIAPGSRFYFVHSYYAR
                     PANGADVAATANYPEPFAAALAHGNIFAVQFHPEKSQAAGLRLLANFLRWHPES"
     CDS             565751..566482
                     /codon_start=1
                     /gene="hisA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HU43"
                     /locus_tag="MishRS11D_04880"
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino] imidazole-4-carboxamide isomerase"
                     /protein_id="BBL73390.1"
                     /transl_table=11
                     /translation="MLLIPAIDLKDGKCVRLRQGRMDEDTVFSDDPVAVAGKWVSEGA
                     QRLHLVDLDGAFAGVPRNAEVIHAIRATYPEVRIQVGGGIRDEETIQGYLNTGVDYVI
                     IGTKAVSAPHFIREVAAEFPGHIIVGLDAKEGKVAIDGWSKLSHHDVIDLAQKFEDDG
                     VEAIIYTDISRDGMMGGVNVEATARLARSIRIPVIASGGIHTIADIHALGQVVGDGIM
                     GAITGRAIYEGTLEFASARKIAEQY"
     CDS             566484..567248
                     /codon_start=1
                     /gene="hisF1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HU44"
                     /locus_tag="MishRS11D_04890"
                     /product="imidazole glycerol phosphate synthase subunit
                     hisF1"
                     /protein_id="BBL73391.1"
                     /transl_table=11
                     /translation="MLAKRIIPCLDVDNGRVVKGVRFVEIKDAGDPVEIARRYDREGA
                     DEITFLDITASSDNRETMVHVVEQVAGEVFIPLTVGGGIRTLEDIRRMLNAGADKVGI
                     NTAAVFRPEFVREAAERFGSQCIVVAIDAKQVAEDPKRWEIFTHGGRKATGLDAVEWA
                     RRMVEYGAGEILLTSMDRDGTKQGFDLDLTRAISEAVPVPVIASGGVGNLQHLADGVT
                     QGKADAVLAASIFHFAEYSIREAKAHMAAQGIEVRL"
     CDS             567245..567631
                     /codon_start=1
                     /gene="hisI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HUB7"
                     /locus_tag="MishRS11D_04900"
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="BBL73392.1"
                     /transl_table=11
                     /translation="MSAWLDEVRWNEDGLIPAIAQEAATGQILMVAWMNREALALTAQ
                     EGHAVYWSRSRKKLWRKGEESGHRQKVLEIRLDCDEDVILLKVEQIGGIACHTGRHHC
                     FFRVLRGGRWETVEPVLKSPESIYTA"
     CDS             567636..567953
                     /codon_start=1
                     /gene="hisE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HUB6"
                     /locus_tag="MishRS11D_04910"
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="BBL73393.1"
                     /transl_table=11
                     /translation="MDVLTELAAVLEQRKTQDPKSSYVAGLYAKGLDAILKKIGEEAT
                     ETVMAAKDGVPDKIVYEVADLWFHSMVLLAQQGLHPDQVLDELRRRFGLSGLDEKAAR
                     SPQ"
     CDS             568153..569871
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_04920"
                     /product="hypothetical protein"
                     /protein_id="BBL73394.1"
                     /transl_table=11
                     /translation="MKASTYFSPMGGQQLGVMVPEPTLSGVSVWLAELPLANTPYCFD
                     AIEAALESFNHRPELPIWVRVELAELLRPMVLMLAQQAEARFLDAALPYAAEAERYIH
                     QGIGLHRELGMGYVLAAFDAVGSSRRGRAENAQALALYRALEHWGQVLLWTSRLYRPV
                     DEAYWLILYRLYRVAEARRTLDLVFDEMDEPAPCRTAGGVFIRSVLFAAANTRRLRQR
                     DMGLVFKLLGQWVDRVGFGTEIVRDGQLAEIYIDVGGSLPPARTRLPNGFEVSEPRFL
                     HTQSLANTLLEPEVVLGKSPHERAVLIRVARSLAGLEKRRYARRAESDRCGCVAGLPS
                     LVAALGGRPDCGPDDSAPSGAALELIRERHERSPSADGNIEARLSRSEVGLGKLLASR
                     RKGVAAVRAEDIWSVDQESAMAPEAVPVMVEGRIVNSSAQGCCIFWSAQPAARTKVGE
                     LIGLWLGTPERQLRFIAVIRWVECGKQGLTFGVELFAPSAEVVEIYDGASKPRGKALL
                     LAADGVLRKGPELLALPGAVRQGGTVRVRAGGELAHYWVSEELEATLSFARYSLVELD
                     SGGEDA"
     CDS             569963..570511
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001889777.1"
                     /locus_tag="MishRS11D_04930"
                     /product="gamma carbonic anhydrase family protein"
                     /protein_id="BBL73395.1"
                     /transl_table=11
                     /translation="MAVQNFHGIEPRLGAGVYIAESAVVIGDVGLGRDVSIWPTSVVR
                     GDVNLIEIGDETNIQDGSVLHVTHRSAANPEGHPLIVGNGVTVGHRVVLHGCRIGDLC
                     LIGIGAIIMDGAVVEERVIVGAGTLVPPGKRLESGFLYVGAPAKQVRTLKDEELEYLS
                     YSKDGYVLLKNQYLRDAGLALS"
     CDS             complement(570508..571347)
                     /codon_start=1
                     /gene="aroE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P43904"
                     /locus_tag="MishRS11D_04940"
                     /product="shikimate dehydrogenase (NADP(+))"
                     /protein_id="BBL73396.1"
                     /transl_table=11
                     /translation="MTFPDRYAVFGHPIGHSQSPRIHALFAAQTGQSLTYTAQDVPAE
                     AFETAVREFFATGGKGLNCTVPLKELAFAWADSLSERAARAKAVNTLALRPDGAVFGD
                     NTDGEGLVRDLTGNLGLEIGGRRVLLLGAGGAGRGVLAPLLALAPGRLVIANRTVAKA
                     EILAGEFGDLGPVVGRGFADLAGESFDLILNATAASLGGEVPDLPGGILAAGGSCYDL
                     AYGKEPTPFVRWGGAAGAALSVDGIGMLVEQAAVAFELWRGVRPATRPVIAALNAGRG
                     LAA"
     CDS             complement(571354..572142)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013227782.1"
                     /locus_tag="MishRS11D_04950"
                     /product="hypothetical protein"
                     /protein_id="BBL73397.1"
                     /transl_table=11
                     /translation="MPWTFAHPAAVLPLWPYCPAWLRCGALVAGSLSPDLGYYLQRFD
                     WATLAHTGAGSLLVGLPSGLCLYGLAYGLRKPLCHALPQPHRAALWPLTQAPGPSRPG
                     EWVALAVSVVLGAWTHTGWDSLTHRDGWVVAKLAWLRESMRIGGTEFPVYALLQQFST
                     VAGTLILLACYRAWLRAQPAPAPSWQDDRGRYLLGSLAALAALIAAVLVSLPTVADIQ
                     GTMAVRVLAFQLAVHGTAIFLPLFTLGALVFYGLSRPPSNDSND"
     CDS             complement(572156..573118)
                     /codon_start=1
                     /gene="hemB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEG3"
                     /locus_tag="MishRS11D_04960"
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="BBL73398.1"
                     /transl_table=11
                     /translation="MRRDDFSRRLMRETRLAPDDLIYPLFVLEGGNRREAVASMPGVE
                     RLSIDLLVEECAAAHALGIPAVALFPVTPPELKSLDAAEAHNPEGLAQRAVRALKQAV
                     PGLGVMTDVALDPFTTHGQDGLIDGQGYVVNDATVEVLVKQALSHAAAGADIVAPSDM
                     MDGRIGAIRAALEAQGQVNTRILAYSAKYASAFYGPFRDAVGSAAHLAGGDKYSYQMD
                     PANSDEALREVALDLAEGADMVMVKPGLPYLDIIRRIKDEFGVPTLAYQVSGEYAMLK
                     AAAQNGWLDERKTVLEALLSLKRAGADAILSYYAKDVAQWLREA"
     CDS             573269..573931
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012546348.1"
                     /locus_tag="MishRS11D_04970"
                     /product="toluene tolerance protein"
                     /protein_id="BBL73399.1"
                     /transl_table=11
                     /translation="MKFTKSSFGLASWAGVLGLLLGLCAATVRAEEGLLPPQVVIQKT
                     ADQLQVSLQKPEYKSDFRKATALVDQIIEPQIDFDRVSVLILGKLWKTASPEQKDRFK
                     KEFRLLLVRTYTTAFTEYADWKIRYLPLEMNPADKKVMVRTEILQSGAQPVGVNYRMI
                     LEGSQWKVYDVLIEGVSLLQNYRSSFTEEVARTGSLDQLIAHLTERNAAALKEPVGKK
                     GS"
     CDS             complement(573926..574837)
                     /codon_start=1
                     /gene="hemF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P43898"
                     /locus_tag="MishRS11D_04980"
                     /product="oxygen-dependent coproporphyrinogen-III oxidase"
                     /protein_id="BBL73400.1"
                     /transl_table=11
                     /translation="MNTPDLAAVKTYLLDLQDRICAALETEEPEARFQEDNWTYASGI
                     GGGRTRVMAGGQTFEQAGVNFSHVAGKTLPPSATAHRPELAGRGFQAVGVSLVVHPLN
                     PYVPTSHANVRFFIAEKEGEAPVWWFGGGFDLTPYYPFEEDAAHWHRTARTACEPFGP
                     EVYPRFKRWCDEYFFLKHRGETRGVGGLFFDDVNEGGFERSFSFLRSVGDHYLPAYLP
                     IVRERKATPHGAREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPVAH
                     WRYDWKPEAGSPEEALYRDFLRPRDWL"
     CDS             574961..575950
                     /codon_start=1
                     /gene="cmoB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KIF5"
                     /locus_tag="MishRS11D_04990"
                     /product="tRNA U34 carboxymethyltransferase"
                     /protein_id="BBL73401.1"
                     /transl_table=11
                     /translation="MIDSPELAAYATLAETFPEPVFRPWLESLPAQLARAFAADHHGD
                     WPRWREVLRRLPPIQPAWVNLNADAVQLKGRADAAAELALIETLLRELHPWRKGPYDV
                     LGIPIDTEWRSDLKWRRLESAIQPLAGRTVLDVGCGNGYHAWRMVGAGAGRVIGIDPT
                     LLSVAQFLAIRHFAGDFPVYVLPVGIDDVPPNLGAFDTVFSMGVLYHRRSPLDHLLEL
                     KGCMREGGELVLETLVIEGGAGQVLVPEDRYARMRNVWFIPSCPTLEGWLKRCGYRNI
                     RLIDVTPTTAEEQRSTDWMRFQSLPDCLDPANPGLTVEGLPAPRRAVFLAEGP"
     CDS             576038..576670
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05000"
                     /product="hypothetical protein"
                     /protein_id="BBL73402.1"
                     /transl_table=11
                     /translation="MSPDPRFRPLESLLRQHLDNSIACGQELKRLFGHLDAPQAHIAE
                     IRRMEEFGDRLTAEAHRALEDPPYSELIHLTQLWVKHLDDIIDGLNNTARVIDIFTPE
                     RAEPDAQRILAIILEMAARLAVEVWRYPGNTLDGVRDCREALKRWEEEADAIYHEWRK
                     SHRRHSSLSLISELDWTEILGLLEATTDACYHSAVLLERITRHHLRQAAS"
     CDS             576740..577465
                     /codon_start=1
                     /gene="cmoA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KIF6"
                     /locus_tag="MishRS11D_05010"
                     /product="carboxy-S-adenosyl-L-methionine synthase"
                     /protein_id="BBL73403.1"
                     /transl_table=11
                     /translation="MSKDQLFRAPQPIAGDFNFGQETALVFDDMLDRSVPFYAELQRM
                     IGEIAADFAAEGSRLYDLGCSTGTTLLCLDRMVPPGVAFVGVDASPEMLEQARQKLAR
                     HGLARPCELVRQNLDQGVALVDASVVVMNLTLQFVRPLHRDRLIAAIAQGTRANGCLI
                     LVEKVLGQDSTLNRLFIKYHYDFKKRNGYSELEIAQKREALENVLIPYHLEENRELLL
                     RNGFRTCDVFFRWYNFCGMLAIK"
     CDS             577531..578199
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010895592.1"
                     /locus_tag="MishRS11D_05020"
                     /product="hypothetical protein"
                     /protein_id="BBL73404.1"
                     /transl_table=11
                     /translation="MSTAEKSSARKTPLLKGTLVMWNDLKGFGFVRPEPADGDQDDHF
                     IHITAFKKGMSRRPEIGDAVRFRPDDSAEAGDKKRAAFALIEGMDYEHPEPKPFSLAP
                     KPRSLLTNLLILTPLMLSSYTLWMARNPLPFFSYCIFSLITIMIYGADKTHAATRRWR
                     VPENYLLVLELMGGWPGALVAQNQLRHKTRKSTYKILLHTIVAAHLLGWAVYLYWKLH
                     LQTA"
     CDS             578668..579150
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05030"
                     /product="hypothetical protein"
                     /protein_id="BBL73405.1"
                     /transl_table=11
                     /translation="MRRPPNRSPKPVKPSAPLPRPAAEIFAGLLFAEVPPPVLQRLQT
                     MNAVLADNMRGLDDVGRNNMREALARWSCRLPEGLESWNHAFVAAMAHVHEAKFAKWL
                     KQLPDPPPEPPGLWETLAAQAAAPDETGLAACLILYDLGCARAFLAFKRSASAAPFSP
                     "
     CDS             579166..579930
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8DHM3"
                     /locus_tag="MishRS11D_05040"
                     /product="UPF0721 transmembrane protein"
                     /protein_id="BBL73406.1"
                     /transl_table=11
                     /translation="MSGIEWALVALAALAAGAVNALAGGGTLITFPLLTAVGLPAIEA
                     NITNTVALCPGYFAATLAQAGDLRSQRRRLWLYLPTAILGGIVGGALLLHTGERTFRA
                     LVPYLILFAALLLAGQDWVRAWLLRRANHPDSARWLETLGVVPAFLAAVYGGYFGAGV
                     SVIVLAVLGLVLDDSLTRLNALKQGVAFAINTAAALFLALSGRVDWPVALAMAVGALV
                     GGALGGKLAGRIQPALLRGIVVGVGVVVAGIYWVRG"
     CDS             579958..580233
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05050"
                     /product="hypothetical protein"
                     /protein_id="BBL73407.1"
                     /transl_table=11
                     /translation="MVDRAAVAEDWRRRGFGCDLWVDPPGQRWEDFVHGVDELVMVVE
                     GRVEFEIDGVVHQPEAGEELLIPAGAVHSVRNLGGGPARWLYGYHAG"
     CDS             complement(580297..581712)
                     /codon_start=1
                     /gene="sdaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011963040.1"
                     /locus_tag="MishRS11D_05060"
                     /product="L-serine ammonia-lyase"
                     /protein_id="BBL73408.1"
                     /transl_table=11
                     /translation="MESISAFEIIKIGIGPSSSHTMGPWRAAAQFVNELGDLDAVAQI
                     NARLYGSLAKTGAGHGTDIAVLMGLSGEDYTRIDTGAIPAKVEAIKRGGRLHLGGVRE
                     LPFAYASDLVFDYDTTLPRHANGMRFGATRKDGSTVERTYYSLGGGFIATEHEPDPAT
                     MKKIVTPYPCHTGAALEDNCRKLGLSVSELTYVNEQAWRSRAEIDALALGLWKEIREC
                     VFRGVNSEGYLPGGLRVRRRAAEMNRRLLGDAVYASLNQWLDLIQSQPRDFTRVNKWI
                     SCFALAVNEENASFGRIVTAPTNGAAGVIPAVLMYAWCFLDGFDQDKVIRFLLIAGEI
                     GTLFKKNATISAAMGGCQAEIGVSSAMAAAGLAEALGACPAQVLIAAEIAMEHHLGLT
                     CDPVGGLVQIPCIERNSMGAMKAITAANIALETDPKDARVSLDAVIKTMWETAQDMNS
                     RYKETAEAGLAMHIPVSVPEC"
     CDS             complement(581869..583632)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05070"
                     /product="hypothetical protein"
                     /protein_id="BBL73409.1"
                     /transl_table=11
                     /translation="MPQATRLLIVDDDPLTRTLIGGTLKTMGFDIAEAGDGLECLALF
                     GSEPVDAVLLDVMMPGMDGFTACAELRKLPQGRHTPILIMTGLDDLESITRAFEAGAT
                     DFITKPINFPLLGHRVRYALKASDTTRRFADSERRLHRLAYFDSLTELPNREFFKEHL
                     HYMVSLAAAKNSLLAVLFLDLDGFKRINDTLGHPLGDKVLRAAAERLRQSLRAGAAVG
                     WSERFREGDALARLGGDEFTVLLSRIERAEDASLAAERIRTALGQALKIGGQELYTTV
                     SIGIAVFPEDGGNADELLRNADLAMYYAKRDGGNAHRRFSGQMAAAVLKRMTLENLLR
                     KAVERGELRLHYQPQFNINDGTVAGAETLLRWTNPELGMVSPAEFIPLAEDTGLIVPI
                     GEWVLRNACAQAKAWRGQGLALPRMAVNVSAVQFLHKGFPDLVTRILEETGLEPRALE
                     LELTESALMQDADSATLALRTLKDIGVQLAIDDFGTGYSSLSRLKQFPIDRLKIDRSF
                     VRDIETDADDAAIAVAVIAMASSMKLEVVAEGVETPGQLEFLRSRGCHEVQGFLLSRP
                     LPAEQIAALLARPGARRAGSA"
     CDS             583881..585233
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05080"
                     /product="hypothetical protein"
                     /protein_id="BBL73410.1"
                     /transl_table=11
                     /translation="MGFLSRLFGAKHREPDSEISELVEASPERRVILPSARPPLPITL
                     DILKRLFPIRNLDDDELGAYALERKAEVCGPGSILFRAGYPIKYVHYLLEGTVVMDVG
                     QGTRYEIGADTAKARFPLCYGKHYTATAEAKTDVQILRVSAKIMSLGSTLTREIPHSL
                     DADNLDIPEAVRESSLFQAFSQHYRDDELRVPSLPEVAARVGQAVREDVGLAEIARIV
                     QLDPVIAARLVHIANSPLYLPSRPVVTCLDAVSRLGLLATRNLVMAFALKQVFRCKDE
                     DLARIAQNHWRHSIHLSALCYVLAADNPGMNREEALLAGLLADIGAVPCLYFTENLPR
                     TLWTPEEVEAILPRVRGPVGAYILKRWDFPPELGIIPQVAEDWYYDGGERLTLNDIVI
                     LSKLHSYIGTPQMAALPAINAIPACTKLKNQQLSPAYSLRVLHEAKDAIAQAMKFFEG
                     "
     CDS             585294..587339
                     /codon_start=1
                     /gene="prlC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704124.1"
                     /locus_tag="MishRS11D_05090"
                     /product="oligopeptidase A"
                     /protein_id="BBL73411.1"
                     /transl_table=11
                     /translation="MSNPLLESHDLPPFSRILPEQVVPAITQLLADNRAAIAALLEPG
                     KTYTWDNLVEPLEDLDDKLNRAWSPVGHMNSVVNSDALREAYNACLPLLSEYATEVGQ
                     NEALYRAYRAIADGPEFARLDPAQRKIIDNALRDFRLSGVDLPPEQKDRYKDIAQELS
                     KLTSQFQDNLMDATQAWTKHIEDESLLAGLPDSAKAMARQAAAAKELPGWLFTLEFPS
                     YIAILTYADHRELRQEFYTAYATRASETGPNAGQFDNTELMERILALRHEEAGLLGFA
                     NFAELSLATKMAPSTDEVVAFLTDLAERSLPHARRDLAELKAFAAGHLGLADAQSWDL
                     TYASEKLRQHKFDLSEEEVRTYFPAPKAVGGMFAVVEKLYGLSIQAVEGVEVWHPEVT
                     FYEIHDRDGQKRGAFYLDLYARPKKRGGAWMDECLTRRRKGDAVQTPVAFLTCNFTPP
                     TGDDPALLRHDEVLTLFHEFGHGLQHMLTQVDHLGVSGIHGVEWDAVELPSQFMENFC
                     WEPEALALISGHYQTGEPLPQALLDKMTAARNFQSGMQMVRQLEFSLFDFRMHREYDP
                     AQGGRVYAILDEVRKQVAVVVPPAFNRFPHSFSHIFAGGYAAGYYSYKWAEVLSSDAY
                     SLFEENGVFDADTGRAFMENILETGGSRKAMDVFVAFRGREPNIDALLRHNGIAEAA"
     CDS             587435..588232
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010919615.1"
                     /locus_tag="MishRS11D_05100"
                     /product="nucleoside triphosphate pyrophosphohydrolase"
                     /protein_id="BBL73412.1"
                     /transl_table=11
                     /translation="MQNTLRLLDIMARLRDPETGCPWDVQQDFASLVPYTLEEAYEVA
                     DAAERGDPEDLREELGDLLLQVVFHARIAEERGLFGFDDVAGAIADKLVRRHPHVFGG
                     VVFDSDEARQRSWEASKQAERQEKGKAAPAPSVLDGLTDSLPALMAAQKLQKRAARHG
                     FDWPEIGPVFDKVREELLELEEAQAAGDPGPIREEIGDLLFVVVNLARHFDVDAESAL
                     RDGNRKFSQRFRYIEERVAALGKTLDETTLAEMDALWDEAKRWGTRS"
     CDS             complement(588354..588941)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05110"
                     /product="hypothetical protein"
                     /protein_id="BBL73413.1"
                     /transl_table=11
                     /translation="MKKLRTLLFAAPFLAFSALAPSVDAAPILVGSGPYTGISGIDIS
                     GTSYDVTFIEGAYDSLSSTHFGLTQGNDTLANAIASAIANVLLAGPTTRAQVYGLTGT
                     GSGSSILIPVGIGFPFGSGTPFVVGSQVHSDFAPSNWQVGTSPTPLNSPTNDTTTGDL
                     VYVDVTLSAAAVPEPTSLALFAAGLAAAAVRRKPA"
     CDS             589273..589935
                     /codon_start=1
                     /gene="nfi"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A1JIJ2"
                     /locus_tag="MishRS11D_05120"
                     /product="endonuclease V"
                     /protein_id="BBL73414.1"
                     /transl_table=11
                     /translation="MRIHHEHPWNLDPKAAIALQNQLRRLVKIEDELPADIRRVAGVD
                     VGFEDGGKVTRAAVAVLDYPGLGLIESSIARLPTAFPYVPGLLSFREVPAILKALAGL
                     AVLPDLLLVDGQGYAHPRRLGIACHLGLLTDLPSIGAGKTRLCGRHEEVPDVKGAWVP
                     LRDKEETLGAVLRTRRGVQPIYVSAGHRIGLATAVEWVLRCTGRFRLPETTRQAHRLA
                     SG"
     CDS             complement(589972..590193)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011140188.1"
                     /locus_tag="MishRS11D_05130"
                     /product="hypothetical protein"
                     /protein_id="BBL73415.1"
                     /transl_table=11
                     /translation="MYLKQKKDGHLVEVLGLNDLVNPIHTQVIGRLHYGEEMQEPDKF
                     PKTELIFPSGEALPQCWMDVHYRDQELHR"
     CDS             590485..591951
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012582502.1"
                     /locus_tag="MishRS11D_05140"
                     /product="NADP oxidoreductase"
                     /protein_id="BBL73416.1"
                     /transl_table=11
                     /translation="MYEHLETAANPENLKRIVIDPVTRVEGHGKVTLLLDEDNRVKQA
                     RLHIVEFRGFERFIQGRPYWELPIMVQRLCGICPVSHHLAAAKAVDQLVGVDQLTPTA
                     DKLRRLLHFGQMLQSHALHFFHLASPDLLFGFGSDLAKRNIVGVIQDYPDVGLKGVKL
                     RKYGQEVIRMICGKRVHGTGAIAGGMNKALSAEERDYLLEGIAEAVQWSQEAVELAKR
                     LHLADLEHNGQFAYIRSNFLSLIRADGAMDLYHGGLRARDDLGQDIFDHVDYRQYTDY
                     LREEVRPWSYMKFPYIVSKGKENGWYRVGPLARVNNCDFIDTPLAEAARQDFMAHGAG
                     GPVQGSLAFHWARMIEALHSAEGIQRYLLDPEILGTDLVVKGQKRYAGVGVIEAPRGT
                     LFHHYQIDDQDLVVKANLIVSTTSNNQAMNESIRQVAATYLDGVEPTEGLLNHLEVAI
                     RAYDPCLSCATHALGKMPLELEILDAEERVVSRLQRHA"
     CDS             592086..593369
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706550.1"
                     /locus_tag="MishRS11D_05150"
                     /product="twitching motility protein PilT"
                     /protein_id="BBL73417.1"
                     /transl_table=11
                     /translation="MKFQAYLKLLVYKDGSDLYLTANAPPAAKFQGKLTPIDNLMMTD
                     ESIREIAHSIMDAEQRREFEHRPEMNLAITEPGVGRFRVNIFKQRNAYAMVVRNIKVK
                     IPSLEELGLPETLKSVIMEKRGLVLFVGGTGSGKSTSLAALIDYRNTHSAGHIITIED
                     PIEFIHPHKKSLVNQREVGVDTQSYEDALKNTLRQAPDVILIGEIRSQDTMEYALAFA
                     ETGHLCLSTLHANNANQALDRIINFFPEERRNQLLMDLSLNLRAFISQRLVPTVDGKR
                     AAAIEILLGTPLVSDLIRKGEVHTIREVMEKSEGVGMQTFDNHLVRMYRQGLIGEETA
                     IKNADSANNVRLKINLGQPRMVEPEEEAPPEAAPAPGNKAETPPPERPKPAPGRSGLS
                     LEPIASEEETPAAAAALDEPSFEWKPAKPLNRPGG"
     CDS             593454..593951
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05160"
                     /product="hypothetical protein"
                     /protein_id="BBL73418.1"
                     /transl_table=11
                     /translation="MADLLIFGYGNPGRGDDALGPALLDLLESHLDPDTRQAAGGIEC
                     LTDFQLQVEHALDLAGRKLVLFADAHARCDPPYRFERLAPAGAMAYTTHALSPAAVLG
                     VYQRINGVAPPPCFLLGIRGDDFELGAALSQAAQGHLQAALRLVLDLCRHPHPDHWQA
                     YVSNG"
     CDS             594080..596206
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05170"
                     /product="hypothetical protein"
                     /protein_id="BBL73419.1"
                     /transl_table=11
                     /translation="MSDTPSALYLATDGFSTPQMGDLARAVESISPEAQVPQLLALFH
                     KREDLLAVPLLDEQRRYHGIVSRRAFMSFMSRSYARDIYARRSVADLIQAMPELAAAP
                     ANPGPEERIDRVLIDYLARDPGMLYDALPVVADEGIVGVVAIADMMLSLSESQGKLLT
                     AVRSLSDRLKQEVALAAQVQRQLLPPAEIDLPGVKGLATLLTSSEVGGDYYDCYTVEG
                     RYILLMIGDVSGHGVAAGTLVSAVKAGVNMLATAGERSPAQILGRLNATLLETARQTL
                     YMTFFAACLDTLTGQLTYANAGHQFPYLYRAMLGTLEMLEAAGLPLGKSEQAEYPEVR
                     VELDLGDRLFLYTDGLLEEPNAADEPFGYERLESLLHEQGGTALEGLRDGLLEALAQH
                     AGHPYFEDDVTFFSAEYHERPLRVAATPTQEIPDLNEPGLVRLLEAWYRANAEPLSPY
                     ISRQNLVFLAEGRFADLLPRFAQEGIRRVLPRHQPIVQRLGWDALINQHLGHAAADLA
                     GLIPGAGGEWRDFSVTHSDDKPFLIEECGAFLEEAGVKGEHLEPALLAIDELLENGLY
                     AAPKDGKGVPLYAKGGRRALADDERLGLSVALKDNLLGLAVADSWGTLTPAVFLERLA
                     RHVEGDGLISGQGGAGFYLLWRLSSYLQLRVLPYRRTQITVLFDLARPVDTEADKGFQ
                     FLFHSEVHETTHHVSNHPAYPAGRFG"
     CDS             596163..597686
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05180"
                     /product="hypothetical protein"
                     /protein_id="BBL73420.1"
                     /transl_table=11
                     /translation="MSPTILHIQPVDSADPKLRRYALGGVIDVDAIPALEPLYGLPAG
                     IRVELDFAAVQRVNSMGLAQLLKLFEHWQACGIDIRVENANRMTAMLFKMTGLDRFLG
                     TGGAKPAPAAASPAQAAERIRVRLRGILDIDAIATLEPLYKLPDGAEVELDFAEVQRV
                     NSMGLAQLLKLFEHWQARGIAIRASHVGRMTAMLFKMTGLERFLVPEAAAQPALAVNS
                     GLSLDGPAAPAKSLAYAKPVASTGPRAMVPPAAAPLAAAGDHALNWQVHMQSNQQLNG
                     WYFLNTHLQRRLGLAAHLDIADNLLGERGKAVAPAELVFTKPFDAVRLITRQGYRPLA
                     RPSDQSDEVTLLARADDGRATLAEFAGCKVAAATPDTFVYLLGRYLLDEQGLDSGAMS
                     YQFPGHEIKAVQMLLKGEADLLFMHGENYRRLSGMTRRMVRALDQSEAGFAFHLWCLS
                     PRRVELAEPLRDFLIGMNHDEEGRKLLAELGYAEWVEPIPEDIEMLERIYTLYGGGD"
     CDS             597885..600422
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05190"
                     /product="hypothetical protein"
                     /protein_id="BBL73421.1"
                     /transl_table=11
                     /translation="MGESFKTIILGVLLTLVSLAGVAWGDPVAGGLPFARTEVREPCA
                     NYTPTKQPFFGETHLHTAYSFDAVVLETRNTPEQAYLYAKGGRVGLPPWADTRIQDDT
                     PPDQKTLVAAYPYCMPGEHCQFMATRTVQFPEGRALDFAAITDHSEQFGESNTCMFEA
                     TQSCAADSDCDTRNGQKCFTAPGADTGMCRPRGYNDPICVAARDELSRLRQGAVPGIM
                     AGFENVAENPARPPVCGPDGRRCAQQAKLVWDKVRSMANDAYDRSSACAFTSFIAYEY
                     TAMAANGRCADATALPCWDQRQNNKVVDKPDDNTPSADCPSGAACLMNFTGNSGADNL
                     HRNVIFRNDQVIDQPLSNVEAPLGCGAGADCTSAPGWPVASPVPMLQKLKEACTDNPS
                     KPDCDVLTIPHNPNMSRGSMFIPPANTPAGLAEAALRQEFEPLVEITQIKGQSECRYN
                     AKTGMAWTNPPDELCGFENEGWARLGGVADGYLTDELQTTDTIPARSYVRNTLENGLA
                     YAAKHGVNPFQLGFAGALDNHNGTPGQTDAAQYAKSGAHGIQSFATSSGALNERFFLG
                     LETNAGGLTVAWAEENSRDAIFTALKNRETYATSGTRPIVRVFGGFGLPKNLCDKGDF
                     AERGYAGGVPMGGTLAGSPGGQAPSFAVSALMDAGWPGHAGTPLERAQIVKGWVDAGG
                     ATHEKVYDVVGKASGKAPEDLVNLRTCKPASWEGAKELCTVWTDPAFNPAQHAFYYVR
                     VLENPSCRWTQYYCNARGVDCSKPMGTCRTKDRSFNKKGCNSNAECGGGVCTLPQSYE
                     EYEYTQCCSGIVPQTVQQRAWTSPIWYKPAASPLADLLKDAPALAGR"
     CDS             600445..601440
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012706562.1"
                     /locus_tag="MishRS11D_05200"
                     /product="hypothetical protein"
                     /protein_id="BBL73422.1"
                     /transl_table=11
                     /translation="MVRRWLRHPLLHFVVIGAALFALRAFWPGAEPDRPQAQREPLVV
                     TAARIETLRADFTRRWGKPPTAQELSALIVQTLDEELLYREARLLALDYEDPSVRRRL
                     IEKMRAVGSHPGRDPDELAREARALGLDDDAVIRRLLVEKMRILLAQDPQAPAFTEEQ
                     LRDYLQRHRERFELPPAITFTQVFLSEARHGAGLKRAAQTLLRRIRALSPPDAAGLSD
                     PFLLGLRLQAWTWNRVTARFGKPFAEQVFALRPGAWSGPIESPYGLHLVWVEEVSVRH
                     LPEPESIRQQLVEGLQAEQAEAQLARGMERLRGLYGIQVEGHGELSSPRTLAARP"
     CDS             601442..602446
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012706561.1"
                     /locus_tag="MishRS11D_05210"
                     /product="membrane protein"
                     /protein_id="BBL73423.1"
                     /transl_table=11
                     /translation="MAGPWRGSLWALALWMAGALPVGMAHPLDPALLEIHESTAGALD
                     ILWRLPSAQEAEPPLRAVLPDACKPVSTTSIDRSGPLVTQRWRAVCDPADLVGRPIAV
                     TGLRERQTDALLRVHLADGRLIQHVLRGDAPLLLIPERAGRFDVLRDYLRLGFEHILG
                     GPDHLLFVLGLVLLILGWKRLLWTITAFTVGHSATLSLAVLGVVRVPPQPVEVLIALT
                     LVVVAVELARRGPGGGTWARRFPWAMASAFGLLHGLGFAGALAQVGLPAEEIPLALFA
                     FNLGIETGQVLWVAVILAGRAGLEAMPLRWPWPVGWVPAYAIGSLGIYWVIERAASWL
                     "
     CDS             complement(602537..603196)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391457.1"
                     /locus_tag="MishRS11D_05220"
                     /product="peptidase S16"
                     /protein_id="BBL73424.1"
                     /transl_table=11
                     /translation="MASNPFTLPFERLPSSLPIFPLPDAIVMPRCQLPLNIFEQRYLD
                     MVLDALGSERLIGMVQPDSSSGNEDAVYRTGTAGRIVSFNETSDGRLLIVLTGVCRFD
                     IVEEIPTERAYRRVLADWTRFQRDYETPNESVGYDRLRLMALLREYFQRKGFETNWTN
                     LEQVPVPLLANVLAGQLPFNPPERQALVETAAPEDIVAKLINLLEFDVVGAMVGDGRQ
                     H"
     CDS             complement(603223..604011)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05230"
                     /product="hypothetical protein"
                     /protein_id="BBL73425.1"
                     /transl_table=11
                     /translation="MIVKFRRAGFFYALGAWLALSGEACAQAQSFGLVIAAVDEADSE
                     DEDEEDSSANPQQRLDQLRGWLRQRNQERQGTESDAPAGDDSAPAHSYYNDSDWERPR
                     YSRAHYRAYRHQGRGHRHGHRHYRRGHRHGHHSYHGHRHRAARHGYRHVAVHHGRGHG
                     HHHYATHASHRPLGYPRHGHHHASHRPLGHPGHGHRGHAGPAHRSHALPKRGPSKTLR
                     QARPHATQAGFAAKRRTHAAPVKHRPAAHTPAKTFKRGGHKSRR"
     CDS             604263..604706
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05240"
                     /product="hypothetical protein"
                     /protein_id="BBL73426.1"
                     /transl_table=11
                     /translation="MKFATGFAATLLAAALSLPVLAETQPAAPAAAPPSPAPGQPAMG
                     GGMMGGMGDEAHLKQKQEFFLKMYETSGKILSAKDDKERDRLKAEQLEMMRENEKAMH
                     QMMQQHMQMMRQGGGMGGMGGMQHGGGQGGMGGMQHGDPAAAPAH"
     CDS             complement(604808..605191)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012583024.1"
                     /locus_tag="MishRS11D_05250"
                     /product="hypothetical protein"
                     /protein_id="BBL73427.1"
                     /transl_table=11
                     /translation="MNDAAPITYQLLIRVAEPVRVRVGRLGEFDFPAGRYIYTGSAKR
                     NPEARIARHLRALKRLHWHIDYLLGAPGVAVTGTLRFGEPECVVNQMTGGRILVPRFG
                     SGDCRAGCSSHLKWLDGEAGLAARP"
     CDS             complement(605188..605955)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F0KJ93"
                     /locus_tag="MishRS11D_05260"
                     /product="GTP cyclohydrolase 1 type 2"
                     /protein_id="BBL73428.1"
                     /transl_table=11
                     /translation="MPIARADLQSFLTELLQPSDYADYGPNGLQIEGTETLGRIAFAV
                     SATADSARLAVEGGAQALIVHHGLFWKFHGPKPLTGPFARRVFPLVRHGVNLFAYHLP
                     LDAHPEVGNAASLARALGMVELEPFGDHEGRPTGIKGRLAEPMAAEAWRGRLGAVLEH
                     PVMMASPDPEAPVRSAGIITGGANRDWPRAVRERLDAYVTGEMSEHDWHESQEAGLHM
                     YAGGHNATERFGILALMAKVEATFAVDCFFIPSGNPA"
     CDS             606070..607629
                     /codon_start=1
                     /gene="opgD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EI02"
                     /locus_tag="MishRS11D_05270"
                     /product="putative glucans biosynthesis protein D"
                     /protein_id="BBL73429.1"
                     /transl_table=11
                     /translation="MIRREVLLRLMALAAWGAWTPGRLLAARREPNRSAPEGKPFSRD
                     WLRQEARDLAQQPFVPAPDEALPDWVADLDWDAYQAIRFRPEQALWAGLGLPFQARMF
                     HLGLFFKHPVALYEVVHGVAEPVHYCPELFDFGKTAAPDAAEDLGFAGFGIYAPPDLD
                     HDLFSFLGASYFRAVGATRQYGLSARGLALDTGLPRPEEFPEFRAFWLERPSARADHL
                     RLHALLDSPSVAGAYTFEVRTGTHTVMEIEARLFPRRPIERVGIAPLTSMYQFGENDR
                     RVADDFRPEIHDSDGLCLHTGADEWIWRPLVNSPVVRVNSFFDHNPKGFGLLQRDRDF
                     DHYLDDGARYHLRPSAWVEPVGDWGRGAVQLVEIPTADETFDNIVAFWNPAEALGPGQ
                     ERVFRYRLSWGEVPVDRPGIAAAVATRIGAGGVPGQRGRVPSRKFVIDFAGGRLAGLA
                     GNARVEPVVWSSRGIVKEPAARPLQGTPLWRCNFDLMSEGGEPVDLRCYLRDDKGALT
                     ETWLYQWTPPG"
     CDS             607856..608788
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141987.1"
                     /locus_tag="MishRS11D_05280"
                     /product="hypothetical protein"
                     /protein_id="BBL73430.1"
                     /transl_table=11
                     /translation="MPGLDLLDVAISLVFLYLLISLIATTLIELVENFLNKRSAFLLE
                     GMKEMLGSDGQGLVAQVYNHPMIFSLFRGEFKDGGSNLPSYIPSRKFATALLDIVVQR
                     TDGVGTAPLGIQKIRESVDQLPDGQLKSALTAILNKAGDDVDQVRAELAAWYDDSMQR
                     VSGWYQRHTRMVALVVGFLVAASLNADTVGISANLSRDRAMREAFVAVAQGYAQRPAP
                     ATANADQDFSAFLDEVQKKTPSAGVPLGWNEMNPLPTGIWAILSKLAGLFLTAAATTL
                     GASFWFDLLKKLINVRSTVKPEPVPAATPATTGQ"
     CDS             complement(609126..611963)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05290"
                     /product="hypothetical protein"
                     /protein_id="BBL73431.1"
                     /transl_table=11
                     /translation="MPFLLLLSGFAGISYEVLYGRLLGNLIGDQFAVSAAVLITFLLG
                     SGLGSACAHRLWRWLWLIEAGIGACGLAFVLCYGDLQTLLYSGQVSAASGLGAQVGVG
                     VVLLLLPAFLVGCSVPLFAGYLATEADDAGFAQVYSIYNLGAGVTAVALEFAVLRWFG
                     ISGAMLGFVGINFGVAAWLRLGYGEPRPAPVVAVESRAFPVREVAALALASVASAIFQ
                     LFMVKLAEFMFGPFRETFALVLGIVLFGIALGTPLVKRYKVGFATLMLVNLAGLALLL
                     AAVEPAVTAYSLLYQGASEIRGAVTALKALLLLALMAVPALTFGATVPALLIRSAQVA
                     KESGYLLFVAALANSAGFLLMVFALHPYLDYGVQLLVVAGFSGAAWLVYRGLGVREIE
                     FAVAGAALLFAVQRWVWDERLLYMNYVTFQSHAEFTKTRASFKVTDRFKGHQDIFSIT
                     WIGNKPYFFINGYVSFPLNSSSEQIVGLMAAMFSPRTDEALVLGLGSGATASVVGMAF
                     DHTDAVEINPAVQANLGKLKRWNHDIANNPKVDVILDDAIHYVRGVGKTYSLILNTVT
                     SPLYFSSAKLYTLDFYRAVKTHLRPDGVYATWVDSRIGDVGINIILKTLGAAFKECSI
                     FYVKATYFLILCGDQPVALRQTGLASKAPEVWRELGGQYLTLPDWIPYNLLSGRALTL
                     IENPEAVPVNTLDFPALEFEIARLKHKGIPRFKAVLESRVQLDHVRDYLTALGEWKPA
                     RLVVEAGQRLDKEAYLTRRWSALVRAAAQDYRRDYAVADFDYWQALVDQTPTAKAHHK
                     YGYRLLENGRYEEAIAQFRQALALDGRYDNAYFNIGSAYEAMGNRAAALENYQRELAV
                     DGGDQEALYRMGRSYVELGDYEKAWFYLTIPKRSFDGIKAVLYRARALDGLGRRDEAM
                     ALYREIIQTRHADPAVVEEARRRLAEPVAAK"
     CDS             611926..612255
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05300"
                     /product="hypothetical protein"
                     /protein_id="BBL73432.1"
                     /transl_table=11
                     /translation="MPANPDSNSRKGKGFLDQGQEGDGNGRFMAWARGWMGKGIVAMK
                     YTPGMAWIGEAEMNKPGWVIDTDCYVFFAASRAIRLMPVRQWSMMHPPLVIDCPVRAR
                     EMDISAI"
     CDS             612405..613721
                     /codon_start=1
                     /gene="apeB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HYZ3"
                     /locus_tag="MishRS11D_05310"
                     /product="putative M18 family aminopeptidase 2"
                     /protein_id="BBL73433.1"
                     /transl_table=11
                     /translation="MNIAPEPQRHAQDLLDFIDHSPSPWHAAATLEIRLLAQGYTPLP
                     EGAAWSLGPGGKHYVIRGGSSLIAFHIGDGALPERGFRIVGAHTDSPGLRLKPKAPHK
                     AENLLRLGVEVYGGPILATFTDRDLSLAGRLHLRGPARIETRLLRFPRALARLPNLAI
                     HMNRGVNEDGLKLNKQSELPLLLTGLQGETQPEQRFLDLLAEQAGCAPADILSFELNV
                     YDTQPGAFWGAAGEFIADGQIDNLSSCHAGLAALLAAETGAHTQVAAFFDHEEVGSES
                     HKGAQGGFLADVLERIAHGLGLGAADYKRALAQGFLVSADAAHAYHPNFPNAYEPAHG
                     LKVNGGPAIKLNANQRYATDGLGEARFMRLCEQAGVPYQKYAHRTDLACGSTIGPMTS
                     ARLGLPAVDCGCPMWAMHSARESAGVLDQAWFAQVLRQFLDVAELP"
     CDS             complement(613735..614130)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05320"
                     /product="hypothetical protein"
                     /protein_id="BBL73434.1"
                     /transl_table=11
                     /translation="MFGFTLRFLAALVLVFATWNPSPWNYVRWATATGWGAPEAFAGV
                     VLLIGWVLFLHATLESLGFLGIALAGAFLGSLAWLLFDLGWLSAQGEAMAYVALVLIA
                     AVLAIGMSWAHIWRRMSGQVEVDEGHDHG"
     CDS             complement(614243..616552)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05330"
                     /product="hypothetical protein"
                     /protein_id="BBL73435.1"
                     /transl_table=11
                     /translation="MIRTAEQAACPEALTVEPETPVAEVLRSVRAGGGGAALVARGGR
                     LLGLVTVRECVFAALRYRNLPEVAVAELMYAPVPVAGAREDWATAYAAMVEQGICHRA
                     VVDAEGRCAGLIGLDDCWAGLVDALPGCLPVPEQAMSRAVVTVKETDSLLLAIRHMAR
                     HAIGCVVVERRGKPVGVLSDMDIAPLIQYGVDLAAIPASVRMGREVPVFPVDGAAAAA
                     FAALREPGVRRLVMVDGLGRIAGLLSRHDLLRGLGGEQAGPVPLHAIREGLEWRAIAD
                     AGEDAVAVLDGAGRVVRANRALAGLLRRDRAEILGRPLEAVLNGRNVQPIPRFWLKRR
                     AGDLVLAAQDPRNPFGIPVLLGSGPLELDGLAATGRLFKIRDLGGTLRHEERDRLWGA
                     LMEQSAEGVLVISAAGEIAEANRAFCEIVGCGEQALLGSDLAVWVDHGPAAPLFRALR
                     EAVAAGRDWRGTVLHQGRNGSLHSRELRVGPVEPERGAPARYLALVSGMPVAESVWYG
                     AGAWFEREAAAAGLESQLRRAIERDELSLCYQPQVEIEGGRVVGIEAMVRWQHGERGL
                     IAPDGILPTAERGGFMAELDRWVLRRACAQGRRWLDSGFNFGHITVNVAESHLRCPDF
                     GTTVRRILEETGLPAAGLEIDIPETALAVRDRELTEALDALSQLGVAVAIDNFGTGQT
                     SLMLLASLPVRCLKLDRGVLGEARATGSGLTRAAVAVGRTLGLGIIAKGVETERQRDE
                     LLAEGCGEAQGFLYGRPAPAEEIARMWAV"
     CDS             complement(616846..618324)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003088294.1"
                     /locus_tag="MishRS11D_05340"
                     /product="hypothetical protein"
                     /protein_id="BBL73436.1"
                     /transl_table=11
                     /translation="MALHLVVVESLKDWQPDYPKVRVVTARDYLSKPEYLKAKDLRVI
                     NLCRSYRYLSTGYHCSLLAEARSHRVLPSVRTLTSLSSKSIYSLNAEDLDGLIQRSLK
                     KRSAGPGDEFELPIFFGRGADPALQDLARQIFDLFPCPLLKVEFRYHGKWAIDTVKAL
                     PLNGMASGPHRPFFIDALNGYLAKPWRALRPRNACRWDLAILRNPAEKMPPSNALALQ
                     KFAKAGKRQGVDVELIEKRDYERLAEYDALFIRETTAIDHHTYRFARKAQIEGLVVID
                     DPDSILKCTNKVYLAELMAAHRIPAPQTRILQKGDPDLAKLGEGLGFPLVLKIPDGSF
                     SRGVFKADDPRQFQDLTQKLFKESDLILAQEFLYTQFDWRIGVLNGQPLYACQYFMSR
                     AHWQVVRHEASGRAVEGGFKTLAVASVPASVLDAALGIAKLIGDGLYGVDVKQDGRGV
                     YVIEINDNPNLDAGIEDQILGDQLYDRLVGEFVRRLEARRRA"
     CDS             complement(618326..619435)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113487.1"
                     /locus_tag="MishRS11D_05350"
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="BBL73437.1"
                     /transl_table=11
                     /translation="MIRPARLEDLETLVRIENTSFETDRISRRNFRYLLTKANAATLV
                     YEQGGAVCGYATTLFHTGTSLARLYSYAVDPAWLRRGIGAALVQRCEALALERECIAL
                     RLEVRRDNPASLKLFEKLGYRYLEIVPDYYEDHASALRFEKTLAPHLNPELARVPYYQ
                     QTLDFTCGPASLMMGMKALQPELELSRKLELRIWREATTVFMTSGHGGCGPYGMALSA
                     YHRGFEVEVYVNDDGALFITSVRDPEKREVMQVVQEDFLEELRTLPVRIVHSALNVME
                     LQEQMERGGIPVVLISSYRLYQEKFPHWIVVTGYDELYFYLHDPYVDTEAGKTLTDCV
                     NLPILKKDFQRMARYGKTGQKAVLILKKPGKRRRH"
     CDS             complement(619432..620289)
                     /codon_start=1
                     /gene="rlmJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87TK0"
                     /locus_tag="MishRS11D_05360"
                     /product="ribosomal RNA large subunit methyltransferase J"
                     /protein_id="BBL73438.1"
                     /transl_table=11
                     /translation="MLSYRHAFHAGNHADVFKHLALCCLVRALLHKDKPFFYLDTHAG
                     AGRYNLHAEMARKNREHETGISRLWDEPNPPAGVREYLDAVRATNPGRELRWYPGSPR
                     IVRPWLRDPDRMALCELHPNEVHLLEAEFAGDRQVRVEHLDGYQGLKALLPPPERRGL
                     VHIDPAYELKDERKRLLQAVKEGYKRWATGIYAIWYPIQDRATADDFLRRFKKLEIPK
                     VLLAEFSVLPDAPFRLNGSGMIVINPPWQLEEQLRAALPWLWERLAVGRQGRWRVEWL
                     AGERERGAE"
     CDS             620418..620912
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05370"
                     /product="hypothetical protein"
                     /protein_id="BBL73439.1"
                     /transl_table=11
                     /translation="MNPFLYKAHPLLHRLISLLLDPAGTTPADALALAALMFGLNLLW
                     VPALLWAALKTDRLRLSLPLAYGLALPACSLYTPMLLTVVGDVAAHGFRFQERFLLVF
                     ALFVVSQTLAGLYAFALRHRPSGYPAGLMAGETIALFMLLYSLVMAAGLLGLDAVFGI
                     FRGL"
     CDS             complement(620929..621357)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088400.1"
                     /locus_tag="MishRS11D_05380"
                     /product="aldehyde-activating protein"
                     /protein_id="BBL73440.1"
                     /transl_table=11
                     /translation="MIERTGRCLCGAVTFTLVGEPLAVRVCWCRDCQHLAANGSVNAM
                     VPAEALVVAGTLSAYTKQADSGNTVTRQFCPACGTQLFAQSSGRPQFRVVRIGNLDDP
                     SSLRPGMNIWAASAPGWACLDPALERVEQQPTPPPPRQSA"
     CDS             complement(621481..621870)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05390"
                     /product="hypothetical protein"
                     /protein_id="BBL73441.1"
                     /transl_table=11
                     /translation="MAILLVGAVLCMAALITSAWLMTFARWFPIEGIDKKFLVDYKTM
                     IRAHVDYALMALFNLAFYGAGVDLPVFACWCVAIGGFANPTVFVIAAFDPDFWNKTHW
                     KIYTAASFVITTLGFLGVGIAFLKHVL"
     CDS             complement(621931..622407)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05400"
                     /product="hypothetical protein"
                     /protein_id="BBL73442.1"
                     /transl_table=11
                     /translation="MKMPSWFRPAVAWVVLAAPLSAGAEAPAMVRGQLLYVPVYSEVP
                     YGDKGLNLNLTATLSLRNTDRGHAIRLKRIDYYGATGSLVRAYLRQAETLRPMASTEA
                     IVKESDRSGGISASFLVEWESDAPVSAPVVEALMVNSTYNQGLAFNSPARVLEERR"
     CDS             complement(622440..623198)
                     /codon_start=1
                     /gene="algR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007247212.1"
                     /locus_tag="MishRS11D_05410"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL73443.1"
                     /transl_table=11
                     /translation="MKILLVDDEPSARDRLRGLLAEIDPATEIVGEAGDGGEALRLIA
                     KAAPDLVFLDILMPRLDGIATAREISKLAEPPAVVFATAHDDYAVDAFELSAIDYLLK
                     PVRKQRLEAALSKAKRFTGEAWSKLAEALPPERRPARRHLCVYRHGELRLVPLAAVAY
                     FRADNKYTTVRFDEGEALLDDSLVSLEREFGESFIRIHRNALVAVDRVEGLHKLPEGG
                     MGMRLVGVAELLEVSRRHLPGVRERFRQIGGLVP"
     CDS             complement(623179..624234)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05420"
                     /product="hypothetical protein"
                     /protein_id="BBL73444.1"
                     /transl_table=11
                     /translation="MKTPEAFLPDFCSLTTAFMLILGSLLLAFVLALADFSPRYDFLT
                     EVGLRGLFIAWIAWLSAALLCAMRRWLGAWRAFRAGAAAFATVLLVTLAVGGVAQAGL
                     ARIGYPEGTGLEPWAFYGRILAISALVTLAWLRHQYVQSRWRSQIRAESIARLDALQA
                     RVQPHFLFNSLNTIASLIRKEPATAEELLLDLAEVFRAILKKTGKLVPLSEEIALTRQ
                     YLGIEQYRLGPRLKVAWDMRQAPGDALLPPLSLQPLVENAIRYGIEPALNGGKIEIQG
                     RLARGSLVLSILNSLPEEVVRRSRPGNGVALENLQARLESCFPNRARLYTSQADGRYQ
                     VRIVIPYQGAGHENPPR"
     CDS             complement(624338..624997)
                     /codon_start=1
                     /gene="tpm"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P6D0"
                     /locus_tag="MishRS11D_05430"
                     /product="thiopurine S-methyltransferase"
                     /protein_id="BBL73445.1"
                     /transl_table=11
                     /translation="MDPQFWLDRWQNQEIGFHLDGVNPLLERHWSALDAPAGCAVFVP
                     LCGKSLDLVYLRRLGHPVVGVELSALAVGQFFAENGLEPRVAERGPLRVFEAGGITLY
                     QGDLFALTPADLPAIGAVYDRASLIALPPERQPAYAEHLLALVPAAAPILLIALDYPA
                     GEMQGPPFSTPAAQVERLYGPRRAIDALEVLDALADSPALRARGLTALGETAWRLRAP
                     G"
     CDS             625289..630538
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05440"
                     /product="hypothetical protein"
                     /protein_id="BBL73446.1"
                     /transl_table=11
                     /translation="MPPPPHPPTLETCRPTLGIALVIALAFAVFALLSHTWVSRLGQD
                     WYDYHHNALRAARQLEKIRTAWDYGGFVHHFKEWILHRDPGDYDRAGAALQALYAAID
                     GYDRLKPDAEERADLDQLRIGVDQYAARHRRSGLPENRGLPPPELAQRVGVPDRDPLG
                     AAIARLQTHMDDQATRQDAKLAHSLDRLGTLIAAGLGFLPAFLLGGFSLARSQQRSAQ
                     LAENLRNSAQRLAESARTFRHLAQFSPVGIFRCDAGGDCVYVNERLAQMTGRAGDTPP
                     AGLDWLGDPHPEDCGRVLANWAGALAADGEFREEYRLLRADGGIAWVIAEARPERDDT
                     GAVAGYIGTCTEITESRHMQIWHEHFFALSPDLLCIAGLDGYFRELSASWNSTLGWTA
                     EDLRARPWLDFVHPDDRAASENARLRLVKGRRVHAFENRYRTREGGYRWLSWHSLPLP
                     EEGICYAVARDITEQKRAEDDIRRLNENLERRVVKRTAELAAVNAALRVSEARLQAIL
                     DNTRTVVFLKDLNGRYLLANRRYLKLFQLAPDQVLGKTDQDLFPTATTAHVQANDLAV
                     ARNGVPMEFEETVPTPDGVPRIYISIKFPLRDEQGQIYAVGGLATDITERKMAEAALQ
                     ASEARLRLFLEHAPASIAMFDRKMRYLATSRRWMTDYGLGDRDITGLSYYEVFPDIPE
                     RWKDIHRRGLAGEVLRSEEDRFERWNGEVLWLRWEIQPWYDGGDTPAGLVVSSEDISG
                     RKRAERELRLSEERLKLGMEVAGVALAEIDYATGLCHLSAEAAHLFGLGLEPTILSRA
                     ALHTVFHSDDQAELMDHIAACLDPGGPGWFAMEHRVVWPDGSVRWLRVRKQVFFADEG
                     AARKPVRAMLAVLDVTVEKAATAAVAASEAFVRGVLDSLPQQVVVLDETGEVRAVNEP
                     WLDFANAHGTPESAVSTGVNYLEVCRRAAAEGDAYAQEALDALQDLLAGRRERCVLEY
                     PCVGPEREQWFLLQARRLLYGRPGLILSHIDISERKQAEEALRNQEERIRTVFEHVVD
                     AIITIDSHGLIHSFNPAAERIFGYRAGEVLGRNVGLLMPEAQADAHDGYLKRYLDTGE
                     ARIIGLGREVLARHRDGHELPCDLAISEFHMGGERYFTGVLRDITERKAMLAALAQAK
                     EEAEQANRAKSLFLANMSHEIRTPMNAIMGMTALCLAANPSEQQRNYLTKIGSASESL
                     LHVINDILDFSKIEAGKLDMVEEPFILAAVFEGLASMLGAKAQERGLELVFHIAPGFD
                     QTLVGDAHRLNQVLVNLVGNAIKFSRQGQVRVDVDEVARGDGRITLAFAVRDQGIGIA
                     AATQARLFQPFSQADASTTRGFGGTGLGLAISKRLVEMMGGGIEVESAPRRGSLFRFT
                     ACFLLGGPVPARLPPPLFAQTPEGAALDQRRGADILVVEDAELNQEVMRELLERAGFK
                     VRLAVNGKEALRAVAEAVPDCVLMDCQMPVMDGFEATRRLRAEGYADLPIVALTANAM
                     AGDRERCIAAGMNGFVTKPVNLAELLDTLVRWVKPRAAPPPAQSPAAPGGPPLPELPG
                     IDTGRGLARIAGRLVVYVKLLRRFRDQHGPEFRADFQAARRRGDWTELGRLAHTLKGA
                     ALTLGITELGGWAARLEKAIRAGQAELAAQCLDPLEQSLETALAGLARLEDWKEAGPP
                     PPATTNPAEWAGLCRELEHLLEEHDTAALETVAALEQAMRGSGFQTEIAAIAHLIARY
                     AFMEARERLTRLIPLLPGPGNIL"
     CDS             630535..631569
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071150.1"
                     /locus_tag="MishRS11D_05450"
                     /product="two-component system response regulator"
                     /protein_id="BBL73447.1"
                     /transl_table=11
                     /translation="MNKPSLETLLLVDDSPQIIDVLGEILRPRYRVKFATNGPDALAL
                     ARKAPPSLILLDVMMQGIGGHEVCRRLKADPRTRDVPVIFITASDAAADEQLGLELGA
                     VDYLHKPLNPPLVLQRVRIHLDLHNQNLALEAKVRERTRQLEETRIEIVRRLSMAGEY
                     RDNETGMHIVRMSHTARLLALAAGVPERQAEVLYQAAPMHDIGKIGIPDRILLKPGKL
                     DPDEWEIMKRHTLIGAEIIGQHDSPLLRTARLVALTHHEKWDGSGYPHGLAGEDIPLE
                     GRIVALADVYDALTSQRPYKQAWPTAEAFAFLQEQAGRHFDPKLTGLFLGLEADIMRI
                     SATYQETSGP"
     CDS             631621..632955
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05460"
                     /product="hypothetical protein"
                     /protein_id="BBL73448.1"
                     /transl_table=11
                     /translation="MSASSFPLVLPKVQDTALETTKYQNLLRALRNRRLNAARLDHTP
                     LDITVDMCTACHLRCPYCATGSGVLDRRAQVLDLEEHRRILDFCGEQLFTIWYFSNGE
                     PLLNKRLHRIVADAKRYGIFTVISTSLSVPLSDTRIDEILYSGLDLISCSIDGPDAAT
                     YNRYRIGGDFNLVQRNLERLIARKRELGLQYPLIEWRYLVFRHNQDLQAETRRMAHSK
                     GVDILELFQGSAPAQAPEGAVAAMTGALLSPAISGPAVEAGLRRRDTLLRRHLPELSI
                     NPGEPGPGLLGRKCDWLYFGSMFYPDGSVGPCCVLGNSDTDFGQRGPGLDYRALWNNP
                     KYLDARASFPTPPKPSHSICAHCPAPQVQDWFFRQSLRAYLLNAPEWFIQAVLAEPEQ
                     LFYPVDLYMMPDEFMALKRYQQAKPSVRQAGEPGLDCPLSERDSQPQPSEGE"
     CDS             633245..633868
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05470"
                     /product="hypothetical protein"
                     /protein_id="BBL73449.1"
                     /transl_table=11
                     /translation="MKNLVKHRFDAAKCRTEWQDFIQLLASKPKLSETGDILPFFKQC
                     PDLSLLICKYFPKAKNPDVLAHEYEIYGDFVADLVVGDSAAHQYLLVEFEDATPDSIF
                     KYKGKKSTPDWSPRIECAYSQLVDWLWKLEDMRSTNDFFCEFGSHRARFQGLIVIGKD
                     MKLAQREIDRLRWRMDRTLIDSNAISVVSFDELAEEFDYWLKTHHGV"
     CDS             complement(633881..635011)
                     /codon_start=1
                     /gene="flhB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003083056.1"
                     /locus_tag="MishRS11D_05480"
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="BBL73450.1"
                     /transl_table=11
                     /translation="MAEDNDQERTEEPTAKRLEDSRKQGQIPRSRELNTLAVLMAGAA
                     GMLMFGSGLLHDLREVMLHDIRLTQRDAFDPEAPLAHLAYDLGLMLEMLWPLLALAVL
                     AALLGPLALGGWNFTSENLGVKLDKLNPLPGIARMFSAQAAVEAIKAVIKFLLVGFVT
                     AGLFMHHLDDFVGLGRLDFLPAASRAMDLVLTCLLWLCASLVLIAAVDVPFQLWSWKR
                     KLRMTLQEIKDEMRDAEGKPEVKSRIRGLQMEMARRRMMEEVPKADVVITNPSHYAVA
                     LKYDAAGMGAPKVVAKGVDLIAAQIRNLALGAEVPLVAAPPLARALHASTELDQEIPQ
                     ALYLAVAQVLAYVYQLRDARHHGGKMPGPLGDIEVPEEYARS"
     CDS             complement(635015..635785)
                     /codon_start=1
                     /gene="fliR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I3Q3"
                     /locus_tag="MishRS11D_05490"
                     /product="flagellar biosynthetic protein FliR"
                     /protein_id="BBL73451.1"
                     /transl_table=11
                     /translation="MRFDEAQILASIAGFAWVLLRSAAMFVSMPLFIGHTVPMPVRVM
                     LATGVAFAVLPNLPPMPEVELFSLPGLFVSVQQCLIGAAMGFVLHMVFAAIVFGGQSV
                     AYSMGLGFASLVDPLTGVQVPAIAQVYQLLATLLFLSMDGHLVMIRLLADSFQEVPVG
                     FEGLGRNALWELSRWTGKLMAAGLLFSLPMVAALLLINLGFGVASRAAPQLNIFSVGF
                     PISLLLGLILMRLTLPDVLALFAGFLDEGYRLIDHLLG"
     CDS             complement(635789..636058)
                     /codon_start=1
                     /gene="fliQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_008500315.1"
                     /locus_tag="MishRS11D_05500"
                     /product="flagellar export apparatus protein FliQ"
                     /protein_id="BBL73452.1"
                     /transl_table=11
                     /translation="MNPDMIAELGRQAMTVTVEISAPLLIATLAVGLVIAVFQAATQI
                     NEMTLSFVPKLIVMALILMFAGTWMLQLLIDYTRGLIRAIPHLIG"
     CDS             complement(636211..638154)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05510"
                     /product="hypothetical protein"
                     /protein_id="BBL73453.1"
                     /transl_table=11
                     /translation="MKQKGTLWRWRARRYIQAAWVTLGLAAVLGLVEPFFGDIPPVSP
                     FLLGVMFAAWQGGFRVGLFATLLSVLAHWLFFHPPGRFPAILDAYEGPRILMLLVMGG
                     ALSRAIAHLRMAERRALALSLRQARRLERELAERGRVAEALSQSEERYRAVVEDQTEV
                     IARFTPDGTLTFVNEVYCRFFGKSYGELVGHKWHPRAVAEDVPLIEAKLATLSTAQPV
                     VSLENRVYSGAGRIHWMQFINRGLFDAEGGLLGVQCVGRDITGLKQAEAELRESQERL
                     TLALEAAEMGVWSWDVLTDAVYWSPECFRIYGYPEFDGTAAAFGRLLHPDDAGAVWRA
                     VERALAGIDGYAVEFRAIRPDGRVVWLSKRAQIGRDPEGRPLRMVGTVQDITRRKEAE
                     AERESLQRQLQQAQHMEAIGRLTGGIAHDFNNILASILGYTGLALDRHVPDPHGKLAD
                     YLRQIKTAGERARDLVAKMLAYSRDGEARALPPLAPGPLVAEVIGMLESVMPPGVEVH
                     ADLDPTVPDILIEPVDFHQVLTNLALNARDAIGKAGRIDIVLRRAWVDAGCAACHRRV
                     RGGFVELSVADSGAGIPDEVLSRIFEPFFTTKPLGKGTGMGLPVVLGIVHHAGGHILV
                     ESPPDAGAVFRLLFPPTPREAAA"
     CDS             complement(638185..638766)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072497.1"
                     /locus_tag="MishRS11D_05520"
                     /product="transcriptional regulator"
                     /protein_id="BBL73454.1"
                     /transl_table=11
                     /translation="MSADNERNYLTPYEVAELLMVAPVTVRAWAQKGLLHSMTTPGGH
                     RRFLREEVERFARENGVNLESRQVRGLRVLVVDDDRQFAGYLNEFLEGLPEPVAVAVA
                     NDGFEAGCKVHTFRPDVILLDLMMPDLDGFKVCRQIKQDPATAAIRVVAITGYPTPEN
                     FRRSLDEGAVHCLRKPVDTAELLSALGLPAVSG"
     CDS             639348..639791
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05530"
                     /product="hypothetical protein"
                     /protein_id="BBL73455.1"
                     /transl_table=11
                     /translation="MYQCYLRESGHFATLMAGMLWVFSGAAVGGECWLDIYDQGDYQG
                     AHRRIEGPVELPSLKDLGGEDWGHRIESLKVGKAAEVTAFRQENFREEPKGPVNHPEA
                     FARWGKQEIPAYQELEISFGPGKQAHHLGELDFHRNINSLKIRCK"
     CDS             complement(639829..640245)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05540"
                     /product="hypothetical protein"
                     /protein_id="BBL73456.1"
                     /transl_table=11
                     /translation="MGGIGNVFAYGTLQLPEVMQAVTRAVFPAQPATLPGYARYALRG
                     LAYPGLRAQAGTATDGILYGGIDAAALRRLDDFEDGFYRRENLRVRLASGAWTRAEVY
                     VVPPEHYGLLLPAAWDMEAFQATALDGFMARCHAGA"
     CDS             complement(640248..641957)
                     /codon_start=1
                     /gene="nadE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011815768.1"
                     /locus_tag="MishRS11D_05550"
                     /product="NAD+ synthase"
                     /protein_id="BBL73457.1"
                     /transl_table=11
                     /translation="MADGANIRPYPRWADPGKIARRLPQPHRCLAVKLRIAIAQLDFL
                     VGDVQGNARRVLATALDARDRLKAHAVVFPELTLSGYPPEDLILRPDFLAAAGRELQA
                     LAGQIHGITALVGFPEQRIGMPYNSAAVLRDGAVHAVYRKQALPNYGVFDEKRYFLAG
                     HEPCVFDLEGVPVGVTICEDVWVPGAVERAAAAGAKLVLNINASPYQAGKTHQREAVV
                     RERLAVAQVPLVYANLVGGQDELVFDGASFVMDAAGNVTYRAPEFAEALAAVDFVCRD
                     TVEPLPAAIAEPLSEEASVYQALVLGIRDYVDKNRFKGAVLGLSGGIDSALTLALAAD
                     ALGAERVEAVAMPSRYTADMSNEDARLEAEALGCRFHTIPIEPAFNTFLEMLAPSFAG
                     LPPDTTEENIQARCRGILLMAFSNKTGKILLTTGNKSEMSVGYATLYGDMAGGFAPLK
                     DVPKMLVYRLCEYRNTLSPVIPQRVIDRPPSAELRPDQKDEDSLPPYPVLDAILELYV
                     EQDKSVAEIVALGFPEPIVLRVAGMVDRNEYKRRQAPPGVKISKRAFGRDRRYPMTCG
                     FGR"
     CDS             642056..643132
                     /codon_start=1
                     /gene="gcvT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83B06"
                     /locus_tag="MishRS11D_05560"
                     /product="aminomethyltransferase"
                     /protein_id="BBL73458.1"
                     /transl_table=11
                     /translation="MSRKTVLNSLHLEYGGRMVDFAGWALPLHFGSQVEEHHRVRREA
                     GMFDVSHMGLFDLDGAEAPAFLRRLCANDTGRLARPGLGLYTCLLNEAGGILDDAIVY
                     RTGNTRFRLVANAATRDKIAAWLERQATAHPALRIAARPDLAMIAAQGPEARARVEAC
                     LPGPLRTAAAALPSFGCAEAGDWLVSRTGYTGEDGYEIQLPLEAAPDLWRALAAAGVA
                     PCGLGARDTLRLEAGLRLYGADMDETVTPLESGLAWTVAFMPEDRDFIGRAALEDQRR
                     RGGLRRFVGLVLEEPGVMRGGQRVVVPEFGEGVVTSGIYAPTLGRSVAFARLPPGGYE
                     RAWVEIRGQRKAARVGPGRFLPPK"
     CDS             643535..644563
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103696.1"
                     /locus_tag="MishRS11D_05570"
                     /product="glycosyl transferase"
                     /protein_id="BBL73459.1"
                     /transl_table=11
                     /translation="MSLFSYLLLLFFPFLVAAFATCAVRGYALKRLLDLPNARSSHSV
                     PTPRGGGLGIVAALVLATLQLHGLGLVSSDWLLALAGAVPVAAFGFWDDHGHVPARWR
                     LLAQVAAAGWALYWLGGCGTLRLAGEAYALGGWGLPLGLLFIVWVLNLFNFMDGIDGI
                     AGVETITVGLTVAALIGLDPAPVLPGSAEVAAALAAAAGGFLLWNWPPAKIFMGDVGS
                     GFVGFLLGVLALRTAATGGPSLAVWLIALGVFFVDASFTLLRRMADGQRWYEAHRSHA
                     YQHAAQRYGHRPVTLAVLAINLFWLGPLAWAAARWPALEWAWLGVAYAPLLALALRFG
                     AGLSHGTR"
     CDS             644566..646458
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010946701.1"
                     /locus_tag="MishRS11D_05580"
                     /product="multidrug MFS transporter"
                     /protein_id="BBL73460.1"
                     /transl_table=11
                     /translation="MVSKLRSRTVIFLHDLVMVALAWLGAYWLRFNLSLPPKYEVHSA
                     LVCLPWVMAVQAVVFWRVGLYRGIWRFASIPDLVRIVQASGVGIVAAALTLFVVNRLD
                     GVPRTAIPLYALLLPVLLSAPRLLYRIWKDRRAVLSVGKRALIVGAGKAGEMLVRDLL
                     RTHYAQFVPVAFVDDDPGKRGSEIQGVRVKGGCERIPNLVDKLGIDAVLLAVPSASDK
                     EMRRIVEICEGAGVPFLTLPSVQDMLAGQAGALREVSIEDLLGRAPIRLDRKAVRSHL
                     AGKRVLVTGGGGSIGSELCKQIARFEVAELVVFERCEYNLYKIEQDLLKVFPGLNFVA
                     LLGDVTDLSSVEWAIARYRPQVIFHAAAYKHVPLLQHQARQAVRNNVVGTRIVAEAAM
                     AAGVGEFVLISTDKAVRPTNIMGATKRAAEMLVQSLNGVTETRFITVRFGNVLDSAGS
                     VVPLFREQIKTGGPVTVTHPEVTRYFMTIPEACQLIMQAAAVGQGGEVFVLDMGEPIK
                     ISYLAEQMIQLSGKRPGQDIRIEYIGLRPGEKVTEELFLDHERPTPTGHTKLLLARPM
                     VLDHRVIRKSVSELAESCRVFDEDAIVRKLKALVPEYHQTHAQEDGAAASTGGNDLAV
                     RRKLVL"
     CDS             646519..646947
                     /codon_start=1
                     /gene="rplM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q0WB88"
                     /locus_tag="MishRS11D_05590"
                     /product="50S ribosomal protein L13"
                     /protein_id="BBL73461.1"
                     /transl_table=11
                     /translation="MKTFSAKPAEVKRDWYVIDAEGKTLGRLSTEIARRLRGKHKAEY
                     TPHVDTGDYIIVINAEKVHVTGTKELNKVYYKHTGYIGNMKSVTLGKLRQTHPERIIE
                     TAVQGMLPKNPLGRAMYRKLKIYKGSTHNHQAQQPKVLDI"
     CDS             646966..647358
                     /codon_start=1
                     /gene="rpsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPZ2"
                     /locus_tag="MishRS11D_05600"
                     /product="30S ribosomal protein S9"
                     /protein_id="BBL73462.1"
                     /transl_table=11
                     /translation="MAQSQYYGTGRRKSAVARVYTKTGTGRIVINNKQLDEYFGRKTD
                     QMVVRQPLELVSLTEKLDVIVTVAGGGPTGQAGAIRHGLTRALIVYDENLRSPLRKAG
                     YVTRDAREVERKKVGLHKARRRPQYSKR"
     tRNA            647377..647450
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="MishRS11D_t00060"
                     /product="tRNA-Gln"
     CDS             647904..649715
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000675225.1"
                     /locus_tag="MishRS11D_05610"
                     /product="hypothetical protein"
                     /protein_id="BBL73463.1"
                     /transl_table=11
                     /translation="MRPVDIQTAYALQNISALSAEQASEPSKTVLRRLGLLDRFEVEP
                     ARVLAELHRGLNPVDDDERLFALAELAFLHADRTRDRRYFLASAVYAWALLFPDGDPP
                     RFSPSDPRYRLAYDLYNQAVAKGLGQARGGDREEVMLRPGLYPLPFGTLRLGADPAGP
                     AWGGYRLDHFMPTTTLRVRGFRNRYNRHGIGAPLTAAIDTQRSLEKTVGAERLASGTQ
                     VPVTVLLRLDQARAHLADGRIEGRIEIYAADQATTVAIAGRTLPLESDPTAALAYQLE
                     HSPLYDLELTGFLRGGLFKSWLPKDRAQDGLFTLHPYKPGRIPVVLVHGTGSSPARWA
                     ELVNELEGDPQIRERFQIWVFFYDSGNPIGFSASRLRSALAAAVGEFDPAGRDADLRR
                     MVVIGHSQGGLLTKLTAIDSGDRFWRRISDQPFDAVPMDPEARAMLKGYTFYTPLPFV
                     ARVVFVATPHHGALLAAGRIGAFAAALVSLPVDLFSRAAQAVALSGEEKLMKAILSPP
                     TAVDNMNPDNPALRILQTIPVDPRIKAHSIIAVRGDGPEAAGDDGVVSYRSAHIDEAV
                     SEKVVRWDHSCQGQPEVIEEIRRILYRHAAEYAGQRP"
     CDS             649945..650139
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05620"
                     /product="hypothetical protein"
                     /protein_id="BBL73464.1"
                     /transl_table=11
                     /translation="MLAIIETLIRKFHGRIHEAAGFVIAYFDDPAQTQGCALAIASQT
                     HREVEWCGCQLSVLLYGLRD"
     CDS             650278..650763
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05630"
                     /product="hypothetical protein"
                     /protein_id="BBL73465.1"
                     /transl_table=11
                     /translation="MTATVFIRNIPADTDPKRLGRFVADGLDPRPGFLPWRRKGGILA
                     IKIMALLDVETRLAEYHGLVEVESELAADLVVKRLNLRVFGGRRVVVRRYRERSPAND
                     RRHGQSQATARLFYDRRAGDRRRRCLEWTTVAATGAVPSPAKPADADMAFTKFNPRPG
                     G"
     CDS             650766..650960
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05640"
                     /product="hypothetical protein"
                     /protein_id="BBL73466.1"
                     /transl_table=11
                     /translation="MSKALELFAVAAGGGGIALACVAGVGRLLGVRHLMGLESLTLLV
                     AAIALMAASCVVQLHLLRTR"
     CDS             651236..653992
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="MishRS11D_05650"
                     /product="hypothetical protein"
                     /protein_id="BBL73467.1"
                     /transl_table=11
                     /translation="MQPQPHPAQAAGAGSQGFFREALAWALDQYVTVLALLAMTALVT
                     YAILIADLRSQEGSAAALNLAGHQRMLIERGVLLALKMQHAETHAERQKIRQQMVETV
                     TLFDNMHSYLRNGDRLIRQGPRLLAEPGELSPELRTIYFADPINLDQQVQSYISAVKK
                     LLSQPVDQIDLDNPGLQYLLSTAPEKAVEGIDKVVAFYQKDSDFRLQNTQNLQAVSLV
                     FFLGAIVF