LOCUS       AP019749             4673011 bp    DNA     circular BCT 15-JUN-2019
DEFINITION  Comamonas terrigena NBRC 13299 DNA, complete genome.
ACCESSION   AP019749 BCNR01000000 BCNR01000001-BCNR01000023
VERSION     AP019749.1
DBLINK      BioProject:PRJDB311
            BioSample:SAMD00018640
KEYWORDS    .
SOURCE      Comamonas terrigena NBRC 13299
  ORGANISM  Comamonas terrigena NBRC 13299
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Comamonadaceae; Comamonas.
REFERENCE   1  (bases 1 to 4673011)
  AUTHORS   Miura,T., Furukawa,M., Shimamura,M., Ohyama,Y., Yamazoe,A. and
            Kawasaki,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-2019) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Biological Resource Center
            National Institute of Technology and Evaluation, Biological
            Resource Center, NBRC; 2-5-8 Kazusakamatari, Kisarazu, Chiba
            292-0818, Japan
            URL    :https://www.nite.go.jp/en/nbrc/
REFERENCE   2
  AUTHORS   Miura,T., Furukawa,M., Shimamura,M., Ohyama,Y., Yamazoe,A. and
            Kawasaki,H.
  TITLE     Complete genome sequence of Comamonas terrigena NBRC 13299
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.4
            Genome Coverage       :: 382x
            Sequencing Technology :: Illumina HiSeq; ONT GridION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4673011
                     /culture_collection="NBRC:13299"
                     /db_xref="taxon:1219032"
                     /mol_type="genomic DNA"
                     /organism="Comamonas terrigena NBRC 13299"
                     /strain="NBRC 13299"
                     /type_material="type strain of Comamonas terrigena NBRC
                     13299"
     CDS             1..1407
                     /codon_start=1
                     /gene="dnaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VSE0"
                     /locus_tag="CT3_00010"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BBL22546.1"
                     /transl_table=11
                     /translation="MTEEPTNDAGQGLWQACVEQLSQDLPEQQFNTWIKPLTASVAED
                     FSKVTVYVANRFKLDWIRAQYAGRIAALLEALYGQAVTLELALAHRESVVRTYVRPVQ
                     ATSAAAPEAGTPATTLSASEEPTAPVFRTRLNPALTFDTLVEGTANRMARSAAMHVAG
                     SPGHLYNPLFIYGGVGLGKTHLVHAVGNQLLKDKPDAKVLYIHAEQFVSDVVKAYQRR
                     TFDEFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGL
                     ANIHERLVSRFDSGLTVAIEPPELEMRVAILINKARAENAEMPEEVAFFVAKNVRSNV
                     RELEGALRKILAYSRFNQKEVSIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKV
                     ADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIAGERQ
                     QLTELNQQLHVLEQTLKG"
     CDS             1545..2666
                     /codon_start=1
                     /gene="dnaN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YW6"
                     /locus_tag="CT3_00020"
                     /product="DNA polymerase III subunit beta"
                     /protein_id="BBL22547.1"
                     /transl_table=11
                     /translation="MIVLKATQDKVLAVLQSVSGIVERRHTLPILANVLIRKTGNALQ
                     LTTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMPGDQTVSLETQQSKMILKG
                     GKSRFTLQTLPAEDFPLVQEAAAFGPAFSVPQKVLKELLGQVSFAMAVQDIRYYLNGI
                     LFVAEGNTLSLVATDGHRLAFASAELDVDVGIKQEVILPRKTVLELQRLLSDVGGENQ
                     PRIEMQFANNQAKFTFGGMEFVTKLVEGKFPDYNRVIPRNHSNSITLGRAPLLASLQR
                     TAIMTSDKFKGVRLNLEPGTLRVASTNAEQEEAVDELDIDYGGDTIEIGFNVTYLIDV
                     LANMGQDMVQVQLADGNSSALVTIPENERFKYVVMPMRI"
     CDS             2817..5396
                     /codon_start=1
                     /gene="gyrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YW7"
                     /locus_tag="CT3_00030"
                     /product="DNA gyrase subunit B"
                     /protein_id="BBL22548.1"
                     /transl_table=11
                     /translation="MTAENQPDPQNQAPAGADASGYGEGAIQILEGLEAVRKRPGMYI
                     GDTSDGTGLHHLVFEVVDNSIDEALAGHCDDILVTIHADGSLSVIDNGRGIPTGVKMD
                     DKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSVKLKLTVRRDGK
                     THEIDFSRGFVQNRLIEVVDGVEISPMRIIGDTDKRGTKVHFLPDTEIFKENNEFHYE
                     ILAKRLRELSFLNNGVRIRLKDERDGKEDDFSGAGGVQGFVKFINGNKKDLDITPFYA
                     TGSRPAESYGGIPGTEIGVEVAMQWNDGYTEQVLCFTNNIPQRDGGTHLTGLRAAMTR
                     VIGKYITDNDLAKKAKVEISGDDMREGLCAVLSVKVPEPKFSSQTKDKLVSSEVRAPV
                     EDIVAKTLTEYLEEKPNDAKKLCGKIIDAARAREAARRAREMTRRKGVLDGMGLPGKL
                     ADCQEKDPALCEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARAEKLLSSQ
                     EIVTLITALGTGIGKASADSGKSNADDYDLAKLRYHRIIIMTDADVDGAHIRTLLLTF
                     FYRQMPDLVEAGHIYIAQPPLYKVKNGKEELYLKDGPALDQYLMRIALQNASVTTGGT
                     AARGIEGEELEKLAHMHLAAESVIERLSAFMDAEALRAIADGVQIKLDTLADAQACAP
                     VLEAKLRELTTTGVPAAVTAEIDPHSQNPILRISRHHHGNIKSSILTQEFVASHDYAA
                     LADEAQNFVGLLNEGAKVTRGEGEKAKTEKVSDFRQAMRWLISEAERTTGRQRYKGLG
                     EMNPEQLWETTMDPAVRSLLQVKVGDAIEADRVFTMLMGDEVEPRRNFIEDNALRAGN
                     IDA"
     CDS             complement(5630..15043)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00040"
                     /product="hypothetical protein"
                     /protein_id="BBL22549.1"
                     /transl_table=11
                     /translation="MASTPVLVTQLTGQAWVRDADGNLTPLRQGMRIPADAEVVTASG
                     STVVLQADGQPPLVLGENQDVALSPDVFEDIPAAEAAVPTAVDPLVENLIAAINNGQD
                     PLAELDPTAATNAGGGGGDHTFVRLASVLEATTPLALAYPRPASDVVEDRLSGAAGTT
                     LPPLYEGTLTLSAQQQVTEGGMIIVTATVDRAPRGSDLVITLRTGEVIVIRVGETSGS
                     VEIPTRTDDAYVQGTDQHLFEVGSTTGGGYDRLDTTSTTSTNVVDDQDPTEIVLSADT
                     QVTEGGKITVTATVDKAPQGSDLVITLKTGETITIKVGELTGSVLTDSRPDDGYLQGT
                     QGQQFEIAQAEGGNYEALDTSSTTSTQVQDDADTVTVQLTATTSTTEDGGSITYTASL
                     VDAAGKPVTTNNAITVTLANGEVITIAAGSASGVSDPVAVNRDDVFLEADSISNHIES
                     ISEANAGTTGALEHLVADDTPVKTTILDDSDPVYVQISVDQSAVFEGGALVYTVRLVD
                     GNGDPVSVAAGKNVTVTLDWSGAAANGADVNNLPPTVTIAGGQTAAPSFTVTTLVDTQ
                     VEYREPLTATIAAVQDNGGSNKGFEDLQISATQSSVSSTVVDKPTLTVVDSNGAAIKG
                     QVTVNEKGLTSTTDDSESAHGTLKVTAGSGLDSIKINGTTISLADLQDLGTDGIAITV
                     AGHGVLTITGFTPTATADGMEVAWDVQYTYTLTQAQTHASVQGTNDALKNIALEVIAK
                     GADGTGTVSTAGTLGVQVIDDVPTIVTEVGAAEPTLTTDDADLQAGTPDKASMDFAAV
                     FVVKSADYGADGAKGAVAWSYKLAVDNGADSGLKSGGQSILLYQKANGEIVGVTGGNA
                     TTGKVVFSVTVDATGKVTLVQTGAIDHDSKDSSDYSSDTQSLLDGLVKLSGTATITDK
                     DGDKASHTTTVNIGANLVFTDDGPTIGSPTNAEVAEKNLATGTEANSALTVFTGSLAV
                     DFGADNASGAKAYFTQATADQLQALGLSSNGTALVITLGADGKIIATAGVGGAEVFRL
                     EITNAGTNQAGYKFTLTGALDHVDGNGQQVNVLDLPISFEARDSDGDTASGNFQVSVV
                     DDVERASQTITVTEDSGAGTADNKFSLGADVAASEIRILAADGVTVLQGTPGANGSTV
                     YATGHGLQGTVTVNKDGSITYVPSANYSNQLQGNGQYAADELKYSIVRDDGSPVPGTV
                     TVQVKAVADAPVLDKLAAATTNEDTAVHLGLKAPTTSDASDQNGTGAGDNPERLGPIT
                     LSGFPAGAQLLDANGNVVYTFTSGNAVSIVLTDGNHTASASGVLQMTTAEFEALQVLP
                     PAENAANFKVTVKVTSYEVDESGNKLSSVDGKTGSTTVDVKVHAVTDPIELKIDGKDS
                     HDLTVKEDSSYNLTPLLKVSLDTGADGNTQADVDGSEHRWLEVTGLPVGSTVNGTLIT
                     STTQVVKVEITSKDASSLPDIIVTPPKDFSGDITGITVTLKAQDLDPNGAQENGVVLS
                     DSVTLNLHVEPVAGDVVVTHPQAIAEDTEVAFLAGVRVTDSGTAGGTEVITKVQFELP
                     QDWTLSGQPAAGTAGDAVWTVTGSGTTADPYVIEFTAGSEASRELALGQFTLTPPAHS
                     SKDATVQLSITTVDSNADVTGGADTSDEVTVQKPVQITVTPVAESTAAGDTDHNGQAD
                     LTVPTTDHTYAALGKEDTVFNLNIEATDLLNQAGWKNEDQDETTTVLLTPVKLSEDGL
                     GSSPAIGTVFTWNGGSATYQGTPIEVPLSALSSLTFQAPLNDAGTFQVQFQAKTYDYD
                     DDTETGVADTAISDAGSLTIHVAPDADLAALSVQPAQGLEDTAIALTIRPSSTDGSET
                     FNVSIAQIPAGASLHYGGLEITSSTTGVPGITVTSQGGSWSVVITDYQTSAGLSVTPP
                     VNSNADFALEVKTQAVDALQGFDTSTGAWSQTQNLPVKVVGVADEASVAAKPHTYTEA
                     DLDGGAAKIQLGDLIQSVQQADTDGSEKLSFRITGLPEGFTLEGARYLGGTGADRVWA
                     VDSEAALKAITITGPENFSGTVSVQVTPVTTENDGDWKSHATETLVATITPSPESVGN
                     QHATLYEDRESALDFSIQTPQGENESLTHVHIKVEDFESQGFQLFLNGEPIDSASVAI
                     VTDAQGNDWYVLDATQAGQVTALPITENKADNQANAPDLKLTVKYEVTDASSDGSVAP
                     VTTVGEPQDYHLHVTPVTDEVGLQLDGITSGGASLNTDTSGTVPLVTLESTGNFQVGV
                     VLSSADQDGSESLIQVLVTGVPNGLTVDGLSIGGTQVGVAHQLDSGKWVIEVTPSQLA
                     QFQASVQGGDVQAQLSFTAGSALSGQAHATIGIEVFSQDAGASNVSNASVQYELQADL
                     TGGGQPGQAVQLDFARNPDFTGQEDTAFTLDQLFQATISDNPSGQDVAFTLSLKLPAG
                     ATIVQDGHTLTAIKVGGDGAEELWLISGTAKTTEELQALLSEVVVTPPADLNDHFGGM
                     QIDATMAGHVVSTGEQTVVKVHDTLPLAPETDGVSTAVVLSAADADGSPTGDRPKEGS
                     DIAIQIDIARGVDGPSLLNGTLTIKLTEGDGFSGGKLFYGTTELVQQADGSYQLPLDA
                     ATQQALLTGSSTSIVGLHYQPDAAQKYVNGSLEVEVIVQSKEQNAPDWTSSQGWADSN
                     GDSGTVVVEQINNGFEFTNVGSNTPYKDGDIGTIQGSENQTGTSLITLDIAGKLLDAD
                     GSEQIHTAILENLPNGFLVYYTDANGALVQAINTGSSWSIPVDGGKLPVISIQAPQNW
                     SGTVENLALRVLSGEGSDAAHQQVSSATFQLEVAARADGFETDTPVVEQSFGREGDII
                     ALNLNLAMKDRQSAGTGDSSLETVTLTLTGLGEHASFYVGSTLHTASYDQATDTYTLT
                     GLSQTDMDQLGFVQAKDALTDQNASANGLQIGFTAHTVDGSDVSSSISGSFDLTLSSQ
                     SGSGVVLDGSGSSHGNLIGGAGSDTLLGGAGDDVLRGGAGNDSLHGGAGNDHLEGGSG
                     NDVLIGGAGNDTLIGGDGDDIFVWKQGDAGGEGLALAAKDVVADFGNGHDVLDLADLL
                     QNENADNLGKYLSFSKEGEDTVLRISSNGAFSDDAGSLISKVDQQITLQGVDLLQGSS
                     SEELVKQMLSDGRLKVDQT"
     CDS             15641..16045
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003123521.1"
                     /locus_tag="CT3_00050"
                     /product="zinc/iron-chelating domain-containing protein"
                     /protein_id="BBL22550.1"
                     /transl_table=11
                     /translation="MKSSIRIVDVDRLETWSKYKPGMCDTCAANCCTMPLEVRLPDLV
                     RLGLVDPFEVEHIEPKQIAKRLTKMRLIDHFNPKHEIFTMARRASGDCNFLDATTRRC
                     TVYEQRPETCRLHPKKGPKPGFCAYGNKNARL"
     CDS             16103..16516
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113894.1"
                     /locus_tag="CT3_00060"
                     /product="NUDIX domain-containing protein"
                     /protein_id="BBL22551.1"
                     /transl_table=11
                     /translation="MHHLHIAAACLFNTQGHLLTVRKRGTQAWMLPGGKRDGDETPLR
                     ALVRELQEELQITMAAADFAPLGQFSAIAANEAATQVHAHVLVAHAPLQQTVQAAAEI
                     AGVQWLALDQPLPDTLAPLLRSQVIPALRARNATA"
     CDS             complement(16613..17929)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010932228.1"
                     /locus_tag="CT3_00070"
                     /product="membrane protein"
                     /protein_id="BBL22552.1"
                     /transl_table=11
                     /translation="MEIPILIALILLNGVFAMSEIALVTARKARLQKLIDEGDSAAAA
                     ALKLGEDPTRFLSTIQIGITSIGVLNGIFGEAALAQPLSVWLEQWGMPVKYAGTVSTA
                     VVVVLITYVSIVLGELVPKRLGQTNPESIARLVARPINLLAKLTKPFVWMLTSSTLGL
                     LKLLGVRQSNESSVTEDEIHAMLAEGTSSGAIEQNEHAMVRNLFRLDDRQISSLMVPR
                     SDVVCLDISASFEENLALIEEHDHARFPVTSGSFEDLLGVLNARQWMAHALKGDRELT
                     PTSVFLEKPLYIPETITGMELLENFKNSGAPMAFVVDEYGVVQGIVTVHDLMEAITGE
                     FVTEDPSDAWAVQRDDGSWLLDGHIPIMELKDRLNLKSVPEEEKGRYQTLSGMVMLLT
                     GKLPTEADKVVWESWQFEVVDMDGKIIDKILATRLQDNVIETLQDE"
     CDS             complement(17987..18835)
                     /codon_start=1
                     /gene="uppP2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P58741"
                     /locus_tag="CT3_00080"
                     /product="undecaprenyl-diphosphatase 2"
                     /protein_id="BBL22553.1"
                     /transl_table=11
                     /translation="MHANFGWLDALILGLVQGLTEFLPISSSAHLRILGPLLPGHADP
                     GAAFTAITQLGTELAVLIYFRKDVWRMLTAWLASLPVIGSRRAGEPLSADAKLAWLVI
                     LGTIPICVLGLLLRDFIETTFRTLALTAVMLIVFGLLLGWAERRGSQTRTIAQLGAKD
                     GVLLGLAQAMALIPGVSRSGGTITVALLLGMTREAAARFSFLLAIPAVLLSGFYMLLF
                     KREPMSPDQWGMTLAATFVAFVVGYAVIVWFMRLISHKGFTFFVVYRVVLGLLILAGL
                     YFGLIQ"
     CDS             complement(18935..20203)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003119637.1"
                     /locus_tag="CT3_00090"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BBL22554.1"
                     /transl_table=11
                     /translation="MAIPVSPENEAATLRQEMGQSLEMLRFASPVLEQEFTQELRVQQ
                     RRSTLFTLGFLGLVWIFFAAFDWWRMQAVLGTGRELQFVLGVMLQRWVVLACFLCTLY
                     VLLHPGTRSATHEFWIVVSVVACGCGVVISSYTAKSLGLPEASIVMLLTVVVALYPLG
                     IRLRQALLAAVSVCVVTTFAGPWLLPQPQQLAEHWLVVIMMWVTLVLSGVTAYFRERA
                     LRQQFVLRKLLDWEACHDPLTGLANRRIFREQFQRNMLHAKREKESLFLAVIDIDHFK
                     LYNDLYGHQAGDEVLRLVGNLLADYARRPLDLAVRLGGEEFALVAYDEDVQSLRKRME
                     KLLIDLHGLNLAHDASPTAPYVTVSVGLAQVRDEDTVDTVFKLADSLLFQAKEQGRNQ
                     VCGVASIAMPVINPRRPSWAQQAAAVGPAS"
     CDS             20542..21123
                     /codon_start=1
                     /gene="pcaC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013229034.1"
                     /locus_tag="CT3_00100"
                     /product="carboxymuconolactone decarboxylase"
                     /protein_id="BBL22555.1"
                     /transl_table=11
                     /translation="MSTPSADRLPPIPESDWTPEQRRLAQPIIDGPRGALISPFVPLL
                     RSPELMDHAQRMGEYLRFRSSIGLRLSELAICITARHWSQQVEWAIHAPIAEREGIAP
                     AALADIALGRTPGALQPDEAVLYAFCTELHRHQGISDATWAQAVALWGEQGVVDLIGV
                     NGYYTLLSMVMNSARTTVPASSASPLPPLGKGG"
     CDS             22022..24187
                     /codon_start=1
                     /gene="dinG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002224852.1"
                     /locus_tag="CT3_00110"
                     /product="ATP-dependent DNA helicase DinG"
                     /protein_id="BBL22556.1"
                     /transl_table=11
                     /translation="MSQEKWAALALESFDSVVASIPGFRSRDGQRRMADQVARTFAQT
                     QLGKIEEGAPEPKKSIAVVQAGTGVGKSLAYSVPAISTALARGTRVLISTATVALQEQ
                     LVNKDLPALAQKMPVPFKFALAKGRGRFVCKLKLERLSSTGEHSEEADDLFAEEEAAQ
                     RKARPPAEKEARMQFYASMADALATGEWDGDRDSLKTPPEPEAWSPVAAEGSSCTGKH
                     CPVFSSCTYYERRKDMVAAQVIVANHDLLLSSLGARLLPELDNCLLVLDEAHHLPQTA
                     LSQFACEMDLSRLQWIDKLTSRALRVGQLMEVEDIAELPGHSAGLRQHLTDLARLVME
                     IYGDALKGQKDSWGPARVRAPRGVLPEPLINPLAQVMHHASGFLDALRAISKALRAEI
                     KDKPEEAQRLSALYAQVGTLAPRLESVHDTAQLLSQQPEMQADGSAQVPNAKWFTLEI
                     DGDYIVVKAHASPILPGATLRHHLWSQVRGAVLTSATLTSCGGFDFFLREAGLHGDAS
                     VQTLEVASPFDYAAQGTLVAHQTQADPREAQAFTAEMVDALLNDLALVQAGALVLFTS
                     REQMRQAVDALPSHMRSYVLVQNAMPRTMLLADHRSRVESGLPSIIFGMQSFGEGLDL
                     PGALCESLFITKLPFAPPDDPVGESRAEWLRTSGRNPFNELVVPATAIRLAQWVGRAI
                     RTEEDQAHVYCYDKRLVATSYGAQLLKGLPPFTLAKRAA"
     CDS             complement(25961..26536)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00120"
                     /product="hypothetical protein"
                     /protein_id="BBL22557.1"
                     /transl_table=11
                     /translation="MALLQRSLIATATAAALAGAFTLPVWAQNTAAPAAPTAQTAPAH
                     PHQAGRPALDPAAMHAQHMERVKPLLQLTAAQEGAWKKYVEATRPAERKAPRMDREAF
                     NKLTTPQRIDQAQSLRKERNAAIEQRENATKAFYASLNPAQQKAFDVAMPMHGHGHGK
                     GPGMHRGGPRDEGHPGMGQPSQAAPAAAPGA"
     CDS             26825..27871
                     /codon_start=1
                     /gene="rdgC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MD18"
                     /locus_tag="CT3_00130"
                     /product="recombination-associated protein RdgC"
                     /protein_id="BBL22558.1"
                     /transl_table=11
                     /translation="MFKNMIVYRIAAQWQGALEQMEEALQKTPFTPCGATQEKSSGWV
                     PPRGEEHGLLAESVGGQWVMRYMSESKMLPASVLNRKVAEKAEAIEKEFGRKPGKKEK
                     QELKDEAKLDLLPMAFTKQGAMWVWLDPQAKLLVLDTGAQGRADEVVTLLVESLQGFG
                     VALLDTQTSPQAAMAHWLISQEPPVGFSVDRECELKAADESKAVVRYARHPLDIDEVK
                     QHVEQGKLPTKLAMTWDDRVSFVLSDTLQVKKIAFLDSVLDEAGDEGGFDTDVAIATG
                     ELSRLIPDLIDALGGEGRTELGQDLPAALQPSGSGTETLAVRVAGGRPAGQGGKVTGP
                     AEAPVDTDPQSMPF"
     CDS             complement(27900..29093)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00140"
                     /product="hypothetical protein"
                     /protein_id="BBL22559.1"
                     /transl_table=11
                     /translation="MIGLAAWVLAWVIWVLGRPFWYQGLSQGLWCNTLIGMAYLLLAL
                     VSRNASLALLMASLLLVCLATSCFTIALQRFRQSDRLVRDSLILFLPQAITMALAALL
                     LPQDWGLFHRLHAALLLGQLLYLLWLLQRMRRSTPGSGWVLVVVAVLAQSLALLPLIV
                     QETSPLPFSRQRLSVYEQLALWSVCLTLFVNLVLSSIGLLLMLHDRQAALDQDKARLD
                     PLTQLPNRTALVQGLLDAMAQAVHTGMPLSVVVLDIDFFKRINDSHGHLVGDRVIQSV
                     AHTLQSQLRKGDLAARYGGEEFVLLLPHTHSAEALPLAQRLCDAVRLSPLQLSTGPRL
                     EFTISVGVYTAQLQQPSPWEALVAAADAAMYEAKRNGRNRVVLAQPTAESLRFFERSH
                     RDAPF"
     CDS             complement(29257..30276)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706561.1"
                     /locus_tag="CT3_00150"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BBL22560.1"
                     /transl_table=11
                     /translation="MESLLPRLSHTLVHAKSLEELTRPLLDMLQQVTKLDSTYLTRID
                     LPHSQQHVLYTCNRGRLEMPEGLVVPWQDTLCRRALEDRQPYTADVVSSWGDSEAARA
                     LGLHTYVSAPVRLPQGQLYGTLCAASGVEQAMPDGAMATLELFAGLIGQQVERELLLQ
                     ELQQRNLELANYALTDALTGLPNRHALMEELPRMWARAERDGRSVLLAFIDLDGFKQI
                     NDQHGHEAGDQLLQTVARQLLNALRDSDFAARIGGDEFVMVGTGPEISQSATQVLYEL
                     EERLALATQCDVAVAEDLLHYPGASVGVVAVHPAQTSTEQALALADAAMYENKTRRRT
                     RSGIH"
     CDS             complement(30473..31663)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064006.1"
                     /locus_tag="CT3_00160"
                     /product="thiolase"
                     /protein_id="BBL22561.1"
                     /transl_table=11
                     /translation="MSQTREVFLVSAARTAIGTFGGSLKDVPNTQLATTAVKAAITRA
                     GIAPDAVGHVVMGNVIPTDTKDAYLSRVAAIDAGCPIETPAFNVNRLCGSGLQAIVSA
                     AQAISLGDCDVAIGGGAESMSRGPYFDLASRWGQRMGDAKSIDYMLGILHDPWQKMHM
                     GITAENVAERYRISRSMQDELAVLSQQRAAAAIEAGRFKEQIVTVEIASRKGTVLFDT
                     DEHVRAATTLVTLAGMKPAFKKEGGSVTAGNASGINDGAAAVTLVAGDRVQALGVKPL
                     ARLVGYAHAGVEPAYMGIGPVPATQKVLARTGLKIQDMDVIEANEAFAAQACAVIQEL
                     GLDPAKVNPNGSGISLGHPVGATGAIITTKAVYELHRTGGRYALVTMCIGGGQGIAAI
                     FERV"
     CDS             complement(31819..32247)
                     /codon_start=1
                     /gene="hmrR2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P58379"
                     /locus_tag="CT3_00170"
                     /product="heavy metal-dependent transcription regulator 2"
                     /protein_id="BBL22562.1"
                     /transl_table=11
                     /translation="MAPAHWPVPIGDAARLAGVSARMVRHYESLGLLPEVARTDSGYR
                     QYGPADVHTLRFIRRSRDLGFSMEEISLLLGLWRDQARSSAQVKQIAQQHIAELGERI
                     AAMQAMQRSLQSLVSCCRGDDRPDCPILDDLAAPELAPPH"
     CDS             complement(32252..32449)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003366461.1"
                     /locus_tag="CT3_00180"
                     /product="heavy metal transport/detoxification protein"
                     /protein_id="BBL22563.1"
                     /transl_table=11
                     /translation="MEHEFHVEGMTCGHCERAVTNAVHEVDASAQVQIDRAQKKVVVQ
                     SAAEREALRHAIAEEGYQVAA"
     CDS             32836..34542
                     /codon_start=1
                     /gene="cheM_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015063734.1"
                     /locus_tag="CT3_00190"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBL22564.1"
                     /transl_table=11
                     /translation="MNVFALMRGFTIRLRMLGAIAVVLVLLGLLGGAGMWGMFRIQDM
                     SQDFRQTSYTKAQHLSQLRASLGLVRQHEKDMIIQYENPERVTKAKESWLKGLEQVKA
                     VSQKFVGEVSDADDALVQELMQRMDNYQKQFEPVVRQLEANGYDTATIAYRMGNKAMA
                     ELVEVDTLVQKLAQVLQDEADAAQRNESEAATQTQWLFLLSVVITVLVVAPLTLLNMV
                     SICRPLEIARRMALAISKGDLSQQMQVEGKDEVADLQTALQEMRRSLNLMVGQVHDAS
                     GNIATASQEIAMGNTDLSSRTEQTASNLQQTVASLMQLTSTVQQTASSAQLANQLASS
                     ASDTALRGGAIVQQAVQSMQDISTSSRKISDIIGLIDSIAFQTNILALNAAVEAARAG
                     EQGRGFAVVAGEVRLLAGRSAEAANEIKRLIQTSVSAVDGGVRHVEEAGLNMQEIVDS
                     VRRVGDIIGEITAASNEQSSGIGQVNQAVGDIDRMTQQNVALVEEASAAADSLRDQAG
                     RLAQVVNQFHLDQSLQVQHGSRAPAAAVGSLPGAGRPVAAPRAQPKVAAAPRKEERAL
                     LS"
     CDS             complement(34645..35292)
                     /codon_start=1
                     /gene="gst"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002210962.1"
                     /locus_tag="CT3_00200"
                     /product="glutathione S-transferase"
                     /protein_id="BBL22565.1"
                     /transl_table=11
                     /translation="MFNPLPCAGMPHTMKLYYSPGACSLSPHIVLEEAGLPYEAILAS
                     TKTHTLQDGTDFYTINPLGYVPFLVLDNGQTLREGPVIVQYIADQVPAKQLIPASGTL
                     ERYRVQEWLNFIGTELHKGFGPLFNPSTPADYKPTILAQLRKRFAWVEKELTGKDYLT
                     GAQFCVADAYLFTVSNWAQHVGLELGDLPQLQAYRQRVGSRPAVQAALRAEGLAK"
     CDS             35641..37614
                     /codon_start=1
                     /gene="mnmG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62FS8"
                     /locus_tag="CT3_00210"
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme MnmG"
                     /protein_id="BBL22566.1"
                     /transl_table=11
                     /translation="MLYPQEFDVIVVGGGHAGTEAALAAARMGCKTLLLSHNIETLGQ
                     MSCNPSIGGIGKGHLVKEVDAMGGAMALATDQGGIQFRILNSSKGPAVRATRAQADRI
                     LYKAAIREMLENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGIQFKSKTVVLTAGTFLD
                     GKIHVGLDNYAAGRAGDPPAVTLSARLKELKLPQGRLKTGTPPRIDGRSIDFSQCTEQ
                     PGDGMPGGMNEGHVPVFSFRGNAAMHPQQMPCWITHTNERTHEIIRSGFDRSPMFTGK
                     IEGVGPRYCPSVEDKINRFADKDSHQIFLEPEGLTTHEYYPNGISTSLPFDIQYALVR
                     SMKGLENAHILRPGYAIEYDYFDPRGLKSSFETRQIQGLFFAGQINGTTGYEEAAAQG
                     LFAGINAGLQARGQGPWMPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLRED
                     NADMRLTEIGRQLGVVGDAQWELFNRKRDAVSRETERLKATWVNPRNLPAAESERVLG
                     KSIEHEYNLFDLLRRPGVGYAALVGMDGGKYEAAEVSREALGDLHDDVLEQVEIAAKY
                     SGYIDRQKEEVQRAAHYESLKLPAELDYMQVAALSIEVRQKLQKHRPETLGQASRISG
                     VTPAAISLLMIHLKKGGFKGFAPAAATGTEQQA"
     CDS             37611..38273
                     /codon_start=1
                     /gene="rsmG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7W0S9"
                     /locus_tag="CT3_00220"
                     /product="ribosomal RNA small subunit methyltransferase G"
                     /protein_id="BBL22567.1"
                     /transl_table=11
                     /translation="MSAALRSQLEQGAQQLNLGLGVAQIDTLMAFLDLLQKWNKVYNL
                     TAVRDPQEMMTHHLLDSLAAVPALRRHVASLGRQPGERVAQLDVGSGGGLPGVVFAVC
                     CPEVDVHCVDTVAKKAAFLQQAAVSLKLPNLKGIHARVESLKGPYDIVSCRAFASLID
                     FTTWSRGAIAPQGIWFAMKGKKPDDEMAALGADVQVFHVEHLQVPGLDAERCIVWLRP
                     IG"
     CDS             38361..38975
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192135.1"
                     /locus_tag="CT3_00230"
                     /product="leucine efflux protein"
                     /protein_id="BBL22568.1"
                     /transl_table=11
                     /translation="MLGVADYGAFVVAILLFLLIPGPGNLALITSTGQGGMRAGMVTG
                     LGVIAADQVLMWLAVAGVSALLAAHPALFHAVQYLGVAYLGWLGWRMLRAQPGDAPVL
                     KMAPRQYFRQGALITLLNPKAIVFYMAFFPLFVDPAQHRGVLTFAVMAATAALLTALY
                     SVVVVLLTARMAQRLRANPVVVRVLNKTAGVFLIGFGLKLAISK"
     CDS             38987..39763
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205314.1"
                     /locus_tag="CT3_00240"
                     /product="chromosome partitioning protein ParA"
                     /protein_id="BBL22569.1"
                     /transl_table=11
                     /translation="MAKIFCVANQKGGVGKTTSAVNLAAGLASIGQRVLLVDLDPQGN
                     ATMGSGVDKRALELTVYDVLLENASVKEAAVHSEQVGYHVLGANRELSGAEIELVSLE
                     RRNERLKGALSTVDGDYDFVLIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTD
                     LVNTIKQVHANMNPDLQIIGLLRVMFDPRTTLQQQVSDQLKDHFGDKVFDTVIPRNVR
                     LAEAPSYGLPGVVFDPSAKGSKAFITFAKEMVGRIKKMRV"
     CDS             39828..40382
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003106176.1"
                     /locus_tag="CT3_00250"
                     /product="hypothetical protein"
                     /protein_id="BBL22570.1"
                     /transl_table=11
                     /translation="MACFTPSDVLLLPGWQNSDADHWQSRWEQRYGYQRLEQHDWQRP
                     LRGDWSARLQEHLVDAPAPVVLVAHSLGCILAAWWAAHSPLARTQVRAALLVAPGDVE
                     QPDLRALLPGWSPVVLQALPFPSVLVSGSNDPYCAQARARQFAQAWGSQWVDAGPAGH
                     INTASGLGDWDAGHALLEQLMKDN"
     CDS             40386..41309
                     /codon_start=1
                     /gene="parB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003806881.1"
                     /locus_tag="CT3_00260"
                     /product="chromosome partitioning protein ParB"
                     /protein_id="BBL22571.1"
                     /transl_table=11
                     /translation="MATKKPKGLGRGLEALLGPKVDDKAAQAEAVQTGQPSTLNLDQM
                     VAGQYQPRTRMDEGALYELAESIKAQGIMQPILVRLLGQGANAGKYEIIAGERRFRAS
                     RLAGLDSVPVLVRDVPDEAAAAMALIENIQREDLNPLEEAQGLARLVQEFGLTHEQAA
                     QAVGRSRSAASNLLRLLNLADPVQTMLMAGDIDMGHARALLALDKAGQITAGNQIAAR
                     KLSVREAEGLVKKITEENDGTAAAKARKVSKSRDVQRVEEELSDLLMAQVEVRVKKRV
                     KRHGKVQDMGEVAIQFGSLDELNGLIERLRG"
     CDS             complement(41391..42221)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00270"
                     /product="hypothetical protein"
                     /protein_id="BBL22572.1"
                     /transl_table=11
                     /translation="MSKTTSALRWVAIATSLTLAGCVTPGGGTISTGTAPTAATGAAG
                     GASSVNANPTLERCDAPLGTLAVDDGRNKEWYASFGAATKITTIEPLIRLAVQQSNCF
                     VITSVGNNRTESKISSITDKQRNSGEFRAGSKQQKGQRVAADYYMEPSIIIDNDATGQ
                     LAAGVGGLFGSVGALVGGAMQSKASVVTLSMFDIRSGVQISISEGNATATNFGAALGG
                     LGGGAAAGLGGFSRSPEGKATVAAFMDAYNNMVVSLRNYKAQEVKGGLGRGGQLKVGK
                     "
     CDS             complement(42285..42875)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204870.1"
                     /locus_tag="CT3_00280"
                     /product="hypothetical protein"
                     /protein_id="BBL22573.1"
                     /transl_table=11
                     /translation="MLWTGSLLALSLVGCAAQSPAEQTARPETVRICQGNVCADQHRS
                     TTTFQGTPVDAEAERRMQALTQLAERDPRAAYDLGMRLLRGDGVERNSYQAIEWLRKA
                     GDGGHLPAQVALGRMYLTGVEEMGADPAEAESWLSRAAARGDRESQKLLKEAQAAKQD
                     EQRLYQIRDAYRKSWGSWYYSAPYYWVWSSSGWNLR"
     CDS             43210..44070
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00290"
                     /product="hypothetical protein"
                     /protein_id="BBL22574.1"
                     /transl_table=11
                     /translation="MPALLAWAASWAAFVALGRVLPVWLALCMGCAVGTAASLWGHSW
                     WRRCMIALGFPLSLAVVGVVGLPAWAWLVPLVLLLLVYPLNAWRDAPVFPTPAGALDA
                     LPQHVPLPDGALVLDAGCGMGDGLQALRAAYPRAQLEGLEWSWPLRCVSALRCPWAKV
                     RRGDIWAEDWGAYDMVYLFQRPESMSRAALKAEGEMYSGSWLVSLDFAVPDVEARASL
                     PAAGHTLHIYQLPLWPDAAETVQQALDAHPPSPEEQAWSAIYPHRQPPRIKHRPPPPP
                     PQRNRWGLRK"
     CDS             complement(44110..45003)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004192042.1"
                     /locus_tag="CT3_00300"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BBL22575.1"
                     /transl_table=11
                     /translation="MPSIAPTAPLRAGKASAYVETLTPHLYVPTVQRPVRAKCRWLAG
                     DTQVKPHRHPWAQLAISTTGTIRLTVAQGTYIVPPSRALWVPPDMEHAVTMVGDADLR
                     TLYFYQPDGRCGPGVSRQEEATWRQCRVLNASDLLRAVVRELPTLPDDRLQLSPQDRA
                     REHHLSALLLDELRRASAVQLGVNLPQDKRLRGLCEAVLADPTRYATLEDWARDTGAS
                     PRTVARLFRQELECTFTQWRQQVVLTKAVAMAARQHSIQHIATSLGYGPSAFSAMVKR
                     TMGMAPARFFGLHSGQEDGGL"
     CDS             45051..46358
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003810358.1"
                     /locus_tag="CT3_00310"
                     /product="MFS transporter"
                     /protein_id="BBL22576.1"
                     /transl_table=11
                     /translation="MPKITPMTATATSSATPPAADLRQDARTIGLIGLAHGSSHFFHL
                     LLPPLFPWLIADFGYSYSELGVMVSLFFIVSGTGQMLSGFLVDRVGARPVLFAALGSF
                     VVAGVVASTAQNYAMLLLASLFAGLGNAPFHPVDFTILNKRVSPQRIGHAFSMHGLSG
                     NIGWATAPVFMAGITTATGSWRVACLCGAALAAVVLAIMLVNRRWLDDRDPAAIGNQA
                     KPAATQAAAAAKPEHAMAFLKLPSVWLCFSFFFWSTCAMSAIQNFASPSLRAVYGLPL
                     SVTALIVTGYMLCGALGMLIGGFLVGRVQRLEKVISICMLGSALLLALVGTGWLPGMG
                     AVVVASIAGLGTGLAGPSRDMLIKRAAPEGATGRVYGTVYSGLDLGFCVAAPVFGWML
                     DHHMYLGIFFGSATALALSVVSALVVGDGVHKRKQGAVAARAA"
     CDS             complement(46454..47470)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003814146.1"
                     /locus_tag="CT3_00320"
                     /product="MFS transporter"
                     /protein_id="BBL22577.1"
                     /transl_table=11
                     /translation="MQRNPSRTPASTFTRRSALLACGAALAGGLMVPAQAAGAWPDKL
                     IKLVVAFPPGGPTDTAARLVAQSLSERLGQNVIIENRAGASGSIGTASFIKSPADGYT
                     LSMFGMPALLAPVLFKNNLYDVRKDFLPVATVYDLPMAIIVNPRVLPDVKDLPSLIAY
                     AKKAQPSLNYTSSGTGSFGHLSMEQLKDLGGFDMQHVAYRGSAPAVTDLIGGQIPVMF
                     ADVVAALPHIQAGKLRAIAVSSNQAKLLLPGVKSVAEQGFPGFDADTWGGLVAPLGTP
                     QAVVDRLNKELKVVLADPALQHKMQAAGAIARYQDGATMKARLAHDFARWSKIANDKG
                     ISAQ"
     CDS             complement(47537..48745)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004526008.1"
                     /locus_tag="CT3_00330"
                     /product="CoA transferase"
                     /protein_id="BBL22578.1"
                     /transl_table=11
                     /translation="MNNSSPLQPLAGIRVLDLSRVLAGPMCAMALADFGADVIKVEHP
                     ARGDDTRDWGVRVGTRNTSYFNSANRNKRSITLDLQSEAGLQVARELAAQCDVVVQNF
                     KVGGAEKLGLGYEQLSALNPRLVYCSISGYSRSGGEAQRPGYDLVVQGESGIMAMNGE
                     AGQGPLKFGVAAVDMFTGMYSAQAILAALLERERTGTGRHVQMALYDCGLMITSYYGM
                     EALLKAGDPPKFGNAHPSIVPYGVFEAADGPLVITVGNNGQFVRFCHEVVNQPEWATD
                     ERFATNVARSAHRTTLMPLIEAALLRFSRAELLDRLRAAQIPCGEVFGLLDALQSDRT
                     QEAGLLHHFDDSEAGPQAVLAPPYAMDGQRLPVRRPPPHLGQHTDEVLHELLGMAPEA
                     VAALRAQQVL"
     CDS             48868..49767
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198295.1"
                     /locus_tag="CT3_00340"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL22579.1"
                     /transl_table=11
                     /translation="MDVNALGLLVEIIDAGNLSRAAARLGMSRANVSHRLSQFERDLG
                     QQLLRRTTRQIEPTELGRRLYEHGRSIRHELLSADESVAALGQALQGRVRLSVPSGYG
                     QLTMAGWLTDFMRSYPGIALEVIFDNAIEDLMDGRVDCAVRVMNDPPEHLVARHLGPV
                     QYVACATPACMAQWGQPQTLQALLRLPLIASGLTEQKLRMAGLQTLGQGDAALSMRLV
                     SPNFYFLREALLQGLGVGLVPDYMVRESIAQGALQALALPAGSLDFLATHKYLLYMPT
                     RFQTRAIQTLTEYLHERALAEAG"
     CDS             49891..50673
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004530221.1"
                     /locus_tag="CT3_00350"
                     /product="class II aldolase"
                     /protein_id="BBL22580.1"
                     /transl_table=11
                     /translation="MSQPLPATPDIPSVQHLVSPAEWQLRVDLAACYRLVALYGWSDL
                     VFTHISARLPGPEHHFLINPYGLMFDEITASSLVKVDMQCNKLMDSPYPVNPAGFVIH
                     SAVHAARDDVQCVLHTHTRAGVAVSAQKHGVLPISQQSTFVLASLAYHDYEGVAFRDD
                     EKPRLQADMGRANFLMLRNHGLLTCGRSIADAFLSMYTFEAACKIQVDALAGGTELTQ
                     VNPAIVQGVSQASRVQTGGMGGAFVWPSLLRKLDRESPGYRS"
     CDS             complement(50793..52205)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015039542.1"
                     /locus_tag="CT3_00360"
                     /product="oxidoreductase"
                     /protein_id="BBL22581.1"
                     /transl_table=11
                     /translation="MNAPTAALHLQPRAIPQAFLDALAARFGSRCSTAQAVREQHGRD
                     EGSIQAPPPAAVVYAESTQDVADAVQLADQYEVPVIAYGAGSSLEGHLLAVQGGISID
                     VSRMNQVLRVNAEDMTVTVQPGILRKQLNDAIKDQGLFFPIDPGADASIGGMTSTRAS
                     GTNAVRYGTMRENVLALEVVTAQGRIIRTGNRAKKSAAGYDLTRLMVGSEGTLGIFTE
                     ITLRLFPLPEAVSAAVCSFPTIADAVHTVIQTIQMGVPIARVELVDAATVAMVNKHSN
                     LTLREEPMLLMEFHGSPNGVKEQAEMVQDIAAEFDAKGFEWADTPEERTRLFTARHNA
                     YFAGIQSRPGCRSITTDTCVPISRLADCLLESIDEVNASGIPYFLVGHVGDGNFHFGY
                     LIDPDNADERHRAEALNHALVRRAIAMEGTCTGEHGIGIHKQDFLREECGDGAIAMMA
                     AIKQALDPKNILNPGKIFTL"
     CDS             complement(52366..52737)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00370"
                     /product="hypothetical protein"
                     /protein_id="BBL22582.1"
                     /transl_table=11
                     /translation="MQPTRSLSRIRVLHGFDARSLVLFAGLTMGGTQAIMAQSVTSPP
                     AQQAAPSQAVQQAQAAPATPRAAPTADQAFDRADANGDGKLTLREAERFPAVAERFQQ
                     FDVDHNGSLSREEFSNGLKQH"
     CDS             52903..53472
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004201622.1"
                     /locus_tag="CT3_00380"
                     /product="ATP:cob(I)alamin adenosyltransferase"
                     /protein_id="BBL22583.1"
                     /transl_table=11
                     /translation="MGNRLTQIATRTGDDGSTGLGDNTRVSKNSLRPHAMGDVDELNS
                     HIGLLLCEPLPQDVRELLGDVQHQLFNLGGELSMPGYELLKDDGLLQLDNALAQYNAQ
                     LPRLVEFILPAGTRAAAQAHVCRTVARRAERQVVALQEVETMRPAPRQYLNRLSDLLF
                     VLARVLNRMDGGDDVYWKSERLARLAAGE"
     CDS             53610..54515
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003811588.1"
                     /locus_tag="CT3_00390"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL22584.1"
                     /transl_table=11
                     /translation="MRLRHIEVFNAVMQTGSVSAAARLINVTQPAVSRTLQHAELQLG
                     FALFQRARGRLTPTNEALALFPHIEKLFEQLDEVQRLAANLRHGQAADRLQVLTVFAL
                     SREVLPRAVAGFRQKYPQVQVNVQALHTPQVVSALLLQEADVGFVISSVGQPALEHET
                     LAEVDMHCILPKGLLPPRKVRAEGMELADLADLPVVALDGKDPLGMRINQACREHGVG
                     LSPVVTVQTYLAALSMAEYGLGAAIVDGCTASAADRHKVHVVPLLPRITVGINALHLA
                     QRPGSVLARAMTQEMRKALRELLGD"
     CDS             complement(54554..55774)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003810872.1"
                     /locus_tag="CT3_00400"
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="BBL22585.1"
                     /transl_table=11
                     /translation="MHVCVIGAGVVGLATAYALQQAGHRVTVVDRAERPAMGASGGNG
                     AQLSYAYVQPLADPGIWRQLPKLLLEPDSPLKFRLQADPRQWSWGLQFLGACNARTSA
                     DSTRSLLTLAAESRLAFEAMLAREALDCDHHQPGKLVLYPTQQALDGAAQQVALQATL
                     AGPLQQVVDAAEVARLEPALASYAPRMAGAIYTPSESAADCRKLCEQLAHLLAQRGAD
                     LHFGTQVHRHAVQGGRITALDTSNGRITADQFVLASGWESAVQARQLGVHVPVYPLKG
                     YSITIDAAAAPHTGPTVSVTDTTRKVVFARIGDRVRVAGMVEIVGHDTTLDAGKIASL
                     QQSTREVFPQLAQTGDVQPWTGMRPATPMGLPVTGRARGGPANLWLQTGHGALGLTLA
                     FGSAQRLVQQLARA"
     CDS             56063..56944
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003082770.1"
                     /locus_tag="CT3_00410"
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="BBL22586.1"
                     /transl_table=11
                     /translation="MQFRTTLLCAALGLASLATAHADTLSKAKENGQITLAYRESSVP
                     FSYLNGGKPVGITVDISNAIADAVKKAVGKPDLKVNWQAVTSQNRIPLLMNGTIDVEC
                     GSTTNNTTRGKDVDFAINHFYTGTRLVVKKDSGIKNYADLKGKTVAITSGTTNLQVVR
                     KANAENNWGANIVMPKDHADAFLLVESGRAAAFAMDDILLYGLIANAKNAKDFEVVGD
                     SLQVEPYACMVRKDDPAFKKLVDGVIGGMMKSGEFTKLYDKWFLQPIPPTSTALGLAM
                     GDALKKNLVEQSDKPAF"
     CDS             56947..57702
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010929592.1"
                     /locus_tag="CT3_00420"
                     /product="glutamate racemase"
                     /protein_id="BBL22587.1"
                     /transl_table=11
                     /translation="MVPGVMAPPRAVGILGGMGPAAGADFVRLFVQACTAYLQDHGQP
                     VRDQAFPEHWLVQMPIPDRTQALSGTPPGPQDPAPHMLQGIGRLAALGVRSVAVACNT
                     AHVWHSQLQGLFPQLAILHIAQETAAHLQRQGATRAVVLATAGTYRTGLYDEALRSCG
                     IEPLVPDAAGIEQLMQGIYDGVKQGDLALAAQRFGHVLEGMRRQHGDVPVIMGCTEIP
                     LALPQAPEAQGASLVDPAWILAQALARQAYEAA"
     CDS             complement(57783..58208)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002211810.1"
                     /locus_tag="CT3_00430"
                     /product="acyl-CoA esterase"
                     /protein_id="BBL22588.1"
                     /transl_table=11
                     /translation="MAIWKKQASLEEMNARNAGCAVGHLGIEITEKGDDYLVGRVPVD
                     ARTKQPFGLLHGGVSVVLAETLGSVGAFNACPEGHMAVGLDINANHLRPATSGWVTGT
                     ARPVHIGRTTQVWQIDMVNEAGELTCVSRITMAILPPRD"
     CDS             complement(58306..59685)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010925787.1"
                     /locus_tag="CT3_00440"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBL22589.1"
                     /transl_table=11
                     /translation="MTAPSSIGRPWSSIAFRLALYYGGLLLLTMVVVLAIFYVQMVGV
                     LSNRMDQQAKQDLKRLETLSRHYGEASLELEIRNLLNDGVDSQTEIVILTDAHGAVLL
                     GNASIQPERSLTTAGLRELRLQRHGRTITGRVAVALLPSGNMLVVGSDMEALRDIEQR
                     FMRASLSAVVIVVILALSGSVGFRRLVDARATSIRRTLQQVANGELGARIPLSERDDE
                     FTRLAHDINRMLDQVEQLMDGVRHVSNTIAHNLRTPLTRVLLQLRSARYLDGPEQRRQ
                     LERVEQELQDLGTVFEKLLQIAELESGMRRQEFTAVDLYTLLAEVDDLYAPVAEDAQC
                     TMTVELQDQPRALGDGDLLASALANLVENALKYACQQPGGQITITAQQHDAMVELRIQ
                     DNGPGVPPERLHQLTQRFFRAHERQPGHGLGLSSVQAIVALHDGQLSFANLHPGFEVR
                     LTLPAAPAA"
     CDS             complement(59682..60374)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015038792.1"
                     /locus_tag="CT3_00450"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL22590.1"
                     /transl_table=11
                     /translation="MPRFLIIEDDTQNARFLAEGMRELQAEVCVCHDGMEGLTQAVTG
                     HWEAIVLDRMLPDGFDGLKILQALRGMGNTTPVLVLSALSTTDERVRCLKAGCDDYLT
                     KPFAFSELHARLEALLRRVHTPAPIPMLEVADLRLNLLSRYAERGGTTLQLQPREFRL
                     LAFLARHVDQTVTRTMLLESVWDYRFDPQTNVIDVHISRLRNKVDKGFNPPLIHTVRG
                     VGYCLSTTAPTA"
     CDS             complement(60461..61762)
                     /codon_start=1
                     /gene="czcC_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113317.1"
                     /locus_tag="CT3_00460"
                     /product="outer membrane protein CzcC"
                     /protein_id="BBL22591.1"
                     /transl_table=11
                     /translation="MKTIKTIAVAAALVAAGACLAAETVPGTASRAAGEPTNATTASA
                     DPLPQSLGLVEFLSLVRSRHPVLRAMPLRQGMDRADVRIAGTWANPSIHYARKPDEKE
                     WGIEQPVPVFGQVSMRTEAAKLAAATAQAERSVEAQDILNQAAQRFAELLVAQEKLSA
                     KQQAMEHLNQAVKVVQGQVELGARSKYDGARVELQRAQLEAQLEQQQAETQAAQAALA
                     ELLVQPHWQPRAIGSLLPAKPVPAAADASFDRLWEQAAPQLPQLQAVHAKVLQAEQLI
                     SQQAREALPTPSIGVARVRNRPDGSSYNQVGISMELPLFDRKQGAVDRARLEYEQAML
                     EEQSAQQLARQRLQQALAQRNLLRKTLQSFESRGLTQLDPLRRMALDAYRLGQSSILE
                     WLDAMESVAEHQQQYLDLTLRVWQAEWELQTAQGRQPLPPQ"
     CDS             complement(61749..64853)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_008765563.1"
                     /locus_tag="CT3_00470"
                     /product="cation transporter"
                     /protein_id="BBL22592.1"
                     /transl_table=11
                     /translation="MLRAFIDFVVHRRLVALCATLAIAIYGIYAYLQTAIEAYPDVTN
                     VQVGIIAQAPGLAPEEVERQITQPLERELNGTPGLISLRSESYFGLSMVNLVFNDDAN
                     SFKARAEVAQRLPQADLPPGVTPEMAPDYTPLGKIYYYRLRSDRHTLDQLRSEQEWNI
                     VRVLKQVQGVADVVSVGGFVKEYHVEVNPDKLYRLGLSLGDVTEALEKSNRNVGGGLL
                     RRGEQSFIIRGIGLLKSPQEIKDVVVQLRGGAPVTIGDVAQVIQSHTPRQGSVGMDDE
                     NDVVQGIVLLKRGENPSVVLEGIHEKVEQLNGGLLPEGMHMEVTYDRSDLVGHTLATV
                     QHNLLFGACLIIAILWLVLRSIRGSLIVAAVIPLSLLVAFIGLHWLGMPANLISMGAI
                     DFGIMVDGAVVLAENIIRNARLRKPTTQREMRAIIIDSAIAVAKPTLFAMAIVIAALI
                     PVFSLESIEGRIFRPLAMTYSFALLGALLFAMGLVPALCALFLKPKHVMAPEPAVFER
                     MDHGFHRWIAATLHNPRRRTTVAAVALAILAIAGLSATKLGTEFLPALDEGDAYVLVQ
                     MPASISLEKGQEVLADVRQIIRQFPEVISVSTEQGRPESGTDNETLNMAKVLVRLKPL
                     KEWRAGLDKSALIEEMRAQLGTIPGVAFNFSQPIRDSVEESTSGARGQVVLKVFGPEI
                     PQLRAILQKTMEEVRHIEGVVDLDLYRDAPAPQLHVEFNREALARQGIPMDTAQKTLE
                     LALAGDIATTLWEGERGIPVRVRLPYANRMDESSIRDIAIPTASGGSVPLHAVGTVSV
                     KIGNASIFRENNLRYMALKFNVEGRDIGSVVKETLATFKDKVQVPDGYQAVWGGEWEN
                     QQRAAKRLQVVVPLSLLIVFALLFGALGQARSSFVILLCTPFTMVGGIAALHFTGIEL
                     SISAAIGFIALLGQVALAGLLVISSVESLRRQGTPLLEAVVEGTVERLRSVLLVAMLA
                     LLGLLPMALSTGVGSETQRPFASVIVGGMLVLPMVALVLLPVLYVWLGPKTLKKPDEL
                     DEDH"
     CDS             complement(64872..65993)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142490.1"
                     /locus_tag="CT3_00480"
                     /product="secretion protein HlyD"
                     /protein_id="BBL22593.1"
                     /transl_table=11
                     /translation="MRDLIPSLPLSTLTARLQRHRTAALLAGALCAFPAWSETPPAVQ
                     VAPAALRAVQVATVQAPQAGQLFWAPAHLEYLPGQLDSVVAPVQARVTAIHVQPGQTV
                     KAGAPLATLVSADALRMRHEVRAAQLASETARTELQRQQNLVERGVGTDMELRSAQAR
                     SKEAAQELERARGTAALLGQDGGDRIVLRAPHAGVVAQHQATMGALAEAGAVLFAIGN
                     PQSLGIVADVFEAELAGLKAGSAAQVELQTQAAAVPAKVLQVGAVVNAESRRAAVQLA
                     FADKTVPAGLRAGMQARVGIAMERGDQMMVPLAAVLIKGENRTVVFVQTGEHAFAARD
                     IQLGQPVRGWVPVISGLKPGERIVVRGALLLDGAASQML"
     CDS             complement(66222..67736)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205422.1"
                     /locus_tag="CT3_00490"
                     /product="acetyl-CoA hydrolase/transferase"
                     /protein_id="BBL22594.1"
                     /transl_table=11
                     /translation="MTLTDRVRYPEFQTRFMSAEAAAALIPHGVNVGMSGFTGAGYPK
                     ALPQAIAARAKAEHAAGNPYKINVWTGASTAAECDGVMAEAEALGQRLPFNTDPTARK
                     AINAGDIDFIDMHLSHVAQHAWFGFLGHMHVAVVEVLGVTPDGLLIPSTAVGNNKTWL
                     EIADKVILEVNTKPPAKMEGMHDIYYGTAIPPRRVPINMTHADDRIGQPYLRVDPSKV
                     IAVVETHKGDRDNVFAVPDENSNKIASYIIDFLSHEMKMGRLPKEMLPIQSGVGNVAN
                     AVLAGLLHGPFENLLGFTEVLQDGMLDLLRAGKMSKASATSISLGAAACKDFEDNIDF
                     YRERIILRPQEISNHPELVRRLGIIAMNSMIEADIYGNINSTHVMGTGMMNGIGGSGD
                     FARNGYLSFFVTPSVAKDGKISCIVPMCSHVDHTEHDTQIIVTEQGLADLRGLSPKQR
                     AKVIIDQCAHPDYRPMLHDYFDRARQQGAQHTPHLLTEALSWHQRFVDTGDMRA"
     CDS             complement(68059..69351)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004197818.1"
                     /locus_tag="CT3_00500"
                     /product="permease"
                     /protein_id="BBL22595.1"
                     /transl_table=11
                     /translation="MGMFSWTEKSPAVLQGGGVIGPDERLPWAQTGLMGIQHVIAMFG
                     STVLAPILMGFDPNLAVLMSGIGTLIFFLITGGKVPSYLGSSFAFIGVVIAATAYAGK
                     GANANIGVALGGIIACGAVYTLVGLLVQAIGTSWIERFMPPVVTGAVVAIIGLNLAAI
                     PVKNMAANNFEAWMQALTFVSVALVAVFTKGMLQRLLILIGLIVASILYGVFTNVLGW
                     GKPIDLSGVVNAAWFGLPTFHAPVFNANAMLLIVPVVIILVAENLGHIKAVTAMTGKN
                     LDQYMGRAFIGDGVATMVSGAAGGTGVTTYAENIGVMAATRIYSTAVFFVAALLAVLL
                     GFSPKFGALIQAIPLPVMGGVSIVVFGLIAVAGAKIWVDNKVDFSDTKNLIVAAITLI
                     LGTGEFTLKFGEFALGGIGTATFGAIILYALLNTKRSN"
     CDS             complement(69665..70939)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010951321.1"
                     /locus_tag="CT3_00510"
                     /product="ubiquinone biosynthesis hydroxylase"
                     /protein_id="BBL22596.1"
                     /transl_table=11
                     /translation="MHTDALIVGAGPAGLSLAISLAQAGLQVTVLEQQPALALQQPKP
                     DGREIALTHPSVQTLQRLGSWELLQPHEQGQIREAQIHDGPVGQRPMLAISADGSGVD
                     QLGRIVPNHALRRTAWEVASTTPGVEIITEAQVTAVSVHPCHAEVRYTRTDQGVRCEA
                     PALTAPLVVAADSRFSGMRRLLGVGAQMTDFGRSVIVCRMRHTLPHEDIAHECFGYER
                     TLAILPLQPDPDTGELLCSAVITTDSADAQRLLQLSPEDFAAHVQHDFQDRLGPMELV
                     GERHSYPLVATYAHRFSGARWALLGDAAVGMHPVTAHGFNLGLAGVERLTAAVAAARQ
                     AGQDWGDAAVLDAYAQGQHRHAFPIFAGTNSIVKLYTDARPLPRVLRQVVLTGARHLP
                     PLKAAIAAQLTGRSPWQLIRATLPQPPWAGRH"
     CDS             71146..73236
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011087443.1"
                     /locus_tag="CT3_00520"
                     /product="acetoacetyl-CoA synthetase"
                     /protein_id="BBL22597.1"
                     /transl_table=11
                     /translation="MPLSTSPSASHPPHIPQIRLYQEWLAQQHGLRFDSYDALWRWST
                     TELDAFWQSIWDYFHVESPTPHTAVLARNVMPGAQWFPGAQVNYARQVLRHVQPAHAA
                     GMPAVIADNEQGQVSELGWPDLQRQVAALALHLRAQGVGKGDRVAAYLPNVPEAIVAL
                     LAVASLGAVWSVCAPDMGTAAVLDRFQQIEPKALIAVDGVYYAGKPLDRSAVLQELRA
                     QLPTLAHMVVLRSPHAAQVVADSADLAQVLARDDAATAAFAPEWLPFDHPLWIVYSSG
                     TTGLPKPIVHGHGGMVLVALCLKALHNDVGPSYDANSWGERFHWYSSTGWVMWNSQAS
                     GLLGGTTCVIYDGSPSGSKAQPDWGVLWRFAARHGVSNFGAGAAFYTGCMKAGLDLAD
                     CGDLSRVRSLGSTGSPLSPDVQQWGSDQFARLGTPGIWWNNISGGTDFCGAFIGGNRE
                     LPLLAGEMQCRQLGAAVEAWDEQGRPVVDAVGELVCTQPMPSMPLYFWGDRDGSRYLS
                     SYFDSYAPGHGRQPGGGDLPAAAGGVWRHGDWLRIGAQGGCTIYGRSDATINRHGLRM
                     GTSELYSAIEALPEVLDSMVVDLEYLGKESWMPMFVVLREGLTLDAALRERLNAAIRT
                     ALSPRFVPDEIVQVAEIPRTLTGKKQELPIKKLLLGQPLAKVVNPDTMANAGCLPWYE
                     AFAAQYLARQAQAA"
     CDS             73411..74151
                     /codon_start=1
                     /gene="minC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63RS4"
                     /locus_tag="CT3_00530"
                     /product="putative septum site-determining protein MinC"
                     /protein_id="BBL22598.1"
                     /transl_table=11
                     /translation="MAVESQGTARTSFDLKSAQLPVVAVVLKDTDIHVLAHDLAERLA
                     ADPDFFDNDPVLIDLSHIREAVDPVDFAELRRVLSSHHTQPVAVRGGSADQMAAAHAA
                     GLMAAPDALPARSAPVEIREVIREVEVVREIPAPLSDALIIDRPLRSGQQVYARNTDV
                     VVLGMVSYGAEVIADGNVHVYAPLRGRAVAGARGNTEARIFSTCMEPQLLSIAGIYRA
                     IDSPLPADVAGKPAKVRLEGEKIIIESL"
     CDS             74226..75038
                     /codon_start=1
                     /gene="minD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63RS5"
                     /locus_tag="CT3_00540"
                     /product="site-determining protein"
                     /protein_id="BBL22599.1"
                     /transl_table=11
                     /translation="MAKIVVVTSGKGGVGKTTTSASFASGLALRGHKTAVIDFDVGLR
                     NLDLIMGCERRVVYDLINVIQGEANLHQALIKDKQCENLFVLAASQTRDKEALTQDGV
                     KKVLDDLAAMDFEYIVCDSPAGIESGALMAMHYADEALVVTNPEVSSVRDSDRILGML
                     SSKTDRATKGESVKEHLLITRYNPNRVEDGQMLSLEDIQDILRIELIGVIPESETVLQ
                     ASNQGVPAVHMQGTDVSEAYKDVVDRFLGEEKPMRFIDAQKPGFFKRIFGGR"
     CDS             75045..75308
                     /codon_start=1
                     /gene="minE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HY7"
                     /locus_tag="CT3_00550"
                     /product="cell division topological specificity factor"
                     /protein_id="BBL22600.1"
                     /transl_table=11
                     /translation="MSLISMLLGEKKKTASVAKERLQIILARERVGNSNAQPDYLPAL
                     QRELMAVISKYVSINPSDIKVQLERQDNLEVLEVKIELPDAQR"
     CDS             complement(75429..75944)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189275.1"
                     /locus_tag="CT3_00560"
                     /product="flavin reductase"
                     /protein_id="BBL22601.1"
                     /transl_table=11
                     /translation="MLAPAAFTTRDFRHALGQFATGVTIVTTADALGRPIGLTVSSFN
                     SVSLEPPLVLWSMAHRAASLPVFQQGGHYAIHVLAAGQQELAQRFATRGVDKFAGVTW
                     EANEQGVPLIEGAAAVFECSNRSRYDEGDHTIFVGLVERCQHLQGVQPLIYHGGHMYA
                     KHGLPPAPYTD"
     CDS             complement(76070..76627)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013222864.1"
                     /locus_tag="CT3_00570"
                     /product="flavodoxin"
                     /protein_id="BBL22602.1"
                     /transl_table=11
                     /translation="MRNDHYLFLTASAREPHVIGNTEWLAREAARHLPDDVQQTWVHL
                     AHEPIPAFIDVRHSAGSYPAPEGRMADLLQATLDASHLVLVCPVYWFSLPTAVKAYLD
                     HWSGWLRVPGLDFKARMAGKPLYLVSTGGERRKAQPSIDAAQLCAEFMAMPWGGALWG
                     KGGAPDAVQADTEAVQAAAGFLQRA"
     CDS             complement(76783..78123)
                     /codon_start=1
                     /gene="dadA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010930578.1"
                     /locus_tag="CT3_00580"
                     /product="D-amino-acid dehydrogenase"
                     /protein_id="BBL22603.1"
                     /transl_table=11
                     /translation="MKTIILGAGIIGISTAWHLRARGHDVIVIDRQAEAAQETSFANA
                     GQISVSYCEPWANREAPLKALKWMFDAQAPLLFRPQLDWQQWRWALQFLGQCNDRAFA
                     RNVQQIVALGAYSHTALQQMVAETGISYHRLERGIAHFYSSAQAFEEAGEAVEIMRQH
                     GVQRQLVSRDELLRIEPAFTPYKDQIFGGTFTPTDESGDARAFTQQLAQLCAQRGVQF
                     LYGHDVLRLNQAGGEVQSITVRQRLDDGPGREQTLTADSFVVACGSYSAPLLRTVGVD
                     LPIYPGKGYSATFRILQPDAAPFVSCIDDARKIAMSRFGDQLRVAGTIELGGFDLSLD
                     SPVAQARCRMLSERIEEILPGVCDTRSEAEGGQPNYWCGLRPATPTNIPFIGHTGVGR
                     LWVNAGHGTLGWTHGAGSGKALAALISGERPAMDFGFLGQGRDPVAWHQRPVEA"
     CDS             78220..79143
                     /codon_start=1
                     /gene="iciA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010937897.1"
                     /locus_tag="CT3_00590"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL22604.1"
                     /transl_table=11
                     /translation="MQHWDPVALECLAAIVETGGFEKAAQRLHVTQSAVSQRLRALEE
                     QAGSVLVVRSRPLRPTRAGQLLLKHAQQLRLLRADLARDMQTLAPHTAGSGAGVGLAV
                     AVNADSIATWALEALTPLVRAGIALEVITDDQDFTQEWLRSGEVLGCVTTLRQPLQGC
                     RVQPLGAMRYLAVAAPEYAAAHLPQGLNAHNFHRVPFLCFNRKDDMQSEFVARLLGLS
                     QVVLNSLYLPNSEAQVRAVEAGWGVGVLPELLVRDRLSHGRLVDVAPGTMLSIDLYWH
                     CWNLDSSLLRQLTDTLLQGAKVNLKDNCSER"
     CDS             79216..79899
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00600"
                     /product="hypothetical protein"
                     /protein_id="BBL22605.1"
                     /transl_table=11
                     /translation="MSNRPSFSHVSFRDMMHRARKEAILEECTRLLSERGYDAMTLDQ
                     VAEAAGMAKAVLYKHFKGKEDLCCEVMVRGLERAQGFLDGLPARMVASQRLQAFVRWV
                     LQAQLNSDAPLLAERKSEIRHALKASEPYQLALQGLSTRLEEWIVQAQEAGHIHPGWP
                     LLVARQMLMTRAVDPMVDALMHTQAYSHDEVVEWCVKTCMATLHASPEYLPLSQKAKP
                     AKKSMLAVG"
     CDS             complement(80029..80451)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010903120.1"
                     /locus_tag="CT3_00610"
                     /product="universal stress protein UspA"
                     /protein_id="BBL22606.1"
                     /transl_table=11
                     /translation="MKILLAVDGSPYTKKMLAYMTTHEELTAGTHAYSAITVQSALPP
                     RARAALGKETVDAYYAEESAKVLDPVCEFLARHNVQPTRIAKVGPAGEAIAKEAVEGK
                     YDLIIMGTHGHGALGKLVMGSVSTQVLANCDVPVMLIR"
     CDS             complement(80558..81412)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003101593.1"
                     /locus_tag="CT3_00620"
                     /product="hypothetical protein"
                     /protein_id="BBL22607.1"
                     /transl_table=11
                     /translation="MRIQLLSDLHLEVHPQFVPEPAADADVLVLAGDIGSYQDGSLLQ
                     DDCFGLERFSPLPQYAGWPCPVVFVPGNHEYDAQDWDAAHARLRRICDRLGLIWLERD
                     TAVLDGVRFVGTTLWTDYDAIALLDDQVQAGDVGRLLKLRDKSFRAANFYLQKTGGTR
                     HGEPFLAAPMREQALVCQEWLRTALAQPFDGPTVAVTHFAPSLRSSDPRYGMVPGTAG
                     FCNALDDLLPCAQLWLHGHLHTPVDYTAQGLRADGSAWQCRVHANPLGYARKGEQDKF
                     HPAQSLAL"
     CDS             complement(81458..82426)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088245.1"
                     /locus_tag="CT3_00630"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL22608.1"
                     /transl_table=11
                     /translation="MTPLNFRTLDLNLLRVFDEVMSERSLTRAAENLAITQPAVSNAM
                     RRLRDAMGDELLVRHGQGVQPTPRAQALWPVVREALASLADNLAPERFDPATAKTTLV
                     LVMADATAGTLIPHLLEILEVEAPGVTVRILPLTTRDPRSLLDEETADLAIGNFPAVL
                     ADLTARAQSGALVAYESRRLYDGQYVAAMRRDHPLSRQPLTLERYCAARHALVSFSGR
                     AWGFIDEALASLGKKRHIALTVNQYGTAARVVAQTDLVTVMPRHFVPISHMAEELHIA
                     KLPLDVMAVHVDALWHKRGPNRPAYDWMVQALGRAAQQALALQHPL"
     CDS             82556..82969
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00640"
                     /product="hypothetical protein"
                     /protein_id="BBL22609.1"
                     /transl_table=11
                     /translation="MSNFIYNSYCVVHPGAEQISLTAEYRPVQEAAAPVRRSAHFSFV
                     WPLVAVMALLAAFASAGEGSALLVGMLLWVLALAGWALSMSSVRRSLVSLRQGLRAWQ
                     HSRRMAAEDERTWNMALQDARLMADLARAMDRQER"
     CDS             complement(83168..85036)
                     /codon_start=1
                     /gene="pckG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P0V5"
                     /locus_tag="CT3_00650"
                     /product="phosphoenolpyruvate carboxykinase [GTP]"
                     /protein_id="BBL22610.1"
                     /transl_table=11
                     /translation="MNALAPQALQLQAPAFVKNPKLIAWVAEMAALCKPARIHWCDGS
                     QEEYDALCQQLVDAGTFKKLNPAKRPGSFLAWSDPSDVARVEDRTYICSARKEDAGPT
                     NNWMAPAEMRATLQPLFDGCMTGRTMYVVPFSMGPLGSPIAHIGIELSDSAYVAVNMQ
                     IMTRMGKAVYDVLGTDGEFVPCVHTVGAPLAAGETDQTSWPCNPTTKYIVHYPETREI
                     WSYGSGYGGNALLGKKCFALRIASTMGRDQGWLAEHMLILGVTNPEGQKYHVAAAFPS
                     ACGKTNFSMLVPPTGFEGWKVTTIGDDIAWIKPQADGSLRAINPEAGYFGVAPGTNLL
                     TNPNCMQSLDKNVIFTNVALTDDGDVWWEGLEKDQGKLPDHLIDWKGQDWTPAIAKET
                     GAKAAHPNARFTVAATNNPALDEAWDDPKGVKIDAMIFGGRRSTTVPLVTEARNWTEG
                     VYMAATMGSETTAAAFGAQGVVRRDPFAMLPFAGYNMSDYFQHWLNLGAKIEAQGATL
                     PKIFTTNWFRKDADGKFVWPGYGENMRVLKWMIDRIEGRAQGQQTAFGVAPTYGEINW
                     TGLDFSADQFASVTSIDKAAWNEEMQLHTAHFDQLAYNLPQELLATKKALEARLAA"
     CDS             complement(85322..85474)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00660"
                     /product="hypothetical protein"
                     /protein_id="BBL22611.1"
                     /transl_table=11
                     /translation="MSHDPAAHDAQPQINPDDAAEAVVPLIPIVLPLVGAVMMFLLAF
                     IAVNMA"
     CDS             complement(85683..86882)
                     /codon_start=1
                     /gene="tdcB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813999.1"
                     /locus_tag="CT3_00670"
                     /product="threonine ammonia-lyase"
                     /protein_id="BBL22612.1"
                     /transl_table=11
                     /translation="MLTYADIQAAATRLRDQVLQTPCVESETLSQIVGAQVFLKFENL
                     QFTASFKERGASNRLQLLSAEEKARGVIAMSAGNHAQGVAYHAQRMGLRAVIVMPRFT
                     PGVKVERTRGFGAEVVLHGDTLEEARQHAFLLSKEQNLTFVHPFDDEAVAAGQGTLAL
                     EMLAVQPDLDTLVVAIGGGGLIAGVATAAKALKPGIRVVGVQTQRFPSMLNAVQGTDL
                     PMGQSTIAEGIAVATAGTITREVVKRLVDELLLVDEGDIEQAVLMLLEIEKTLVEGAG
                     AAGLAALIRHREKFAGQKVGLILSGGNIDPLLLAAIIERGMVRSGRLARVRVSARDVP
                     GVLAQITATVAAAGANIEEVHHQRAFTLLAAQNVEIDFVLQTRNQQHVEQVLEALRAA
                     GMQAARA"
     CDS             complement(87106..89565)
                     /codon_start=1
                     /gene="fpvA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P48632"
                     /locus_tag="CT3_00680"
                     /product="ferripyoverdine receptor"
                     /protein_id="BBL22613.1"
                     /transl_table=11
                     /translation="MNRRPLHPQPTATARATQLLCASLIACATALPALPALAQTSTAQ
                     AQRNYTIPAGTLASALNRLGRESGALISFAPDLVAGLQTSGAQGTQGVAQSLAALLAG
                     TGLEAVPDASGAYALRRIPEAAQRSSGGAATLAEVKVTAAATVADGTTEGTGRYTAAG
                     PSGAATGLALTLRETPQSVTVFTRQRMEDFKLQTLTDVMEQTPGLTVSRQNQMVTYNV
                     RGSTANLQVDGSRQLSSGWGFNTHTLYTMDDLADIDRVEVLKGSSGLMNGDGNYGATI
                     NLIRKRPTKEFQAHVEASAGSWDSYRADADIAGPLNAEGSLRGRLVLSEKRARGFRDY
                     EDSSGRMVYGTLEYDLSPDTLLSAGVTYRERSLHGSGATTPLQAYSGTGAFVGWMPRS
                     YNNGARWAGYEQKGLNLFTRLEHNFGQGWKAKLQLVHEEIDVPEQLLGYMNNALPGAV
                     NFGRYGENTTRNQSIQLDVQGPFSLFGRQHDLLLGAGASKSRINLQRGGGDNTTLGAL
                     GLDYAQGGGALPNVNLSGLTYSDDLFSRKRNYVYAAGRFSLADPVKLIVGARATNYDQ
                     KDVSDVSWYNYDLHERGVVTPYAGVVVDVARDVSLYASYASIFQAQSAKNASEQTLPP
                     EEGKTYEIGAKGEFFDKRLNASAAYFWMKTDNTAETVGQTPAGETISRAVSGVTRRGW
                     ELELSGELARGWQLQGGFVMNSSTLDSSSTTPKYQFKLGTTYQFRDSALQGLTVGAAT
                     RWQSDISTSRGATTLRQDAYWLVDLMARYQVDRHWSVAANVNNALDKRYFAGVTNFNA
                     QGLFYTWGAPRSLNLSARYDF"
     CDS             complement(89749..90780)
                     /codon_start=1
                     /gene="foxR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113290.1"
                     /locus_tag="CT3_00690"
                     /product="anti-sigma factor FoxR"
                     /protein_id="BBL22614.1"
                     /transl_table=11
                     /translation="MDQPAPPPPATATIPPAVARAAVHWLLTLDDDSAPPSERTRQQW
                     QRWLQADPLHAQAWQRIATLDAQWQQQLLHGLPASVARQALTASGHGRRHALRLALLL
                     TAGTGGLLAWQQSGLGQPHWQRLAADLATATGEQRSRELADGTRLWLNTATAVNLHYS
                     ATERLIVLRAGEILVHSAPDNTPDATTGQPRPLRVRTAEGLVRAIGTRFTVRQHAQHT
                     SVAVLEGAVELRPAQAPQDALRLEAGEQATLGRSQAGPATPLAEGAGAWHDGMLVVND
                     MPLPDFLAELSRYRSGLLRCAPDAAGLRVSGAYPLADTDRVLNALTRALPVQLQARTR
                     WWVTVERRS"
     CDS             complement(90782..91297)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004406806.1"
                     /locus_tag="CT3_00700"
                     /product="RNA polymerase sigma factor"
                     /protein_id="BBL22615.1"
                     /transl_table=11
                     /translation="MSASLSAAAHTLQTFYLQHHGWLVARLRRKIGCPWDAADLAQST
                     FLRAWTAPGPPLDQVAEPRAYLTTIAQRLLSNHLRRRQIERAYLEALGALPDPVAPPP
                     DVQLMVLETLVAIDQLLDGLPAVARQAFLLWRLEELTQEEIAQQLGLSRTTVRRHLAT
                     AAERCYFGMGE"
     CDS             complement(91464..93128)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195844.1"
                     /locus_tag="CT3_00710"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBL22616.1"
                     /transl_table=11
                     /translation="MASDDTHEVFNQVDEPCQQAPLQHDAALLHAVQQDHASWALPSL
                     QDYAQRVTSPATWQWAQLANTHAPRLQAFDARGRRTNTVHYHPCWHALLTLYREQGLV
                     GLPYENTRAGRWTAWAAGFYLHGQVEQGSLCPATMTTAAIGVLRHETALWPHIKAGLL
                     SRHFDAQDRPWPDKQALWVGMGMTEKQGGSDVRANTTQAVPDEASGRGQAYRLTGHKW
                     FFSAPMSDAHLVVAQTPDAGPACFWVPRWQPDGTRNAVHLLQLKDKVGNRSNASSEVE
                     FHGAYGLLLGEPGRGIPTIIEMATTTRLCCVLGSSAILRQALVQALHHAQRRQAFGKP
                     LVQQPLMRSVLADLALESEAATMLAMRLARAFEACEGADPAPAERAWKRLMTPAAKFW
                     VCKRAVEVAGEAMEVLGGNGYVEPAVVARLFREAPVNSIWEGSGNIMCLDMLRALGRE
                     PEGSQALLAHLMDAAGEDSHLLTELHALQALLHRPPAEQELLARLIAQKLVLVAQACL
                     LRRHAPSWVADAFIATRIVHGSARVVGAIDARTLDVAALLERALPA"
     CDS             complement(93246..95114)
                     /codon_start=1
                     /gene="recQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198363.1"
                     /locus_tag="CT3_00720"
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="BBL22617.1"
                     /transl_table=11
                     /translation="MSAALSTLQNVFGYASFRGPQAAIVDQVVAGGDALVLMPTGGGK
                     SLCYQVPAIVRQQAGQGVAIVVSPLIALMHDQVGALHEAGVSAAFLNSSLSYDEAQQV
                     EWQLQSGQLTLLYAAPERLVTPRFLGLLDDLHAQGQLSLFAIDEAHCVSQWGHDFRPE
                     YRALSVLHERYAGVPRIALTATADALTRADIVERLHLEQAQQFVSSFDRPNIRYTIVE
                     KKDVTQQLLRFIQNEHADEAGVVYCQSRRRVEEIAQTLQQAGINALPYHAGFPSEVRQ
                     QHQDRFLREEGIVMVATIAFGMGIDKPDVRFVAHVDMPKNIEGYYQETGRAGRDGLPA
                     HAWMAYGLSDVVNQRRMIDEGGAEEEFKAVLRSKLDALLSLAEATDCRRVRLLQYFGE
                     TSSPCGNCDNCLHPPTVWDGTDAARKLLSTIYRVHEMSALTFGAGHIMDVLRGKDTDK
                     VRQFLHDKVSTFGIGKGYSETQLRGVMRQLLATGALGLHKVTSENSGHVFDTLCLTSG
                     SRDVLRGEVQVQLRETVAAARSRSTKRGVQPNAAAANLGPDAQARFINLKAWRSEVAK
                     SHNLPAYVIFQDATLAAIAEQCPGSLQALGSISGIGSKKLDAYGAEVLRVIGGPSV"
     CDS             95401..95961
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63XN4"
                     /locus_tag="CT3_00730"
                     /product="lipid A deacylase"
                     /protein_id="BBL22618.1"
                     /transl_table=11
                     /translation="MHVHALRGIATGVTVFAALAAGSPARAQEAPTLYLQGGAGEREA
                     YATTVGLTWPWTSWSWALGSGVVRGQWDGYLGNWSSRPQASARRNTLVLGLGPSLRWR
                     GAGGQSPWFVELGTGVSWFSRHYRNGSDAFGSRVNFSSHLGLGRNFGPQRAHELSLRI
                     QHSSNAGIKEPNPGENFLLLRYAHVF"
     CDS             96110..97507
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887004.1"
                     /locus_tag="CT3_00740"
                     /product="oxidoreductase"
                     /protein_id="BBL22619.1"
                     /transl_table=11
                     /translation="MSLPSIDSFLSALQQQLGDAAVQTGAAVEARFHTDWSGQPPVAP
                     LALVRPRSTEEVAAVLRLCHAHRIAVVPQGGLTGLAGGAVPVQGCVALSLERMNAMEA
                     VDARTGLVTVQAGVTLQAVQEAAVAAGMVFGVDLGARGSCQIGGNVSTNAGGNGVLQH
                     GMMREQVLGLEVVLADGTVLPMLRPMLKNNTGYDLKQFFIGAEGTLGVITRVLLRLRP
                     MPQAKATALVAVPHFDAALAVLQRMQGRFGNSVAAFELMWDSFVQASIQWQKLQAPLA
                     ERHPLLALIDVDGKDEASLRDAVEEALGEAMEAGEVADAVIAQSHTQARTLWKLREAP
                     AELNTQMHPPINFDVSLPQADIGRFAQAIQADFDARWPGHHTLFFGHVGDGNLHVSTD
                     GATVRGECDAVEAALYAQVERFHGSVSAEHGIGLHKKPFLHASRTPQELAAMRAIKAA
                     LDPLNLMNPGKVFDL"
     CDS             97549..98364
                     /codon_start=1
                     /gene="hutG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004193651.1"
                     /locus_tag="CT3_00750"
                     /product="N-formylglutamate deformylase"
                     /protein_id="BBL22620.1"
                     /transl_table=11
                     /translation="MTDIAPFHFHQGSLPLLVSMPHAGTHVPADIAALLTDEARQVPD
                     TDWHMPELYAFAKAMGASILAATHSRYVVDLNRSPDGASLYPGQSVTGLCPVDTFDDT
                     PLYQRAEDQPDDAEVARRRSTYWAPYHAQLRAELDRLRAEHGRVLLWDAHSIRSVLPR
                     FFDGKLPDLNLGTADGASCAPELAQQLLAIAEQAPGATAVLNGRFKGGYITRHYGQPE
                     QGIHAVQLELTQCSYMQETLPFAYLPERAGALQPTLQQLLQTALTWVQQPAQP"
     CDS             98412..99533
                     /codon_start=1
                     /gene="hisC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UMN3"
                     /locus_tag="CT3_00760"
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="BBL22621.1"
                     /transl_table=11
                     /translation="MNENIAQLARPEVPTLPAYNAGLSSDAVRTRYGVQHIARLGSNE
                     NPHGPSPRVGAALVDLARQIQYYPDASATTLRDALAARHAVQPGQLVLGNGSEDILQM
                     LCQAFTGVGDVVLTQRPSFGLHEIYPRMMGASVELVELTADLEFDLAAWCAALQRAPK
                     LAFIANPSNPVGCMWTAEQFAQLLQAASPQTLLVVDEAYVEYASLTPGYPDTLAQLQD
                     CGKPWIVLRTFSKAWGLAGLRVGYGVAGDAATIALLDRVRTPFNVNQAAQVAAMAALK
                     DEAYMRRSVQATVLEREALAQRLRTAGLRVAPSATNFLFVEVGRDAAVVAEGLLAKGV
                     IIKPWKEPGFTQFLRVSVGLQEDNQRFVQALSAVLGRPI"
     CDS             99551..100219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268133.1"
                     /locus_tag="CT3_00770"
                     /product="alpha-ketoglutarate-dependent dioxygenase AlkB"
                     /protein_id="BBL22622.1"
                     /transl_table=11
                     /translation="MTASLFDDPPQPVERMAIDDGAWLLRGWALEQQTQWIAAVQQVL
                     ALQPLRASCTPSGKPMSVRMSNCGAYGWVTDAAGYRYSATNPDTGVAWPAMPDFLRDQ
                     AVAAAAAAGYPGYAPDVCLVNQYLPGARMGLHRDADEQDWAAPIVSVSLGLPCRFQWG
                     GLERSSPVRRFTLLHGDVLVWGGATRMAYHGVLPLQDGAHPLLGPRRWNLTFRMARSH
                     YRPQ"
     CDS             100303..101367
                     /codon_start=1
                     /gene="metH2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004204527.1"
                     /locus_tag="CT3_00780"
                     /product="5-methyltetrahydrofolate--homocysteine
                     methyltransferase"
                     /protein_id="BBL22623.1"
                     /transl_table=11
                     /translation="MSLPTYTRAQELPATLAQRLVILDGAMGTMIQRFKLGEAQYRGE
                     GYSGADGAGDRFTDFPRDVKGNNELLSITRPDVIRDIHEKYLAAGADLIETNTFGATT
                     VAQEDYGMAELAREMNLKSAQLARAACDKYSVNGRICYVAGALGPTPKTASISPDVND
                     PGARNVTFEQLRQAYFEQTVALIEGGADVILVETIFDTLNAKAALFAVEEAFDATGER
                     LPIMISGTVTDASGRILSGQTVTAFWHSVRHSNPLSVGLNCALGATLMRPYIQELAKA
                     APDTFISCYPNAGLPNPMSDTGFDETPDITGRLVHEFAAEGLVNIVGGCCGTTPDHIG
                     AIARAVQSTTTRKLFYPAHA"
     CDS             101517..102740
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00790"
                     /product="hypothetical protein"
                     /protein_id="BBL22624.1"
                     /transl_table=11
                     /translation="MTTSLPSSLTPTAAPAAAAPTAATSAAGAVLPVSGVASAAQVAP
                     ILAAAQAALAKTVNLSPQAQQAIKAEAFAQLVSQLVQQIQGGTVQLPANWPAGGVTPQ
                     WQALLAALVQQASAGQPLPQQLLSVQSWPAALAQAVLQSGAGSTAGAPVPPSTTPASA
                     APAPQAPAGAGAAAASAASPGASGAAGQTAGAGTPAATVRPALPALQNWLVQQGVLQG
                     PDGERAFTLTLRVPVAWAQAQSVLGQALGAQLAGGGPALSGSALGALLLPYGSSVQQL
                     ANATFGLVLAPQGLPAAQTQAMRTSAVLQLEFQPMPMAASQVAQQAVTAGLLPAGMLP
                     QEAYQALLARGGDPWLHMAQQQASGQLPRERQQHGSDGQCNRAGCQYQGRAECAQPFC
                     AEMNSLWAASRSSRL"
     CDS             103012..105309
                     /codon_start=1
                     /gene="norB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010980966.1"
                     /locus_tag="CT3_00800"
                     /product="nitric-oxide reductase large subunit"
                     /protein_id="BBL22625.1"
                     /transl_table=11
                     /translation="MGSYRKHWLALIAVLIVTFSMLGYYGREVYRQAPPIPDRVATAG
                     GEVLYTQESILDGQTAWQSVGGMQLGSIWGHGAYQAPDWTADWLHRELTAWLEVAAER
                     EQGKPFAQLDAAAQAVLRDRLKTEYRSNTFDAATGTATVSDLRAEAIARTARYYDELF
                     SDAPALQKSREHFAMKENTLPSAERRAQMAGFFFWTAWAAATERPADVGGSGATYTNN
                     WPHEPLIGNQPTGENLVWSIMSVVVMMAGVGFLVWGWSFLRKQEEDDPTPPVHDPLSR
                     VPLTPSQRALGKYLFLVVALFTTQVFLGGFTAHYTVEGQQFYGVDVSQWFPYALVRTW
                     HIQSALFWIATGFLAAGLFLAPLINGGKDPKYQKLGVDILFWALVVVCVGSFIGNYFA
                     IAQVLPPEWNFWLGHQGYEYVDLGRLWQIGKFAGIVFWLVLMARGIFPALLAPSGQDK
                     NLLALLTCSVVCIGLFYGSGLFYGERTHLSVMEYWRWWVVHLWVEGFFEVFATTALAF
                     IFSTLGLVSYRMATAASLASASLFMLGGVPGTFHHLYFAGTTTPVMAVGASFSALEVV
                     PLVVLGHEAWEHWRLQHRTPWMAHLKWPLMCFVAVAFWNMLGAGVFGFMINPPISLYY
                     LQGLNTTPVHAHAALFGVYGFLALGFTLMVLRYVRPQLVFSESLMKTGFWWLNAGLAL
                     MMFTSLLPIGLFQFHASVSEGLWYARSEAFLQQPFLQTLRWVRTFGDVVFIVGALCVS
                     WQVVRGLFGTPAAAAPAEALLVKGM"
     CDS             105309..105737
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00810"
                     /product="hypothetical protein"
                     /protein_id="BBL22626.1"
                     /transl_table=11
                     /translation="MQIDKFKHQHGDIKRRIAELRDLARAGADTHAEAIAQGIVAMSA
                     LIKLHLAVEDQVLYPALQADRQSDLARLARHYQSDMVPIAAAYDAFARRWNTSQRVRE
                     DAQGFRDDANLVLRKLHERMLREDREFYPQIEAQELAGAL"
     CDS             complement(105817..106746)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003085908.1"
                     /locus_tag="CT3_00820"
                     /product="transcriptional regulator"
                     /protein_id="BBL22627.1"
                     /transl_table=11
                     /translation="MQLELKDLRLFLLIAQTGSLTRASEQSHLSLAATSARIKALEEQ
                     AGMPLLIREARGVRLSPPGEAFLHHARAMLEQTRQLQADLQEYGAGLRGHVRVFANTT
                     AVTEFMPDILAAYLMQHPHISVDLQERPNAHIAHDIREGRADLGIIAGEVDTHGLTSL
                     HFSTDRLVLVTPDTPAWRSHQQLAFAQVLHEHFVGMHRHSTLQTFLDQIGQQLGHTLR
                     LRIQLSNFDAMCRMVAAGVGVAVVPESAALRHRSQSPLHHVQLQDAWAVRPRYMLLRE
                     GQTPSPHVQALMDAIQAYHLPQHAPQAGAATAG"
     CDS             106894..107784
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010925894.1"
                     /locus_tag="CT3_00830"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBL22628.1"
                     /transl_table=11
                     /translation="MSDFSPLIDAAALAHLQTWQGKSETTPDSITTAPLRALSATLDR
                     DDAPPAPGSVVPPLWHWLYFLPHARQSEIGPDGHPRRGGFLPPVPLPRRMWAGGRLRW
                     DAGNPLRVGQEVERLSTIQSVRHKAGRSGELLFVQVEHQFRNARGVALTEEHDIVYRP
                     LAQPGEAAPAPQTPPLAGQAAWSRTIVPDDVLLFRYSALTFNGHRIHYDRQYVTQVEG
                     YPGLIVHGPLIATLLVDLVRRSVPGAQLTSFAFKAVRPTFDLHAFSVHGTPSADGKTI
                     ELWAQDHEGWLTMQATATLA"
     CDS             107869..109035
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003085913.1"
                     /locus_tag="CT3_00840"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBL22629.1"
                     /transl_table=11
                     /translation="MIEQTQSNNYPEIRDAIRDLCKGFPDEYFRKVDEERAYPEAFVN
                     ALTEAGWLAALIPQEYGGSGLGLTEASVIMEEINRCGGNSGACHGQMYNMGTLLRHGS
                     EAQKQKYLPKIASGAWRLQSMGVTEPTTGTDTTKIKTSAVKQGDKYVINGQKVWISRI
                     QHSDFMILLARTTPLAEVKKKSEGMSIFMVDLREAEKKGMTVRPIPNMVNHETNELFF
                     ENLELPEDSLIGEEGKGFKYILDGLNAERTLIAAECIGDGYWFMDRVTQYVKDRTVFG
                     RPIGQNQGVQFPIAETFIELEAANLMRWKACELFDRHEAMGAQANMAKYLAAKASWEA
                     ANACLQFHGGFGFACEYDVERKFRETRLYQVAPISTNLIYSYVAEHLLGLPRSF"
     CDS             109055..110251
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003085918.1"
                     /locus_tag="CT3_00850"
                     /product="CoA transferase"
                     /protein_id="BBL22630.1"
                     /transl_table=11
                     /translation="MALSERPRPLDGITVVSLEHAVAAPFCTRQLADLGARVIKVERP
                     GSGDFARGYDQRVNGQSSHFTWINRSKQSLALDVKQPQAKQALLALLASADVLVQNLA
                     PGAAARMGLSYEALKAHNPRLIVCDISGYGSDGPYRDKKAYDLLIQSEAGFLSVTGTP
                     ETPSKSGISVADIAAGMYAYTNILSALLLRGKTGEGSHIDVSMLEAMGEWMGYPLYYA
                     YDGATPPPRTGASHASIYPYGPFQAGDGGTVMLGLQNEREWKAFCDAVLLRPEVATDA
                     RFNSNANRNTHRAALQELILQEFQALTAAQLVERLETAGIANARVNDMAGLWAHPQLA
                     ARQRWRTVDTPAGEVPALLPPGVNSAFDYRMDPIPAVGQHNAAILAELGWSAEQVAAL
                     QQAQTA"
     CDS             110322..111686
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003811151.1"
                     /locus_tag="CT3_00860"
                     /product="2-methylcitrate dehydratase"
                     /protein_id="BBL22631.1"
                     /transl_table=11
                     /translation="MKAENQVAIHPLAQFAGTLQWSQVPAAVQRKAEDLWVDWFGSVL
                     AGQNARPVHSIARFALSQGPAQGPCEVIGQSATTSPMMAALANAAAAHVAEQDDVHNG
                     SVFHPAAVVFPPALAVAQSLGASGAQLMAACVAGYEVGIRVGEFLGRSHYKIFHTTGT
                     AGTLAAAAAVGNLLGLTPAQMQHALGSAGTQAAGLWEFLRTAADSKQLHTAHAASAGL
                     MAAYLAQDGFTGAQDIFTGPQGLAAGMSTDANPARLTDGLGTRWATAETSFKWHASCR
                     HTHPAADALLQVMQRDGVQIGDIAQVICHVHQGAIDVLGPVTSPATVHQSKFSMGTVL
                     ALAARFGHAGLTEFDEQYLAADTVALRNKVTMALDPEVDAAYPQRWIGKVTVQTTDGR
                     TLHGRVDEPKGDPGNTLSRQEITDKALRLAAYGSQVPAAQVQQAVQQLWQVAQWPRVA
                     RLLA"
     CDS             111793..112794
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012706118.1"
                     /locus_tag="CT3_00870"
                     /product="hypothetical protein"
                     /protein_id="BBL22632.1"
                     /transl_table=11
                     /translation="MTRSSTSRRWALRACAAGAVLALGAGSAMANNWPDKPITLVVPY
                     TAGGPTDVVARLIAVPMGQSLGQTVLVENTVGAGGTIAPARVAKSKNDGYTILIHHMG
                     MATAPALYKKLPYDPLKDFEYIGQVLDVPMTLLSRKDFPASNFKELQDYVKKNQDKVS
                     LANAGIGAVSQLCGMLFMHQMGVKLTTVPYKGAGPAMNDLMGGQVDLLCDQTTQTVPV
                     IKDGKRAKVFGVTTSERLSSLPEIPTLNEQGLKGFDVKVWHGMYAPKGTPKDVVDKIN
                     KALNVALKDDNVKKRIAELSSDLVSPEKATPEGLRKHLEAEVARWDKVIKAAGVTAE"
     CDS             112850..113236
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003085915.1"
                     /locus_tag="CT3_00880"
                     /product="ring-cleaving dioxygenase"
                     /protein_id="BBL22633.1"
                     /transl_table=11
                     /translation="MTALIDRLDHLVLTTAHETACVHFYCTVLGMELQTFGEGRKAFV
                     WNGQKINLHLQGKEFEPKAQHPTPGSLDLCFIAAVPLEQVQQQLAAHGIAVECGPVQR
                     TGARGPIRSVYVRDPDLNLIEISEYL"
     CDS             113266..114132
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010925778.1"
                     /locus_tag="CT3_00890"
                     /product="CoA ester lyase"
                     /protein_id="BBL22634.1"
                     /transl_table=11
                     /translation="MSALVQHACSFLFVPANRPERLPKALASGADMVIADWEDAVAPA
                     DKDGARAALLAACADLSAAQRARLLVRINAAGTAWHAPDLRALAQLVAQGVAGAVVPK
                     AESADTLQGVATAAGSACALVPLIESVAGLDAADALARAPQVARLAFGHLDFQVDAGM
                     QCASDEAELLPVRMALVLASRRGALAQPIDGVTVDTRDAATTTADTRRAQRMGFGAKL
                     CIHPAQVAAVHAVFAPTPEAVERARQVVQAMEAAQGGVCVLDGRMVDAPVLHLARQTL
                     QRHAWALQRSPH"
     CDS             complement(114210..115517)
                     /codon_start=1
                     /gene="gdhA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WJJ6"
                     /locus_tag="CT3_00900"
                     /product="glutamate dehydrogenase"
                     /protein_id="BBL22635.1"
                     /transl_table=11
                     /translation="MQASSTSASKPAHALPSYLNAHDLGPWGNYLQQVDRVTPYLGSL
                     ARWVETLKRPKRILIVDVPIELDNGTIAHFEGYRVQHNLSRGPGKGGVRFHQDVTLSE
                     VMALSAWMSVKNAAVNVPYGGAKGGIRVDPKTLTRGELERLTRRYTSEIGMMIGPSKD
                     IPAPDVNTNGQIMAWMMDTYSMNTGATSTGVVTGKPVDLGGSLGRVEATGRGVFTVGV
                     EAAKLTGLAIQGARVAVQGFGNVGGTAGKLFADAGAIVVAVQDHTGSIYNAKGFDVPA
                     LLEHVGNTGGVGGFKGGDKLKNEEFWGVDCDILIPAALEGQITAKNAGKIKAKMVIEG
                     ANGPTTPEADDILNDKGVLVLPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINARLVR
                     IMQEAFAGIWQVAQENKVSLRTATFIVACKRILHAREMRGLYP"
     CDS             115799..116785
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00910"
                     /product="hypothetical protein"
                     /protein_id="BBL22636.1"
                     /transl_table=11
                     /translation="MAQSLRAAQADAEFAIIGTMPEKNDCQDGWCASGPAPFANTPPI
                     GLAPALQDQHDVLPDWSKQAPDLHEDAYAMADALWWSRKLGASQALGADVAPLLRGPD
                     DARAVQRALAQTYGWWPADRAPRYWKSGGPGRAQPLVHVPLPEPGVLSGLAEAPPPGP
                     VFQLRGAEAEIALRIGSAVSAEQAAALDHAAALALVDAWCVALEWVDVRWRDGLKAPA
                     LAQLADGQCHGGLLLGDWQGMDVLQGRDWSAQTCAVTLNGGAPQVFTGTHSLGDPAWL
                     LRDWLQHVAQAYGSVPAGTVVTTGTWCGCMQLQAGDRFHAEFAGLGALAWQF"
     CDS             complement(116828..117802)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003817045.1"
                     /locus_tag="CT3_00920"
                     /product="MFS transporter"
                     /protein_id="BBL22637.1"
                     /transl_table=11
                     /translation="MIDRRLFLSRSTALCTAAALPVWAQSPWPARPIRVVIPYAAGGV
                     TDSVGRRLIDQMAQALGQPMVVENKGGAGGTVGMAEVLKAAPDGYTLALTAISPLTLS
                     PHLMKLPYDPAKDVVAVAPMMYSPVYVLATPAFQGKSWEDLIAQAKAQPGTIRFATSG
                     VGSVGHIMLEQIQHQTGAQFVHVPYKGVGQTVNDAVGGHFEIMTGNPYGTINGLITQG
                     KLRVLATTGPQRAPNQPQVPTLAEKGLAAANITSLFGFVAPARTASDVVLRLSSVVQA
                     QLATPAIQEALRSTDNVGLQMSPAEFGNLLQQESRANADIIRKARITL"
     CDS             complement(117906..118808)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189747.1"
                     /locus_tag="CT3_00930"
                     /product="hypothetical protein"
                     /protein_id="BBL22638.1"
                     /transl_table=11
                     /translation="MATKKAAPPSTPASPFTSRDAALRKRWQSCQPGTPQAGSTGRFV
                     DLSHFDPAGKPFATGKGKSQDKARVLELAGELDGLQNIFYADRRYKLLVILQGMDAAG
                     KDGTLRGVFGQMSPLGVRTVGWKAPTETEKAHDYLWRIHQQMPGAGEVVVFNRSQYED
                     VLVPVVNGWLTPEQQQQRYAQINDFERMLSETGTLVVKFMLHISQDEQRLRLQERLDD
                     PAKHWKFDQNDLQVRAQWHDYQQAYAHLLAATHTPWAPWTIVPADSKTHRNLMVATLL
                     RELLHNLDLRYPPGDPALEKITVV"
     CDS             complement(118947..119864)
                     /codon_start=1
                     /gene="yahB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207049.1"
                     /locus_tag="CT3_00940"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL22639.1"
                     /transl_table=11
                     /translation="MAFPPEQVPLFLAVLDSGSFSAAARRLGRVPSAVSMAVAQLEAE
                     LDLQLFDRSGREPRPTAAARALEPQARLLAAQLQQLNQQAQALHQGLEERLTFAIAPE
                     LLSTGWADGLVPLVQEFPALTVEVLAAPQDDALELLHAGRAQLALVFERPAIDGREDF
                     QEMGQETLVAVMAPQFAPWRAALAAQAPGGPAPQLNVDQLAATRQVLVASRDPQQTDP
                     RFVFAHQQWRTDSHQAALSLISTGLAWGWLPKGLVETHIAAGTLLEIPVQNLSNGTTL
                     FVDWVWSKERPLGLAAQRFVHMLRERPAH"
     CDS             complement(119910..120179)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00950"
                     /product="hypothetical protein"
                     /protein_id="BBL22640.1"
                     /transl_table=11
                     /translation="MEEATTAITPEAPESWPVAMNSRLETMMAISSYRPTNTTRRLAP
                     CRPVARAGVAVTGETDEAEEEAERELADAIAETGFDMLRSVCFEN"
     CDS             120064..120480
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004525507.1"
                     /locus_tag="CT3_00960"
                     /product="hypothetical protein"
                     /protein_id="BBL22641.1"
                     /transl_table=11
                     /translation="MVFVGLYELIAIIVSSLLFMATGQDSGASGVMAVVASSIAILWN
                     LTFNWLFERWELRQSRKGRSLLRRIVHAVGFEGGIAAMLIPLMAWWFEITLWQAVVME
                     AGLLVFFMVYTFVFNWCFDRIFGLPASAQAQPVAAS"
     CDS             120802..121470
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003893323.1"
                     /locus_tag="CT3_00970"
                     /product="membrane protein"
                     /protein_id="BBL22642.1"
                     /transl_table=11
                     /translation="MSSRLNWLRAAVLGANDGVLSTAGLVLGVAGADASFSALLAAGV
                     AGLVAGALSMAAGEYVSVSTQRDTEKAAVHQEKAELAALPEAELRELAAMLQRKGLQP
                     ATAHQAALEMTQHDALAAHAELELGIQPGQYTNPWHAAWASAVSFAVGALVPLLTVLL
                     SPSTWAVTWTAVAVLLALVATGVASAHLGGAPRLPAALRNVAGGLLAMGVTYAIGRVV
                     GAQL"
     CDS             121654..124404
                     /codon_start=1
                     /gene="metH1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004550945.1"
                     /locus_tag="CT3_00980"
                     /product="methionine synthase"
                     /protein_id="BBL22643.1"
                     /transl_table=11
                     /translation="MSAAVPVSIPPMRLSGLEPVFIGEDTLFVNVGERTNVTGSKAFA
                     RLILNEQYEEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIAKVP
                     VMVDSSKWEVIEAGLRCLQGKGIVNSISMKEGVEEFKKHAKLVKRYGAAAVVMAFDEK
                     GQADTYERKIEICERAYRLLVDEVGFPPEDIIFDPNIFAVATGIEEHNNYGVDFIEAT
                     RWIKQNLPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIAAGMDMGIVNAGMVGV
                     YDDLEPQLRERVEDVVLNRRPDAAERLLEIADQAKGNAKDDSKKLEWRGTAEHPRTVS
                     ERLSHALVHGITDFITEDTEEAYQAIVVQGGGRPLHVIEGPLMDGMNVVGDLFGAGKM
                     FLPQVVKSARVMKQAVAHLVPYIEEEKRQQEAAGLDVSSKGKIVIATVKGDVHDIGKN
                     IVTVVLQCNNFEVINMGVMVPCHEILARAKAEGADIIGLSGLITPSLEEMQYVAGEMH
                     KDDYFRIKKIPLLIGGATCSRVHTAVKIAPNYEGPVVYVPDASRSVSVAQSLLGEGKD
                     AYVSEVMADYDKARSQHANKKKTPLWTLEQARANATPVDFAHHAPVVPRALGRKVFQN
                     FDLAEIARYIDWGPFFQTWDLAGPYPAILEDEVVGEQARQVLADAQAMLKKIIEGRWL
                     QANGVMGLFPANRVGDDVVFYTDESRTQVLSTWYGMRQQTEKQIVDGVMRPSRCLADF
                     VATRDSGIADYAGMFAVTAGIGAEKKDQEFEAALDDYSGIMFKALADRLAEAFAECLH
                     ERVRKDLWGYAEDEQLSNEQLIKEQYKGIRPAPGYPACPDHTAKTDLFKVLNAQEIGM
                     TLTESLAMFPASSVSGFYLGHTDATYFNVGQIGEDQLEDMAQRRGIDLETMRRALAPN
                     LG"
     CDS             complement(124490..124690)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_00990"
                     /product="hypothetical protein"
                     /protein_id="BBL22644.1"
                     /transl_table=11
                     /translation="MKSTLLALGLAAAFLAPAAYSSPLTASQHTQVSAAKKTSAHATP
                     HKAKATKHAKAKKRPQHMVKKA"
     CDS             complement(124862..125245)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01000"
                     /product="hypothetical protein"
                     /protein_id="BBL22645.1"
                     /transl_table=11
                     /translation="MLTIRRGLLLAATLALGGCLFDEAMLPETLHFPPGTPITYGGKP
                     AKLYGTEACAQGELAGHSCLIFPPNRPTSKAVIISGQRVKEIQVTAKRDPQNPTHFIV
                     VDDQGRRLLSTTGNHDDMANIQITY"
     CDS             complement(125594..126277)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012067763.1"
                     /locus_tag="CT3_01010"
                     /product="hypothetical protein"
                     /protein_id="BBL22646.1"
                     /transl_table=11
                     /translation="MTPSFHARRHTLYRTAALLFGLGGLPLLHAMSATALHEAATRGD
                     TAVLRQQLQQGVPVDGRDGAGRTALLAATHANQVEAARLLVAAGADVNAKDAIQDSPY
                     LYAGARGLLEILQLTLAHGADLRSTNRYGGTALIPAAERGHVEAVRTLITAGVEVDHI
                     NRLGWTALLEAILLSDGGPRHQQIVQLLLAAGANPNLADGDGVRPLQHAQQRGYTAIA
                     DLLRAAGGR"
     CDS             complement(126367..127125)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003808041.1"
                     /locus_tag="CT3_01020"
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="BBL22647.1"
                     /transl_table=11
                     /translation="MHDAFLAQHTVFITGAGRGIGQAVALGLAAMGAHLVVSDLDGEA
                     AAATAADIRSRGGVASSLALDVADAAACQAAAAALSLPAGHRLVLVNNAGIRPKHAFD
                     SPDRDAQWRRTMDINLDGARHTILAFQALLAASGGNVVNVGSISASRASPGSIAYSTS
                     KAAVEMLTKVMALELAPQGIRVNAVAPGVMLTGMTEQTRKDPRHVEYILRRVPLKRYG
                     EPAEIAGPVAFLASPLASYITATVLNVDGGYLAA"
     CDS             complement(127209..128177)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815063.1"
                     /locus_tag="CT3_01030"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBL22648.1"
                     /transl_table=11
                     /translation="MQRRHFLAAAAASCAIPTLPTRAAGKPVRIVVPYAAGGAIDLSV
                     RRMATMLEADLGTVIIENRPGGGGGIGMAAVARAPADGMTLGIAAVATNAINPWLFAN
                     LAYDPIKDFAPITQMTRIPNVLVVNAEVAQRRGIASLGDFVDFARRESGKLTYASGGN
                     GSAGHLAGEMFKREAQVDIVHVPYNGGAPSQLALLSGQVDCSFDNLASAAANIRAGKL
                     KALAVTTAQRSELLPDLPAVAERFKGFQIDTWWGLVAPAGTPAEVVQRLNTQAVKALY
                     SAEVMALYRDMMMETVTSTPDAFGAFMRLELARYQQVVRISGATVG"
     CDS             complement(128367..129284)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004196791.1"
                     /locus_tag="CT3_01040"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL22649.1"
                     /transl_table=11
                     /translation="MDLRALRYFIEVVRQNGFTRAAETLHVTQPTISKMVKALEDELG
                     GPLLLREGRGVQLTDAGQVVYDRGQEMLDQARLLRQQVAEVDNITRGELSVGIMPTTG
                     HYMAPVIALFQQRFPGVHLQVNEQGARAQYQLIQDGKLDMALGLFSAPDPALERYTVA
                     RQKTRVVLPVHRVGDPDRPLRWQDLRDLPFVLYTSDFALHEHVLQQCEAAGFSPQVKV
                     QTRYWDFIGHLVAADVGVAVMFEHVIARYDPRRVASRPLTEPAITWDVALMWRPGYLS
                     RAARAWLDCVRAVYPRPLQGADQPPLPQS"
     CDS             129437..129856
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707491.1"
                     /locus_tag="CT3_01050"
                     /product="murein hydrolase exporter"
                     /protein_id="BBL22650.1"
                     /transl_table=11
                     /translation="MVLQVGLLSAIWAAMEGMRQHFGWSMPAGLIGFGLLAVGLFTGL
                     VKAQWLQAGTNWLMAEMLLFFVPAMLVVTEYPDLIRHQGLRILAVIVISTACVMAVTA
                     LAVDRVYRLELWLARRKSTARARRAVREEVRTCSRTR"
     CDS             129838..130533
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707492.1"
                     /locus_tag="CT3_01060"
                     /product="murein hydrolase effector protein LrgB"
                     /protein_id="BBL22651.1"
                     /transl_table=11
                     /translation="MLSNQVIGLLSFAATVACYAVNKRLYGRHPHVLLMPIIATPVVL
                     VTLALLTQVRFPQYYAQTHWLVWLLGPTTVAFALPLHAHRDLLRKHWMSIATGVLAAT
                     VVSIGTSVTFAQWFGLPEELEKGLVVRSITTPFAIEAEKVLGGPTDLAALFVLLTGVS
                     AMLLGQTVLRLLPRIRSKLATGACWGGAAHGSGVARARQAGEVQAVMASLVMLIAGAV
                     NVLAAPFIKTLLF"
     CDS             complement(130701..132269)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205422.1"
                     /locus_tag="CT3_01070"
                     /product="acetyl-CoA hydrolase/transferase"
                     /protein_id="BBL22652.1"
                     /transl_table=11
                     /translation="MHTTFTHASPADRVLCPALRERIMTADQAASLIQSGMTLGMSGF
                     TPAGAPKAVPQALARRIEEQNAHGGQFRISLWTGASTSAELDGALAKVHGIERRLPYQ
                     SDPTVRKEINEGRMQYVDIHLSHVAQYVWFGFLGHLDVAVVEVAGILPDGRLIPSTSV
                     GNNKTWLEQADKIILEVNSAQPAALEGMHDIYYGAAVPPLRKPIPMVHPYDRIGDPYL
                     HCDLDKVIAVVPTQQRDRLAGFTAPDADSQRIAQHIIDFLQHEVKVGRLPPELLPLQS
                     GVGNIANAVLAGLNHGPFEQLHAYTEVLQDGMLDMLESGKLATASTTSLALSPAAMER
                     FLADIDRYRSRVILRPQEISNHPELIRRMGLISMNALIEADMYGNVNSTHVMGSSIMN
                     GIGGSGDFARNAYLSIFMTPSMAKGGNISCIVPMVSHVDHTEHDVQVIVTEQGLADLR
                     GLAPVQRARLIIAQCVHPDYRAEMTDYLERALRDAPGKHTPHLLEEAYAWHQRYLKTG
                     SMHAAAPVPRVRAA"
     CDS             132647..133669
                     /codon_start=1
                     /gene="brkB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003808614.1"
                     /locus_tag="CT3_01080"
                     /product="membrane protein"
                     /protein_id="BBL22653.1"
                     /transl_table=11
                     /translation="MGRMAFDLTLWKHRATRLLRPVQPVIDSVQLWLQADGLRMSAAL
                     SFYGMLSLSPLLLLIVALLGWWLDRSVIESELLDQASAVMGNQGASVLKAAMASAQTK
                     KEGLLASALSLVLLASGATGVFAELQNSLRKLWVVGRDVPPEPAKPWWSMATIRLRGL
                     GYVVVLGLMLLVSMVLSTGLKLASDWAGTVLPIAPLGQVMLVVNELVSFAVSVALFWG
                     VMRLGSGPKPPTRYLVFGAMVGAALFSVGKQAFAWYLSTAAVVSAYGAAGSLVVLLMW
                     IYFTSAILLYAAACARAFGATQPPVFGMPRNWQDPLAVAPPATAQPPVPTTPTAPQPA
                     YGGLQH"
     CDS             134150..135013
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010886926.1"
                     /locus_tag="CT3_01090"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BBL22654.1"
                     /transl_table=11
                     /translation="MDVFLQQVLNGLTLGGIYGLVALGLTLVYGILHVPNFAHGGFYM
                     IGAFVALHAMVAWSWGYWSAMVMAAVTVAVLGIVSERLVFHPLRKASPLHPKIASIGL
                     LLFLEAGAQAVWGADFQRLPTPYTSVIEMGGLTAPAQRLLIIAAAFALMVALHLFLTR
                     TTTGSTIIAMAQNREGASLVGIDANRVAMMTFAISGALAAVAATLYAPINLVYPAMGQ
                     LVITKAFVIIILGGMGSIPGAVLGGLIIGFAESFGAYYISTDYKDIIAFVLLVIILSL
                     RPQGLFAKRGH"
     CDS             135016..135990
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010886927.1"
                     /locus_tag="CT3_01100"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BBL22655.1"
                     /transl_table=11
                     /translation="MSGLFDSKLAWGALLLLAIAFPWIAGNDYFLTVMSTAYIFAIAT
                     LGLNLITGYTGQLNLAHAGFMAVGAYTVGILTVDHGWTFWASLLMSGVVCVALGYVIG
                     IISLRLKGHYFSIFTLCVGYIMFLVIEKWEGLTRGTVGIMGIPEPEAIGALTFDTPLS
                     LYYFVLCFLVLLVWVKRRIVKSLLGRTFIAIRNSDELAEALGINLMRNKVLAFMLSVF
                     YAGIAGGLYAGFVRFIGPDMAAVHHTFDMMIFAMVGGMGTVLGPLLGAIGMPWITQYL
                     QFLQEFRFIVFGPILVALVIFMPYGVVGSFMAWRTRRATKEGKAHAAD"
     CDS             135977..136741
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010886928.1"
                     /locus_tag="CT3_01110"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL22656.1"
                     /transl_table=11
                     /translation="MLQIEHLTKKFGGLAAVNDVTTTIEQGKINAIIGPNGAGKTTFF
                     NLISSMHKPTSGTITFDGQDVTSLRPDQVARLGVARTFQTTALFDRATVLDNLIVGHR
                     LRTQSGLWDVLRGSSRLREEERVCREKAREALDFVGLSPIANRVAGDISQEERKRVAF
                     ALALATDPKLMLLDEPAGGVNPEETEGLAELIRKIVRHGITVALIEHKMGMIMSLADK
                     ILVLSYGEKIAEGTPEEIRRNPAVIDAYLGSEHAEI"
     CDS             136728..137435
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010886929.1"
                     /locus_tag="CT3_01120"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL22657.1"
                     /transl_table=11
                     /translation="MLKFENVSLKYGSFLALDQVSLHADKGELVVLLGANGAGKSSLF
                     LTASGIHKAAGGSITWEGQELVGQKPSAIVQGGLVQCPEGRKLFPQMTVQKNLELGAY
                     VHRRDPGPSRQTLEEVLELFPILRQKKDDPAGSLSGGQQQMVAIGRAMMGRPKVLLLD
                     EPSLGLAPLVIKQMFEVIQRINQAGTTVLLAEQNAYAALKIAHRAYVLENGRIVREGK
                     PAELLADDSIRKAYIGA"
     CDS             137536..138702
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010886925.1"
                     /locus_tag="CT3_01130"
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="BBL22658.1"
                     /transl_table=11
                     /translation="MRAFPQFTRRQLTGLALACAAVAAGPAMAQEVVKIGYSGPLSGG
                     AAQYGKNALDGMQMAVAEINAANPEIAGKKVKYEIVPLDDKYNPSETAINAQRLVQQH
                     KTAAILVPHSGGIYALQTTNERSNFIVLAYSSVPQITARGNKLTLRIPPEFTSYIDPF
                     SKYVMNRFGKKVAMVGADHDYAKAWAAAFKPGWEKLGGTVVAENPMSYNRATDFYSGV
                     SKALAAKPDVLFVGGASEPTALVVKQARELGFKGGFIIMDQAKLDEMSRVVGGYATLE
                     GAIGVMPVSEDTKPANQAFVKRFGQMFPGRVPGSEAQWNYTAVHATAKAMQLAGTYSD
                     AKAIHAKLNDGYKALAPDVNPGGVMGVDDKGGTLTTERGAAVKDGKIEAVSTVK"
     CDS             complement(138949..139722)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010889459.1"
                     /locus_tag="CT3_01140"
                     /product="gluconate 5-dehydrogenase"
                     /protein_id="BBL22659.1"
                     /transl_table=11
                     /translation="MSVKALFDLTGKTALITGGSRGLGLQMAEALGEMGARLAITARK
                     ADELAEAKAHLQGLGYEVETFTNDLQKFDSIPGLVDDVLARCKDIDILVNNAGATWGA
                     KAEDYPDEAWHKVMNLNVNAPFFLTREVGKRVMIPKGRGNVIITASVAAFKGTPPGMN
                     TVAYNTSKAAAVHLAKVLASEWGPYGIRVNSICPGFFPSKLANGLIDKIGDAIIARAP
                     LRRIGNEEDLKGAVAYLASDASRHMTGQALVIDGGASLF"
     CDS             complement(139865..140668)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003097851.1"
                     /locus_tag="CT3_01150"
                     /product="transcriptional regulator"
                     /protein_id="BBL22660.1"
                     /transl_table=11
                     /translation="MPAPQLSTTAPEDDRHFVTALARGLEVLSCFRSGEKLLGNQEIA
                     QRCGLPKSTVSRLTRTLTMLGYLIHVPDAGKYRLGTATLALGSAMLTGLDVRQIARPL
                     MQRLADFAQAEIALGTRDRHNMLYIEHCPCPQPIVSDLDMGSRIPLATTAMGRAWLAA
                     CSAADRQEALDYLQAHAPEQWAAAQAQAPLWPAAKERAQPWLTCSFGDWLEHVNAIAL
                     AFSPGRGLPLMVISCGGPTRLVSPEFLMQRAKPELERMVRRLQQAIYKA"
     CDS             complement(140748..141764)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003809004.1"
                     /locus_tag="CT3_01160"
                     /product="MFS transporter"
                     /protein_id="BBL22661.1"
                     /transl_table=11
                     /translation="MTTTLRPFAHRPRPPRRHALAQAAAACAALWLAGTALAADPVWP
                     AKPLRIVVGFAPGGTTDVMARLVGKALSDQLGQPVVIDNKPGASGNIAVAEVARAPAD
                     GHTFLVAPTTVETANPSLFKFPVLPARDLLPVAGLGKTQMYLVSRPGLAATDVPSLVR
                     LGSTPGKELSFASAGTGTAPHLACELFKQATKVDFVHAPYRGAAPALQDVMANQADFV
                     CDPGIAFQHIRSGKVRLLGIVSSKRSPFFPDVPTVAEQGFPGADLDIWFGMWAPKGTP
                     EAVIRRMDAAVAQALAHPDVARRYADLGAETVPLATLAFKAKLQQEAQLLGTLIAQQK
                     IRAE"
     CDS             complement(141881..143533)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011729559.1"
                     /locus_tag="CT3_01170"
                     /product="cyclohexanecarboxylate-CoA ligase"
                     /protein_id="BBL22662.1"
                     /transl_table=11
                     /translation="MEFDAVLIPPRRARNLQAGHWRDQTINDALDQAVRERPQQLALT
                     AWRTEDDAVRRFSYAELARMADRMAVGLHRLGVRRNDVVACQLPNWWQFTLLYLACAR
                     IGAVLNPLMPIFRERELRFMLQHGEAKVMVVPQRFRNFDHAAMLRQLRPELPQLQHLL
                     VVGGTGAESFEAALTEPAWEEAEDAAAILHATRPTADDVTQLMYTSGTTGEPKGVMHT
                     ANTVSANIWAYAERLHLGADDVVLMASPMAHQTGFLYGLMMPVMLGARVVLQDLWEPA
                     KAAQIIRDEGVSFTMASTPFLSDLARVVAESGQPVPTLKTFLCAGAPIPGPLVEQARS
                     ALGAKIVSAWGMTENGAVTLIRPEDADERAVHTDGLPLPGVEIKVVDIDGRSLPAGTT
                     GQLWLRACSNFGGYLKRPHLNGTDAEDWFDTGDQARIDAQGYLRITGRSKDVIIRGGE
                     NIPVLEVETLLYKHPAVLQAAVVGFPDARLGERACAFVVTRPGQQLVFDDMVAYFKAQ
                     QLTTQYIPERLEVLPVMPATPSGKIQKFRLREQLVALLSPSA"
     CDS             complement(143618..144769)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804113.1"
                     /locus_tag="CT3_01180"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBL22663.1"
                     /transl_table=11
                     /translation="MNPYLDDDLLTLAEHAQRFAQGRVAPGFQERDQTRVLDRALMRE
                     MGQMGFIAPELPEAVGGQGMGCLAAGVIHEAIAAADLSLSYINLLASLNGQILSQHGE
                     RSVVQPWLDKLIAGEALCAIALTEPRGGSDAASLRLRVERQGDHYLLNGEKTSISAAD
                     QCDIAVVFGRTGTVESGAHGVTALLVPMDLPGITRSRFDCHGQRAIGRGSLFFENVRV
                     PVDHRLGAENKGFVQVMQGFDFSRALIGLQVLSVARTALDESWAYAAQREAFGAPLTA
                     FQGVSHPLADFDTQVTAARLLCLQALWLKDRHLPHSAEAAMCKWWAPKLAYDAIHQCL
                     LTHGHGGYDRGLMEQRLRDVLGFQIGDGTAQIMKTIIARTRAGRQAVPI"
     CDS             complement(144791..145573)
                     /codon_start=1
                     /gene="menB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P23966"
                     /locus_tag="CT3_01190"
                     /product="1,4-dihydroxy-2-naphthoyl-CoA synthase"
                     /protein_id="BBL22664.1"
                     /transl_table=11
                     /translation="MQFEDILYEIRNGVAWITINRPDKMNAFRGQTCDEIIRALNKAG
                     YDRDVGCIVLAGAGDKAFCTGGDQSAHNGNYDGRGTIGLPMEELHTAIRDVPKPVIAR
                     VQGYAIGGGNVLATICDLTIVSDKAILGQVGPKMGSVDPGYGTAFLARVVGEKKAREI
                     WYLNKRYSGQEAVDMGLANICVPHDQLDATVQEWAETICQRSPTAIAIAKRSFNMDTA
                     HQAGIAGMGMYALKLYYDTEESREGVNALKDKRQPDFRKYAK"
     CDS             complement(145590..146357)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815607.1"
                     /locus_tag="CT3_01200"
                     /product="acetoacetyl-CoA reductase"
                     /protein_id="BBL22665.1"
                     /transl_table=11
                     /translation="MQGLAGKTVIVTGGGGGIGNATCERLAQEGAQVAVLDRDLAAAQ
                     ATAQRITAAGGKALAVAADITRRSEVDAAVQAVHTAFGPVDVLVNNAGWDVFKPFAQT
                     APDEWERLIAINLVGALHMHHSVLPDMVARRGGRIVNVASDAARVGSSGEAVYAACKG
                     GLVAFSKTLAREHARHGITVNVVCPGPTDTALLAGVTDAAPNPEKLREAFTKAIPLGR
                     LGQPQDLAAAIAFFASDDAGFITGQVLSVSGGLTMNG"
     CDS             146485..147009
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815617.1"
                     /locus_tag="CT3_01210"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BBL22666.1"
                     /transl_table=11
                     /translation="MDNPNKTPQEAEMELANRIFFRLYQCANMLHKTGSRAVEQQGLT
                     TQQWAVLGALSRPDAKAGMGVGELARYLMVSRQNLSGLVGRMERDGHVELAADPQDRR
                     ARLIRMTDRGQHVWQQEAQEHIRRYYGQALADFSVGDMAHLLHYLLKLLGNMQTIDAA
                     HGGDDAAAPQDAAA"
     CDS             complement(147079..147852)
                     /codon_start=1
                     /gene="fpr"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003811187.1"
                     /locus_tag="CT3_01220"
                     /product="ferredoxin--NADP(+) reductase"
                     /protein_id="BBL22667.1"
                     /transl_table=11
                     /translation="MSAFLEERVLSVHHWTDRLFSFTTTRDTALRFSNGHFTMIGLKV
                     NGKPLLRAYSIASPNYEEHLEFLSIKVPDGPLTSKLQNIQVGDTIIVGKKPTGTLLID
                     YLLPGKNLYLIGTGTGLAPWLAVARDPETYERFDNVVVVHGVRQVEELAYQELFEKEL
                     PEHEFLGDIVQGKLHYYPTVTREPFRNQGRISDQINAGTFPQNLGLPALNPETDRIML
                     CGSPAMLAELKEMLEERGFKEGNTTTPGDFVIERAFVEK"
     CDS             148096..149313
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010930653.1"
                     /locus_tag="CT3_01230"
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="BBL22668.1"
                     /transl_table=11
                     /translation="MSTSYGSCMRWSLPLLTLAAAPAWAQAVLKIGEINSYKAMPAFL
                     EPYKKGMDLAVEQINASGGLLGKKVQLVIRDDNGNPGDAVRAAEELYTREKVDVLTGS
                     FLSHVGMALTDYAGQKKRFFLASETLTDKVVWENGNRYTYRLRGSTYMQTAMLVKEAV
                     KLRKKRWAIVYPNYEYGQSAVATFKKLMKEAQPDIEFVAEQAPALGKIDAGSVVQALA
                     DAKPDAIFNVLFSVDLGKFVREGNTRGLFKDRAVVGLLSGEPEYLDALRQEAPEGWIV
                     TGYPWYGIQTPEHQAFLKAYEAKFKDYPRLGSIVGYNAIQSLAAGIKKANSTDTEKLI
                     AAFKGLPVNTPWGTITYRAQDNQSTMGAFVGKTTYSQKMQRGIMTDFYYADGKDYQPS
                     DEAVKKLRPASAQ"
     CDS             149421..151328
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003810078.1"
                     /locus_tag="CT3_01240"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BBL22669.1"
                     /transl_table=11
                     /translation="MSASGLLAQLLNGLASASSLFLVSVGLSLIFGVTRTINFAHGSF
                     FMLGAFMAFSSVEHLAPHIGFWPALLLAPLACGLLGALTEMLLLRRIYQAPELFQLLA
                     TFALVLVIKDAVLWLWGPEELFGPRAAGFEGSVEILGRQFPAYDLLLIAVGPLVLLGL
                     TLLLAKTRFGILVRAATQDREMVGALGVNQAWLFTAVFALGTLLAGLGGALQLPREPA
                     SLEMDMLTIGAAFVVVVVGGMGSIPGAFIAALLVAELKAICIWLGVQEIGGVEVSFSK
                     LTLVVEFLVMAVVLVWRPWGLLGKPQALARSGGEPEQPLRAPGRGASAAWLGLVAALV
                     LFPLAAGDAGSYATVLLTDIFIAALLAASLHFIVGPGGMHSFGHAAYFGLGAYGAALL
                     VRQLDLPMAAALLLGPLVAAGGALLYGWFCVRLSGVYLTMLTLAFAQISWAIVFQWDR
                     FTGGSNGLTGVWPPEWASQGATFYWLALAVCAAGLYLLRRMLFAPLGFALRAARDSAL
                     RADAIGIDVRRVQWTAFVIAGLLAGLAGALFAFSKGGVAPDAMSVTKSVDALVMVLLG
                     GVQTLAGPVVGAAAFTWLHDTVARNTEYWRALLGGIMLVLVLLFPQGLSGFVQMLWAR
                     LVSRKVQGAAA"
     CDS             151325..152086
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003810082.1"
                     /locus_tag="CT3_01250"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL22670.1"
                     /transl_table=11
                     /translation="MNLLQVTNLSKAFGGVQAVQNVSLALQAGELLALIGPNGAGKST
                     TFNMVGGQLAPDSGQVLLNGQDITGLPPRAVWRRGVGRTFQVAQTFATLTVSENVQMA
                     LLSTDRRIFHWWRRATAHRRSDALALLAQVGMDAQADRPCSELAYGDVKRVELAMALA
                     HNPQLLLMDEPTAGMAPGERVALMQLTRQIARQRRMGVLFTEHSMDVVFGQADRVAVL
                     VRGQLLAEGTPQAIRADARVQQAYLGTGLVLEKQK"
     CDS             152092..152868
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003810083.1"
                     /locus_tag="CT3_01260"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL22671.1"
                     /transl_table=11
                     /translation="MDSGSAATHGALRTDPSTPLLLQVDGLHAWYGAAHILHGVGLSV
                     GRGEVVALMGRNGAGKSTTLKSIAALVPRREGKILFRGEAIAHQASHQIARRGLGYVP
                     EDRRIFTELTVRENLEVGRQPPRSWPDGTAVPHWTPEKLFALFPNLGEMPDRLGGRMS
                     GGEQQMLSVARTLMGQPCLVLLDEPSEGVAPLIVEQMARTILELKAQGIGILLSEQNL
                     PFAEVVADRAYVLEKGQIVHHSSMVALAGDAAVRQQYLGV"
     CDS             complement(152865..153803)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038319.1"
                     /locus_tag="CT3_01270"
                     /product="transcriptional regulator"
                     /protein_id="BBL22672.1"
                     /transl_table=11
                     /translation="MNSLERMHIFTRVAELASFTQAAATLGLPKASTSTAVQQLEAEL
                     GTRLLHRTTRRVQLTQDGQAYYERCKDLLADVDELQSMFQHADRGGLQGRVRIDMSTG
                     MARNVVVPHLPALLDQHPGLNVELSSTERRVDVVREGFDCVLRSGAVVDQSLVARPLG
                     MARLANCVSPAYVQRYGRPGHLHELDRHRLVHFVNTLGAASAGFEALVDGRLVQRPMA
                     GAVTVNNAEAYVSACRAGLGIIQVPRLGVEDLLARGELLEVLPHHQAPPMALTLMYAT
                     RRHLPRRVRVVMDWLAAVVAAHLAADTGEAPVRPAD"
     CDS             153908..154693
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705962.1"
                     /locus_tag="CT3_01280"
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="BBL22673.1"
                     /transl_table=11
                     /translation="MTALTALTTTTTPIALITGGSRGLGRNAALQVARSGIDVILTYR
                     SQAAEAHAVVADIEALGRRAVALPLDVSDSHSFAAFALQVQAALAAHWQRERFDFLVN
                     NAGVGIHASFMETTEAQFDELVNIHLKGTFFLSQKLLPLMNDGGRILNVSTGLARFAL
                     PGYAAYAAMKGGIEVLSRYMAKELGARGIAVNVVAPGAIETDFGGGAVRDNAQLNAMV
                     ASQTALGRVGQPDDIGGVIAALLQPGCSWINAQRIEASGGMFL"
     CDS             complement(154740..155372)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01290"
                     /product="hypothetical protein"
                     /protein_id="BBL22674.1"
                     /transl_table=11
                     /translation="MRLCRRCAALLLIAGAGLAACRLGGAAPLQPFLAQLSAQAQAGD
                     LLFRHGTEAISQLVRSVDAGDFSHVGLLVAPASPSGPWRVVHATPSEKPGQPDAVVLD
                     TLDFYLHPQRARSYQLYRVAASATARQQAVDWALGQQGRAFDLLDAERGLYCTTLVWQ
                     AWRHGGVALEATFTEVMLPLLSGHYLLPDGLRRAPQLQALTPVLPVVPAP"
     CDS             complement(155369..155800)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01300"
                     /product="hypothetical protein"
                     /protein_id="BBL22675.1"
                     /transl_table=11
                     /translation="MSVSVPVSRRRCLLAGVAVFSALNLAACATAPTEAESQDALIQR
                     FYRLVADGDFDRCIPLVGARNISKEALAGFEDKLRRMLAGAKAKIDSKGGLQQVEIVE
                     RVPSEDGQFTKLRVLVRYGDGNTRRERMNVFQEDGVWKVLL"
     CDS             complement(155981..157051)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114723.1"
                     /locus_tag="CT3_01310"
                     /product="hypothetical protein"
                     /protein_id="BBL22676.1"
                     /transl_table=11
                     /translation="MTPSLPDWMARLGLQHPLIQAPMAGTSTPQLAAAVSEAGALGSV
                     GIGAYSVDQAQQHIAQTQALTQRPVNVNLFCHQQAAADAEREAAWIRYLAPEFARFGA
                     QPPSQLRSIYATAVGNAALQAMLLAHKPAVVSFHFGLPEPAFIAALRAAGITTLACAT
                     TLDEARQIEQAGVDVVVAQGMEAGGHRGAFVPEQDRLMGTFALTRVLAAHCRLPVVAA
                     GGIMDGSGIAAALELGACAVQMGTAFILCPESAASPAYRAELQSERAHHTAITAAISG
                     RPARGMANRLHLLGADYAGDLPGYPMVYDAGKALHQAASAQGHSDYAAHWAGQGAPLA
                     RALPAATLVQTLVQELAQARQA"
     CDS             complement(157088..158278)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088680.1"
                     /locus_tag="CT3_01320"
                     /product="MFS transporter"
                     /protein_id="BBL22677.1"
                     /transl_table=11
                     /translation="MIHRHELPLFFTGFAATLSGVGLARFAYTALMPQMVHAGWFSGE
                     QVAYLGAANLLGYLVGALAAAPLAERFGTLRVLVACWLAVAFSFAACGQAQPMALFFV
                     WRLVSGIAGAVLMVLGPSVAMAATPVQRRATLGPLMFCGIGCGALLSATLVPALAATS
                     LSLVWWALAAVSALAGWGGWRQARRLPAPAPQALSPQAGIPLRSAPLWTVPVLLVMLA
                     YTCDAFGFVPHTVFWVDYLARELHLGAAYASTQWAFFGLGAIAGPLAAAFCASRWGWW
                     GTTTSAYAIKAAAIALPLVWASFAGHATSAFLVGALSPGMAAITSGYLMQLIGPLQHK
                     KMWGYATAAFALMQAVSGYFMAWMYAATGVYQPLFAIGSAVLLAGTVMVVASRWARPV
                     PVAA"
     CDS             158414..159349
                     /codon_start=1
                     /gene="oxyR_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207332.1"
                     /locus_tag="CT3_01330"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL22678.1"
                     /transl_table=11
                     /translation="MQLKSLRMFEAVCESGSFGAAAQLLHTVQSNVTAHIKKLEDEAG
                     AQLLERSAPVHPTPAGRLLRRYAQQMLQAHDEALALLQGRQAAPGALRIGSMETTAAL
                     RLPPLLAQLHQRHPGMALELRTGPTASQLAELLAGQIDCAFVAGLPPQARLTGWPVFR
                     ETLVLVGVAPLAAFPTPEQLGSTPFLAFRQGCSYRQRIELLLASQGITAVQIMELGTL
                     DAILGCVAAGMGYALLPQALIAAQQQRFGVHWCPLPPALAGIAQVDTCFVTGPQASWS
                     PALRAMAQLLQEVVEPVAGAKEALVAAPVAEPQWA"
     CDS             complement(159503..160138)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01340"
                     /product="hypothetical protein"
                     /protein_id="BBL22679.1"
                     /transl_table=11
                     /translation="MLGLKSKIPEFARPALEALREPLETGRIQIARAAQQADFPARFQ
                     LVAAMNPCPCGLQGNPRCRCTPDQVARYHAKLSGPLLDRIDLQVEVPALAPAELLQRS
                     EPGSAAAPAESSAQVQARVVQARHLALQRQGHANQWLEAATLQQHLQLDDAAQALARK
                     AAERLGWSARATHRALKVARTIADLADSPGIQAAHVAEALQYRRAIVRPHP"
     CDS             complement(160198..160962)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01350"
                     /product="hypothetical protein"
                     /protein_id="BBL22680.1"
                     /transl_table=11
                     /translation="MHESDGTLASLQLKESRPRQSAPALAFSWSSLAKATAAAIGATA
                     TAFNFIGQEAYARYLAHWGFDDGLLPQETSDRVHHGYMAVFESIHTLLNGQFGAFLLL
                     LIFIVCFIQGWLTSLMKKSPPRDTSAGKWLKRNADRLPGAFKSFFAAFGTSGLIVVLL
                     YYVVLAAFVALAVAPIIGEHAAGKWAEKKEGEIKNGCQRNSKHSVCTELTRDGKVVGI
                     GFIIASSTTRIAYFDITANHGRLIKFEDGELTGWMP"
     CDS             162173..163168
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01360"
                     /product="hypothetical protein"
                     /protein_id="BBL22681.1"
                     /transl_table=11
                     /translation="MILHVVSNEEFDPAPAQVVQHAGFFLSRILDTDVAPVYQFKEVS
                     RSRERLEEMAQGAITFEHGAQELSREFSREHGNTARDGAFFIFELRTDDEDVRIYSLI
                     KYDYREAIEQADDGDGETLLRKIVHAFIDDKKAIQKAALIRVVDGQAEPLLATRDRTR
                     VAPEIADYFAKFLDVHRISSDEALNRKMVDALRETFTECKDVLPRNDVPLALRRAKAV
                     LRDRQEIDEDAIVDAVMAAAGHPEQEDTKDLLRKRTMQKLRAKRLAGLSFRPDRVLLR
                     KAPMRKIRTTEGVTILYPDRATKVRRVVNPGGAGETITITTDLIVEDIVVADNTR"
     CDS             163182..164678
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01370"
                     /product="hypothetical protein"
                     /protein_id="BBL22682.1"
                     /transl_table=11
                     /translation="MVVDHAVCIDESDNSAIVSNLAAEHVAELQAICVALTWGAQLFD
                     SAGELFEGEPDSNFEPFLLVIDKPASADSTVQLLTNRAFSKLLLEGHEASIWKVAQIE
                     CTLFTGTRVIAPWSVNHVAEIAEVTKSPRALVKEFGGERKVPEDVRPWLVKAQPENFD
                     DPSTQVWVRASSIALIRCLPSEIDAETEALKFRGPPRLAIPEFDAEKDSLDPETYKTL
                     VDAVTWVFENQREAEMRHVLLAAEIARSGSTIQSAGAFLKQNLADAWESAKIAYEMAV
                     AETGRDTLKVLSDLRKAVTEETAKLSDMGRQLNAAVAAALATGIGLMAARVATNAPPL
                     LIAVVMGVVAIYIATVIHSGVQFMRLQRQLREDWQQRLYRFLPETEYEKMVVKPTRHA
                     ETAFTWTAWLGGIAVVVLTVACVFWAFKNEVKTPDNTKETISEPSPHRDPQDLDQTRD
                     GMSHNKPPTAVVPADSAGHPTDTFLAQPATGAAKTDAPMPTPPPLTEP"
     CDS             165947..169762
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01380"
                     /product="hypothetical protein"
                     /protein_id="BBL22683.1"
                     /transl_table=11
                     /translation="MNEYSESWLHLKALIGSYGRGDLNVKAPSYKDQRHARALSVFLI
                     NAELATPRLNRKTVKAILEGGFQWPQVGGTKYLGTDIPLSRFEQLGLVSFYADWCAIH
                     ASSVNDESAIDPTLIPVIRTIEHLRDIKLGRNGYLRPHYACGERELRKLLQIEFGDCF
                     LIEEILPELELECGKFRLIPGNQNFSIEISTQLWNDLRDYHEPEDAFIRWIMFFCVNC
                     DRVMPVVFDGDQYKERIEFNEQLLKFLAKDTDLCASLDCYGRQSINEESFAYLIRPTE
                     ENIQIYIDLNGERSTSTTPEQALSRPSLSSLEDIYPSPLGEASSALEFVIHSKNMRIR
                     GREFFYSWLVSNVVEASVRIEIAHLASSGLVEKLVDMANDKRPVLKYLLYFILPNYEL
                     PKYMLLLLAGNKTSDVAFFHLSTRSFDRSQGPGTAHIQCLENGYQQLLCHEYVQAIQN
                     RPDFSSRFIAVVTMLGERCILHSPDFFKEIGYRLLLTILESLADKQVTEIAQRFAETR
                     FDEDVFSCEKTCLHCRYLVGFWLIDRLKKTGADPSETIRDAVRESLREQYKKEFVSNL
                     KGMKSLAPSSFFSTLSWKQIFIGVGQDFMLELSIECNEWAQSLVHKDEKSVAVADAIR
                     HYLQILMHVGRTSVEISVKQAVASRVMEIIWLCGFKDRKRYVQIFEGPRSGNFDLWKQ
                     VCIYSNSVSDVMYEDFIKRCAPHMPLTHLFALLERTPVIARQNLLQNAIEKHCENTDY
                     GIDMEAMEVAFNAAINLGQTEIASRIISSAKKIISQDRFTKSTNSYLVRIRKIWQSYE
                     YKFHLLMLYEEHKEDPLKFEELAKTYQIPHESHFDSEDKVHHDDCRIFRRQITATAFS
                     DSKPAKTISYMKQLYMETKREHHGFLILYGHVKLFAREKKKTDLKNALATFLATSGKG
                     HPDQMKDYWVATVLEAYQLSGAEGVDGFWAQLSAEQQEHIRIFTPYCRALLARGDSFT
                     VQKILARYREINHASLEKLEIEDLVSELTSIEKDGSSIKGFLSIMAEKSQRTDEQLQK
                     HYNQIIAKDFAGYVAVVKPSQAVHEYLRDAMLAIANELTLRKRNLQEEGKDEKGKFSF
                     KGIKLENLVNDWFVSLFDQRMSHAKLSLRDQKRGGHSASGKGPGEIDGFITSSDGSRV
                     GIFEAFRLLSFDTTTIRGHLNKIAGYDGESLSPVVIVGYCDVTDFSKLVESYKSYVST
                     LSYKGYMPLEGALGELTVSHDFEHVWLGSETRRRGRKDIVFYHLLINLHFSPPVAATG
                     SDGLCYAGT"
     CDS             170563..172161
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01390"
                     /product="hypothetical protein"
                     /protein_id="BBL22684.1"
                     /transl_table=11
                     /translation="MAASAFQEWAVIRLAVVQTRGCKGRLLFATVTELARGRPAPAKM
                     VGVEACSLANSDDRVFFRRTVLSKEDAVAWYTSLGEGERCTPVPTHPDHREGSDGVPF
                     LVPRLQDDQPWPALGLPITEELFSRPGQQALDAAPFIGSVPGRVHRRFGHHEGLDAFL
                     RDNAAQAFVARRMHVNLSEYQEYLGSAAYIAPDPIIRQIDNFMAPAKDDRGERIIYRF
                     VPRPGQNLEHLRLTTFDKEARLLTSFDTHHVPADGILEVAKGTCSGQYGYVVTHEQQG
                     ILAYQPFVGFIRQMNFSVQVAPRKSVRVRVPTTSAKDAPPMEYQAAVEQEEASRSILG
                     EVTSPDPGARVAAEARRRERIALAKQYGQRWFHDNSREEAADFVRGLLRAARFRVVLV
                     DPYLGALQLGQFLYVIYGSEVNVTLLTTALAFEATATESKMHQLQIFSKHLADLKDIQ
                     RLEPEVRVVPASKLHDRFMVVDDEVWFVGNSLNSLGVKASMIVRLPNPGEVIDRLEVL
                     RLDAPSLANYIDVVGRSASGQSPE"
     CDS             172158..172781
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01400"
                     /product="hypothetical protein"
                     /protein_id="BBL22685.1"
                     /transl_table=11
                     /translation="MSSFGSPVALAPAAPRPPAEILWACENGGTSRFPGDIATIYARR
                     QSPSPRHLDAFQVAVREAQTRVWMLDEYLFLPDKGKGSPDDRILTILDWLHVDIVAND
                     IKILTGVHQEVSEADLRLFKDRENDINKKLARRGPHCSITVSTHLSRVFDIHDRFAVI
                     DDELWHFGATVGGFHTSVNAASRGWPAGAVGAIEFFELAWTMSEGKT"
     CDS             172778..174802
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01410"
                     /product="hypothetical protein"
                     /protein_id="BBL22686.1"
                     /transl_table=11
                     /translation="MTTHWIRERIRESEESQTHNSFRSCDDFLGLAPQLNARAPQLLA
                     EVAAAIGPVDDSAGVEALRTLAAQRGPGFDADMVLTMACAILLSQRPDLSTWHMVRQV
                     AYHSWPVEQWLGEAMSAHRRVSAEAGEAYVTLAVLLFEALESGELEAMSERRNQDRKN
                     AREHWRENRSLEDIWWGLRGSDFMNFEEEMRVFGVLSEIDPAVFQRLLGNSQDPLLVD
                     AALLSAGVGAFTPRFAMWEACASAAPDAFAEDGSWNGSVLLPLLLLRARDELLEPGRQ
                     IPRFNANQAEVASLTSEVDALVQAVVDVLAQRTDAPGVFARWSTWLMRQQLRQRNQDP
                     VDIRSSDYVDKALVVRLGRAVLDRGLVPAPPADAAPWEAWCYQCVLSMLANESIGEPP
                     PFAAFADQWQLTPEDWHQQKGRDLLARASTRLPSDEIPGLFANLLVFPLASRAGFAAG
                     WLRLWNSAHYLREVLEFGSFDADEKVYSDRSDASSLLLLLGCMGLGCFDQAASRLGKD
                     DQVEAGELVSLHRILTSAAMEISQLDDTLHRDRWQTILQHLALRRIYGDERVAGTSRA
                     AVFAPGDETLIQAYMQYFQADPGELIAFLHASMSNRFDAAMLRDELQGAAIDLRACVA
                     NLQRLHDLNDRRYPLRADALQAIAPLMPTVHRPVQPVLAIMPGRSGPSHF"
     CDS             complement(175178..176959)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:D3H9L7"
                     /locus_tag="CT3_01420"
                     /product="DNA helicase"
                     /protein_id="BBL22687.1"
                     /transl_table=11
                     /translation="MFVWDATELNPEQAAAVEEPSSVFLVACPGSGKTRTLTYKIAYE
                     LSRREDKRIVVAITYTHRAADEIQERIEALGVDTTALWIGTIHSFCLEWIIKPYGIYV
                     PELARGYTVLDRHDREKMLERLCAQYRGVTLYDCDYYFEGDGYRLGCADTRKHDSIHE
                     VLAAYFRELADTRRIDFELILWHSQVLMRSLPYIPTVLSQVFSYVLVDEYQDTKQIQY
                     NLVGAILRAGAGSTKTFIVGDPNQAIYGSLGGYAISVSDFRALTGIPIREMALRLNYR
                     SSARIIGHFSNFNVHATDIEGAGRMVGFPSHVSYNRLVTHGNLHDELVRLIQKSLAEG
                     HAPEEICVLAPWWILLASTTRKLVALLPDQQFDGPGLVPFSNDPDNFWFKLSKILLTG
                     SSPQMLVRRMRWARDVITDLRDFGVDTTSITQRSLLRESNSLNITETDGLAYLDQTFT
                     ALLNRLGIELRAFPALVEHREAFFASSQARLDRLQSSGASYITDLSFFKKVFRERSGI
                     TVSTIHGVKGAEFDVVIAFGLLEGMVPHFSDSDGDVAAHKLLYVLASRARKHLHLISE
                     AGRPRGRSGSYEPTEVLIRCDFHYNRY"
     CDS             complement(176959..179097)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000470932.1"
                     /locus_tag="CT3_01430"
                     /product="ATP-dependent endonuclease"
                     /protein_id="BBL22688.1"
                     /transl_table=11
                     /translation="MHISKLTLVNYRNFKSTNLAFQRGVNTIIGENGAGKSNILRAIR
                     LLLDDNMVRAAYRLEESDFNRALGQWKGHWIIISMEFENLSPDEAVQALFLHGTAGIH
                     AGPISKATYNLIFRPKKEIRLKLAALEDFDNAGLKAIRDGITIDDYETIFTGRSSADF
                     GDPATYQRIVGNFDVCSFSGETDFPEIGAKVPGFLSVTKEVSLTFIQALRDVVAEFHN
                     NRTNPLLTLLRSKSGEIDAAALVPIVDKVRDLNGAIEGLEDVQSVRKHIRETIKETAG
                     ETYSPTSLSIRSDLPEDAEQLFQSLRLFVGESEDGYEGTINELSLGGANLIYLTLKLL
                     EFKYQREKMAIANFLLIEEPEAHIHTHIQKTLFDRIAYEDAQVIYTTHSTHISEVSNV
                     SNVNILGRRGSFCEAYQPATGLDPAQVTSIQRYLDAVRSNLLFAKSVILVEGDAEEIL
                     IPALVKKVLGLSVDELGLSVINIRSTGFKNVAVLFHDTRIRKRCAIVTDLDTAFFNTT
                     PNPADDDARVARKRKAIGSQTAGAQRKVDLDAFSAGNAWVQSFYAKHTFEVDLVGSGN
                     HEAFVRSVDKVYKAPATITQAITDLRSGQIHQSGCRTLTMAEQEGKGWFAILLAQTLD
                     HQAVVPDYIREAVLFAHGPFSRPLIMRILRHRMNCLWGTDHSARPGLTLFNSEVERFG
                     CSEIDLVTLRTAAIAALPGDVIHVFLAGMT"
     CDS             181216..181560
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01440"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBL22689.1"
                     /transl_table=11
                     /translation="MLEAAGVKVWFSEKDLGLEVPMMRAIDKGLAASKIGLVLVTPAL
                     LARLPKEGVADKELSTLLQGNRLVPIVHGTTYSALRDVSPMLASRSGLDTSEDSMAVV
                     ATKVAELVSIWS"
     CDS             complement(181784..182146)
                     /codon_start=1
                     /gene="bprA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004187356.1"
                     /locus_tag="CT3_01450"
                     /product="DNA-binding protein"
                     /protein_id="BBL22690.1"
                     /transl_table=11
                     /translation="MTSPKREPYAQLSTRNSKLSNKGTPNMSTYKSLLQQKAELDAKI
                     AEARKHELAQAVTQARELVKQYGLTADDVFGGKKVSTGARAAVAPKYRDPATGATWTG
                     RGKPPKWIADQDRAAFAI"
     CDS             182600..182974
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011390973.1"
                     /locus_tag="CT3_01460"
                     /product="hypothetical protein"
                     /protein_id="BBL22691.1"
                     /transl_table=11
                     /translation="MAAVPKVKPNPEVVLSKATLNAAMQLGLNNAELAKVLGISEPSI
                     SRIASGSRHIDPHSREGQTALILVRIFRALDLLVGGDSSARNAWMTSHNKVIASVPKA
                     AIQTVPGLVHTIDYLDGMKGAA"
     CDS             182971..183699
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01470"
                     /product="hypothetical protein"
                     /protein_id="BBL22692.1"
                     /transl_table=11
                     /translation="MSGSQVWGDSWFGDTGKHLEMPAAWRGILTEYFSASLKLVDDAD
                     ELQVLEELLGATTPTLHSHQEDKHPQVLAPFNFRPKHASRFRVADRSGFWYGASTLDA
                     AQFEVAYWRMLFIRDSAGLRQSELLTDHSFFQINVAGHGIDLMAQPWSEHRDIWRHPN
                     DYTATQALAEAAEAQHIEWMQYESVRAPHAALAVVFTPNALHGTTHDMNVSLQEWTCK
                     TNRDRVVFVNRSSGAVMAWTIDGD"
     CDS             complement(183927..184385)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01480"
                     /product="hypothetical protein"
                     /protein_id="BBL22693.1"
                     /transl_table=11
                     /translation="MFLTNDTNKSSLSSLFGDSQNLWSGAELQIRIFWFLVEFEASNQ
                     DDVDELKMISTLLLSRPEHVLGLVQQGVKILSVYLMIPLPSFEGGGWDMARLKEIWEA
                     VEPAAPRMKAKIYATADGFHFVESKLGTTVNEFKDRELLLRCPAVTTKSA"
     CDS             184466..184777
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01490"
                     /product="hypothetical protein"
                     /protein_id="BBL22694.1"
                     /transl_table=11
                     /translation="MLHARDSQRVPSVSDITFRQAVAAEVKARRAQIGISQEELAFRA
                     NVHRTFVARLEVARTQPSLSVVFQLADALQVSPEDLVKAVRQRIVRAINGTTAQQRLP
                     S"
     CDS             complement(185259..185588)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01500"
                     /product="hypothetical protein"
                     /protein_id="BBL22695.1"
                     /transl_table=11
                     /translation="MFVALIEQHDFESPSDLRRAIISVKDIKQQLQQWTGHLSLSSLD
                     RYIDLAFSEIEQVGTNRSVIDLHAELEALRAAVNRIGSSSLETSPDLAAQLLALANEK
                     ILPKTPK"
     CDS             complement(186625..187164)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01510"
                     /product="hypothetical protein"
                     /protein_id="BBL22696.1"
                     /transl_table=11
                     /translation="MSVTPREASTLALLSAMEAAYAQPSAEQHQGIHSYLHSQATLAK
                     YSDQLNGISACSLNTLKKSCSVIPGGFNALDMARRRALAALENNAGAAQQDDSGSKRI
                     LQLRVKSLKDQLQASTEDLLLVHRLLERALRHGRQYATDSRDASLIERCAQDQKEIRD
                     MLSLRQILPSHLHVVDESK"
     CDS             complement(187161..189239)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105146.1"
                     /locus_tag="CT3_01520"
                     /product="integrase"
                     /protein_id="BBL22697.1"
                     /transl_table=11
                     /translation="MNKKANAQELISRTLAYINDSPPVISPEWLFSDFEDKTWIIKLE
                     SISTLDFQVRLDDGSILTDEKNRPLIKFFKHFLLAQAHPQFTQGVHYANSSLKGRLDP
                     AIHICEYLVVRAEEFKLGRLGLSALPSSFSHRMLHEVSLYDSADSIYQFRTRLARLLK
                     QGAADLSQDDLLRATSEVPNIAQSGGCDQLELSEEEIQNARAWLWINGYYRGAAYEGG
                     RRFVPDTTLLSELLYPAGVLRSKWTKPVIDSLVIGYGPLLFREIKGVPVRGVERAESI
                     TRYYIRALHAAVWLRKFDISVPHGFTEVLSDRQFAQQLPLAGVGRYTTLPYTVALRAL
                     RCAVEFSLERVPLLLKAYTTIAKHAAASKSTMTMAARELVASDHPDLSAAGIKCWSIS
                     TELRAERSQGLAKKSKQIEETFFREFRRGSGLYELLQVLWGSLLIAIGAIMARRQGEL
                     LDLMAGDIFDESRTRLKFLARKRNVGELRERIIRPVPEIIVRFISNLENLQKDFIELG
                     LIKNYIQLLSFPSLHHPRFIECDNESCNITLDRFCDFFEIDKDSTGRRYYIRQHQLRR
                     FFAMLFFYGNSFSSLETLRWFLGHTDAKHLYHYITESTPGEVLKSVKVDFAVDRLRQA
                     DASTENLAAILNERFNSTAIQLLDNDELAGLISELMEDGSVTIEPHFFEGHSGQEYVV
                     MIQVERKSTL"
     CDS             complement(189232..190656)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01530"
                     /product="hypothetical protein"
                     /protein_id="BBL22698.1"
                     /transl_table=11
                     /translation="MYTKLLTQIPLELSDDEAFELIFKRIKNDLNQIKNWAWAEVNRR
                     AELLARRKQLSKLGTPRQICPNLSLPANRGGTTNWSHVNHLANAAATFEQHGYPCSGH
                     DSRLSMLLFPPPRAKWAEELAIPTTGYLIPHCAVIVGEHPSVTTAFLENLKLFDSDGR
                     MIGLKQTDNGYVLIGAKMRRGPDLAMQEIHLNSNSFFAVDQIIQLTEPLRNFLREKKD
                     NNWQYLLINSSKAFGYPTRSKRLSADVSTPHGTQVLAASFASVLGLSDEEAMDLALRF
                     SLSSLRASAATQVYFETRSVQAMSTALGHLKYDVTLLQRYLPSPIRMFFEERWIRIFQ
                     TGIIVEALSGSKYQLEASGFSSIEELHLFLTKNVLRLPPKETTSLNTNIDEILDIGSL
                     SSPREAIFGLNTEILTTLISLDLATKSCDRPLQPKAQYWAAVTKELIPYVERAGSYRP
                     DILHFLAEARAKASPKLVERLAYE"
     CDS             complement(191663..192592)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01540"
                     /product="hypothetical protein"
                     /protein_id="BBL22699.1"
                     /transl_table=11
                     /translation="MGLASVRSRALVGMHAQPIEVEVHLANGLPCLTLVGLADTEVKE
                     ARERVRSAILNAGLEFPHSKRITVNLAPADLPKDSGRFDLPIALGILAASGQIDPAQL
                     ARYEFAGELSLSGALRPVRGALATALAMQLHREGTPLVLPQDSAREAALVPGTTVYGA
                     AHLLEVVRALQPQATEGLPLAEAIAPAAAPAGPDLADVQGQASAKRALEIAAAGGHGV
                     LLVGPPGSGKSMLAQRFAGLLPPLTALEALEAAAMASLAGPFDAGTWGQRQIAAPHHT
                     ASAVALVGGGSPPRPGAISRAHHGVLFLDEWIF"
     CDS             192860..193198
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198020.1"
                     /locus_tag="CT3_01550"
                     /product="nitrogen regulatory protein P-II 1"
                     /protein_id="BBL22700.1"
                     /transl_table=11
                     /translation="MKMVSAIIKPFKLDEVREALSQIGVQGITVTEVKGFGRQKGHTE
                     LYRGAEYVVDFLPKVKLEAAVDDAVLEQALEAIESAARTGKIGDGKIFVYDLEQVVRI
                     RTGETGKEAL"
     CDS             193225..194589
                     /codon_start=1
                     /gene="amtB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8PDZ7"
                     /locus_tag="CT3_01560"
                     /product="ammonium transporter"
                     /protein_id="BBL22701.1"
                     /transl_table=11
                     /translation="MKKTLPALSLGLGLLTAAAGALAQEAAPAVAAVAEAAAPAAAAA
                     AEAVPTLSAGDTAWMLTSTMLVILMTIPGLALFYGGLVRSKNMLSVLAQVFVIFSAIT
                     VLWAIYGFSLTFGGEGTFFGGFDKLFLAGITPDTLSSALKTIPEYVFVAFQSTFAAIT
                     VSLIVGAFAERIKFAAVMLFSILWFTFSYIPMAHMVWGGGLLAADGALDFAGGTVVHI
                     NAAIAGLVGSYMVGKRIGFGREALPPHSLTLTMVGASLLWVGWFGFNAGSAGAANGIA
                     GLAFINTILATGAAAVSWIVAEALHKGKASMLGAASGAVAGLVTITPAAGFVGPMGSI
                     VMGLIAGPLCLWGVSGLKRMLKADDTCDVFGVHGVGGILGAILTGVFCASSLGGVEPE
                     GFNMAHQVWVQFKSVVVTLVWSGVVAAIAFAICKVTVGLRVSEEAEREGLDITSHGES
                     AYQR"
     CDS             194963..196078
                     /codon_start=1
                     /gene="glcE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004194396.1"
                     /locus_tag="CT3_01570"
                     /product="glycolate oxidase subunit GlcE"
                     /protein_id="BBL22702.1"
                     /transl_table=11
                     /translation="MEPALSQIIERVRAATPQALRIQGGGSKDFLGLELRGEALDVRP
                     LQGIVEYEPSELVVTVRAGTPLAALEQVLAERGQALAFEPPHFARQGRQATVGGMVAA
                     GLSGPARASVGAVRDYVLGIEILNGKAELLRFGGQVMKNVAGYDVSRLMAGSWGTLGV
                     ITEVSLKVLPVAPAEATLRFDGIGQADALKQLNTWGGQPLPLNASCWLQDGGTGTLYV
                     RLRGASAAVDAACRSMGGTRLDAASTAADWAACRELQLPWFTARAADHCLWRLSVPQT
                     APELALPTGTAAPLVEWHGGLRWVQAPRSAGAALKAAARAVGGDALLFSAEAAQPLSG
                     EPLFDPQNAAVQRIQQQLKTAFDPAGIFNPGRTSAAL"
     CDS             196113..197360
                     /codon_start=1
                     /gene="glcF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63R29"
                     /locus_tag="CT3_01580"
                     /product="glycolate oxidase iron-sulfur subunit"
                     /protein_id="BBL22703.1"
                     /transl_table=11
                     /translation="MQTNLAPEYRSTPEGQEAEAILRKCVHCGFCTATCPTYQTLGDE
                     LDGPRGRIYLIKQVLEGATPTRATQEHLDRCLTCRNCESTCPSGVQYGHLVDIGRKVV
                     DEKVPRPLGERLKRWALKEGIPSPLFAPAMKLGQAVRPLLPEVIKAKVPPKTEHGVWP
                     TRAHARKVLLLAGCVQPAMLPNINYATARVLDAVGIQTVIADKAGCCGAVKFHLNDQD
                     SARDQMRANIDAWWPAVEAGEVEAIISNASGCGAMVKDYAHALRDDSAYAAKAQRVSA
                     LARDLSELLPALLPELADKLAGRTKVPAQPMAYHPPCTLQHAQKLKGVVEANLGKLGF
                     QLRTARTESHLCCGSAGTYSILQSDISQQLRTRKLDALDEAFEGGAPAAILSANIGCI
                     THLQAGTAVPVRHWVEVLDEALV"
     CDS             197512..198279
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01590"
                     /product="hypothetical protein"
                     /protein_id="BBL22704.1"
                     /transl_table=11
                     /translation="MTEIVSSLPETPASDAAAAQPAQADGARRRNRRGGRGRAAAAKG
                     AAPQSAAASARPVREIHPVLLQLAQLYPALFGDSPKPLKRGIFQDLQVAQGEALDKDG
                     LKQALALHTRSTRYLNVVATGAARCDLQGVEVEAMAPEHVLHALIEVFRRKKPRDGED
                     LQAKLQRRIGQAFIDSGLGRDAYLEKVQLREPSALAKVEAALAVVAEQDAKAEAVLRA
                     FEGSGAETVDAFADMYGMNTQQVQRQLHRARQLKAQA"
     CDS             complement(198376..198876)
                     /codon_start=1
                     /gene="bsaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WFT3"
                     /locus_tag="CT3_01600"
                     /product="glutathione peroxidase"
                     /protein_id="BBL22705.1"
                     /transl_table=11
                     /translation="MTTLHDFQVRSIEGDEHDLGQYAGKVVLVVNTASACGFTPQLAG
                     LQQLYERFGPQGLVVLGFPCNQFGHQDPAHNSDIAAFCQKNYGVEFPMMAKIEVNGEA
                     AAPLFVWLKEQAPGLLGSKAIKWNFTKFLVGRDGRAIRRYAPQDAPVTLGGDIEQALA
                     QAPTAA"
     CDS             complement(198924..199811)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004556463.1"
                     /locus_tag="CT3_01610"
                     /product="hypothetical protein"
                     /protein_id="BBL22706.1"
                     /transl_table=11
                     /translation="MHSPAPYFALLFNAVVWGLSWWPFKTMHAAGLAAPWATSLIYAA
                     LVLGTTLLAPRSWAGLLAHPALWLLALSSGLTNVAFNTASSTGDVVRVILLFYLMPAW
                     AVLLAWKFLGERPTPQGLLRLALAFAGMGLVIVPAGASWSSLTAGIALPDYLAVFGGL
                     CFAITNVVLRRTHSAPGTSRMLAMFVGCMATGLTTASLGYGLGALPGLPAPQTEWVLC
                     ALVMAVLVAVGNWALQYGAARLPTATTSLIMLSEVLFATVSAWLLGATELTPRMLLGG
                     ALIIGGALLAALQGRRRKA"
     CDS             complement(199882..201174)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004266648.1"
                     /locus_tag="CT3_01620"
                     /product="lysophospholipid transporter LplT"
                     /protein_id="BBL22707.1"
                     /transl_table=11
                     /translation="MKRGFYTIMSAQFFSSLADNALFVTAVELLRTSGAPEWQRAALV
                     PMFALFYVILAPFVGAFADALPKGRVMFISNAIKVAGCLMMLIGHHPLLAYAVVGLGA
                     AAYSPAKYGILTELLPPSQLVKANGWIEGLTITSIILGVLLGGQLVGPAVAAHLMALD
                     VPFVDNAAEAAIGVLVFVYALAAAFNLRIPRTSTPLVPMRQHPDQGLLAATLALLPDF
                     RDCNRRLWRDKLGQISLSTTTLFWGVSGNLRYIVLAWAAVALGYGTTQASALVGVVAI
                     GTAAGAVLASMRMRLQHATRVIPLGIAMGLLVVCMNFISHLWIAIPFLILLGGLGGFL
                     VVPMNALLQHRGHDLMGAGRSIAVQNFNEQACILGLGALYALATKLGVSAYGAITGFG
                     LIVAITMWLIGRWYRYNCRHHGGEVRRLLNIARHDHHH"
     CDS             201315..202418
                     /codon_start=1
                     /gene="dadX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F0KJB4"
                     /locus_tag="CT3_01630"
                     /product="alanine racemase"
                     /protein_id="BBL22708.1"
                     /transl_table=11
                     /translation="MPRPIQATIHPEALRHNLERARQAAPDARLWAVVKANAYGHGIE
                     RVFDAMRATDGFALLELSEAERIRQLGWRGPILLLEGVFDARDLELCSRLGVWHSVHC
                     DQQIDWLAAHKTQQPHRVFLKMNSGMNRLGFTPERFRSAYARLNALTQVEEISFITHF
                     SDADGPRGIEHQLQAFLGATQDLPGERSVCNSAATLLHGMEARVRNDWVRPGIVLYGS
                     APDYPLHTAADWGLRPAMTLSTQVIGVQQLQAGDSVGYGSTFVADAPMRTGIIACGYA
                     DGYPRHCGTGTPVLVNGVRTRVLGRVSMDMLNVDLTPVPDAGIGSDVTLWGTARNGTQ
                     LSIDEVAAAAGTVGYELMCAVAPRVPVVVEGAA"
     CDS             complement(202485..202994)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01640"
                     /product="hypothetical protein"
                     /protein_id="BBL22709.1"
                     /transl_table=11
                     /translation="MNTSALPSAVLDAMHNLTLAYRRQMRAALHAQALPLTANELKVL
                     LYVGHHPLCTHKDLVAHTGTDKAQLARLLQQMETHGWLERVPHPQDKRSRCLRLSAQG
                     AEAFTGLRNHRSSLGAQMLAGWSMSEQQQLLDLLRQMHSQLAALPLPQGEGDSLAHDP
                     SYNPPHLHD"
     CDS             203100..203912
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004532447.1"
                     /locus_tag="CT3_01650"
                     /product="siderophore-interacting protein"
                     /protein_id="BBL22710.1"
                     /transl_table=11
                     /translation="MPTTDIAATGSTIPDTALRVERVRHVFAAHHLQLQSREVVSPGF
                     VRITLAGADLTGFRSDGFDDHIKFLLPQPGQDKPNLPQMVDGRPHFDGERPVARDYTP
                     VRWDAAKGQLVLEFALHDHGPAAEWARTAQIGQWAGVAGPRGSMVIPAGFAWHWLLGD
                     DSALPAVERRLAELPATARVTVRLKVAAADRRPLPSAAQVDLQWVDDLAEAAAALPLP
                     SEDGYIWAAGEHNDMAALRTVFKDKGASLKRMRISAYWKRGQADHHEELVQE"
     CDS             complement(203938..204561)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706154.1"
                     /locus_tag="CT3_01660"
                     /product="glutathione S-transferase"
                     /protein_id="BBL22711.1"
                     /transl_table=11
                     /translation="MPHLTLFYAPHTCALATRIALNEAGADYQLQYVDFSQNAQRSGE
                     YLALNPLGRVPALRLEDGSTVLTETVALLAYVAQRFPDAHLAPTDPVQFARMQGFHSY
                     LASTVHVAHAHGRRGARWSDDPAAITSMQDKVAANMAECCALIEAHWLDRGPWVLGET
                     FSVADAYLFTIAGWLHGDGVEIAHFPRLADHYQRMQLRPAVRAALHD"
     CDS             204713..206098
                     /codon_start=1
                     /gene="radA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WEM3"
                     /locus_tag="CT3_01670"
                     /product="DNA repair protein RadA"
                     /protein_id="BBL22712.1"
                     /transl_table=11
                     /translation="MAKDKTIYTCNACGGTTPRWLGKCPNCGAWNSLIETVPDSASGG
                     KNRLSAPQGYAGLANAQPVTPLAAIEAQDVARTPSGIEELDRVLGGGVVEGGVVLIGG
                     DPGIGKSTLLLQAMDALQRAGLPTLYVTGEESGAQVAMRSRRLGIDGSQVNLLAEIQL
                     EKILATVEATQPAVVVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRMAKSTGVTVIL
                     VGHVTKEGALAGPRVLEHMVDTVLYFEGDTHSPHRLVRAIKNRFGAVNEIGVFAMTEK
                     GLKGVSNPSAIFLSQHTEPVPGSCVLVTLEGTRPLLVEIQALVDGGGPSPRRLSVGLD
                     KDRLAMLLAVLNRHAGVACADQDVFVNAVGGVRIGEPAADLAVMLSITSSLRGKALPK
                     GFIAFGEVGLAGEVRPAPRGQDRLKEAAKLGFTVAVVPKANAPKKAIAGLKIHTVERV
                     DEAMQIVRGLE"
     CDS             206288..206740
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01680"
                     /product="hypothetical protein"
                     /protein_id="BBL22713.1"
                     /transl_table=11
                     /translation="MNFRKFVVPVGLAILFYAAHRSYGWMGVAAVGGGTVMWLLLHFT
                     RLMTIVRRASNQPIGYVGSAIMLNVKLKPKVSLMHVIAMTRSLGQRMSKEGQDPEIFR
                     WTDGTNSHVTCEFVGGRLMKWTLQRPPQPEATATDAAQAPAALPPVAH"
     CDS             206919..207857
                     /codon_start=1
                     /gene="ilvE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004188924.1"
                     /locus_tag="CT3_01690"
                     /product="branched chain amino acid aminotransferase"
                     /protein_id="BBL22714.1"
                     /transl_table=11
                     /translation="MSPVVPSMSDRDGKIWMDGQMVEWRDAKVHVLTHTLHYGCGAFE
                     GVRAYDTAQGTAIFRLEDHTKRLFNSAKILRMQIPFTQEQVNQAQVDVVKANQLQSCY
                     LRPLTWIGDRKLGVSPKGNSIHLMVAAWAWGAYLGEEGMQRGIRVKVSSFTRHHVNIT
                     MSQAKAVSNYTNSILANTEALDDGYDEAILLDAAGFVSEGSGENIFVIKDGVVYTPDL
                     SAGALNGITRNTVFHICKDLGLEVVQKRITRDELYIADEVFFTGTAAEVTPIREVDRL
                     PIGEGRRGPLTEKIQNAFFDIVNGRNPKYTHWLTRV"
     CDS             207889..208098
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003814195.1"
                     /locus_tag="CT3_01700"
                     /product="zinc-finger domain-containing protein"
                     /protein_id="BBL22715.1"
                     /transl_table=11
                     /translation="MSTTAVVELAAKDLNAQGGVYCPSPKADMKLWNSHPKVYLDVAH
                     TGQAKCPYCGTTYRLKEGEVFAGGH"
     CDS             208082..208996
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012255989.1"
                     /locus_tag="CT3_01710"
                     /product="glycosyl transferase"
                     /protein_id="BBL22716.1"
                     /transl_table=11
                     /translation="MRVATDHILASDDSAPAERCFALDAVTAVIVTFNSAHCAEALGA
                     QLADWPHVIVVDNGSADDTPARIRAALPQAQVLELGENRGFGAANNAALHQVRTPFAL
                     LMNPDCAVMAADAQALLASMADWPHAAIMAPQLVGGDGGKQVNYGWVRHLWASKGPAA
                     EGVTCVGNACGAAMLLRLNAMPTRDWFDTRFFLYYEDEDLCLRLLQAGKPVLIEPSVH
                     VAHANRGSVRGPRPLSVEYGRGYHHARSKVLFTAKHQGHAAAIEHRRRALWGAVGLLA
                     LRVFAPSPKHVARVWGRVVGLWSAPVQY"
     CDS             209012..209785
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813226.1"
                     /locus_tag="CT3_01720"
                     /product="glycosyl transferase family 2"
                     /protein_id="BBL22717.1"
                     /transl_table=11
                     /translation="MSRLSIVVLTLNEAHNIEACLRSAQGVADQILVVDSGSQDATVS
                     LAQGLGAEVVAYPDWQGFGEQRSRALQHVRADWVFFLDADERLTPALADEIRQVVAGN
                     AEAVWEVEWEQMAYGQSLGRMRGTGGVARLFPMRVLEGFSGAVHEGAVLRTAVPTRHL
                     RQRLPHFSRETIYGSLVKLAQYVQLGALKRHQAGKRGGVLRGLGSGIANFTRLYVFQR
                     GFLCGRAGFLYSFFVGLECFFRYVALEVDRDQLKKPVRR"
     CDS             209850..211079
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01730"
                     /product="hypothetical protein"
                     /protein_id="BBL22718.1"
                     /transl_table=11
                     /translation="MISSRLETGAQWMLVAAFLFFPAAMALGNIAMLLTGLLALLSGV
                     LWRERSTWRRAPYPWLMLGLYGVVLLGGLWSSALWGDIQLNYTKYIKLLLGAVFFVLL
                     AQPQWRTRCLQAFSACMLFILVSVYANIWLQLPWSKTQNLGWGVDHTVIGDYITQNIM
                     MSFFVVLALWYGKNAPRLSLRLLAAAVALLAAVAITQLSLGRTGYVLLMLGVSSFVFF
                     ALKGYQRWLALLTIVVAAGGAYAVSQTAQDRVHLAIAEARDSEKMEITSIGGRINFWK
                     HTWELVQQKPLTGWGTGSYHDEWCRHVTEPGWCDFGDRHPHNQYLLFWMENGLIGVLL
                     FIGILAATAHSVWRDDRWRPVVLSFLVILATNSLINVSLWSSRESHFFTMMLSLLAAQ
                     AYFGTRQTSVALEKDRM"
     CDS             211076..211720
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01740"
                     /product="hypothetical protein"
                     /protein_id="BBL22719.1"
                     /transl_table=11
                     /translation="MIVDVSRLSLLGEGTVKRVYALPDDDGKVLKLIRPELVAPDGGF
                     AKHGRLKRAFAQGVYRQFRREIIQYLQLSKAAYHQQTTFFPMETPYGLVPTTQGLGLV
                     TEKILGPDGLPQTLEALAAAGALEAKHYTALEQFFDACADLHLVFGEVNVAGLMYTES
                     RSGGPEFVLVDGIGEKLLIPVRSWFKSVNTSYVRKVQRRLMGQVQALVQAAAQA"
     CDS             complement(211769..213016)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010975844.1"
                     /locus_tag="CT3_01750"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBL22720.1"
                     /transl_table=11
                     /translation="MFKAFSQRLYLRIWLAVVLGVAILTLLVGWAWKEAAEQNARNQT
                     QVNQIARELVLTDPDGKVIAQGSATRAPTPPQEGVLFDIVTPDGDLLQLHMAPRPDRG
                     DRNERGGGPHGGRPPPGGYAAFWLSPPFGFLWMLALVGVAVAVGVFPIIRRLLQRLEN
                     LQRGVQRFGEGDLSVRVATKGDDEVADLARQFNAAAERIETLVTSHKTLLANASHELR
                     SPLTRIRMGLELMGDGQPSASAKAEILRNIGELDQLVDEILLASRLESKETDVGTPES
                     VDLIGLAAEECARVEAELDLQGTSPLEVQGIAKLLRRAVRNLLENARRYSHGDITLTL
                     AQEGDMALIRVQDHGPGVPAAQRERIFEKFYRLPGASERSGGVGLGLSLVRSIAERHG
                     GTVRATDRTDGAAGACFELRLPL"
     CDS             complement(213030..213758)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010975845.1"
                     /locus_tag="CT3_01760"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL22721.1"
                     /transl_table=11
                     /translation="MSTHTLLMIEDDARLAQMVSEYLGQNSLAVIHCADATSGLERLQ
                     PSDPSELPDLVILDLMLPDMDGLEVCRRLRALPGVAAKVPVLMLTAKGDPMDRVIGLE
                     MGADDYLPKPFEPRELLARIRAILRRRGSEGAPASQPIPALRFGSLEIDRDARTVTVA
                     SQPCELTSYQFDLLVALAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRIRAAIE
                     ADSKNPKRILTVRGVGYVFAKQQD"
     CDS             complement(213994..215364)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705057.1"
                     /locus_tag="CT3_01770"
                     /product="MFS transporter"
                     /protein_id="BBL22722.1"
                     /transl_table=11
                     /translation="MTEPSTSPASTAATPSPPSTAVPRRSWGQTLRVYAEPASLRMLA
                     LGFSAGLPLLLVLGTLSFWLRKAGIDRSTIGYMSWVGLAYAFKWVWSPLVDRLPLPVL
                     NGWLGRRRSWLLLAQMLVVGGLLGMAFTDPQQDLNRMVWCALAVAFGSATQDIALDAY
                     RIESADAERQAALAATYQTGYRLAMIWAGAGALWLVAAALHGEQAAYVHAAWQLAYGV
                     MAASMLVGVFTVLLSPEPAARALTPARNLGEWLREALVAPFADFVRRYGGQAILILAL
                     IGIYRISDVVMGIMANPFYVDMGYSEAEVATVSKVFGVIMTLLGAFIGGVISMRIGVM
                     RVLMLGAVLSAASNLLFAWLSTRGHDVAGLTLVVSADNLAGGIASAAFIAYLSSLTNV
                     QYSATQYALFSSMMMLAPKWLAGFSGAFVDAHGYSSFFISTAALGLPVLLLVALASRV
                     TLRTKA"
     CDS             215418..216215
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704556.1"
                     /locus_tag="CT3_01780"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BBL22723.1"
                     /transl_table=11
                     /translation="MVAVCRARYHGSSHLRTAMADPSTVSALVDSSAAPSQDGGRLDA
                     PAWSVRRYSGEHQSHAHDHVQILYALQGRMELELNGHAGYVDAASGMLIPAGASHGYL
                     AQAHTQVQVIDLPAGPGLDRIRRFAVPARLRAPALARHPLSAAAQLALVLDAPSLLHR
                     RTVDLAWLTQQVQAALHADWPTARLAALCHLSVPQFHSRFVELVGQPPQSWLRGLRLD
                     AAEAQLARGQPLETTALRCGYRTASALAYALRRERQVSARSLRAAQR"
     CDS             216369..217313
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011339199.1"
                     /locus_tag="CT3_01790"
                     /product="membrane protein"
                     /protein_id="BBL22724.1"
                     /transl_table=11
                     /translation="MSSSSASSSVWGVALVSVASMLWGTTGTAQSLGAQGLSPFWVGA
                     AQLAVASTFFALVLWVTRRSAPTGQPLLPRPSLLGMPARWFCLASAGTAGYSISFYAG
                     VKLAGVGVGTAVAIGSAPIWAGLIQAVLLRQPLSLLWWLGTGVSVAGGVAMVLSKGGG
                     TGALSLPGLLLCLLAGLSYASYALVNKRLVSKVPTRLVNLYVFSGAAVLAAPVALLLA
                     GVPRFTASSLMVVVYLGLVVSGLAYVLFSNGLRHISGPTGVTLTLIEPVAAFLLAVWI
                     VGEHQPLASWLGLLAVLAGLMVVIGAEVRGARRKLALV"
     CDS             217407..218285
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010930369.1"
                     /locus_tag="CT3_01800"
                     /product="lipoprotein"
                     /protein_id="BBL22725.1"
                     /transl_table=11
                     /translation="MPLSPMPLNHLSDGDHLPQACRCHAGRRGFLRALVAGTAATGAG
                     AALAQVNVGGSSGLRKLVPAETLESAATEQYQELLQKAKAQGALAGSSHPQLQRLRGI
                     AQRLIPYASQWNARASQWRWEVNLIGSKEINAFCMPGGKIAFYTGILEKLQLSDDEVA
                     MVMGHEMAHALREHSREQMAKNSATSIGLSLGAQLLGLGDLGNLAARMGTQLLSLRFS
                     RSDESEADLVGLEMAARAGYSPQAAVSLWRKMGEATGDGGIGFLSTHPTGPDRIRELE
                     RNIPRVQGLYESARRR"
     CDS             complement(218411..219364)
                     /codon_start=1
                     /gene="ldh"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5SJA1"
                     /locus_tag="CT3_01810"
                     /product="L-lactate dehydrogenase"
                     /protein_id="BBL22726.1"
                     /transl_table=11
                     /translation="MGARIGIIGAGQVGAAAGYLLSATPGISQIVLVDQNEARAAGEA
                     ADIGHAAAFGTAARVSEGDYADLAGASVVVITAGASLKPGQTRLELLHQNLKMTDTII
                     GQVLKVAPDAVLLFATNPVDVMPSIAVHRYGLPPGRAIGTGCSLDSIRFRDRLADYLG
                     VAAPAIHAYVLGEHGDSSVPHWSSAQIAGMPVTDFAAQLGRPIDAAMQAQIAEEVRTS
                     AYRIKAGKGVSNFGIGGCIARLVKAIVADEQSVFAVSTCMPELLGVRDTCVSLPHLIG
                     ARGASAPFMPRLNAEETEALRASAALLSSTIADGLQSLQKA"
     CDS             complement(219365..220873)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002438863.1"
                     /locus_tag="CT3_01820"
                     /product="membrane protein"
                     /protein_id="BBL22727.1"
                     /transl_table=11
                     /translation="MASTPATETGPITSKPEPDSNKKLAFLLLALVLYGIVLALPQPA
                     GLTDSGQVALGLLVLVVVLWISECVSPANSAVVLTGAAVLGLMGTSMTAGGKPMDSAA
                     ALTTMLSGFSSTAVLLVAAALFLAVALKHTGLDKRIALLVMSKIGVSPARLVLGAMIV
                     GFVLALFIPSATARVGAVIPIMIGITAALGLAVNSSLGATLMIVTASACSIFNMAVKT
                     GAAQNIISLNFMQQAFGHNITWSQWFITALPFTIGMCVVLFFAALWILRPQVPEGEDM
                     PAKLRQQLADLGPVSSSEKRLIAVAALLLVMWSTEGVLHPFDTTTTTQIGIALLLMPK
                     IGVMHWSQAEKLVPWGTIVLFAASISLGNLLSKTGAAGWLAQQTLGQMGLSALPVVAV
                     IGALSVFSIVLHLGFASATGLASTLIPIMIAFTQTLPVSPETAFGIVMIQSFVVSFGF
                     ILPTNAPQNMLCYGTNAFSTPQFAKVGIVVTLAGLGLILLLSATLWPAMGVL"
     CDS             complement(221217..221450)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01830"
                     /product="hypothetical protein"
                     /protein_id="BBL22728.1"
                     /transl_table=11
                     /translation="MGAATRHCLVLLAAAALVFLVAWPALAASAAAWQGQPWTADWAR
                     YLRWWGMASAVLCGLRLLLAGGDWLLHALLRSY"
     CDS             complement(221450..222088)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072952.1"
                     /locus_tag="CT3_01840"
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="BBL22729.1"
                     /transl_table=11
                     /translation="MLHYQTIPVTAFQQNCSLVWCDQTQDAAVIDPGGDLEAIQWEVE
                     RLGLQLKAIWLTHAHIDHAGGTADLAEQLDLPIIGPHPGDQFWIDGLPQQGAMFGFPP
                     SRPFTPTRWLADGDSVQIGHETVQVRHCPGHTPGHVVFHAPQIDRCFVGDVLFAGSIG
                     RTDFPQGNHQQLIDSITQRLWPMGDQTVFIPGHGPESTFGRERKTNPYVGNT"
     CDS             complement(222396..222848)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P0A320"
                     /locus_tag="CT3_01850"
                     /product="azurin"
                     /protein_id="BBL22730.1"
                     /transl_table=11
                     /translation="MKKILMTVALCAAGAISAPAMAADCALTVESNDAMQFNVKNIDV
                     PKACKKFSVTLKHVGKMPKTSMGHNMVVTTTADVAAAAADGMKAGAAADYVKAGDTRV
                     LAHSKVIGGGESTTLDIDVAKLKAGTDYTFFCSFPGHYSIMKGSLKLI"
     CDS             complement(223252..224070)
                     /codon_start=1
                     /gene="xth-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004190029.1"
                     /locus_tag="CT3_01860"
                     /product="exodeoxyribonuclease III"
                     /protein_id="BBL22731.1"
                     /transl_table=11
                     /translation="MDSSLFKLTSLNLNGIRSATSKGVEAWVAATGPDCICVQEIKAQ
                     APDIQDRFEQLAGLDGYFHFAEKKGYSGVGVYTRHAPSDVIVGLGSPEFDAEGRYVEA
                     RFDTAGRKLSIISAYFPSGSSGEDRQQAKFRFLAEMHIHLMRMKGEREFILCGDINIA
                     HRKEDLKNWRGNQKNSGFTPEERAWMDMLLDPVAPTGGIVDVYRVLQPDTTDACYTWW
                     SNRGQAYANNVGWRLDYHLATPALAALARQESIYKGEKFSDHAPITIGYDLKLG"
     CDS             224069..224773
                     /codon_start=1
                     /gene="pyrE_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VSN4"
                     /locus_tag="CT3_01870"
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="BBL22732.1"
                     /transl_table=11
                     /translation="MVVKGAQQQDQDRLAQEFVQFAVDAGVLRFGEFKTKAGRMSPYF
                     FNAGLFDDGAKMGRLAEFYAKAILASGMEFDMVFGPAYKGIPLAATVAVELARLGRNV
                     PFAYNRKEAKDHGEGGTLVGAPLQGRVLVIDDVMSAGTAARESIALIRAAGATPHAVA
                     IALDRQEKATENGHDVDHSAVQYVRHQLGLQVATIATLADLLQYLQTHGGEGEMQAHH
                     ARVLAYRQRYGVDTQA"
     CDS             complement(224912..225289)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01880"
                     /product="hypothetical protein"
                     /protein_id="BBL22733.1"
                     /transl_table=11
                     /translation="MLNDWTSWGPLALSMVGAVAGVGWAVGRVWSMQRRIAPPHPNAR
                     AARFLAQGFALAAVLWLAYGLYTGYARFLPAADRAWQLAVHASALWSVPLFISAIVWA
                     ASIAMGWVMRLLQREGEDGARSR"
     CDS             complement(225519..226538)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388962.1"
                     /locus_tag="CT3_01890"
                     /product="exopolyphosphatase"
                     /protein_id="BBL22734.1"
                     /transl_table=11
                     /translation="MFPAGLCAPALQSSVPLTFLPPTAMSQKYRLVTRSDFDGLVCAM
                     LFKELDMIDEITFVHPKDMQDGKVRITRNDITTNLPFVPGAHLVFDHHASEVVRNRAF
                     LGNYIIDPHAPSAARVVYNHYGGKARFPAITDELMEAVDKADSAQYSLDEVLHPTGWT
                     LMNYLMDARTGLGRFREFRISNYALMMELIQHCRDLSVEQVLQLPDVQERVELYFEQT
                     ARACEQIQRCATVHDNLVVLDLRGEETIWATNRFMVYALFPQCNISIHAMWGKAKANS
                     VFATGKSILDRSCTTNVGELMLQYGGGGHRAAGTCQIDNDRAEQVLQELVARITADHR
                     QAVPA"
     CDS             complement(226733..226963)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01900"
                     /product="hypothetical protein"
                     /protein_id="BBL22735.1"
                     /transl_table=11
                     /translation="MNTAHINLDKLRNIVQKFGSHSFTTSQVATDYLQGDNASALEAH
                     QFEDLLKRHAALLAIRPLPSSAGGDTVWVSAM"
     CDS             227487..228875
                     /codon_start=1
                     /gene="yeeF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207482.1"
                     /locus_tag="CT3_01910"
                     /product="putrescine/spermidine ABC transporter"
                     /protein_id="BBL22736.1"
                     /transl_table=11
                     /translation="MQAADAQKTAQLQKTLVLWQVIIIGLAYIQPMTLLDTFGMVSRD
                     SVQHVPTSYLIALVAVLLTSISYGHMIRKYPSSGSAYTYVQKSVHPNAGFMVGWSSLL
                     DYLLSPMVNILLANIYLTDMFPEVNHWVWIIGLSLVMVAVNLRGVRFVANFNSLIVLL
                     QILVIGFFTYLIFSKLSAGQNALGAISVQDGHDGLWSFSPFWSPDADLGKLITGATIL
                     CFSFTGFDSLSSLAEETKDTKKTLPRAIFLTALISGLIFVFATYFMQLYFPGDPTRYF
                     QLVDETQPEILLLVGGAFFQSVVLSFAIVTVMASGISAHAGVSRLMYVMGRDGVLPKK
                     FFGHIHPRSHTPSYNIWLAGVICLTAGFLSLEFVVALISFGALTAFSFVNLSVICSYG
                     FRDGRLKTPRDIARFFVLPLCGFISIGALWLEVEDTSLKAGVAWAAVGLIYLAWLTKG
                     FRRSAPQLHEEI"
     CDS             complement(229024..229476)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01920"
                     /product="hypothetical protein"
                     /protein_id="BBL22737.1"
                     /transl_table=11
                     /translation="MRASFHALSSTWRCLAIAGLCCAGSAQALELWHYGTLRLSPQRC
                     EATFMFDAGRATYREVRVQAIAKDRQGQHLARFALAPDDMGVDGRNRFASATWISPHA
                     CNPEVVVLFKTATAQVDGMATDLLATQQLRLRRHEPLELRLPQSRERP"
     CDS             complement(229496..230059)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010968293.1"
                     /locus_tag="CT3_01930"
                     /product="oxidoreductase"
                     /protein_id="BBL22738.1"
                     /transl_table=11
                     /translation="MNHTRTATVPIEPQFLSRTSPRAFTGKAVTRTQLEQIVEAARWA
                     PSASNLQPWHFAYALHGDAHWKAFSTIPNEFNRRWCLNAGALIVLLSNPEASAGKHAF
                     DTGCAWGFMALQAQALGLATHAMAGIDTEAARRVLQLPDHWTVQALVAVGQRGDATTL
                     PPDLAEREVPSPRKPLVEILTAGPWTA"
     CDS             complement(230278..231243)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01940"
                     /product="hypothetical protein"
                     /protein_id="BBL22739.1"
                     /transl_table=11
                     /translation="MMLTVLRRLEDVLVQVVRVVLLAFALVVLLALALWVWDSWRGSK
                     PSSPDGAQPAALNWKDARLDLDYVVSETGRDLGQAGNQVPLTQRLADAQLRPSFQKAD
                     QLIRAFVNQDPAARARVEKDNSSRGLAPVHPLLAGSGAPDAALVQRLLKAEQESGCAG
                     ASAAAESAETEAAAAARSTEDEDSSWFSEPFDIPCAIHERAQMAESEHGAGSYAAYVQ
                     GLPAALEQVLGHAELGPRLQQQAVSHMVGTVLTNYTISFDQAARALRGDAEADSDDSL
                     LNLYSKAAETAFWSMLMSLLVLVVMVVVFIRMERHLRVISERAVR"
     CDS             231517..232746
                     /codon_start=1
                     /gene="serA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112947.1"
                     /locus_tag="CT3_01950"
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="BBL22740.1"
                     /transl_table=11
                     /translation="MAKTSLDKSKIKFLLLEGIHPSALKVLQDAGYTNVESLAGALEG
                     EELKAKIADAHFVGIRSRTQLTEDVFAAAQKLVAVGCFCIGTNQVNLNAARERGIAVF
                     NAPFSNTRSVAELVLAEAILLLRGIPEKNAVSHRGGWKKSADNSYEIRGKTLGIVGYG
                     SIGTQLSVLAEGLGMQVIFHDVVTKLPLGNARQAANLQELLGQADIVTLHVPELASTH
                     SMLGAEQIAAMKPGSILINASRGTVVDIDALAAALQARKLLGAAIDVFPVEPKSNKDE
                     FQSPLRGMDNVILTPHIGGSTMEAQANIGLEVAEKLVKYSDNGTTTSAVNFPEVALPE
                     HPGKNRILHVHENRPGILSAINQVFADNGINIAGQYLRTDEKVGYVVIDIDAESSALA
                     LAKLSQIPGTIRCRVLF"
     tRNA            complement(232926..233000)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00010"
                     /product="tRNA-Thr"
     CDS             complement(233122..234480)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005798980.1"
                     /locus_tag="CT3_01960"
                     /product="membrane protein"
                     /protein_id="BBL22741.1"
                     /transl_table=11
                     /translation="MLHDSSWIAWILVPASALLIWPLTATRIVLIPALITLSLLGAIN
                     IFHIGFFGYLADEFFIATALRSNQNEMKEFVQTLPALQIAQVLAWCMAAFFASKTIIR
                     SRSHGSYTAPRTSYLCAMLIWAALAAWGVSKKMDSTTFFQKMHRVYPMHLVQASFRHH
                     EMEQGLFYHPLIPVQPPEHVLAKTIVVVLGESATAQRWSLLGYQDADTNAPLRNKAGV
                     AATQVRAEGPNTASALPFMLTGFSASESVARQAASFIDLAHHAGYKTFVFTNSRFNNQ
                     QEDFYSLALRRSTDVYKKVGDGDFDEVLTPFLQTALSDTAEHKLIVLHTYGSHPGVNQ
                     RYPATRYQLPDPYDNSILYTSDLLEQWISIAQQSNPSSSLLLYASDHGLVMPPLSQTY
                     RTGDAPSTYEVPLLLWSGAPDASPLGALRTSLPTMGSGSNAVLQQLAVRAMGYAPPDG
                     KQ"
     CDS             complement(234720..235985)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088189.1"
                     /locus_tag="CT3_01970"
                     /product="serine hydrolase"
                     /protein_id="BBL22742.1"
                     /transl_table=11
                     /translation="MSATPRFHIPGLPWADSPESLGLGSDRLQRLSARLQQGVDRGEI
                     PGAVALVARHGQLAYLESFGQLNPAKGTAMRPDAIFRIASMTKPLTSLAIMMLLEQGQ
                     LALLDPVAKYLPELAQLRVGRVQPATDGSAPQVVLEPLARPITLHDLLRHTAGITYGV
                     PGSPNPLKQAYISAKLGHKNDNNAQFITKLSQLALLDQPGTVWEYGMSTDVLGRVVEV
                     VSGQTLAEFMRQHITTPLQLHDTAFHAPDSAAERAAWPQPEGPQLQLPPVPPVTQAMA
                     FQSGGGGMVSTISDYARLCLFWRNGGQLDGMRLLSRKTVALMTANHLPAGVRMGPDMA
                     YFGAQLPSPDVGQGFGLGFAVRTASGLNPLPGSVGDFSWSGIYGTFFWIDPQEDLFAI
                     LMMQSMAQRIPYRTVMRQGVYQALVDTPT"
     CDS             complement(236087..237628)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_01980"
                     /product="hypothetical protein"
                     /protein_id="BBL22743.1"
                     /transl_table=11
                     /translation="MPARPASLLAAFAVWTILFLPSMLAGASPRAVFLLLLSALLFWP
                     LAVWRPLRIVSVLFLVILGAANIVHDGFFGYLIDEFFIASSLRTTSSETREFLTSLPM
                     GTMVWCAVWLLLCAGIVRFMLRKGNEPNLQGRASQRLAIAALLVWAGFLGYSHWTGPL
                     DTTTALRKLHIVYPLHIANAGWRQYQITDALLYTPLLPEPTPPSPQSQVDTVVVVLGE
                     SASAHRWSLLGYQQAPTNASLQDIPGLQVARVLANGLNTAAALPYVLTGLSALDSVTH
                     QAPSFIDLAQHAGYKTIVLNNSRYLRTGEDFLTHALRRSANVYLKVGDGDYDEVLTPA
                     LQTALQDPAPRKLIVLHTYGSHVTAASRYPKTAHQLADSYDTSIRYTSDLLAQWIRML
                     DTSSPQQSALLLYASDHGVVVPPCSGSSRSGGSLSSYEIPALAWANPVSLAQNAQLLT
                     PLRQQDPAQVHISNTVIPEMAIQALGYSLQALSPTHRPRQVLLDAEGHPWEHSKAQLC
                     QGQGT"
     CDS             complement(237781..238680)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971962.1"
                     /locus_tag="CT3_01990"
                     /product="membrane protein"
                     /protein_id="BBL22744.1"
                     /transl_table=11
                     /translation="MPASSATTAAVPPSRSSLQRLNRLDAWLMHRPVPDGLAGLKRFV
                     WEFWFFGLKNARSCLFVGLFFAAVFVTPRAGLWGVPRYDLLLIAALAIQIAMVATRLE
                     SWDELKAISLFHVVGFALEVFKTSSGIKSWAYPDFAYTKLWGVPLFSGFMYAAVGSYI
                     IQAWRLFDLRILHHPLYPMAALVAVLIYANFFTHHYIGDYRWYLAACALGLYARTTVV
                     YRPLDRDRRMPLLLAFVLIGFFIWLAENISTFAGVWAYPNQLGAWSTVHVGKWSSWSM
                     LVVMTFTIVANLKHIKRHIHVPA"
     CDS             complement(238954..239817)
                     /codon_start=1
                     /gene="pdxY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9RYX0"
                     /locus_tag="CT3_02000"
                     /product="pyridoxal kinase PdxY"
                     /protein_id="BBL22745.1"
                     /transl_table=11
                     /translation="MNILSIQSHVSYGHVGNSAAVFPLQRLGHEVWPVYTVNFSNHTG
                     YGQWGGSAIPASEVTAIVDAMEARGALAQVDVVLSGYQGGADIADAILSTVARVKALN
                     PQATYTCDPVMGNAKSGCFVNPAIPVLLRERVVPAADLVTPNQFELGYLADTEASTLD
                     STLAAVDTVMAMGPRAVLVTSVHRPDAAPGSIEMLAADATGAWLVTTPHLPFKANGSG
                     DVTAALFAAHYSQQFGETGSALQALERTTASMFELLQRTHDSGQRELQLVQAQDSYVQ
                     PRAAFAAQQVR"
     CDS             complement(240077..241534)
                     /codon_start=1
                     /gene="gatB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YJ8"
                     /locus_tag="CT3_02010"
                     /product="aspartyl/glutamyl-tRNA(Asn/Gln)
                     amidotransferase subunit B"
                     /protein_id="BBL22746.1"
                     /transl_table=11
                     /translation="MTVKLINGYEVVIGFETHTQLATHSKIFSRASTAFGAEPNTQAC
                     PVDLALPGTLPVMNRTAVECAIKLGLSLGSHIAPRSIFARKNYFYPDLPKGYQISQFE
                     IPVVQGGEVSFYLEEGKENVLKTVRLVRAHLEEDAGKSVHDEFIGQSGIDLNRAGTPL
                     LEIVTEPDIRSTAEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGT
                     RREIKNLNSFRNMQIAIDYEILWQIEQIEDGHKIQQATVLFNPDTGETRAMRTKEDAA
                     DYRYFPDPDLPPLVVAPEWVEQVKAGMPELPRAMAARFVEQYSLPAYDATTLTQSQAM
                     AAYFEDAAKACGQPKLVSNWVMGEISRRLNTEEIGMDAVKVSSQQLGALIGRISDSTI
                     SNNSAKQVFEALWSGEGSDVDAIIEAKDLKQSNDTGALEAIIDEVIAANPANVEQYRA
                     GKDKAFNALVGQVMKASKGKANPGQVNELLKAKLA"
     CDS             complement(241560..243050)
                     /codon_start=1
                     /gene="gatA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YJ9"
                     /locus_tag="CT3_02020"
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /protein_id="BBL22747.1"
                     /transl_table=11
                     /translation="MSNTELHHLGVAELAAQLRAKHVSATEAAQHFLARAKAHQNLGA
                     FVSLNEDATLAQAKAADALIAEGKGGKLAGVPIAHKDIFVTKDFPTTAASKMLEGYRS
                     PFDATVVRKLADAGVVTLGKLNCDEFAMGGANENSAIAPVGFDSAQPVRNPWDTNRVP
                     GGSSGGSAAAVAARLAPAVTGTDTGGSIRQPASFCGITGIKPTYGRASRYGMIAFASS
                     LDQAGPMGRSAEDCALLLSEMCGPDLDRDSTSLDVPAEDFSAKLGDSIEGLRIGIPAE
                     FFGEGLSADVRTAVDAALKEYEKLGAKLVPVSLPRTELSVPVYYILAPAEASSNLSRF
                     DGVKFGHRAKDYADLNDMYKKTRAEGFGDEVKRRIMIGAYVLSEGYYDAYYLQAQKIR
                     RMIADDFQAAFKDCDVIAGAAAPTTAWAIGGKADPVSNYLADIFTLPASLAGLPGMSL
                     PAGFGEGGLPVGLQLIGNYFSEARLLNAAHRFQQATDFHLRTPAGI"
     CDS             complement(243071..243370)
                     /codon_start=1
                     /gene="gatC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62MR5"
                     /locus_tag="CT3_02030"
                     /product="aspartyl/glutamyl-tRNA(Asn/Gln)
                     amidotransferase subunit C"
                     /protein_id="BBL22748.1"
                     /transl_table=11
                     /translation="MALTSHDIDRIANLARLELSTPESERMLTQLNGFFGIVEKMQAV
                     DTSGVQPLAHPVATIQDVVLRLRDDVVSECNNREANMQNAPAADKGMFLVPKVIE"
     CDS             243587..244630
                     /codon_start=1
                     /gene="mreB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189550.1"
                     /locus_tag="CT3_02040"
                     /product="rod shape-determining protein"
                     /protein_id="BBL22749.1"
                     /transl_table=11
                     /translation="MFGAFRRYFSTDLAIDLGTANTLIFARDKGIVLDEPSVVAIRHE
                     GGPHGKKVIQAVGAEAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPR
                     SVLAPNPRIIICVPCGSTQVERRAIKDAAEAAGAAQVYLIEEPMAAGIGAGLPVSEAS
                     GSMVVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDEAIINYIRRNYGMLIGEPTAEL
                     IKKQIGSAFPGSEVKEIEVKGRNLSEGVPRSFTISSNEVLEALTDPLNQIVSAVKNAL
                     EQTPPELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEEPLTCVVRGCGMAL
                     ESMDRQGSIFTSE"
     CDS             244768..245742
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189331.1"
                     /locus_tag="CT3_02050"
                     /product="rod shape-determining protein MreC"
                     /protein_id="BBL22750.1"
                     /transl_table=11
                     /translation="MSMGTLERSAPSMFKQGPSALSQLVAYSALALFLMVADARFKVV
                     EPVRQVVSTVLYPVQWAMVQPIRFFSGGVTYFDDLETAQQEAQEARQAMLAMAQRATQ
                     SDQLLQENEQLRQLLALRDRVTVPAKAAQVIYDTPDPYTRRVVIDKGQVAGVLAGSPV
                     IDERGVLGQVTRVQPFLSEVRLLVDRDQAIPVLNQRTGERSVAYGDPSSLRSDAMELR
                     FMPSNADVKEGDLLTTSGVDGVYPSGLPVAKVSKVERRAESAFARIYCEPVARLQGAR
                     HVMILEPMDKVLPDTPHAPEPPTAKRDDKSASRRSTDVRLPGQKEAKP"
     CDS             245739..246257
                     /codon_start=1
                     /gene="mreD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189260.1"
                     /locus_tag="CT3_02060"
                     /product="rod shape-determining protein MreD"
                     /protein_id="BBL22751.1"
                     /transl_table=11
                     /translation="MIMPRGQELMMPVNPLFIALTIVVALALNMLPWGGWVWMPDWLL
                     LVLAFWGVHQSGKVGMGIGFFLGLSMDVHQSALLGQHALSYVLLMFACRQASRRVLWF
                     NVLIQAMYMAPVFVMTHAVEVVVRMVAGGIFPGPWVLIAPLIEALLWPVASWILLAPQ
                     RRPPDRDSNRPL"
     CDS             246316..248364
                     /codon_start=1
                     /gene="mrdA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204769.1"
                     /locus_tag="CT3_02070"
                     /note="frameshifted, deletion at around
                     248496,248340,248373,248598"
                     /note="possible pseudo due to internal stop codon"
                     /product="penicillin-binding protein"
                     /protein_id="BBL22752.1"
                     /transl_table=11
                     /translation="MVNLDVRNTESELMDFRVRVWVIGVVVMLLLGVVWARLVVLQVV
                     RHDAYAERAESNRTAVVPIVPNRGQILDRNGVVLASNYSAYTLEITRSKVENLEETID
                     QLAEVVEISQRDRRKFKRLMEDSKSFESIPIRTRLSDVEVAKFAAQRWRFPGVDIQAR
                     LFRSYPLENVGSHIVGYIGRVSQKDKEAIEEWEDAANYRGTEVIGKLGIEQSYEKELH
                     GQTGWEQLETSAGGYAVRRLNSRPATPGDSIVLSLDIRLQKMVEELYGNRRGALVAID
                     PRNGEVLAMVSKPTYDLNLFVGGIDTENWAMLNESIDRPMLNRALRGTYPPGSTFKPF
                     MAIAGLESGKRTPDTTIMDNGSWTFGGHTFRSGHPNGPTNLRRSIIKSSNVYYYMLAN
                     DMGVEAIHDWLAPMGFGQLTGVDLKGEVRGVLPNQEWKRNTYKRPEQKKWFAGETISL
                     GIGQGYNNFTILQLANAMAMLANHGVKNKPQLGLGRVDAVTREYQPLPRDAAQPMGYK
                     ASNVEAVRSAVAAVTVEGTARGVFMGASYQSAGKTGTAQAVGVRQNEKYNASRLSEYQ
                     RDHSLYIAYAPVDNPTIALAVIVENAGFGAAAAAPIARRVMDYWLLGRYPSEDDMAAM
                     RKGQASTPIGPSRNANDIPLPGETLPLAGLPVHPLPDYRTDGAAAAVAPSGPVEVEED
                     "
     CDS             complement(248465..249385)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011227640.1"
                     /locus_tag="CT3_02080"
                     /product="transporter"
                     /protein_id="BBL22753.1"
                     /transl_table=11
                     /translation="MRTERWGLAALLTVTVVWGTTFPAMKLLSGHLSALEIIWLRFII
                     ASAVLLPLWRGMRRSERRWGLLLGGLMFIAFWLQVEGLAHTSSNRNAFVTGLNVLVVP
                     ILAMAMLGRRYGWQLWVACAMALAGMFFMFFEDAPWNWGDTLTLASTLFYAIYILALE
                     EAARRTAAAPLRATRMAAAQATVMLGCATVALALQGGFGALWEGAAALDSTAWMAVVY
                     LGLIASVIVVTLQAWGQQRVDAMRSAIVFGLEPVFAALTAWVLIGEQMGPVAMAGAAL
                     IVVALIFSQWTPAAHARAEGAGALPEAAKT"
     CDS             complement(249542..250294)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010888285.1"
                     /locus_tag="CT3_02090"
                     /product="arginine ABC transporter ATP-binding protein"
                     /protein_id="BBL22754.1"
                     /transl_table=11
                     /translation="MSTTQTGSPYIVAQNVRKSFGNHEVLKGVSTVFRTGEVTVIIGA
                     SGSGKSTLLRAINRLEPHDSGSITIGGTEVTDDEATLLKQRSEVGMVFQQFNLFGHMS
                     VLDNVTLAPRRIHKLPRAQANEKAMTLLKRVGMEAHAHKYPWQLSGGQQQRVAIARAL
                     AMEPKVMLFDEPTSALDPEMVQEVLDVMRQLAKAGMTMIVVTHEMGFAREVADRVMFF
                     DQGCIAYDAPPAEFFNNPANDRIRAFIGRMSA"
     CDS             complement(250291..251073)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010888786.1"
                     /locus_tag="CT3_02100"
                     /product="amino acid ABC transporter permease"
                     /protein_id="BBL22755.1"
                     /transl_table=11
                     /translation="MFLALWPAHWSRTQRSNATLIAALLLMVLVLSLLGQFLSYFPEP
                     IGSNAELFAEGALTTLYLTLVSGAAGLVLGTGAALARTSRLAWLRWIASFYIWAIRGT
                     PLLVQILFVYFALPVLVPGLNLPDFAAAVVALGLNAGAYNAEAIRAGLLAVPRGQTEA
                     ARALGLPKTRVFLDVVFPQAFKISLPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQ
                     SATFQPVQTLVTVAITYLILTTLVTQVTHAIEYRFDVEGRAK"
     CDS             complement(251131..251892)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011228488.1"
                     /locus_tag="CT3_02110"
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="BBL22756.1"
                     /transl_table=11
                     /translation="MQVLKAVAVAAALCGAVIAQARPLEEIQKSGTIVLATEGQYAPF
                     NFYKGKQLTGYEVEVGEAVAKKMGLKFEWKTVGFDALLTGLAQDRWDLVVASHGVTEE
                     RAKAVTFTHPHYCSGGQIVSLTPSISKVGDLTGKVVAVQTGTSYMDNVKKVAGVKEVK
                     NFPTDEAARSALSSKRVDAWVTDRFVAKEMLAKAPKAGLKAGDMLFIEHIAAAVSKGN
                     QGLADAWNKALKEAIADGTVGTISKKYFQEDVTCK"
     CDS             complement(252240..253010)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011228488.1"
                     /locus_tag="CT3_02120"
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="BBL22757.1"
                     /transl_table=11
                     /translation="MKRISLIAAATLALLGATAAQARSFDAIQKDGTLRLATEGYYAP
                     FAYFEGKKLVGFEVDLAELMAQKMGVKFEWKTIPFDSLLTGLSQDRWDLVISSHGITP
                     EREKAVTFTLPHYCSGAQVISLSDSIKGGKDLAGKTVSAQTGTTYLDYVQKHVPGVKR
                     VVNFPTNEAAMHALMSKRADAWVTERFLAKEMLAKNPSIQFKQGEMLFVERIAAAVAK
                     GNQSLVGAWNKAFAESLKDGSYAKISQKWFKEDIRCPE"
     CDS             complement(253309..254070)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P3B5"
                     /locus_tag="CT3_02130"
                     /product="UPF0721 transmembrane protein"
                     /protein_id="BBL22758.1"
                     /transl_table=11
                     /translation="MEWILVSLASALAGFVDAIVGGGGLILVPAMFAAFPTTTPATLF
                     GTNKSAAVWGTAISAWQYSHRVRITWVTLVPAIGATLVGAFLGAWAVTLIKPDFLRIL
                     LPFILLGVLLYTLAKKELGRDHAPRLTGRTEMWAASAIGLLIGFYDGFFGPGTGSFFV
                     FLFVRLLGYDFLNASASAKLLNLASNAAALLLFSLKGHVWWHFAIPLAVANVLGSMLG
                     TWMALRHGTGFVRTIFIGVVSLLILKTGWDAFKLL"
     CDS             complement(254659..256395)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012706545.1"
                     /locus_tag="CT3_02140"
                     /product="choline dehydrogenase"
                     /protein_id="BBL22759.1"
                     /transl_table=11
                     /translation="MSDNQFDYIIIGGGTAGALLANRLSADRSLRVLLIEAGRKDDYH
                     WIHIPVGYLYCIGNPRTDWLYQTEPDAGLNGRRLRYPRGKTLGGCSSINGMIYMRGQA
                     RDYDAWAQITGDDAWTWDSVLPAFRRHEDHWRLDQPEGVNENFKRLHGNKATGSTGEW
                     RVEKQRLRWDILDAFAQAAQQAGIPATDDFNRGTNEGVGYFEVNQKAGLRWNTAKAFL
                     RPTCYGRPNFELWTCAQATRLLTQRQADGSLRCTGVEVWTGDERLVAHASEEVVLSAG
                     AVNSPQLLQLSGIGPGHLLQQHGIPTLCDLPGVGANLQDHLQIRAVYKVRGAPTLNVM
                     ASSLWGKAKIGMEYAFKRSGPMSMAPSQLGAFTRSDPHQPHPNLEYHVQPLSLDAFGE
                     PLHPFPAFTASVCNLNPTSRGTVQITSAHFKDAPAIAPNYLSTPEDRQVAADSLRVTR
                     RIAAQPALAPYQPEEWKPGPQYQSDEDLARLAGDIATTIFHPVGTTAMGRDGDPNAVL
                     DSRLRVRDGRGGLVAGLRVVDAGAMPTITSGNTNSPTLMMAEKAAEWIRADRQARRQH
                     AAVAPVPETAAA"
     CDS             256689..257816
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003807129.1"
                     /locus_tag="CT3_02150"
                     /product="ABC transporter permease"
                     /protein_id="BBL22760.1"
                     /transl_table=11
                     /translation="MTSLPPQLQRQNSPEGAWAVLQGRWGAADFGDRAHWARVQAQLK
                     AAPAQPDLGWDLHGVDWLDHVGAQLLWQHWQGQWPARLQATPGQKAMLQRVERFTAPP
                     APIPKPHPVREAVESLGCMVIQGREHLLAMVQLVGQLLLDVLRLLRAPLRGPWRDVSG
                     HLYNMGAMALPITALVGFLIGVVLAYLMSLQLRQFGAEAFIVNILGISLIRELGPLLG
                     AILVAGRTGSAITAQIGVMRVTEELDAMQVMGIPQGYRLVMPRALALALAMPLISLWT
                     TLAALAGGMLAADMTMGISAAYFLQSLPDAVNVGNLWLAMGKSVVFGVFIALIGCHWG
                     LRVEPNTQSLGQGTTASVVTAITMVIVVDAVFAILFRNVGF"
     CDS             257816..258664
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003807131.1"
                     /locus_tag="CT3_02160"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL22761.1"
                     /transl_table=11
                     /translation="MVDTAVSPPSAAAALWAQGERVVHIDKLWSIFGEGESQFAVHQD
                     LDLDIYRGEMLSIVGGSGTGKTVLLRQILGLLQPGKGTVEVLGQPAAAMGGEGAASRV
                     GMLFQQGALYSAFNVLDNVAFPLRELGTLPRALVDAAALVKLQMVGLKPEHAMRMPAD
                     LSGGMIKRVALARALIMDPPLLLLDEPTAGLDPNGSDDFCALLRELHAELDLTVVMVT
                     HDLDTLFALSSRVAVLAEKKVLVTGTPQEVAVFPHPFVAQFFQGERGRRAMAPAPSGP
                     GPEGGQ"
     CDS             258664..259647
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003807132.1"
                     /locus_tag="CT3_02170"
                     /product="mammalian cell entry protein"
                     /protein_id="BBL22762.1"
                     /transl_table=11
                     /translation="MENKSHAMAAGLFVVAVVCLLAGLAMWLTRDRHQYVEYEMSTKD
                     AISGLQPQATVRYKGVSVGKVTRIGFDPQSSGNVLIRIAVDADAPVSPQTTYAQLGYQ
                     GVTGIAHIQLDDSDTPQSVLTTGPSGLPRLPMRSSPLTVLADQGMLIMGRVDEATRRI
                     NELLGTENQQRFSAALGDIAGAAKGVNELTHSLNRTITERIDPAAAQLPELSENARRS
                     MLALEKAGQEAGQLATEVRQLAQRLQNQGGPMDQLERGAESMGAAAEQLSRTTLPAVT
                     QAASDVSRAARGMGAAASGITNNPQSLIFGEGRVQPGPGEPGFAAPAAAGR"
     CDS             259664..260311
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204797.1"
                     /locus_tag="CT3_02180"
                     /product="lipoprotein"
                     /protein_id="BBL22763.1"
                     /transl_table=11
                     /translation="MRASTLWGAALLATGLSACSNLPSSPNQPARFDLGPLPAVAAAA
                     PASVHPVLALADIQARAQNENSTSVLYRLAYADANAQHAYAYARWSQPPAVLVQQRLR
                     DILSQDRIVLSAERGAQAPRVQGQTPPVLQLALEEFEQVFTGSTASVGALRLRATLID
                     SRRGGDVLLGQRLFALQQPASAANAAAGAQALAQAVDQAGLQLQQWLTQLPAKAP"
     CDS             260466..260990
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02190"
                     /product="hypothetical protein"
                     /protein_id="BBL22764.1"
                     /transl_table=11
                     /translation="MATLEWSDELALDMAAMDDTHQEFVDLLAVVEEAPDAELPAAWR
                     ALVEHTDGHFGQEDRWMVSTGFAPDNCHSLQHRVVLQIMREGAERGAQGELHVIRGMA
                     AELVTWFTHHAQTMDAALAKHLQDVNFDPASGVVYLPQSLPQAPIHGCGGACSTGDDH
                     VEQQTRTEQVASSL"
     CDS             complement(261112..261750)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q89"
                     /locus_tag="CT3_02200"
                     /product="UPF0056 inner membrane protein"
                     /protein_id="BBL22765.1"
                     /transl_table=11
                     /translation="MDLKPLITLVAIVNPLAIVPFFIHYTQGFDETQRRQTIRTAAIS
                     TCVVICACALIGLQVLDFFNISLQSFQVGGGLLLLISAMNMLNARPAEDRPNTGTLEA
                     GVEKAAMGNSIAVVPLTIPLLTGPAAMSTVVIYADQARSIWQHIALLGYGVVVAAAVW
                     AAFSLADPISRVLGKTGINVMTRLMGLILAALAIEVMAGGLVKIFPALAGVH"
     CDS             complement(261760..262518)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528853.1"
                     /locus_tag="CT3_02210"
                     /product="glucose-1-dehydrogenase"
                     /protein_id="BBL22766.1"
                     /transl_table=11
                     /translation="MSPPPIVLITGASRGIGAATARLAAARGWAVAVNYQQRRDAADA
                     LVHEIQCAGGEAMAVQGDVGDEAQVVAMYEAMDRHWGRPLAVLVNNAGVVDRPSQVAD
                     MSAARLERMFRVNVLGSFYCAREAVRRMSTARGGQGGSIVNVSSAAALLGAAHQYVDY
                     AAAKGAVDVMTRGLAKEVAAEGIRVNAVRPGLIETEIHASGGLPDRVRELQHQVPMQR
                     GGSADEVAEAILWLMSPASSYTTASFTEVSGGRH"
     CDS             262646..263359
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011083659.1"
                     /locus_tag="CT3_02220"
                     /product="carboxymethylenebutenolidase"
                     /protein_id="BBL22767.1"
                     /transl_table=11
                     /translation="MPHTGQLLNLQTPDGRLLPAWAAIPEGPLCGAVVVLQEIFGVNS
                     HIRAVTERFAARGFAAVAPALFYRLAPCDTLGVELGYSDADMQQGRQLKAQAEALPPP
                     GMAQDVGTAVDWLATTTGQKVGAVGFCWGGLLAWRAACSLPQLSAAVCYYGGGMTGPE
                     ERSRQPLCPVMAHFGRHDHFIPVDTVLAFDQVQPQAQVFVYDADHGFNCDQRASYDDA
                     SALVARDRTLAFLDTQLRT"
     CDS             complement(263411..264535)
                     /codon_start=1
                     /gene="corA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208248.1"
                     /locus_tag="CT3_02230"
                     /product="magnesium transporter"
                     /protein_id="BBL22768.1"
                     /transl_table=11
                     /translation="MHLLRIHPAAHLVEDRGTALPSAAPEPGSFWWLACERTELEARL
                     PEIQAMLQAVCGAPLLDLHVSDLLNAHIPSTSDYTSQYDVMLFHRLVDSGASDSPAAI
                     RAAGKGGTAPPPTPVLQRVRTQPIGFAVYDQLLLTVHPPACPLQQQFQQRLETARQVP
                     EGRPGAAKLPHSPADLMLRMLNQMVDGYLDLRRVMTRQLDHWQLSLLRPRAKFHDWSA
                     VLDARLALHQLDEICEDQRGAVQDWIEAMDSWPDDSGHDRREHELLRVRSRDVLEHIE
                     RVIHHVRRIEQSAEAAVQMHFSSQSNRANDIMRTLTTLTAVFLPLNLIAAIFGMNFEF
                     IPWIHQSHGFWWAVASMALIALALLVFFWRRRYLDRNSLR"
     CDS             complement(264634..265647)
                     /codon_start=1
                     /gene="hemB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VTA2"
                     /locus_tag="CT3_02240"
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="BBL22769.1"
                     /transl_table=11
                     /translation="MHLSNPTPFPQNRPRRLRRDAFTRNLVRENRLSAHDFIYPVFVH
                     EGTNRREAVPSMPGVDRLSLDLLLPVAEECVKLEIPVLALFPNIDAALKTPDGKEALN
                     PDGLIPRVVRALKKEFPGLGVMTDVALDPYTSHGQDGILDETGYILNDETVEVLVGQA
                     LNHAAAGVDMVAPSDMMDGRIGAIREALELQGHIHTRIMAYSAKYASAFYGPFRDAVG
                     TRGALGKADKNVYQMDPANTDEALREVALDLAEGADMVMVKPGMPYLDVVRRVKDEFK
                     VPTFAYQVSGEYAMLKAAAANGWLDHDAVMMEALLAFKRAGADGILTYFAIDAAKKLR
                     QQA"
     CDS             265966..266382
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004531998.1"
                     /locus_tag="CT3_02250"
                     /product="hypothetical protein"
                     /protein_id="BBL22770.1"
                     /transl_table=11
                     /translation="MLWVKAFHIVFVASWFAGLFYLPRIYVNLAMVTPGSVAERERLL
                     LMARKLLRFTTMLAVPAVGLGLWLWLGYGFAGGWLHAKLAVVALVVVYHGVCARLLQQ
                     LAADDCRHSHRWFRWFNEIPVLLLIVAVVLVVVKPF"
     CDS             266457..267572
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004522938.1"
                     /locus_tag="CT3_02260"
                     /product="hypothetical protein"
                     /protein_id="BBL22771.1"
                     /transl_table=11
                     /translation="MQPRSSAWTLAAIYAALIVFASLFPFEGWRVQGVDPWVFLTAKL
                     PPPYWTWFDVNTNIAGYVPLGFLLALGMLRDGRRARWAVPLAALLGAALSLGMEFLQI
                     YLPRRVPSNLDLSLNAAGALLGALLAALLERLGALQRWAQFRERWLAPGSGGAVALLA
                     LWPASLLFPTALPFGLGQVLERLDLWLDEQLEDTPFMSWLPLWDAPMTPLTPGAELLC
                     VMLGLLIPCLLGYCVITHKLRRAVFAVCIVLAGVGVTALSAALTYGPAHAWEWLQAPG
                     RAAIWGGVLVALALVPVPRRICGVLLLVALSMHLSWLNQASTDVYFAQTLQVWEQGRF
                     IRFYGLAQWLGWLWPYATLIYVGWYVAQRAAAPRMAA"
     CDS             267569..267928
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004522937.1"
                     /locus_tag="CT3_02270"
                     /product="ferredoxin"
                     /protein_id="BBL22772.1"
                     /transl_table=11
                     /translation="MSDHSRAPEAQAGYYARHIFFCLNERPNGEDCCALHGAKEGFDH
                     CKKRVKEAGLAGKGQVRVNKAGCLDRCAAGPVAVVYPEGTWYTFVDEADIDEIVDSHL
                     KHGQVVERLLVPPELGR"
     CDS             268013..268657
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004188999.1"
                     /locus_tag="CT3_02280"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBL22773.1"
                     /transl_table=11
                     /translation="MNVQTEKFTLTGAAGAIEALRDQPSLDGGLPAPRGVAVITHPHP
                     LFGGTMDNKVVQTLARAFVQCGWTTVRFNFRGVGASAGTHDAGRGELDDLLAVVRQVA
                     PEGPLALAGFSFGAFVASHALATLWHEGRIAKAVLVGTAASRFEVAPVPPEAHERTLV
                     VHGEQDDTVPLSAVMDWARPQILPVTVVPGGGHFFHGQLPLLKGLVVRHLQSAA"
     CDS             268724..269893
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064727.1"
                     /locus_tag="CT3_02290"
                     /product="peptidase"
                     /protein_id="BBL22774.1"
                     /transl_table=11
                     /translation="MKTVKTHLQALVLSAALVPVWGLAQIAQPQPPEIAARNYLLIDV
                     TANQILASKEPDVAIEQASLTKLMTGYLVFDALRTKKITLEQTLPVSEQAWKMPGSRM
                     FIDPKMQVKVDDLLHGMIVQSGNDATMALAEGVGGSKENFVRLMNEQAKALGMKNTSY
                     KNPEGLTEPGHLTTARDLSILATRLMHDFPQYMHYYATKQYRYPGTPASNSNNRNALL
                     FRDPTVDGLKTGHTAAAGYCLVATAKRDMPNVGSRRLLSIVLGTASENARSGESQKLL
                     NWGYTAFDGVKLFDAGQPVEEARLWKGQKDALKIGQESAIVVTVPAGSAGKLTTQVVR
                     KDPLVAPIAKGQNVGSLKVLLGADTVAEVPVVALEDVPEAGFFGRLWDAIRLWIM"
     CDS             270105..270482
                     /codon_start=1
                     /gene="rpsL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6PB25"
                     /locus_tag="CT3_02300"
                     /product="30S ribosomal protein S12"
                     /protein_id="BBL22775.1"
                     /transl_table=11
                     /translation="MPTINQLVRQGRTVEVVKSKSPAMENCPQRRGVCTRVYTTTPKK
                     PNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSL
                     DLQGVKDRKQARSKYGAKKPKAK"
     CDS             270651..271124
                     /codon_start=1
                     /gene="rpsG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q07"
                     /locus_tag="CT3_02310"
                     /product="30S ribosomal protein S7"
                     /protein_id="BBL22776.1"
                     /transl_table=11
                     /translation="MPRRREVPKREILPDPKFGNVELSKFMNVIMEGGKKAVAERIIY
                     GALELISKKSPEKDALEVFTTAINNVKPMVEVKSRRVGGANYQVPVEVRPVRRLALSM
                     RWIKEAARKRGEKSMAQRLANELMEATEGRGGAMKRRDEVHRMAEANKAFSHFRF"
     CDS             271271..273379
                     /codon_start=1
                     /gene="fusA2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q08"
                     /locus_tag="CT3_02320"
                     /product="elongation factor G 2"
                     /protein_id="BBL22777.1"
                     /transl_table=11
                     /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKLGEVH
                     DGAATTDWMEQEQERGITITSAAVTCFWKGMDLSYPEHRFNIIDTPGHVDFTIEVERS
                     MRVLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQMKL
                     RLKANPVPVVIPIGAEDNFKGVVDLVKMKAIIWDEASQGMKFEYQDIPAELVESANKW
                     RENLVEAAAEASEELMNKYLEEGTLTEEEVKLGVRTRTLATEIQPMLCGTAFKNKGVQ
                     RMLDAVIDYLPAPVDIPDVTGTDPDDEEKKLSRKADDAEKFSALAFKLMTDPFVGQLT
                     FVRVYSGVLTKGETVLNAVKGKKERIGRIVQMMANDRVEVEEIRAGDIAACVGLKDVT
                     TGETLCDIAAPIVLERMVFPEPVIAQAVEPKSKADQEKMGIALSRLAAEDPSFRVRTD
                     EESGQTIIAGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETIRNTVKDVDGKFVRQ
                     SGGKGQYGHVVLTLEPQEAGKGFEFVDEIKGGVVPREYIPAVEKGVIEALTSGVLAGY
                     PVVDVKVRLTFGSYHDVDSNEMAFKMAAIFGFKEAARKANPVILEPMMAVEVETPEDY
                     AGTVMGDLSSRRGMVQGMDDMVGGGKAIKAEVPLSEMFGYATSLRSMTQGRASYTMEF
                     KHYAEAPRNVAEAIVAARAK"
     CDS             273564..274754
                     /codon_start=1
                     /gene="tuf_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_104181.1"
                     /locus_tag="CT3_02330"
                     /product="elongation factor Tu"
                     /protein_id="BBL22778.1"
                     /transl_table=11
                     /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEA
                     KAYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDEELLELVEMEVRELLSK
                     YDFPGDDTPIIRGSAKLALEGDQSDKGEPAILRLAEALDTYIPTPERAVDGAFLMPVE
                     DVFSISGRGTVVTGRIERGIIKVGEEIEIVGIKDTQKTTVTGVEMFRKLLDQGQAGDN
                     VGLLLRGTKREDVERGQVLCKPASIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFY
                     FRTTDVTGSIELPADKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVA
                     TIIA"
     CDS             274780..275091
                     /codon_start=1
                     /gene="rpsJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GK4"
                     /locus_tag="CT3_02340"
                     /product="30S ribosomal protein S10"
                     /protein_id="BBL22779.1"
                     /transl_table=11
                     /translation="MSKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPT
                     RMKRFDILRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL
                     Q"
     CDS             275296..275970
                     /codon_start=1
                     /gene="rplC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MC99"
                     /locus_tag="CT3_02350"
                     /product="50S ribosomal protein L3"
                     /protein_id="BBL22780.1"
                     /transl_table=11
                     /translation="MSLSNSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQIKT
                     QENDGYVALQVTFGARKASRVTKPQAGHLAKAGVEAGEVTQEFRVTEETAAKYAAGAV
                     LPVAELFAVGQKVDVQGTSIGKGFQGTIKRHNFGAQRASHGNSRSHRVPGSIGMAQDP
                     GRVFPGKRMSGHMGDVTVTTQNLDVVRIDEARQLLLIKGAVPGSKGGFVSVRPAVKAQ
                     ASKGAN"
     CDS             275970..276590
                     /codon_start=1
                     /gene="rplD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GK6"
                     /locus_tag="CT3_02360"
                     /product="50S ribosomal protein L4"
                     /protein_id="BBL22781.1"
                     /transl_table=11
                     /translation="MQLELLNEQGQAASKCDVPETVFGRDFNEDLVHQIVTAFRANAR
                     QGTRAQKDREQVRHTTAKPFKQKGTGRARAGMSSSPLWRGGGRIFPNLPEENFTQKIN
                     KKMYRAGMASILSQLAREGRLAVVDSLKLESPKTKVLADKFKSMNLESVMVIAEEVDE
                     NLYLASRNLKNVFVVEPRYADPVSLIHYKKVLVTKGAIDKLKEMFA"
     CDS             276587..276901
                     /codon_start=1
                     /gene="rplW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62GK7"
                     /locus_tag="CT3_02370"
                     /product="50S ribosomal protein L23"
                     /protein_id="BBL22782.1"
                     /transl_table=11
                     /translation="MSTLKFDEGRLMQVLVAPIVSEKATMVAEKSNAVTFKVLQNATK
                     PEIKAAVELLFKVEVAGVSVVNTKGKTKRFGKTVGRRDNVRKAYVMLKPGQELNLSGE
                     AA"
     CDS             276904..277728
                     /codon_start=1
                     /gene="rplB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MA56"
                     /locus_tag="CT3_02380"
                     /product="50S ribosomal protein L2"
                     /protein_id="BBL22783.1"
                     /transl_table=11
                     /translation="MAVIKLKPTSPGQRGTVKVTRDHLYKGAPHAPLLEAQFQKAGRN
                     NNGHITTRHKGGGHKHHYRVVDFKRTKDGIPAKVERIEYDPNRTAHIALVCYADGERR
                     YIIAPRNLEVGATIVSGSEAPIRVGNTLPIRNIPVGSTIHCIELNIGGGAQIARSAGT
                     SATLLAREGIYAQVRMRSGEVRKVHIECRATIGEVANEEHSLRQLGKAGVKRWMGIRP
                     TVRGVAMNPVDHPHGGGEGRTGEGRHAVDPWGNLTKGYRTRNNKRTQVMIVSRRKK"
     CDS             277739..278014
                     /codon_start=1
                     /gene="rpsS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0MBE3"
                     /locus_tag="CT3_02390"
                     /product="30S ribosomal protein S19"
                     /protein_id="BBL22784.1"
                     /transl_table=11
                     /translation="MTRSLKKGPFVDHHLLAKVEKAVTTKDKRPVKTWSRRSMVLPEF
                     IGLTIAVHNGKQHVPVYITDQMVGHKLGEFALTRTFKGHPADKKAKK"
     CDS             278024..278356
                     /codon_start=1
                     /gene="rplV"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6PB16"
                     /locus_tag="CT3_02400"
                     /product="50S ribosomal protein L22"
                     /protein_id="BBL22785.1"
                     /transl_table=11
                     /translation="MSETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILAFTQKKA
                     AVIVKKVLESAIANAEHNDGADIDELKVKTIFVEQGTTLKRFTARAKGRGNRISKPTC
                     HIYVTVGN"
     CDS             278373..279245
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02410"
                     /product="hypothetical protein"
                     /protein_id="BBL22786.1"
                     /transl_table=11
                     /translation="MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLK
                     AKLKNAAVSRVLIERPAKNARITIFSARPGVVIGKKGEDIENLKKELATRLGVPVAVN
                     IEEVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQSAMRLGAQGIKIMSSGRLNGI
                     EIARTEWYREGRVPLHTLRADIDYGFSEAKTTYGIIGVKVWVYKGDTLGRNDLPAVET
                     PRPDDERRPRGPRRDGRRDGGRDGAGRGARRPAGGNAAPADGSDKAAAAGADSVKRVR
                     KADAPATAADGKGE"
     CDS             279248..279664
                     /codon_start=1
                     /gene="rplP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q18"
                     /locus_tag="CT3_02420"
                     /product="50S ribosomal protein L16"
                     /protein_id="BBL22787.1"
                     /transl_table=11
                     /translation="MLQPARRKFRKEQKGRNTGIATRGNSVAFGDFGLKSTDRGRLTA
                     RQIEAARRAISRHVKRGGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKV
                     IYEIVGVPEELAREAFRLAAAKLPLRTTFVSRQIGA"
     CDS             279675..279872
                     /codon_start=1
                     /gene="rpmC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VTC5"
                     /locus_tag="CT3_02430"
                     /product="50S ribosomal protein L29"
                     /protein_id="BBL22788.1"
                     /transl_table=11
                     /translation="MTKSAELRQKDVAGLETEVKSLQKAHFGLRMQKATQQLGNTATL
                     KATRRDIARAKTILAEKQAAK"
     CDS             279882..280151
                     /codon_start=1
                     /gene="rpsQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q20"
                     /locus_tag="CT3_02440"
                     /product="30S ribosomal protein S17"
                     /protein_id="BBL22789.1"
                     /transl_table=11
                     /translation="MTEAKTSLKRTLIGKVVSDKRAKTVTVLVERSVKHPIYDKIVVK
                     SSKYHAHDEQGQYKMGDTIEITESRPLSKTKNWVATRLVQKAALV"
     CDS             280275..280784
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015040329.1"
                     /locus_tag="CT3_02450"
                     /product="peroxiredoxin"
                     /protein_id="BBL22790.1"
                     /transl_table=11
                     /translation="MIKVGDTLPACKLMEYVEVEGNGCSIGPNPVELPQALAGKTIAL
                     FAVPGAFTPTCSAKHLPGYIEQVEAFKAAGVDEIWCVAVNDAFVMGAWGRDQKAGGKV
                     RMIADGDAAFAKAIGLTLDLNGKGLGLRSNRYSMLVKDGKVVSLNVEGPGKFEVSDAA
                     TLLGQAKAA"
     CDS             complement(280859..281437)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02460"
                     /product="hypothetical protein"
                     /protein_id="BBL22791.1"
                     /transl_table=11
                     /translation="MIPSNRPVLGRDLDAVRQEFGLLTNDIIWVLSMSITRWMQVVRQ
                     APDEPVKDPTLALLVRFLAQHPELAVVPRQPTAGEMFALMNEVADVEPKRFATYFGAE
                     SSAAYRWMRPDARPSSTVTRLMHFLKTALLMQDTAGRTQLLEDWRKTVEQEARNRGVS
                     DVFKTGRWTTPILDNGAPSSSLKRPPAAETEA"
     CDS             281638..282387
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02470"
                     /product="hypothetical protein"
                     /protein_id="BBL22792.1"
                     /transl_table=11
                     /translation="MPHNATSRVQLTLLSLIRVHGQQVQPMVGTSRVCEQGDDVHLVA
                     GSIPFHDRAMDAKAPTPGKGLLALFGIRDALDELQHWRTVARNSQAQFAYLQLQVEVG
                     TPAPGAVTRQMLRECGAQLRFLNVRRSAAEFQKEALARFAGWVAEEGGDPGRDMAHVR
                     QMALRPDLFERLLYEDADLQHIDVMVLPLADWPDPARVRQVAYVRAGTPLMAQVQGSD
                     RMQVHLPGWMAQRHGPDQDMAYLPCCEDRAA"
     CDS             complement(282475..284565)
                     /codon_start=1
                     /gene="fhiA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001140817.1"
                     /locus_tag="CT3_02480"
                     /product="flagellar export/assembly protein LfhA"
                     /protein_id="BBL22793.1"
                     /transl_table=11
                     /translation="MKHYVTELRQALSRHQWAVPVFLLALLAMVMLPLPPLALDIFFT
                     FNIVLSLVVVLVAVGVKRPLDFAVFPTIILVTTLMRLGLNVASTRVVLLHGQNGPDAA
                     GHVIESFGNVVIGGNFVVGLVVFIILMIINFVVVTKGAERISEVSARFTLDALPGKQM
                     AIDADLNAGLINQQQAQTRRKEVATEADFYGAMDGASKFVRGDAIASILILIINLIGG
                     VAIGSLMHDLPLGESFRLYALLTIGDGLVAQIPALLLSAASAVIVTRISDADAGEFSD
                     QVRQQLLAKPAVLYSAAGVMLVLGLIPGMPWMPFLAFAAVLVLGGWAMAKQPGGVQPA
                     PDNLGLLQSVTAAAVQDFGWQSLPITEQLSVRVGYRLVSQLDPGQGAPLATRLKGVRQ
                     SVSEAMGFVLPPVHVRDDLTLPPNQYTILINDSIVAKAEVHADKLMAIPSPHVYGQLD
                     GIPGIEPAYQLPVTWIDPKDKAHALGMGYQVADCVSIVATHVTRVVRQHLDELIRHDD
                     VHALHERLNALSPKLAAALEKACPAQLQHAVFKQLLREGVALKDIVQIATALLDSIDT
                     TKDPILLTAEVRCALRRQLVSTAPEIKAFTLGTELEQLLLGALSSARHTNKKVPLDNY
                     PVDPSLLGQLQEHMAHARDLMKQQATAPILLVTPQLRPLLARYARLFAQGLQVLSFNE
                     VPEGKELKVLGTVG"
     CDS             complement(284562..285701)
                     /codon_start=1
                     /gene="flhB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000785648.1"
                     /locus_tag="CT3_02490"
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="BBL22794.1"
                     /transl_table=11
                     /translation="MADSAGDKSERASDHKLRKMREEGQVARSRDLATAVGLVVTLQV
                     TALFMPDYLRKFHGLFQRGLDDASGTGTIDAMVGAVWADAGMLFAQMLLPLFITPLLV
                     AVASLFPGGWLLSPKNLQPKFSRLSPKQNLSKFFKAKHYGDLLMSVLKAATVAGVVYA
                     YCKANVRHFTALPSMTLDLAVREGIALFLSGVMSIVVIFVILALIDVPLQRFFFLRSQ
                     RMSKQEVKEEHKSNEGRPEVKNRIRQIQRQLARRSVRATVPKADAVIVNPEHFAVAVR
                     YDTQRAEAPYVIAKGVDEMAFYIREIALQHQVEVVSIPALARAVYHTSQVNQQIPAVL
                     YRSVAQVLHYVLQIKAFRQGQRPARPEMPHALDVPTELSDPSPAP"
     CDS             complement(285706..286482)
                     /codon_start=1
                     /gene="fliR_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002213766.1"
                     /locus_tag="CT3_02500"
                     /product="flagellar biosynthesis protein FliR"
                     /protein_id="BBL22795.1"
                     /transl_table=11
                     /translation="MEQGLYPFLLHWLQILWWPFARIMALLAFAPIFGDPTVPVRVRV
                     TIALTLAVVALPSVSSAVISVNAFSLTAVALTLEQIAIGAVLGLGLQFATTALSIFGF
                     LSASQTSLAMAMLNDPVNGSSSDALSVLALLLGMLLFFVLDIHLLVAGIVSASFDAWP
                     VGQSLNRLQLQTVAYNMGWVFAAAFLLATPIIFAAMLVQLGFGFMARISPSLNIFALG
                     FSVVTLFGLAMLAFMLRHIPAHYLQMTRRALDMLTLMMKA"
     CDS             complement(286491..286760)
                     /codon_start=1
                     /gene="lfiQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000958542.1"
                     /locus_tag="CT3_02510"
                     /product="flagellar biosynthesis protein FliQ"
                     /protein_id="BBL22796.1"
                     /transl_table=11
                     /translation="MTPDIAVDLLLQAIQLVLVIVAVLVVPGLIVGLLVSLFQAATQI
                     NEQTLSFLPRLMVTLLALAVSARWLVTQLMDFCVRFFQYASTLLG"
     CDS             complement(286765..287427)
                     /codon_start=1
                     /gene="lfiP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8B9"
                     /locus_tag="CT3_02520"
                     /product="flagellar biosynthetic protein FliP"
                     /protein_id="BBL22797.1"
                     /transl_table=11
                     /translation="MESQQAHGVTQLSVKTEVLVLMTLLGLLPMMALMMTTFTRFIIV
                     LALLRSALGLQQGLPTRVLTGVALILTLLVMRPVGERLWTEAFEPYEKDQISLIDALR
                     RAEKPMSDFLLAQTHEAALKQVSALAKEGPVATPQDHAFTVKVAAFVLSELKTAFMIG
                     CVLFIPFLVIDLVVSSVLMAMGMMMLSPLVISLPFKILLFVLVDGWSLTVNTLVTSVQ
                     GL"
     CDS             complement(287552..287905)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02530"
                     /product="hypothetical protein"
                     /protein_id="BBL22798.1"
                     /transl_table=11
                     /translation="MELDNNMDLQDLLAGNAEAAPEAPALAPALPEPERLSPFLHRIP
                     VTLTLEAGSARITLQELADLGPDSVVPLDTIVGEPLTIKVNGAAIGKGEVVVCGESYG
                     LKVLELHAELPALGL"
     CDS             complement(287911..288669)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02540"
                     /product="hypothetical protein"
                     /protein_id="BBL22799.1"
                     /transl_table=11
                     /translation="MQNIKTLNPVLLGRPVQAFDQLAADLAQHVQAQLHGTGHRPIAI
                     QIAHAHFTPLPGVAPQALQIELQRATVLAHMAARYGFTADGQADAPDTPPSSTERRIG
                     QALQDAVLRAVAALCAQAGAALDSPPSTSASAWQWQARIQVGDSDWQPLHITLDADAS
                     RTLEHYALQLRRTQRTAPPGAAKPAAPLQVELTARLLEKTVSTADIQALRRGSVLPIA
                     LGRTTVLLNGEALLTASVAEHHGKLHLTAFETLE"
     CDS             288882..289217
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02550"
                     /product="hypothetical protein"
                     /protein_id="BBL22800.1"
                     /transl_table=11
                     /translation="MNIEPSSLLLQTRGAFAQFVPPQLDQAPVMPAAGQQAAGSGFLH
                     LMENAVLSVDAQGRAASDRMAAVDAGKSDDLVGAMLSSQEASLSFSMLMQVRNKVMGA
                     MDEVVKLQV"
     CDS             289234..290928
                     /codon_start=1
                     /gene="fliF_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7CGK2"
                     /locus_tag="CT3_02560"
                     /product="flagellar M-ring protein"
                     /protein_id="BBL22801.1"
                     /transl_table=11
                     /translation="MLDSLKKRFAGMPAAQSVLSFSSSPGMARVAVPLVLAAALVTAL
                     VVLVLWQSSGNYRPLFGARENVVTSDVVAALEADGLKYRLHPDSGQVLVAESDLGRAR
                     MLLAAKGVAAKLPEGLELMDRNDPLGVSQFVQDVRFRRGLEGELARSITTLDAVAAAR
                     VHLSIARSSSFVVNTGDKSSASVVLQMQPGQQLKQEQIAAIIHMVSSSVAGLDPQRVA
                     LTDQAGNFLSARVDLSEGFDPLAQEGQAGKLSAELRQNAQELLTAAVGAGHFRVTVTA
                     DLSQDRTEESYEQYNGDPRVLSEATREENDRSGGVALGVPGSLSNRPVNVPSEPESKD
                     GKDANNSNFRAAVSRNYAYDRSVVQVKRGKGRINKLHVAVILDDTVAPKGSTAWSPEA
                     LQRVEKLLRVGMGVDSVRGDQIAVSSMPFTVPPPVPQWWEEPANWYGAVVMVLWTIAG
                     GVVLVLLVRLVNAVLRHLREGAKTAAAVAQAAPALAGGGETDLALLQAPDSARVSTTD
                     MSMVPLLENVDLPPPGSEVDVMVEHLRTLAAKEPERVAEVVKQWVQKHGQPVGSER"
     CDS             290900..291955
                     /codon_start=1
                     /gene="fliG_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_002345777.1"
                     /locus_tag="CT3_02570"
                     /product="flagellar motor switch protein G"
                     /protein_id="BBL22802.1"
                     /transl_table=11
                     /translation="MANQSVASAEGAARLALPGKSAEELNLIEQAAIVLLSMGEEPAA
                     GVLRCLEREDLLAVTQVMSRLSGIRVDSVRQSLQHFFDDYREQSGVHGASRSFLQRSL
                     GLALGGDIAGSVLDSIYGDEVRPKMARLQWASPAWLAERLAQEHPRMQAVFLAFLPPK
                     LAGDVIEYLPASGREALVLNVARLKDVDRDLLVQLEVLTDQYLSEFGTQSVAMEGVKQ
                     AAEILNRIPGNKQELVEQLRARDPEIASAIETEMYDFFVLSTQSEATLTQIIEAVPAE
                     LWALALKGAELAVRKAVLGAMPRRQAQSFEDQMRRSGPVPLSRVEQARREIMDLVKAM
                     VDAGELEIQLFAEAVVE"
     CDS             291952..292641
                     /codon_start=1
                     /gene="fliH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005478070.1"
                     /locus_tag="CT3_02580"
                     /product="flagellar assembly protein FliH"
                     /protein_id="BBL22803.1"
                     /transl_table=11
                     /translation="MNVLYRPYHFPPLDLVQADSLQQTSAPAGERERNAQELAQAYEQ
                     AVQRGHAQGVAQGQADGERAGYEVGQQAGMAAGRAQALQAAREELQRLGAPVTAAAAQ
                     LQLLHADWEASLRKDLIDLVEKVARQVVRCELTLQPAQILALVEETLAGMPQRTGAVQ
                     VFLNPSDLQRIQELDHSRVPAWQLQADSALEAGECRLLVGDEEVDAGCKQRMAACMDQ
                     VRGQLHPVEPV"
     CDS             292638..293987
                     /codon_start=1
                     /gene="lgiI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001279402.1"
                     /locus_tag="CT3_02590"
                     /product="flagellum-specific ATP synthase FliI"
                     /protein_id="BBL22804.1"
                     /transl_table=11
                     /translation="MSSLAPPRSAPEGGLAHSLRSVQLSDVPVAQPTARLHAATGLLL
                     EATGAALPLGARCQIEGPGGVPLPAQVVGFRGAVSYLMPLKAVTGLATGARVTPDSET
                     QTPHIGASWLGRVINGLAEPLDGLGRLTGDVPLPAHPPKVHPLKKRPIAQPLDVGVRS
                     INGLLTLGRGQRVGLFAGSGVGKSVLLGMITRQTEADVIVVGLIGERGREVREFIEHA
                     LGAEGLRRAIVVVAPADEPALMRMMAAELCHTIAAHFRDQGRNVLLLLDSLTRYAMAR
                     REIALALGEPPATRGYPPSVFSMLPQLVESAGNGEQGQGSMTAIYTVLAEGDDQQDPV
                     ADTARAILDGHIVLRRELAERGQYPAIDVAASISRCMPQVVAEGHLQAARQAKELLAR
                     YSQVRDLIPMGAYVPGADARTDQAVQRWPLLEAYLRQGTHEAAMLPACMAQLQEVLA"
     CDS             293984..294436
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02600"
                     /product="hypothetical protein"
                     /protein_id="BBL22805.1"
                     /transl_table=11
                     /translation="MNVPVPALAQYVHVLDQRAQQSLAQTSQARTRLDHTQTQLERLR
                     NMARSAGVKNLHGSVALYANAAGFRSGLMDMAEQFRDTLGVQQLEYVQAQAQMQKAFR
                     QHGSMQTVLERVRTDMAVVQQRQEQKHTDELAGQAWQRQLRQPDTGNR"
     CDS             294473..295939
                     /codon_start=1
                     /gene="lafB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8F1"
                     /locus_tag="CT3_02610"
                     /product="flagellar hook-associated protein 2"
                     /protein_id="BBL22806.1"
                     /transl_table=11
                     /translation="MATYDPVSTAKALAESYVYARQTQVDTNTSKTQGKVTALTSLQT
                     ALSTFTTALNTLSAKGSVVAQTATVSRSTAASASVSGTASAGSYSFAVSQLATAQQSL
                     YSMEDLGLALDTTFPQDTTMVVTAVGGAGYIQVDLAAADENNDGKLSVTEIARALNQA
                     SDGKVTASVVTQNGKQQLLLNAGGTGLENAFQLHMVSSSGADAAAQQLATDWAATVAG
                     LQNGTITAMPAAGGASIGGKGTQLSLAQDAVFKLGGDTGVEMRQASNTYTGIDGLSVT
                     FQEVTTSPVTVTVAKDDAATKSNMQSFVDAYNTLVKAMDKLTAAGNAEGGVAAGALNG
                     DSGVRTLRNQLNSLLRTSVGGVSLTDYGISAQRDGTIALDADRFAKKVAANPDALTSL
                     LGQTNSLEYKRTGVLGSLQTYINTWSNASTGFLKSRQDGLQKQLTQYSKDQDNIDRLY
                     AQAYQRYLTQFTTLANLETTMGNTTSLLDSLFSSSSSS"
     CDS             295963..296361
                     /codon_start=1
                     /gene="lafC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8F2"
                     /locus_tag="CT3_02620"
                     /product="flagellar protein FliS"
                     /protein_id="BBL22807.1"
                     /transl_table=11
                     /translation="MNDNLWNDGYGGYRSANMVAQTAQASPVELVLMLVDGLLEEMAR
                     LRMHIAHGRFEEKAHSIAKCADILTGLGSALEVEAGNEVVENLSRLYDFCAQRLNQAG
                     FDMDADKVGEVQDIVQTLRAGWQGMADARL"
     CDS             296348..296653
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02630"
                     /product="hypothetical protein"
                     /protein_id="BBL22808.1"
                     /transl_table=11
                     /translation="MPAFDAKRLEALAQQLQAAATAQDWVRLGQLDQLLSQWLAEEQA
                     TPSADPAQQAAWRRVASAHGQARSACQQALQEAGARLRDLHNHNEAHKAYAWQEQLS"
     CDS             296650..297681
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02640"
                     /product="hypothetical protein"
                     /protein_id="BBL22809.1"
                     /transl_table=11
                     /translation="MNSMPVSTALASAPAGATQGPAVAQATEPAAAGTAAPQQAFAPG
                     AADYARVLEQTTLPQGLWAEPGGHAKASTVQALLAKTEQAWADETDSALDANALPLLP
                     SLAPAWQPEMLKPRHAQGAPMPHPAEADAALATAAMAVQMPAVPAETAVLQRVQAPAE
                     TVVATPAAVHAAVSPEAAAVLPAALQLAPTPGGLSLELPAKAAVPTTAAAARTEQPVL
                     QALAQRIQLQQSQGVEVATVRLDPPQLGTLEVRIQHDPSGVQVTLQASHAEVGRQLAG
                     LAEGLRHELQARTQGEVSVVVAQGRPSSQTAGQGGQSRDNPAPWAQAEEEAIGQALQA
                     WQSAAQAAG"
     CDS             297720..298157
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02650"
                     /product="hypothetical protein"
                     /protein_id="BBL22810.1"
                     /transl_table=11
                     /translation="MLLALVAILGVGVAAGGWWWGQRAPVAVAAQTSPQLDVRQASYV
                     SLDKIVVMLKTDQSLRTANTYMSLDLVLRTDKLHEKAAKAELPMLKGVAVRTLSQVAM
                     EQAKAMSIDEWTELLTADLVAAYASHPDLRPFDKVMVSRLIIE"
     CDS             298167..298931
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000938726.1"
                     /locus_tag="CT3_02660"
                     /product="DNA-directed RNA polymerase sigma-70 factor"
                     /protein_id="BBL22811.1"
                     /transl_table=11
                     /translation="MLQQDTSASYGDAAALVAGGWAPADGLYSTAAVSPQQEQAVLTA
                     YLPMVKRVVRQLASQAGEVMDQNDMTQVGLMGLLEALRRYGAVDEAFAGYARQRVRGA
                     ILDELRRQDWRPRTVRQSAHKARDAVRALRRQLGAEPTPAQIQQALGMDDEAYLAYEQ
                     AESAEAMASLDEMVGQGMDLPSSAADPQHAVLQRHLLEQMLAQLNEREQRVIQLYYEF
                     DLNLKEIAAVLELSEARVCQINKEALRKMRAALEGA"
     CDS             298964..299848
                     /codon_start=1
                     /gene="motA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002213750.1"
                     /locus_tag="CT3_02670"
                     /product="flagellar motor protein MotA"
                     /protein_id="BBL22812.1"
                     /transl_table=11
                     /translation="MLQLLGIFIVLGTVFGGFVLSGGQLGVIWQPMEVFIIAGAGLGA
                     LVLGNPKHILSELWLQLRNVMSQTKQTVEFQRQLLLLMYELLLTASGGLKALDAHVEK
                     PKDSPLFQRYPLVLADAKLLHFIVDNFRLMAMGKISSHELEGVLDQELETIQEELLQP
                     AKSLGKIAEAMPGFGILAAVLGIVMAMSYVADGATAGEIAVKVGAAMVGTFIGIFLCY
                     GVLDPLCNFMKQRVMEHIAAMECVKVVLVAHVAGKPPLLSIDAGRRLVPLNIKPSFAA
                     LETWITDMTARETGGARA"
     CDS             299841..300803
                     /codon_start=1
                     /gene="lafU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q03478"
                     /locus_tag="CT3_02680"
                     /product="chemotaxis protein LafU"
                     /protein_id="BBL22813.1"
                     /transl_table=11
                     /translation="MLKRAGQEHGEVVVKKSGGKHQHEEHNSAWKVAFADFCLALMCL
                     FLVLWVLAARDKEEIEMAMAAGAAPNMTYQGQGVRMIGEYQPGSLIPKNPVRPQAQEE
                     TGGQPRVQKLLDSPEELAQLSRRVREVGEQVGLGDHIVTAVTAEGLRITVHDTEQSGM
                     FKLGSAEPTAEFVRLLRRIGPMFREIDNQLVIAGHTDALPYSSHSAFAASNWSLSMQR
                     ALAARGHMMLGGMPERSVLQVIGMAEVAPADPEQPQAAINRRVELLVTTKAHAQNVHQ
                     TFGRLPVSEPLTPGLQSSPADTPMLELLRKVLLQPLQGEAQAKP"
     CDS             300815..301135
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02690"
                     /product="hypothetical protein"
                     /protein_id="BBL22814.1"
                     /transl_table=11
                     /translation="MQSSKLRGSRMKLSPIAPAAGSVAAQGDRVQDLAASLPVAAAVV
                     APDVQVGVQAASVQRAQVQAAQMPDVDVARVAEIKEALARGDISFNPQKLAQLILRHH
                     GGGA"
     CDS             301135..301605
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02700"
                     /product="hypothetical protein"
                     /protein_id="BBL22815.1"
                     /transl_table=11
                     /translation="MADAPAAPGAAPSLSTRQRWAAIAQGMQQDMTAYGHLCELLHTQ
                     FHAALRHDAEAMQEAAVQITAQVQWLEGTRKERGQHVRALLPAGAPLSMEAAFALLQA
                     PLQQQLLGLWGQLEAQVQVCKAMNQRNCQLIMEQAEVMRAVIVGNAQPEIYAPL"
     CDS             301592..302401
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02710"
                     /product="hypothetical protein"
                     /protein_id="BBL22816.1"
                     /transl_table=11
                     /translation="MLRSDFLPLPAWPGTGGTVPSGAAVAPAARLPQLPATTPVAAET
                     AVYTPLGQDVAREVQQFISQGSGGAALASPQARWLALQAARQAARSERSKEGLSATGG
                     VRSAAAAVGAAASLQPAQQAFLDRIAPWAQQAAQRLGVSPRAVMAHAALESGWGQRPV
                     RDALGQDSLNLFGIKAQGGWTGASTPALTTEYEAGQAVRQTQSFRQYADLDATFGDYV
                     RLLAHSPRYQAALRTGDDVQAFASGLAAGGYATDPDYAQKLVRISRQIPSP"
     CDS             complement(302376..303146)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02720"
                     /product="hypothetical protein"
                     /protein_id="BBL22817.1"
                     /transl_table=11
                     /translation="MNSFLTRWTPILLCALGLSAQAAAQQAPAPPPVLPAELQAAAQA
                     QLQAAWAQLLPAAQRAQARLQVQFTAPRGAAHTPCPEGWMVPAVELHSLTRASIPVRC
                     GSQRGSVVAQLQASAPVWTLRSDVPAGQALLAEDLELRPQTLAHRNELLDTPAPVGQQ
                     LKTAGRAGQALQARQLLSPVAMRKGDKIEIRAQGDGVQVSVMGLATGSGKLGDTVTVR
                     NARTGRPVKGQLIAPGVLLAAPQAPGGGVKVKAMESGD"
     CDS             303514..303879
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q79YV1"
                     /locus_tag="CT3_02730"
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="BBL22818.1"
                     /transl_table=11
                     /translation="MALNFDSALSVHAQALRVRSDRTQLLASNLANASTPGYQSRDID
                     FAEAMARTGQEAGLPSLDWGGSADALFRVPNHPSQDGNTVEVGVEQALFSQNASDFQT
                     SLTFLNMKLRGLQSAIKGE"
     CDS             303876..304301
                     /codon_start=1
                     /gene="lfgC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8D6"
                     /locus_tag="CT3_02740"
                     /product="flagellar basal-body rod protein FlgC"
                     /protein_id="BBL22819.1"
                     /transl_table=11
                     /translation="MSMGFREIAQIAGSAMTAQSTRLNTVASNLANAGAAASSESEAY
                     KARKPVFAAVMGESTLDSYAARVQVLDVLETTEPVRKVHEPGNPVADKAGFVYYSNVN
                     SVAEMTDMMSASRAFETNVEVLGRVRSMQQSLLRLGEQS"
     CDS             304298..304960
                     /codon_start=1
                     /gene="lfgD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7CGK7"
                     /locus_tag="CT3_02750"
                     /product="basal-body rod modification protein FlgD"
                     /protein_id="BBL22820.1"
                     /transl_table=11
                     /translation="MSLINSASGTGTNAGSSSSDAISQALGGTELGQMFTKLLVAQVQ
                     YQDPLEPTDSSTFVTQLTQLSQTESLQSLTSQLKTQSSILDSLQTMQLGSQVGSTVMV
                     ATNSVQLDDSTVNAVVNLPATADLTLQLTAPDGKVTTVSLGSNAVGDANFTIDPAALG
                     LPAGKYGIVVKDASGTSYPVEVAGTLQAVRLTSSGSVALQVQGLGDVLPSSVTRFVGQ
                     KA"
     CDS             305003..306184
                     /codon_start=1
                     /gene="lfgE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8D8"
                     /locus_tag="CT3_02760"
                     /product="flagellar hook protein FlgE"
                     /protein_id="BBL22821.1"
                     /transl_table=11
                     /translation="MSFQIALSALQAINNQLDNISQNIANTGTTGYKSSRTNFAAMYA
                     GSSPNGVRAASTTQTLDVAGGLLSTGRNLDVAIAGNGYFMVKDSTGVMNYTRVGVFDV
                     DKQGVLVDHMGRQVQGYGVTAGNAALGNLGNLTVPTGQIPAQASTSVDFVANLSADWS
                     VPANAFNPTDSSSYNSSTVSVVYDSLGRQHTVTQYFVKTANNTVEVHYQNENTAVGTS
                     TLKFTTAGQLDTAASTVAAVNLTPAGANALSVTFDYAGTTQFAGDTSTTTNASDGYAS
                     GTMVNVLVGADGSVNAQYSNGMVQSVGVIALATFPSDSGLTAVDGTSWQASAKSGAAL
                     IGTPGTGQLGELESQQLEQSNVEVASELVDLMGAQRNYQANTKVISTQNEIMQSLMQV
                     M"
     CDS             306201..306923
                     /codon_start=1
                     /gene="lfgF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8D9"
                     /locus_tag="CT3_02770"
                     /product="flagellar basal body protein"
                     /protein_id="BBL22822.1"
                     /transl_table=11
                     /translation="MDKLIYTVMTGAERAFHAQQVHANNLANADTTGFRADYEVAGTQ
                     AVGGYGYDSRHQSTGATDVVSQRLGAVRETGRDLDVAVLGQGLITVADAGGEAYTRAG
                     AMLVDSEGNLSINGRAVLGDGGPIVLPPFRVLSVAEDGTVSILPENGTEMQEVDRLKL
                     VDGSQPMTKTTAGLLVSRSGEALPASETVRVRSGALESSNVQAVEEMVAVMDISRQFE
                     IQMKLYQAADGMAEAGNRLLRD"
     CDS             306978..307763
                     /codon_start=1
                     /gene="lfgG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8E0"
                     /locus_tag="CT3_02780"
                     /product="flagellar basal-body rod protein FlgG"
                     /protein_id="BBL22823.1"
                     /transl_table=11
                     /translation="MNPALLVSKTGLQAQDAKLQVIAHNLANVNTVGFKRNSAAFEDQ
                     FYEITRMPGSNSQGDNRVPAGVQLGTGVRLVSTHKQFTEGSMQNTSQQLDVAIVGNGF
                     LQVLQANGDTAYTRAGQLQVDNEGRLVNANGLPLQPEITIPEGAKSVTISETGLVSAM
                     VGTDATAQELGTLQLATFVNPAGLQAQGDNLYLVSQASGDAVLGEPGEAGFGTLRQFA
                     LESSNVQAVEEMVDMISAQRSYEMNTKVLSAADDMMRNLAQAA"
     CDS             307760..308443
                     /codon_start=1
                     /gene="flgH1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZHZ5"
                     /locus_tag="CT3_02790"
                     /product="flagellar L-ring protein 1"
                     /protein_id="BBL22824.1"
                     /transl_table=11
                     /translation="MICRAAWVLRWRAAGAALALLALAGCAVRPPEVMQPAESVPEFL
                     MAPQARAQGGGLFVPHASTGLVADQRAHRAGDILTVLLEEVTQASKKANTQTSKGSSV
                     GISPPILGGKSIKADIELEGSSKFSGGGSSTQQNALSGAMTVIVQQVLPNGLLYIKGD
                     RALSLNQGDEVLRLSGYVRATDVDLNNRVSSLRVANARISYSGHGALSDASEAGWLTR
                     FFQSPLFPF"
     CDS             308449..309624
                     /codon_start=1
                     /gene="flgI1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZHZ4"
                     /locus_tag="CT3_02800"
                     /product="flagellar P-ring protein 1"
                     /protein_id="BBL22825.1"
                     /transl_table=11
                     /translation="MMFARLLSRFLCRGAMALVLAGLALPSGAQPAGKTVRGAEAGAK
                     TSMRPLRHLVHVEGVRENQLIGYGLVVGLNGTGDSTQVKFAGQSVANMLTQFGIKLPE
                     KTSTKLKNVATVMVSGVFPPGYRKGQSIDVTVSSLGDAKSLRGGMLLMAPLRGVDNEI
                     YAIAQGQLVVGGLNATGNSGSSVTVNTPTSGRIPNGATVEREIPSDFESGETVLLSLR
                     QPSFRTARNIVQAINTRYGDIASTRDGTSIEVRAPLVPTQRVGFVADLQDLQVAMGQE
                     LPRVVFNSRTGTVVIAEGVTVKAAAVSHGALRVVIREQSNVSQPAPFSQGNTVVTPES
                     NVQVQEGNGHMFEWPAGAKLQTIIDTINRTGASPDDIMSILQALDQAGALHGELVVI"
     CDS             309636..310013
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02810"
                     /product="hypothetical protein"
                     /protein_id="BBL22826.1"
                     /transl_table=11
                     /translation="METSTTRLAAERPTVPAGEAGQPPVAAAQPADDATVQRLTAAAV
                     KFEGFFVAQMLKQMRQATAAMADSGSAINDRVNDSTLALAEQTVADGLAGQRAFGIAD
                     VLVRQMLPQSGAAVNAAGTRKLS"
     CDS             310010..311395
                     /codon_start=1
                     /gene="lfgK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N8E4"
                     /locus_tag="CT3_02820"
                     /product="flagellar hook-associated protein 1"
                     /protein_id="BBL22827.1"
                     /transl_table=11
                     /translation="MSMLFNGLTGVVASQVALNTVSHNLANALTPNYTRQGVVLTAKA
                     SANTALSAGDGVAVTSLIRYADSYKTQQMWRAASTKGEYEAAQTYLLQLEQVMGDADG
                     GINAALDKFFSALSATSVEPTSTPLRQQIIEAAKALGQTINNIGQIVSNQALAVRQQR
                     AVAVDQVNSYIHEIAALNDKITQSAGAGLNTSSLQDQRDAKVDELSKLVGLQTTTQPD
                     GSINLSLRGGQPLVVGNRASTVSVDAGSQFLSVSFGTETFQLGAENWGGTLGGLAALE
                     SDVLQPLDASIRGLAQVIASETNAVLQSGYGTNGAAGTDLFVFDATSTSAMLTVSAGI
                     TPEQLGLSGDPAKVGDSTKLQELIALQSKAVNIYGPGGTGMVGSSVLLGDVYTQLVGK
                     LAMYSQQNNASYETAQTVRDQSESNWRSTSAVNTDEEAVNLMQYQQMYQANMKVITVA
                     NELFDSLLEMR"
     CDS             311432..312346
                     /codon_start=1
                     /gene="lfgL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001266799.1"
                     /locus_tag="CT3_02830"
                     /product="flagellar hook-associated protein 3"
                     /protein_id="BBL22828.1"
                     /transl_table=11
                     /translation="MRVSSNQYHITVNASLQNSNTQLEKLMGQMSSGNRLTRPSDDPI
                     AHVRISRLQREEASIAQYKDNIGALSNRMTQSETVLSSINSDLLSTRDLLVWALDGGN
                     TGEDLSAMATNLESLRDALYASALTKDQEGSYLFSGTLSKTATVGFNAAAAAGTRYTV
                     GGNSEQQQVVVGNGLTQPANVTLGDEMAAMLNTLDQAIEAIKGGGTTANNPATRASLQ
                     AALTGVDTGMDQVSTKISKLGGAQNIVSTLETNWGNLSTANQTAVLDYSQLNYATAAV
                     QLNTLMSAIKATQSAYGKVSQLSLFDAL"
     CDS             312343..313413
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02840"
                     /product="hypothetical protein"
                     /protein_id="BBL22829.1"
                     /transl_table=11
                     /translation="MSSARIGGNASAGRIGTAGAPQPGAAAPAMPTSAVGTHPLPAIR
                     YHSTWPRGWMAAAVPQRVREFHVQISKAQMALDFLEQLEQQLSALIQACRHQRKLPSD
                     AGAARLRSALQALQAGWAKRLPRTLDSLDEALHWSPVQRARKQFTLAGWSWESLQAEH
                     ARDTELVGFCLLGQEGAQGAWQARWERAQGASRQALAHALAPLGMQLSGLEQPLLLSV
                     EERWWPVVVQRFMVKGNGKRFPAGQWVSPRLVSSPQALRVDSWSAADAAAVQALAAEL
                     PSARERVLQAQAAVRAFQHDAGQSLDDVGARTTAVQAFAQAFAQAGQMPAYDWILAVV
                     PAVRAVSRRRVARLLQSRGALA"
     CDS             313432..314208
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02850"
                     /product="hypothetical protein"
                     /protein_id="BBL22830.1"
                     /transl_table=11
                     /translation="MNQALRRAESSMQLESVAAPAAVDLSYYRLSTPVAVQQVLESLQ
                     RQQAVMTLLADVPDAYAVQDAGGRPCGMAVLSQVDAEQQRLVMEVSGALLPLPAAVLV
                     VAHLPGSVRTQWELQAQWAELSHGRWQLQAPWPNQVLQHQRRRHPRLQLPLGQRYEAS
                     FMFGQRHCVLHMDDLSQGGVALRGTRSETSMLFMGRKISKVVLDLGSGVQVQVDLTVR
                     SRRSYKSFLLGEQVMVGCSLEGMTDEVQTALARIMQERGV"
     CDS             complement(314326..315159)
                     /codon_start=1
                     /gene="lafA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q03473"
                     /locus_tag="CT3_02860"
                     /product="lateral flagellin"
                     /protein_id="BBL22831.1"
                     /transl_table=11
                     /translation="MLSLHTNAAALSTQNSLGNTNKALSTSMTRLGTGYRVNSAMDDA
                     AGLQIATRLEAQTRGMSVAQKNTQNGISLLQTGEGALAEVNNMILRMKDLATEAANAT
                     STDADKTAMQAEFTALSAEIDNIMANTKFGGQALFSAAGTFTAASTFQIGASNSETYA
                     FNASTDLTALNTAITNLKAGAVSGTTANAAINLADLASAAVGTLRSSFGAAANRLEHV
                     YNNLGNMIQNTEASKGRIMDVDYATETSNMTSKQMLMQASTAMLKQSSSMSQMVASLL
                     Q"
     CDS             complement(315335..315826)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258478.1"
                     /locus_tag="CT3_02870"
                     /product="N-acetyltransferase"
                     /protein_id="BBL22832.1"
                     /transl_table=11
                     /translation="MDKPTVALLLAESPHDLEAVRLLFAEYAGGLGIDLEFQDFEREL
                     ATLPGDYAAPRGGLLLAHVDGALAGCCALRPLDTSDYPNAAEMKRLYVRKAFRGFGLG
                     RELAEAALNAARQMGYDHVLLDTLDDMESARALYTELGFESIPPYYHNPIAGAHYLKA
                     SIA"
     CDS             complement(315938..316615)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813013.1"
                     /locus_tag="CT3_02880"
                     /product="cytochrome b561"
                     /protein_id="BBL22833.1"
                     /transl_table=11
                     /translation="MSNATTRIWDLPTRLFHWLLAACVIALVVTAKVGGNAMEWHLRL
                     GHVVLALLVFRILWGVVGGHWSRFATFIPGPARLLRYLRQAAADTTVGHNPLGALSVL
                     ALLLVLGLQVGTGLLSDDEIAFAGPLTRFVGGDTVAWATGWHKDWGQWLLLGLLALHL
                     CAVAFYAVVRRKPLVQAMLHGNQPAPAGTAASRDGLAARLLALLLIAACAAAAWWVYG
                     LGSTPGF"
     CDS             316763..317212
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813017.1"
                     /locus_tag="CT3_02890"
                     /product="cytochrome c"
                     /protein_id="BBL22834.1"
                     /transl_table=11
                     /translation="MKKILPALLVAASAALLAAPASAQFAKSEDAIKYRQGALFVMSQ
                     HFGRLGAMANGKAPFDAKVAQENAAVLETMVKLPWAAFGDGTEGGKAKPEVWKEKAKF
                     TEHADKFQAESAKLVAAAKTGDLAQLKNAFGPAAQSCKACHDAFRNR"
     CDS             complement(317349..317834)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815191.1"
                     /locus_tag="CT3_02900"
                     /product="thioredoxin"
                     /protein_id="BBL22835.1"
                     /transl_table=11
                     /translation="MAGVALAAFAGLGAYVFWGGHSAAAPQSSFVLLDGSTRTTEDLK
                     GKVTLVNFWATSCTTCVAEMPEIIKTYDKYKDKGYDTLAVAMSYDPPSYVVNFVQSRQ
                     LPFKVALDNTGAAAKAWGDIRITPTTYIVNKRGEIVKTYVGAPDFAELHKLIEKLLAE
                     A"
     CDS             318058..318633
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_02910"
                     /product="hypothetical protein"
                     /protein_id="BBL22836.1"
                     /transl_table=11
                     /translation="MTTFAARCASLFAVCAAVAALSACDHKPELTWHDVTLRDAELHA
                     RFPCEPDVAQQKVDFGMEQGPVNVTMMGCDAVDATYAVSHWLLDDVRQADDALAYWEA
                     AVLTKLKAVDSKEGKSGAPFVPVGAMNLSRSIRATVQGEGPSGWTITTHGVWFAKQEG
                     DKARIYHAVIYAPKPQHEVASQFFQALELQN"
     CDS             318879..319337
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198014.1"
                     /locus_tag="CT3_02920"
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="BBL22837.1"
                     /transl_table=11
                     /translation="MKPVRILLIAHAPLAHALREAALHVFNDCGGDVLALDVQAHAEP
                     EDTLQKARALLPAQSEDGPLLVLTDVFGATPSNVALRLVEGRNARVVTGVNLPMLLRA
                     WCYRAESLENLAARAQAGGTQGIMLAGGGSAPQNQRPRLHHDSDHSHHQQ"
     CDS             319306..319575
                     /codon_start=1
                     /gene="ptsH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198013.1"
                     /locus_tag="CT3_02930"
                     /product="phosphocarrier protein HPr"
                     /protein_id="BBL22838.1"
                     /transl_table=11
                     /translation="MIQTTVTISNKLGLHARASAKLTKLAGSFPCEVWLSRGERRVNA
                     KSIMGVMMLAAGLGAEVVLETDGEQEQQASDALLALINDKFGEGQ"
     CDS             319756..321564
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63XV0"
                     /locus_tag="CT3_02940"
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="BBL22839.1"
                     /transl_table=11
                     /translation="MTFAIHGLAVSRGIAIGRAVVVASSRMEVRHYFIQPEQVESEIA
                     RTRAARNAVVAELSRLLESMPVDAPGEVAALLEVHLMLLQDELMVNGVKQWITERLYN
                     AEWALTTQLEVISRQFDEMEDDYLRERKSDMEQVVERILRHMRGVASPVSPEACAAKP
                     RRAPDAQQTLSDDMTDAPLVLVAQDLSPADMLQFKRSVFEGFVTAVGGKTSHTAIVAR
                     SMDIPAVVGARAASQLVRQDDWVIIDGDAGILIVDPSPIVLEEYQFRRRQMLLERERL
                     TRLRHTPAQTLDGQTIELLANIEQPEDSPAVVKAGAVGVGLFRSEFLFMGRGGKLPGE
                     EEQYQAYRAALEGLEGMPLTIRTIDVGADKPLEGKINASLNPALGLRAIRWSLAEPVM
                     FRTQLRAILRAAAHGKVNMLFPMVAHRSEITQILAQLRLAQSELDARGVAYGKVELGA
                     MIEIPAAALMVRTFLQYFDFLSIGTNDLIQYTLAIDRADEAVAELYDPLHPAVLQLVA
                     QVIREANAAGKSVCVCGEMAGDVAFTKLLLGLGLRSFSMHPAQVLAVKQEVLRTDTRK
                     LHDWAQAVLDADDPTAALQQTADSLTSLAAVVPAMR"
     CDS             complement(322158..323138)
                     /codon_start=1
                     /gene="lipA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0M7X7"
                     /locus_tag="CT3_02950"
                     /product="lipoyl synthase"
                     /protein_id="BBL22840.1"
                     /transl_table=11
                     /translation="MSSNEVVREAQSAENYNPLAKQKAAAKLARIPVKVEQAEVLKKP
                     EWIRVKAGSPTTRFYEIKDILRSNKLHTVCEEASCPNIGECFGKGTATFMIMGDKCTR
                     RCPFCDVGHGRPDPLDKDEPLNLARTIAALKLNYVVITSVDRDDLRDGGSGHFVECIQ
                     NIRALSPTTQIEILVPDFRGRDDRALEILTSAPPDVMNHNLETAPRLYKEARPGSDYQ
                     FSLNLLKKFKALHPKVPTKSGIMVGLGETDEEILQVMRDMRAHNIDMLTIGQYLAPTN
                     SHLPVRRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHAAGV"
     CDS             complement(323152..323889)
                     /codon_start=1
                     /gene="lipB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P6N4"
                     /locus_tag="CT3_02960"
                     /product="octanoyltransferase"
                     /protein_id="BBL22841.1"
                     /transl_table=11
                     /translation="MTTATAQAAVACAPVLDARLIGRAAYAPTVQAMQEFTRTRTAHT
                     PDQLWICEHPATFTQGLAGKSDHLLHTGDIPVVATNRGGQVTYHGPGQVVAYPLLDLQ
                     RLGYFVKEYVYRLEEAAIRTLDHFGVTGHRVAGAPGIYVRLDDPRSHARLEQRPQLRA
                     PGSAAPEPDFTGLGKIAALGIKVSRHCSYHGLALNVDMDLEPYSRINPCGYAGLPTVD
                     LSTIGIQTTWDEVAHVLGHQLIARLAP"
     CDS             complement(323886..324182)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7W0L0"
                     /locus_tag="CT3_02970"
                     /product="UPF0250 protein"
                     /protein_id="BBL22842.1"
                     /transl_table=11
                     /translation="MTDNSTPDEQDPRKDSLIEYPSLFPIKVMGIKTDGLVHAITKVA
                     EEFDPQFDASTVELRPSSTGKYLGVTITVTATSREQLDNLYRALTSHPMVKVVL"
     CDS             324410..324889
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004524510.1"
                     /locus_tag="CT3_02980"
                     /product="F0F1 ATP synthase subunit I"
                     /protein_id="BBL22843.1"
                     /transl_table=11
                     /translation="MKKNAPWQDELEAEEEDFKPLSPEEAQAWRRRNPSLSVWRIVLG
                     QVAVGVLVAVLAWWISGQARVGWSAAYGALCVVVPAVVFARGVTRGGPAAGAGSAMTR
                     LFGWELVKLVLCVAMMAAAPSLVKDLSWLALLAGMVVVMKTYWIALLVRSGVRKTEV"
     CDS             324904..325767
                     /codon_start=1
                     /gene="atpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7DD64"
                     /locus_tag="CT3_02990"
                     /product="ATP synthase subunit a"
                     /protein_id="BBL22844.1"
                     /transl_table=11
                     /translation="MAADANAPTASEYIVHHLQHLQNIKQKSVIDFSVVNYDSVAVAA
                     ILGLLGIFVMWLAVRKATSGVPGRFQAAVEMLVEMVDNQAKANIHNAQSRKFIAPLAL
                     TVFVWIFLMNAMDMLPVDLLPVLWQGATGDHHAYLRVVPTADLSTTLGLSFAVLVLCL
                     YYSVKIKGLGGWGHELVTAPFGTSKNPVFALILGVVNLLMQIIEYVAKTVSHGMRLFG
                     NMYAGELVFMLIALMGGAAAMSLSGALLPVGHIIAGTIWAIFHILVITLQAFIFMMLT
                     LIYLGQAHEAH"
     CDS             325817..326065
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03000"
                     /product="hypothetical protein"
                     /protein_id="BBL22845.1"
                     /transl_table=11
                     /translation="MENILGLVALACGLIVGLGAIGASIGIALMGGKFLESSARQPEL
                     INELQTKMFILAGLIDAAFLIGVAIALLFAFANPFVLA"
     CDS             326101..326571
                     /codon_start=1
                     /gene="atpF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63PH6"
                     /locus_tag="CT3_03010"
                     /product="ATP synthase subunit b"
                     /protein_id="BBL22846.1"
                     /transl_table=11
                     /translation="MSINATLFVQAIVFLILVLFTMKFVWPPIAKALDERAQKIADGL
                     AAADKAKSELTAVNKRVEQELSQTRNETASRLADAERRAQAIIEEAKARATEEGNKIV
                     AAARAEAEQQAVAAREALREQVAALAVKGAEQILRKEVNAGVHADLLNRLKTEL"
     CDS             326582..327121
                     /codon_start=1
                     /gene="atpH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62FR8"
                     /locus_tag="CT3_03020"
                     /product="ATP synthase subunit delta"
                     /protein_id="BBL22847.1"
                     /transl_table=11
                     /translation="MAELATIARPYAEALFKASADKGADLGSTVAWVEELAAIAADPQ
                     LRQLADNPNVSKTQVFDLIAGVAKSALPEAARNFLRVVLENGRLDALPEAAAQFRSLV
                     NSKSGSSDAVVFSAFPIADAALAELGASLEKRFGRKLNLTVKPDDSLIGGVRVVVGDE
                     VLDTSVKARLEQMKAALIA"
     CDS             327168..328727
                     /codon_start=1
                     /gene="atpA1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63PH8"
                     /locus_tag="CT3_03030"
                     /product="ATP synthase subunit alpha 1"
                     /protein_id="BBL22848.1"
                     /transl_table=11
                     /translation="MQLNPAEISELIKSRIEGLAASTDVRNQGTVVSVTDGIVRVHGL
                     SDVMAGEMLEFPAGADGQASFGLALNLERDSVGAVILGAYEHIKEGDVVKCTGRILEV
                     PVGPELVGRVVNALGQPIDGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGIKSIDS
                     MVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGQGVTCIYVAIGQKASSIKNVVRALE
                     QAGAMEYTIVVAATASESAAMQYVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYR
                     QVSLLLRRPPGREAFPGDVFYLHSRLLERAARVNADYVEAFTKGEVKGKTGSLTALPI
                     IETQAGDVSAFVPTNVISITDGQIFLETNLFNAGIRPAINAGISVSRVGGSAQTKLVK
                     GLSGGIRTDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQAQYSPLSTALMG
                     VSLFAVNKGFMDDIEVKQVLPFEAGLHQFLKSSHAALLDRLNEKRAFDKEGKDEAELT
                     AAVAAFKKSFA"
     CDS             328746..329612
                     /codon_start=1
                     /gene="atpG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62FR6"
                     /locus_tag="CT3_03040"
                     /product="ATP synthase gamma chain"
                     /protein_id="BBL22849.1"
                     /transl_table=11
                     /translation="MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMLAARP
                     YSEKIRNIAANLGQANPEYVHPFMQVNDAKKVGVIVVTTDKGLCGGMNTNVLRAVTTK
                     LRELQDAGITTEAVAIGGKGLGFLNRVGAKVVSHATGLGDTPHLDKLIGPVKVLLDQY
                     AEGKLSAVYVAYTKFINTMKQESVVEQLLPLSSEKMQAEKTGASWEYIYEPDAQSVID
                     ELLVRYVESLVYQAVAENMASEQSARMVAMKAATDNAGNVISELKLVYNKTRQAAITT
                     ELSEIVAGAAAV"
     CDS             329647..331056
                     /codon_start=1
                     /gene="atpD1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62FR5"
                     /locus_tag="CT3_03050"
                     /product="ATP synthase subunit beta 1"
                     /protein_id="BBL22850.1"
                     /transl_table=11
                     /translation="MAQVQGKIVQCIGAVVDVEFAHGEVPKVYDALKLEGSALTLEVQ
                     QQLGDGVVRTIALGSSDGIKRGLMVTNTGNPITVPVGKATLGRIMDVLGNPIDERGPV
                     DQTLTAAIHRKAPAYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNM
                     MELINNIAKAHSGLSVFAGVGERTREGNDFYHEMSDAGVVNQESLNDSKVAMVYGQMN
                     EPPGNRLRVALTGLTMAEAFRDEGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQ
                     PTLAEEMGKLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIA
                     SLGIYPAVDPLDSTSRQLDPQVVGEEHYNVARSVQGTLQRYKELRDIIAILGMDELAP
                     EDKLVVARARKMQRFLSQPFHVAEVFTGAPGKYVPLSETIRGFKMIANGEADHLPEQA
                     FYMVGTIDEAFEKAKKLAA"
     CDS             331140..331556
                     /codon_start=1
                     /gene="atpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62FR4"
                     /locus_tag="CT3_03060"
                     /product="ATP synthase epsilon chain"
                     /protein_id="BBL22851.1"
                     /transl_table=11
                     /translation="MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITR
                     IKPGSVRIEMPDGSEEFVFVAGGILEVQPNCVTVLSDTAIRGKDLDDEKAQKAKAAAE
                     EALKNAKSELDLAKAQSELAVMAAQIAALRKFRQKR"
     CDS             331715..332446
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010895592.1"
                     /locus_tag="CT3_03070"
                     /product="hypothetical protein"
                     /protein_id="BBL22852.1"
                     /transl_table=11
                     /translation="MRQLKNYFLSGPGPKDVDMRCSGRLVQWNEARGFGLVQIDGSGE
                     RVFVHISAWQPRPAAQQRPQVGMPLTFALGMVQGKPRALAVAWQEPHRRAPVQGRARA
                     AGATAVPGQVRRSQGARTPALHRGASKPLLVLVLWWVAVAAVWGVSEWVVLAYAGLSL
                     WCFGTYWHDKHQAQSGGWRTPEATLHALALLGGWPGALLAQQWLRHKSSKPEFRQAFW
                     ATVVLNMLAFTGLHVPAVQAWLLHR"
     CDS             complement(332522..333064)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011090000.1"
                     /locus_tag="CT3_03080"
                     /product="membrane protein"
                     /protein_id="BBL22853.1"
                     /transl_table=11
                     /translation="MAGLWNRLQRLLHHRWTEGQVRRAFPPEVLLRLERQVAASEARH
                     SGQVRLCVEGGLPYSYIWRDATARERGVALFGKLRVWDTEQNNGVLIYLLMADHAIEI
                     VADRALHRAVPAASWQAVLEGMQQDFRRDAYAQGMETALLRVSDLLAAHFPADAAHHT
                     GHDASLPDTPVVQGRFFKDL"
     CDS             complement(333066..333971)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03090"
                     /product="hypothetical protein"
                     /protein_id="BBL22854.1"
                     /transl_table=11
                     /translation="MPLTHRRRALGALFLLVFALLWQPAVAQPLQPVPALTARLMDQT
                     QTLSAEQALAVENRLRGIEEKSGSQVVVLMVPTTAPEDIAAYAWRVADSWKIGRKDVG
                     DGLLVVVAKNDRRMRMEVARALEGAIPDLAAARIIDQQMAPHFRQNDYAGGILAALDQ
                     VAARIAGEALPAPSQPARQQDRGWDLEELAIFLFFGVMVAGPIVRGIFGNKLGAAIMG
                     GGTGFLAYVLTTSLLLAGGAGVLALLFTLLSNSRGGGGGGGGPFIGGGGWGGGSGGGG
                     GFGGGGGFSSGGGGSFGGGGASGSW"
     CDS             complement(333999..334592)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004190125.1"
                     /locus_tag="CT3_03100"
                     /product="hypothetical protein"
                     /protein_id="BBL22855.1"
                     /transl_table=11
                     /translation="MKRLLAILALALGLSGCGYNDFQRLDEQTKSAWSEVLNQYQRRA
                     DLVPNIVASVKGEASFEQDTLTKVIEARAKATSIQATPELINDPEAFNKFQQAQGELS
                     GALSRLMVVAEQYPKLQANQGFRDLRVTLEGTENRITVARNQYIKTVQDYNVLARSFP
                     TNLTGMVFGYKPKPNFTVQNEAEISRPPTVDFSSGKK"
     CDS             334853..335398
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03110"
                     /product="hypothetical protein"
                     /protein_id="BBL22856.1"
                     /transl_table=11
                     /translation="MDDIVKQALAKWPNVPDCYGWLALDARGRWFLRDQATQACGFFP
                     SSKGSLLQHGKLIDFIGRNYEVDARGCWYFQNGPQRVYVELEDTPVVWRVDEDGSVRT
                     HTGRSVQPQRCLVDEQGHVYLVADGVLGLVHTQDVMRMAALIEAGRWEPHEVCSAALE
                     AQFRFVRSPQQLVADAPAAAA"
     CDS             complement(335512..336039)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03120"
                     /product="hypothetical protein"
                     /protein_id="BBL22857.1"
                     /transl_table=11
                     /translation="MSATSHEEAHTGPVKNPKQLLIAVFFSFVIPVFVIIGLVQFVSS
                     SNKTGPGAGNHDMAQAMRIQKIGSVEIRDANRPLRGGEDVYKGQCAACHATGVSGAPK
                     FGDAGAWGPRLAQGFETLVQSALKGKGAMAPQGGGDFNDLEIARGVAFMANAGGGKFD
                     EPQPPAAAAETAEAK"
     CDS             complement(336260..337696)
                     /codon_start=1
                     /gene="oprM_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q51487"
                     /locus_tag="CT3_03130"
                     /product="outer membrane protein OprM"
                     /protein_id="BBL22858.1"
                     /transl_table=11
                     /translation="MTKRLVPTLLVSALLASGCSFIPQLERPAAPVAASYPAANAAST
                     SKAAADIPWQNFFADARLQQLITLALDNNRDLRVAVLNIEQARAQYQIQRAAQFPELG
                     VAAQGSRAASTDGSGYVNTYMVGLSMPSWEIDFWGRIRSLKEQSLAQYLATEEGRKST
                     QISLVAAVANAWLGLQADEELRAISQRTLQTREESVRLAKLRFDAGASSELDFQQARS
                     LTENARATLAQQTRQRDLDINALTLLVGQQVPAELLASLQGKRLADLPALADVPEGLP
                     SDLLLRRPDIRQAEQSMVAANASIGAARALFFPNVSLTAAAGFANTELSDLFKSGSTT
                     FSIAPSIYLPIFTAGRNQANLEVAETSKKIAAAQYEKAIQTAFREVSDALVSRESLVE
                     QLRAQQAQLEAESSRLNLSNLRYTNGVASYLDLLDAQRSLFTLEQAVVQVRLAQLQNQ
                     VLLYKALGGGWTETTQTAAAPAAAAPAQ"
     CDS             complement(337689..337835)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03140"
                     /product="hypothetical protein"
                     /protein_id="BBL22859.1"
                     /transl_table=11
                     /translation="MVIGTPLSIFLVPIFFIGVFKLFGQKLDQDKTPPASTAAVTDGG
                     SHHD"
     CDS             complement(337829..340864)
                     /codon_start=1
                     /gene="mtrD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002224969.1"
                     /locus_tag="CT3_03150"
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="BBL22860.1"
                     /transl_table=11
                     /translation="MSKFFIHRPIFAWVIAIFVVLAGIISITQLPVAQFPSVAPPTIT
                     VTATYPGATSETMTDSVLQLIEREMNGAAGLMYMESKAPAGGQGTLTLTFKPGTNADL
                     AQVDVQNRLARAEPRLPSVVQALGVKVDKAMSNFLMILAFQAESGETSRDDIADYVNR
                     NVLPEVQRLEGVGKAQLFAAGRAMRIWVDPIKLQGYGLPIASVNAAIAAQNQQISGGA
                     LGDTPNVPGTTMSASIVVPGQLTTPEQFGNVVLRSNADGSTVRIKDVARVELGTESYA
                     FNSRLDGKPAVAMAVQLTSTANAMATAKLVYEKMDTLAPFLPPGVNWSAPYDTSKFVK
                     ISIEKVVHTLLEAIVLVFIVMLVFLQNIRYTLIPTIVVPIALLGTFGVMLAAGLTINI
                     LAMFAMVLVIGIVVDDAIVVVENVERIMAEEGIPPKEATIKAMGQIQGAVVGITVILV
                     TVFLPLAMFSGATGNIYRQFSLVMAISIFFSGFFALTLTPALCATMLKPIPKGHAHDK
                     KTGPLGPFYNWFNRKFDAGTKRYHGALNSVVKRSFQAVVVYLLVIAGVAFMFMKLPSA
                     FLPTEDQGYVISLAQLPPGATLDRTGDAVAELEKFVLSQPETDHIVSILGFSFSGQGQ
                     NMGLAFTTLKDWSQRSGAGSDAQSFAGRTMGAMMALRDGFIYTLVPPSIPELGNSDGF
                     TFRLLDRGAKGHAALLEARNMLMGKANQSPILTGVRFDGVDDAPQWQVNINRDAVYAQ
                     RVSMGDLASTLATALGSSNSTDFPNQGYMQRVTIQADAHRRMQPEDVMRLTVPNADGK
                     LVELSTMVSAKWISGPMQVTRYNGYPSMSITGSAKPGYTSGQAMAEMEKLALDLPEGF
                     GYEWTGQSLDEKKSGSSAMLLYAFSILAVFLCLAALYESWSIPLSVMLVVPLGVLGAL
                     AGMFIRGMPNDIYFQVALITVIGLSAKNAILIVEFAKDLHAQGMSAYDAALEAAHLRF
                     RPILMTSLAFILGVVPLYIASGASAASQREIGTGVFWAW"
     CDS             complement(340880..342187)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010951249.1"
                     /locus_tag="CT3_03160"
                     /product="membrane protein"
                     /protein_id="BBL22861.1"
                     /transl_table=11
                     /translation="MHPVYEASRAAKAPLFAPHARLRAIALGVAVVSALSLAACGDKN
                     DGAQNAQAAAQAKPPEVGVVTVKLGSVPLVTDLPGRLEAFRTAQVRARAAGILQKRLF
                     QEGSDVKVGQKLFQIDSTPYQANLQSAQATLAQAEASLVQAAATARRYKPLVEANAIS
                     KQDYDAAIAAEKAALAQVAAGKAGVTNANVNLGYATVTAPIAGRIGRAMVTEGALVGQ
                     GEATQLATIQQIHPLYVNLTQSSTDILRLKEALAAGKLTRDGANAAKVHVFTEDGKEY
                     GHTGRMLFTDLTVDENTGQVSVRAELPNPNGLLLPGMYVRVQLEQAQVDNAAVIPQQS
                     VTRNEKGNFVLVVAEDGTVAPRPVQINGSQGNNWIVTGGLKEGEKVMVDGVIKVGMGA
                     KKVTPVPWQADAKAAPAAAAPAADKAPAAKPEAAADAKPAAAQ"
     CDS             342388..343017
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189152.1"
                     /locus_tag="CT3_03170"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BBL22862.1"
                     /transl_table=11
                     /translation="MARRTKEDACATRNSLLDAAEQVFYEQGVARASLNEIAQRAGAT
                     RGAVYWHFKDKLDLFYAMLERVTLPLEQAAYGEDVGGARLEGLARVRHVIASVFVRLE
                     EDSQTRKVFEVLLHKVEYVGELVSVQERNVQAMAEFGAKLEAALVHAQGEQQIELPVS
                     AGEAALALRCLFDGVIQSWLLSRGGFGLSAVGMRAVDAYLRGLGFALAA"
     tRNA            343085..343160
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00020"
                     /product="tRNA-Arg"
     tRNA            343249..343334
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00030"
                     /product="tRNA-Tyr"
     tRNA            343389..343462
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00040"
                     /product="tRNA-Gly"
     tRNA            343503..343577
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00050"
                     /product="tRNA-Thr"
     CDS             343652..344842
                     /codon_start=1
                     /gene="tuf_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_104168.1"
                     /locus_tag="CT3_03180"
                     /product="elongation factor Tu"
                     /protein_id="BBL22863.1"
                     /transl_table=11
                     /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEA
                     KAYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDEELLELVEMEVRELLSK
                     YDFPGDDTPIIRGSAKLALEGDQSDKGEPAILRLAEALDTYIPTPERAVDGAFLMPVE
                     DVFSISGRGTVVTGRIERGIIKVGEEIEIVGIKDTQKTTVTGVEMFRKLLDQGQAGDN
                     VGLLLRGTKREDVERGQVLCKPASIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFY
                     FRTTDVTGSIELPADKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVA
                     TILA"
     tRNA            344856..344931
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00060"
                     /product="tRNA-Trp"
     CDS             345021..345404
                     /codon_start=1
                     /gene="secE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WFG9"
                     /locus_tag="CT3_03190"
                     /product="protein translocase subunit SecE"
                     /protein_id="BBL22864.1"
                     /transl_table=11
                     /translation="MATSQVETVSSGADKAKLAAVLVLVIASIAGFYFLGAQGPVAQW
                     GVLLVGLVAAAAVFLVSEQGKQLIAFAKDSWKEVKKVVWPSRKETLQMTLYVFAFVVI
                     MALFLWLTDKTVEWVLYDLILGWRK"
     CDS             345404..346000
                     /codon_start=1
                     /gene="nusG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63PZ8"
                     /locus_tag="CT3_03200"
                     /product="transcription termination/antitermination
                     protein NusG"
                     /protein_id="BBL22865.1"
                     /transl_table=11
                     /translation="MTDAMDAGASGAQVAPAAAVNPDLRWYIVHAYSGMEKAVERNIT
                     ERIQRSGMQEKFGRILVPTEEVVEMKNGQRKTTERRLFPGYVFVEMVMDDDTWHLVKH
                     TSKVTGFVGGAKNRPAPISEEEVQKIVSQMQEGSDKPRHKIEFMVGELVRVKEGPFTD
                     FNGTVEEVNYEKNRLRVSVAIFGRSTPVELEFAQVEKT"
     CDS             346099..346530
                     /codon_start=1
                     /gene="rplK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63PZ9"
                     /locus_tag="CT3_03210"
                     /product="50S ribosomal protein L11"
                     /protein_id="BBL22866.1"
                     /transl_table=11
                     /translation="MAKKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNA
                     QTQGVEPGLPLPVVITAFADKSFTFVIKTPPATVLIKKAIKLDKGSSNPLKAKVGKIT
                     RAQLEEIAQTKLKDMNAANVDAAVRTLAGSARSMGVIVEGL"
     CDS             346532..347227
                     /codon_start=1
                     /gene="rplA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q00"
                     /locus_tag="CT3_03220"
                     /product="50S ribosomal protein L1"
                     /protein_id="BBL22867.1"
                     /transl_table=11
                     /translation="MAKLTKKQKALQGKVDSTKLYAFGEAVVLVKEAATAKFDESIDV
                     AVQLGVDAKKSDQVVRGAVVLPHGTGKTTRVAVFAQGAKAEEAKAAGADIVGMDDLAA
                     QVKAGDMPFDVVIAAPDAMRVVGQLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQ
                     VQFRVDKAGIVHSTIGRRSFDNDKLQANLAALVDALNKAKPASSKGLYLRKVAVSSTM
                     GVGVRVEPQSIAA"
     CDS             347453..347980
                     /codon_start=1
                     /gene="rplJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q01"
                     /locus_tag="CT3_03230"
                     /product="50S ribosomal protein L10"
                     /protein_id="BBL22868.1"
                     /transl_table=11
                     /translation="MSLNRSEKEAVINEVTSLAAKAQTLVIAEYRGITVADMTKLRSE
                     ARSKGVSLSVLKNTLARRAVAGSAFEVVADQMTGPLIYGFSEDAVAAAKVVADFAKTN
                     DKLVIRGGAFSGKALDVNGVKQLASIPSKEVLLAQVCGLLMSPMSRTAVVLGALAAKK
                     SEGAEQPAAEEAAAA"
     CDS             348021..348395
                     /codon_start=1
                     /gene="rplL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q02"
                     /locus_tag="CT3_03240"
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="BBL22869.1"
                     /transl_table=11
                     /translation="MAFDKDAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAAA
                     GGGAAAAAEEKTEFNVVLAEAGSNKVAVIKAVREITGLGLKEAKDLVDGAPKNVKEGV
                     AKADAEAAVKKLTEAGAKAELK"
     CDS             348676..352788
                     /codon_start=1
                     /gene="rpoB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q03"
                     /locus_tag="CT3_03250"
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="BBL22870.1"
                     /transl_table=11
                     /translation="MAYSYTERKRIRKSFGSRDSVLEVPYLLQMQKDAYTAFLQSDVA
                     PKKRTIEGLQAAFNSAFPIVSHNGFVEMKFVEYNLAKPAFDVRECQTRGLTFASAVRA
                     KVQLIIYDRESSTSQSKVVKEVKEQEVYMGEVPLMTDKGSFIINGTERVIVSQLHRSP
                     GVFFEHDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDLLYFRVDRRRKMPVSILLK
                     AIGLTPESILANFFVNDNFRLMDSGAQMEFVADRLKGEVARFDITDKSGKVVVAKDKR
                     VTARHTRELEQSGTKYISVPEDFLIGRVLAKNIVDPDTGEIIAKANEELTEALLKKLR
                     SAGIQDIQCIYTNELDQGAYISQTLRTDETADEFAARVAIYRMMRPGEPPTEDAVQAL
                     FQRLFYNADTYDLSRVGRMKFNAKVGRDDPTGPMVLSNEDILAVVKILVDLRNGKGEV
                     DDIDHLGNRRVRCVGELAENQYRTGLARIEKAVKERLGQAEQEPLMPHDLINSKPISA
                     ALKEFFGASQLSQFMDQTNPLAEITHKRRVSALGPGGLTRERAGFEVRDVHVTHYGRV
                     CPIETPEGPNIGLINSLALYARLNEYGFIETPYRRVVDGKVTMEIDYLSAIEEGKYVI
                     AQANAELDAEGRLVGELVSAREAGESTLLSPERVQYMDVSPAQIVSVAASLIPFLEHD
                     DANRALMGANMSRQAVPVLRPEKPMVGTGIERVAAVDSGTVVTATRGGIVDYVDATRI
                     VIRVNDEEAVAGEVGVDIYNLIKYQRSNQNTNIHQRPVVKRGDKLAKGDVIADGASTD
                     LGEIAIGQNMLIAFMPWNGYNFEDSILISERVVSEDRYTSIHIEELVVMARDTKLGAE
                     EITRDIPNLSEQQLNRLDESGIIYVGAEVQPGDTLVGKVTPKGETTLTPEEKLLRAIF
                     GEKASDVKDTSLRVDQGSSGTVIDVQVFTREGIQRDKRAQQIIDDELKRFRLDLNDQL
                     RIVEADAFDRIEKLLIGRVANGGPNKLAKGAKLDKAYLDGVEKFHWFDIRPAEDELAA
                     QLESIKNALEQTRHEFDLAFEEKRKKLTQGDELPAGVLKMVKVYLAVKRRLQPGDKMA
                     GRHGNKGVVSRIVPVEDMPYLADGTTADIVLNPLGVPSRMNIGQVLEVHLGWAGKGLG
                     QRIGDMLQAEAKMADLRAFLEEVYNSRGRKEDLSLLSDDEILRMANNLKTGVPFATPV
                     FDGASEQEIKDMLKLAYPDELKERKGLTDSRTQAYLFDGRTGEQFERPTTIGYMHYLK
                     LHHLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYVLQEMLT
                     VKSDDVVGRTKVYESIVKGEHAIEAGMPESFNVLVKEIRSLGLDIELERS"
     CDS             352910..357127
                     /codon_start=1
                     /gene="rpoC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Q04"
                     /locus_tag="CT3_03260"
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="BBL22871.1"
                     /transl_table=11
                     /translation="MKSLLDLFKQFTPDEHFDAIKIGLASPEKIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIDLAAPCAHIWFLKSLPSRLGLVLDMTLRDIERVLYFEAYVVTDPGMTPLKKFSIM
                     SEDDYDAKQREFGYDEFTAKMGAEGIKDLLEGIDIDSEIERLRGDLTGSEVKVKKNAK
                     RLKLLEAFKKSGIKPGWMVMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNS
                     RLRRLLELKAPEIIARNEKRMLQEAVDSLLDNGRRGKAMTGANKRALKSLADMIKGKS
                     GRFRQNLLGKRVDYSGRSVITVGPYLKLHQCGLPKLMALELFKPFIFSRLEQMGIATT
                     IKAAKKEVESGSPVVWDILEEVIKEHPIMLNRAPTLHRLGIQAFEPILIEGKALQLHP
                     LVCAAFNADFDGDQMAVHVPLSVEAQMEARTLMLASNNVLFPASGEPSIVPSQDVVLG
                     LYHATRDKINGKGEGMVFMDTNEVQRALDSGEAELHAKISVRLPQWTKDKETGEFVKS
                     VSLVHTTVGRALLSEILPKGLDFSNINKALKKKEISKLINASFRKCGLKATVVFADKL
                     LQNGFRLSTHAGFSVAIDDMLVPPQKADILARAEAEVKEIEQQYVSGLVTAGERYNKV
                     VDIWGKAGDDVSKVMMDQLKVQKTTDRDGNQVDQESFNAIYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVTQDLVVNEQDCGTYNGYLMRAIVEGGEVIESLRDRVLGRSTAEDVLHPETRVV
                     LLRAGTLLDEDTIEELEAQGVDEIKVRTALTCETRFGLCATCYGRDLGRGGLINMGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASRAAVASSVEAKSNGSISFNPTMRYVSNTKG
                     ELVVISRSGEIVISENGRERERHKVPYGAILTVKPDEAIKAGKILANWDPLTRPIITE
                     YAGQVKFENVEEGLTVAKQVDEVTGLSTLVVIDPKRRGSAKVVRPQVKLIDANNQEVK
                     IPGTDHAVTIGFQVGALIQVRDGQDVGPGEVLARIPVEGQKTRDITGGLPRVAELFEA
                     RTPKDKGTLAEMTGTISFGKETKGKIRLQITDLEGKVWEELVPKERNILVHEGQVVNK
                     GESIVDGPADPQDILRLLGIEELSRYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRV
                     VIENPGDTTYIQGEQVERSEVLNTNEAAQRDGKIPATYSNVLLGITKASLSTDSFISA
                     ASFQETTRVLTEAAIMGKRDELRGLKENVIVGRLIPAGTGLAYHQARKAKDAMDEAER
                     RAIAEAEAAELAGVTADESVAGDDSAA"
     CDS             357291..358607
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VS74"
                     /locus_tag="CT3_03270"
                     /product="ribosomal RNA small subunit methyltransferase B"
                     /protein_id="BBL22872.1"
                     /transl_table=11
                     /translation="MALSRLLDQVAQALQAIRAGQSGTGLLQAVPAALRPGVQALLFQ
                     VLRNLGRAQALRAQLAPKAPAPKVDALLCTALALAWNEAQAPYAPFTLVNQAVEAAKR
                     GPAARQAGFINACLRRFLRERDALVALTDADPQARWNHPRWWIERLQREYPAQWQQIL
                     EANNAHAPMALRVHARKSTPAQYLSALQAVHLEATVFGAHGVQLAKPQPVDALPGFAE
                     GVVSVQDGAAQLAAPLLLHGLELSRPLQVLDACAAPGGKTAHLLELGGEALQVTALEV
                     DAQRAERIHHTLARVGAQAKVLVADAGQPAQWWQQANGGQKFDAILLDAPCTASGIVR
                     RHPDVRWLRRESDVAQLAAIQTQLLDTLWPLVQPGGRLLYCTCSVFKAEGDAQVKAFL
                     ARNTDATHQPSPGHLIPGTTPIRDALPDNGAGDHDGFFYALFTKAL"
     CDS             358651..359268
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03280"
                     /product="hypothetical protein"
                     /protein_id="BBL22873.1"
                     /transl_table=11
                     /translation="MALFWALPGAQAQTLASATSTELLLEPAADTAVPVDGLLLRPAG
                     DKLQLSASLHFELPSLVEDALYKGIPVHFVQEVRMVSERWYWSDKVVAEVERHMRLSY
                     QPLTRRWRLYTGASPLSERGQGGVSLGVTFDTLEDAMSALRRITRWNVAELSQLPSSG
                     ELQLELQMRIDTAQLPRPLQIGNLGRSGWSMLVSRSKRVDAHEWR"
     CDS             359265..361619
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004523096.1"
                     /locus_tag="CT3_03290"
                     /product="PAS domain-containing sensor histidine kinase"
                     /protein_id="BBL22874.1"
                     /transl_table=11
                     /translation="MTTESGAPAALPAGKHAPSARTVRWTVGIVAAVMCAIGMVLLFL
                     LTLATNNRVLYERHYQWLFGLNVLVAGILLCVLLWMAVRLLVRWRQKKFGSRLLLKLA
                     AVFGIAGLVPGLLIYVVSYQFVSRSIESWFDVKVEGALSAGVSLASVTLETVAQDMAN
                     NTRTASAQLVQVPDAAAGLILERIRDQLGASDVVLWNSNGKAVGTAGQSLFALQPERP
                     SSQQLRTVRSQRPLATIEGLDDINPNDAQAVQQVRVRTLALVSNPSVGLLEEPRYLQV
                     VLPLPQALVTNALAVQGANREYQERALAREGLRSMYIGTLTLSLFLAVFGTVVLAVLL
                     GNQLARPLLLLAQGVRDVTQGDLRPKAVLQTNDELGGLTRSFALMTQQLADARTAVDK
                     SMVEVQSARTNLQTILDNLTSGVLVLDAQGRVLSTNPGATRILRLPMAAHLGDALSEL
                     PGLQGFAAMVQEQFALFLGEQGASMGRERWQLVFELGAGDQADGPRAGEVLHDKTSLV
                     VRGAELPGQRRLLVFDDISEIVSAQRSQAWGEVARRVAHEIKNPLTPIQLSAERLDMK
                     LSGKLPEAEQALLQKSVRTIVEQVGAMKRLVNEFRDYARLPAAELQALDLNGLVQDVM
                     HLYGEENARVPVKVELDPQCPRIAGDAQQLRQVIHNLLQNAQDATEQHAQNLGVAPPP
                     VRISTQWLETARRVRLTISDSGGGFPPHILQRAFEPYVTTKARGTGLGLAVVKKIADE
                     HGARIDLANRTEEGVAQGAQVSLSFVPENNAAASEGMATAHRST"
     CDS             361632..362345
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189647.1"
                     /locus_tag="CT3_03300"
                     /product="two-component system response regulator"
                     /protein_id="BBL22875.1"
                     /transl_table=11
                     /translation="MANILVVDDELGIRDLLSEILNDEGHSVDLAENATQAREARNAS
                     SYDLVLLDIWMPDTDGVSLLKEWATAGQLTMPVIMMSGHATIDTAVEATRIGAQSFLE
                     KPITLQKLLKAVEQGLAKAGSAPAPAASASTVYVERRDMAGSDLPASAAVPSMVAPLS
                     SRAGLHDAALSAHQGFDLDRPLREARDGFEKAYFEFHLAREGGSMTRVAEKTGLERTH
                     LYRKLRQLGVDLGRNKRNG"
     tRNA            362404..362479
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00070"
                     /product="tRNA-Phe"
     tRNA            362608..362683
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00080"
                     /product="tRNA-Phe"
     CDS             362949..363278
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03310"
                     /product="hypothetical protein"
                     /protein_id="BBL22876.1"
                     /transl_table=11
                     /translation="MSAPAGKQVPLAPMWRYRGEVLLRAVFALGGGYALSAAWAAAAG
                     LAAVQWLSMSRMDAVMWSTVLSFVVYAVVVLWAFACGSTRKVCAAIGGGTALLVAAAW
                     LLSGGQA"
     CDS             363275..364981
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064860.1"
                     /locus_tag="CT3_03320"
                     /product="iron-regulated membrane protein"
                     /protein_id="BBL22877.1"
                     /transl_table=11
                     /translation="MRLDGKPEGLRQSMSWFHTWSGLLLGWLLYAVFFTGTLSYFVDE
                     VNDWMRPELHVSVPQADTAEKALAGMQKLAPDASTWTISLPSVRQTAVAVSWRPQGAP
                     QGREGLQRAYLDAATGEVIPVRETRGGSFLYRFHFELYAMPRIWGRWIVGIATFVMLV
                     AILSGVITHKKIFTDFFTFRPRKGQRSWLDAHNATAVLALPFHIVITFSGLLLLMTML
                     MPWGVHAVYDGDTQRFNAERRGVVQNAAPQGGAREAGREGREGREGRAGRAGQADAGP
                     VALAPLGPMLQAAQAQWQGRGVAAITVQNPHTARARVELREEGSSSLSNRGSGQRLVF
                     DGVTGQLQEAPAPRVPSAINTFIGSVSGLHLGRFADPAVRWLLFLSGVVGTLMAATGM
                     VLWVVKRLPERRKRGFTPRGHRLVEVLNVASIAGLSVAVAGYFVANRWVPVGIAERAE
                     TEIHWFFGIWLACLVHAALRPHAKAWLEQLALAAVAFAALPLLNAATGGAGLWHTLAR
                     GQWSVAGFDLMMWALALLHAAVVYQLWRRQRAAQPAKPAAVASGGSALPKTALQAPEQ
                     QP"
     CDS             364978..365310
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815588.1"
                     /locus_tag="CT3_03330"
                     /product="hypothetical protein"
                     /protein_id="BBL22878.1"
                     /transl_table=11
                     /translation="MNTWIALLWGVPAFAALSLAMERHHEQMVGEELGIRRMWLWRAV
                     GTALLLGSLLVCLHGWGLSVAVAAWLGVLTFAALFTGLMLTYAPRQLRTVATVCAVLA
                     VAGLGLLR"
     CDS             365438..368986
                     /codon_start=1
                     /gene="recC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HWB5"
                     /locus_tag="CT3_03340"
                     /product="RecBCD enzyme subunit RecC"
                     /protein_id="BBL22879.1"
                     /transl_table=11
                     /translation="MAAAQQAPDTAWQPGLIALHGNQTEALADTVLAWLAAHPLQALE
                     PETVLVQSNGMAEWFKMRMADTLGVCAAARVELPARFVWRSYRQILGKDAVPRESPLD
                     KTPMIWRLMRLLPQCLALPEFAPIANFLRPGEPQRLLQLAERLADLYDQYQIYRADWL
                     EAWAAGQDVLRNPGRPDVPVPAVQQWQPALWRAVLAELEPHERAATRPALLARVLGAL
                     QSGQPPVSPLARRVVVFGMGQMPLSLMQFLSGIAQHSQVLIAVPNPCRFHWADAIDGR
                     ELLRQERRRHAHKGGRDLAQIPLEAMHAHAHPLLAAWARQSRDYVRQLDAFDTTSSTA
                     AQWNWPRVDVYDEADAQDLAQAPLLTQVQQRIRDLVPLAEHPPLAIAASDRSIVFHTA
                     HGLVRELEVLHDQLLQLLAQPPGAGQAALAPRDVVVMLPSIEEAAPAVRAVFGQYGRH
                     DARHIPFDIADVGARASSPLVTALQWLLRLPQQRCRLSELCDLLDVPAVADRMGLAAD
                     ALPQLTQWMAGAGIRWGLNHAQRAQLGLQACGDPNSAWFGLQRMLLGYASGGAMDVPA
                     QAFSGIEPYDEVGGLSAELAGSLASLLQRMLQWWQTAQQPAAPAVWAQRFRMLLEDFF
                     RSRSDEDQALLAALDQALVRWQTACEQAGFEADLPLVVAQEAWLQALSEPALEQRFRA
                     GGVTFCTLMPMRAIPFEVVCLLGMNDGDYPRRASRSDFDLMAQSQQQRPGDRARRDDD
                     RQLMLDALLSARRMLYISWAGRHVRDNSEQPPSVLVSQLRDYLAQGWQGDAAAQGDLL
                     AQRTRQHPLQPFSRRYFEDGSPLHTYAREWHAAHAADSAATAPGMPPLELDPDVPLNL
                     ARLADFLRHPARAFLRHRLLVRFEQEDEVVVDDELFQVGGLTAYQLVQQLQQDVVALM
                     AGAAPVDVPQQVALQVQRLARAGRLPLAGVGAREAEALQQQVVPSLRCWQAVMQDWPQ
                     TAPRQRVLLREGEVVLDDWLDGLRQRPDAISLGDGERGGHFDQAWFAMDPRTLLDKEG
                     AVRPDKLLGFYVRSLALSATGSPALGCVVARDTVLWALPMAQADAQARLQQLMQLWLQ
                     GQNAPLPLPLRTAMAVAAGDLQAAEQAYAGSHVLDGECQDPSWARCYPGWDELLASGA
                     LDTLALAAYGPLLDWSSTCLWVDRGTHGVHAGEPSA"
     CDS             368983..372771
                     /codon_start=1
                     /gene="recB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q889H2"
                     /locus_tag="CT3_03350"
                     /product="RecBCD enzyme subunit RecB"
                     /protein_id="BBL22880.1"
                     /transl_table=11
                     /translation="MSTVNASYTSSGHVLDAIRFPLWGSRLIEASAGTGKTWTIAALY
                     LRLVLGHGGEQGFVRPLMPPDILVMTFTRAATRELSDRIRARLIEAVQCFRGEAEPAA
                     HDQFLRELRDAYPQGAVREQAAWRLDMAAQCMDDAAIHTIDAWCQRMLREHAFDSGNL
                     FDEVLEPDESQRQIEAAQDYWRQQCYPLSGELLEQALAVWPHVGALVADMQALLRVPV
                     PPAAGAGTLAACIAAAQAQQTQTLQALAAGWEQKAQDLEDWLDGQLAHHKTAWNGLKL
                     KPANYKGWLQTVRRWAAAPHPDLAAQLKTGATRLVPAGLEEARKGGAPVDLPPASQEL
                     AEVLQALAQLPSLRSSLRLHAAAQVQLRLQWLKQQAGTFGFADMLQRLDTALAGDNGP
                     ALRASIQAQYPVALIDEFQDTSPLQYRLFDQIYRTRDNSTDSALLLIGDPKQSIYGFR
                     GADIYSYLQARQATAGRHYVLGTNYRSTQALVQAINHWFAGAEQRPGEGAFMFRTSSA
                     QNPLPFEPVAAQGRREVLMEGATSMPALTVVWDGEVSAEPLSSDAIRRRFAVHCADQI
                     VRWLMDASTGYAEDGQPLQRLRPADIAVLVRTGKEAAAVRRALAQRAVASVYLSDQDS
                     VFASDEAQDLLYWLRAVAAPLDALAVRAGLATRLMGWSLEALAQLAADEEAFDAHSEQ
                     LKELHGIWLRQGVLAMLRQTLYRFQLPARWLASIGGERRLTNYLHLAELLQTASAQLE
                     GEQALIRWLATEVDSPGGGGEAQIVRLESDADLVKVVTVHKSKGLEYPVVCLPFAGSF
                     RAVEKRGTAYLSLPVQGEAGPARELVLDFDSTQLARADRERLREDLRLLYVALTRPRH
                     ALWMGMAPMKRGNGKACVNEQGAAGYVLAGDAVHSVQGWRAQLQALAQGCPEIRVVDA
                     PAELPAVQRWQPPAAAPALRPAQPYAAEFDRRWGIGSFSALTRAMAAVSVPVLPVVAL
                     HPADDEVPSTAGDATPPPSDLGLEGLPLPSADTGTAAVWHRFMRGPVVGNFLHDQLEW
                     LAGEGFALPPAPPDEGAAPDELETRLLRRCERAGRKDQGLDVLRWLRAVVHQPLVPLS
                     VSLAQLGQEGAVLAEMEFWLPVQQLSAPRIDALCRQFILPGMERPALPQRELHGMLMG
                     FADLVFCHAGRYWVLDYKTNHLGADARAYSAEALAQAMLEHRYDVQAALYLLALHRLL
                     RSRLGDAYVPAQQLGGALYYFLRGIDGVTQGMQVLPQSPDLLRLLDALDAQLGEEVLP
                     "
     CDS             372768..374825
                     /codon_start=1
                     /gene="recD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HWB7"
                     /locus_tag="CT3_03360"
                     /product="RecBCD enzyme subunit RecD"
                     /protein_id="BBL22881.1"
                     /transl_table=11
                     /translation="MKAKRVRDVQTLDLFAAPELSVADSLTVLDRFSDAGLLRRLDTA
                     LARFVHSQDAAAEPALLVAAAVLAQMEGRGHSCLPLQALVQAPNSVLAWPAEALAAQQ
                     ALWAQLPSDVAPWLATLARSPVVRVVGRDADAGQPLVLLPGAEPLLYLRRYWDYERTV
                     AEHLARRTTVEGQAVDDAAVRHWLDRLFGPPQPQAPLDWQKLACALALRGRLSVITGG
                     PGTGKTYTAARLLALLFATAPDAQQLRVALAAPTGKAAARLKQSIDAALLQLHDAVQP
                     GLDLKTLVQRMGAARTLHALLGARPDTRHFRHHAGHPLDVDVLIVDEASMVHLEMMAA
                     VLQALPPTARLVLLGDKDQLASVEAGAVLGDLCRGAQDGGYLPDTVAYAQRVAGQSIA
                     PAFTTAQAATPLAQHTVMLRESRRFGGPIGELALAVNAGDAAQAQHLLLEQTRSGLDG
                     ALWAHQGGPATAIAAMAVQGRGTQAGYAAYARQLQAGRAARWDSEAAHQDWVRSVLAA
                     FDRFRLLCAVREGDWGVAGLNRAIEQVLERQDLLRKDGEWYLGRPVMVTRNDAQLGVS
                     NGDIGMALPSWADPARLRVYFAQGEQLHAVSTARLAQVETAFAMTVHKSQGSEFEHTA
                     LVLAAQGGHVLNRELVYTGITRARQAFSLWSEGPGLLASAIGSPTQRSSGLLRFLGAP
                     PAA"
     CDS             complement(374904..375317)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006313628.1"
                     /locus_tag="CT3_03370"
                     /product="dioxygenase"
                     /protein_id="BBL22882.1"
                     /transl_table=11
                     /translation="MQSLFHLAYHVTDLDAARRFYGGVLGCREGRSTDTWVDFDFFGH
                     QISLHLGQPFAVANTGKVGNHMVPMPHLGVILLKPEWLALAERLKAAGTQFVLEPQVR
                     FEGEPGEQWTMFFYDPSGNPIEVKGFTSWDAVYAH"
     CDS             complement(375509..376957)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708927.1"
                     /locus_tag="CT3_03380"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BBL22883.1"
                     /transl_table=11
                     /translation="MSRYDNLINGQWTAAATYSPNTNPSDLSDVVGDYAQGDAQDVQA
                     AVAAAVAAFPAWSTSGIQARSDALDKIGSEILARKEELGELLAREEGKTRPEAIGEVG
                     RAGQIFKFFAGECLRLSGETVPSVRPGIGVEITREPIGVVGLITPWNFPIAIPAWKIA
                     PALAFGNCVVLKPADLVPGSAWALADIIHRSGIPAGVFNLVMGRGRVIGEALVNHPGV
                     AAISFTGSVGVGRGIAEACVKNGKKVQLEMGGKNPQIVLDDADLNQAVELSAQSGFYS
                     TGQRCTASSRLIVTDKIYPAFIEALQARMAKIKVGDARAAGTDMGPVVSQAQLEQDLS
                     YVEIAKAEGARLAAGGSRVACHTGSGKDGFYMAPTLFVDTEAGMRINREEVFGPVASV
                     IRVKDYDEALAVSNDTPFGLSAGIATTSLKYATHFKRHSQAGMVMVNLPTAGVDYHVP
                     FGGRKGSSYGPREQGRYAQEFYTTVKTAYTLA"
     CDS             complement(377114..378451)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268234.1"
                     /locus_tag="CT3_03390"
                     /product="glucarate dehydratase"
                     /protein_id="BBL22884.1"
                     /transl_table=11
                     /translation="MSTTPTITEIEVIPVAGRDGMLMNLSGAHAPYFTRNIVLVHDSA
                     GHTGVGEVPGGEGIRQALEDSKQVLIGRSIGQHLQLLQAVQKSLEGRDTGGRGLQTFD
                     LRIGVHAVTAIESALLDLLGQHLGVPVAALLGEGQQRDRVEMLGYLFFVGPSDQTDLP
                     YVKPGEDTLGTDSWTQVRHMTAMTPEAIVRQAEAAHARYGFNDFKLKGGVLAGEQEVE
                     AVTALARRFPEARVTLDPNGGWLLKDAIRLMRDMHGVLAYAEDPCGAEGGFSGREVMA
                     EFRRATGLPTATNMVATDWRQMVHALSLQSVDIPLADPHFWTMAGSVRVGQTCRDWGL
                     TWGSHSNNHFDISLAMFTHVAAAVPGKVTAIDTHWIWQDGQYLTQNPLQIRGGFVEVP
                     QTPGLGVTVDRAALQRANALYLEHGLGARDDAIAMQYLIPGWKFDNKRPCMVR"
     CDS             complement(378497..379462)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064103.1"
                     /locus_tag="CT3_03400"
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase"
                     /protein_id="BBL22885.1"
                     /transl_table=11
                     /translation="MALSRPRVLQYGKMPLPQLDTDLAQRYDVHILSQQADPDRFLAE
                     HGAQFEYVVTSAAMGLPARVVQALPNLRFVSSFGVGFDSLDKDALLQRGARVGYTPGV
                     LDDCVADLAFALLLDATRGLSESDRFVRRGDWSQGRFGIRTRASGKRLGIFGMGRIGS
                     TVARRASGFDMEVAYHNRRPVEGSPHLYLPSLLELARWADILVITAAGGEGTRHLVNA
                     EVLAALGPQGFLVNVARGSVVDEAALADALAHQRIAGAGLDVFEDEPHPLPALLALDN
                     VVLAPHIASGTHETRRAMADLVLHNLDQFIATGRPAAEVPWSAAQ"
     CDS             complement(379572..380531)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003812927.1"
                     /locus_tag="CT3_03410"
                     /product="lipoprotein"
                     /protein_id="BBL22886.1"
                     /transl_table=11
                     /translation="MKKILIALGCALSLTAQASGNFPEKPVNVIVPFPAGGSTDMVAR
                     AVALSMGEQLGKPFVVENRPGATGTIGAGAVKRAPADGYTLLVASLGPFVVAPHLIKN
                     VPYDATKDFDYITIPVQAPNVLVASTSQKARTVAEVIAALKAQPGKLSFASSGNGSSD
                     HLSAELFWQQTGTEAMHVPYKGGAPAITDLLGGQVDFSFQNVNAVLPHLRSGKLRAIA
                     VTGTQRSPVLPDVPTLAEAGVKGAEVYSWQGMAAPKGLPADVKAKLAKAAIAAVQQPE
                     LRKRFMEQGLEIVGNTPEEFTRFQAQENERWKQLIQTRKITAD"
     CDS             complement(380580..381491)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87WJ7"
                     /locus_tag="CT3_03420"
                     /product="putative 5-dehydro-4-deoxyglucarate dehydratase"
                     /protein_id="BBL22887.1"
                     /transl_table=11
                     /translation="MTPQDLKDVMSSGLLSFPVTDFDAQGNFNAKGYAARLEWLAPYG
                     ASALFAAGGTGEYFSLYGEEYGQIIKTAVDTCRGKVPIIAGAGGPTRTAIAHAQEAER
                     LGAHGILLLPHYLTEAGQEGLIAHVEQVCKSVKFGVIVYNRDRSRFTPESLAILAERC
                     PNLVGFKDGMGNIETMSSIFMAMGDRFAYLGGLPTAEVYAAAYKALGTPVYSSAVFNF
                     IPKTAMQFYEAVRTDDQATQHKLLKEFFMPYLKIRNRVEGYGVSIIKAGAKIVGHDAD
                     PVRAPLSDLKPHEMEELKALIDKLGPQ"
     CDS             complement(381530..382507)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813988.1"
                     /locus_tag="CT3_03430"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBL22888.1"
                     /transl_table=11
                     /translation="MVRRSRVLRSLLALTAASLLASPLLAADNWPSKPIRLVVPYPPG
                     GSSDIIARSIGQLISQELKQTVVIENKPGANGNLGAEFVARAQPDGYTWLLCDLGALA
                     ISPAVYTKLSFDPSKDLRGAAMLAYSPHMLVVHPSVQARNLQELVALSKKQDLNFAVT
                     ANGSAPHLAGVELARLTGAKWVYVPYKGGVQSVQDTVAGQTQVLMNGMLATYPHVQSG
                     KLKLLGISKSTRMPLIADVPTLAEQGAQGFASGTWQGVVLPAKTPEAVVQRVNQVLLT
                     AIRSPEVRARLTGQGAEVVTMTPTETDKFFNAERARWRTVVQTAQLQLD"
     CDS             complement(382669..383484)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007243745.1"
                     /locus_tag="CT3_03440"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBL22889.1"
                     /transl_table=11
                     /translation="MAMRSLTSELPQASPPSVLPEGAALRSKAGRGSRNLASLLSEEF
                     GHKIRQGLLREGDKLPTESELVRSYDVSRTVVREALSKLQAAGLVETRHGIGTFVLPA
                     QHNPGPVLSAHELSESVDVLAVLELRISLETEAAGLAAQRRQPQDLEAMRAALQAFEY
                     HFAQGNDTVEHDLAFHLSITQATGNRYFRDILEHFGTLLIPRNRITSIHTSPRDPDYL
                     RRVNREHEEIFSAIERQDADSARAAMRIHLTNSRERLRLAQRLSQAANLPSDT"
     CDS             383644..385227
                     /codon_start=1
                     /gene="garD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z3K0"
                     /locus_tag="CT3_03450"
                     /product="galactarate dehydratase (L-threo-forming)"
                     /protein_id="BBL22890.1"
                     /transl_table=11
                     /translation="MGQALYIRMHAQDNVAIVVNDGGLPAGTVFDDGLTLVQKVPQGH
                     KVALVDLAKGAAVRRYNVTIGYASQDLPRGSWVNEQVLQMPDAPELEGLPMATVRPDP
                     LPPLEGYTFEGYRNADGSVGTRNILAITTTVQCVAGVVDVAVQRIKAELLPRYPQVDD
                     VVGLEHTYGCGVAIDAPDAVIPIRTLRNISRNPNFGDEIMVVSLGCEKLQPERLLPAE
                     APLRPMPHPGAAPAAGAAPAAASVLDVVCLQAEEHTGFMSMIDSIVRQADVHLQRLNR
                     RRRETVPASELVVGVQCGGSDAFSGVTANPAVGFASDLLVRAGASVMFSEVTEVRDGI
                     DQLTARASSPAVAQAMVDQMAWYDAYLARGRADRSANTTPGNKKGGLSNIVEKAMGSI
                     VKSGSAPISGVLAPGEKLQQKGLIYAATPASDFICGTLQLAAGMNLHIFTTGRGTPYG
                     LAACPVIKVATRSDLARRWHDLMDVNAGRIAEGSETIESLGWELFHLMLEIASGKKTW
                     AEHWKLSNALVLFNPAPVT"
     CDS             385313..386308
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012709158.1"
                     /locus_tag="CT3_03460"
                     /product="MFS transporter"
                     /protein_id="BBL22891.1"
                     /transl_table=11
                     /translation="MQRRQLLKAAAAPLVLAGLPAAVQAQGNWPAAKNITYMVPFATG
                     GTTDTLGRLIAQQLGPALGTTVIVENRGGAGGSVGSELAARAQPDGYTLLGGTISSHA
                     INISLYPKLGYDPVKSFTPITLIGTNPLVLVVAANSPYKSLQDVLEAAKKRQGGLSSA
                     SAGAGTSQHLALEMLGWKSGVKFTHVPYKGSGPAIQDVMGGQVDMMFDTTVVAAPHIQ
                     SGKLRALAVTSKQRLEALKDVPTVAESGVSSLANFEVTSWQALFAPSGTPDAIVQKLH
                     QEVAKIIATPDMKARLKTMGMEPSTLSPAQIAEFQKTEVAKWAAVIKEAKVKVDS"
     CDS             386335..386838
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03470"
                     /product="hypothetical protein"
                     /protein_id="BBL22892.1"
                     /transl_table=11
                     /translation="MRPGRPPLPQGTGTPLPVPRQAQAGAIPCRPAGGLAYNVTMRPL
                     APHALHRWTRWVLAAWLCVALGAALSPLARAQAGAGALEPLCGLDGARHWVASPAAQL
                     LGDDAAAAAHGLDCPLCLPLLAPPPPVVGQHAALAPGMAPPAGLRSIPWVYRVAAALP
                     ARGPPHS"
     CDS             386994..387509
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267564.1"
                     /locus_tag="CT3_03480"
                     /product="transporter"
                     /protein_id="BBL22893.1"
                     /transl_table=11
                     /translation="MFATSLTRRVALAAGLLATTSLAWSHADAAHVTAENAWARASVP
                     GQQATGAFVRLTAKEPLRLVGVETPAAAVAEVHEMKMEGDVMRMRAIDSLDLPQGVAV
                     ELKPGGYHIMLQQLKAPLLKDTQVPITLVFKDGKDAVSRLSLQVPVQAMAPKGAAAAP
                     AGHAGHGGHQH"
     CDS             complement(387617..388858)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03490"
                     /product="hypothetical protein"
                     /protein_id="BBL22894.1"
                     /transl_table=11
                     /translation="MAMSPEAVAEFMRRAAQSKREARPHYVDEDTEKALRTRGDTLID
                     LSLARYSWHRAVVSELFQSSAPDSPIRLACLANRSLPEFPSCLIGEEPGPMAEWLLSA
                     SSNELRALLENPTLTNPFLYGLLERKQGWESIDDDHLRHFVSFLDLSPQMRMPSPDFS
                     LVNENKVLEAAWKLAETVPATEAWAFTLGHLFEQLETDYVSIEKPLVIAARWHVAPDD
                     AEANERQAMAHRNGSLGNWERVRKGLARLALRVESLDSMLASDDIAFRAAAYSMERLN
                     AKQLRAGYKKDGELLLVEAIGNMRLWQTRVTRRTLRDFVWDDQTSNAIDRYHRKEQEV
                     RKKHPKWFDYEFGGQAMDDGNADNPFPATKADIFTLSSQLNHNAIGLNDIVPVLRALG
                     NRTSWIWCFSLGALVASVLHF"
     CDS             complement(389560..390246)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003812272.1"
                     /locus_tag="CT3_03500"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBL22895.1"
                     /transl_table=11
                     /translation="MTRNAKALHQTIRDQLRYEILSGALPVGQPLKQDALATRFHASR
                     IPVREALRQLEAEGLVTHQLNRGAVVAGMSLLQICDMLDIRIALECHAAKLGVPNMVE
                     RDFETMEQILAAYDAATTVPEWGEYNRRFHLALSAASNNRRLHQLIEEFCLNTDRYTH
                     VLISQATGKEGPQSDHYKIVAACRRHDTATVVQYLEEHIQSTKRELLAMQRPTANQPV
                     LANPAEQQGH"
     CDS             390354..391979
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010929798.1"
                     /locus_tag="CT3_03510"
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="BBL22896.1"
                     /transl_table=11
                     /translation="MSCINSSHIAVNEPVLSYLPGSAERTQLQAALEQQHAQCVDLPL
                     VIAGRHQQRSDTVEVVSPHAHQHRLARLSQATPADVEQAVQAACAAQRDWSQWSLDAR
                     CEVFLKAADLLAGPWRQKLNAATMLGQSKTVQQAEIDAACELIDFLRFNVQFAQELAA
                     QQPLSSPGVRNRMDCRPLEGFVYAITPFNFTAIGGNLATAPVLMGNTVVWKPSATASL
                     SNYLFMELLEEAGLPPGVINFVPGDPQVVSGAVLSSPHLAGIHFTGSTAVFDSLWQQT
                     AQHLPHYRAYPRLVGETGGKDFVLAHPSADAAALAAALVRGAFEFQGQKCSAASRAYI
                     PSSLWPQVKERMLAMLAEIRMGDVRDFSNFMGAVIDRKAFQRIKGYIDAARTDSRCQL
                     VAGGTADDSEGFFVAPTVIQVSDPQHALMREEIFGPVLAVYVFDDGQWDAVVQLVDQT
                     SPYALTGAVFARDRQVLAQLGQALRFAAGNFYINDKPTGAVVGQQPFGGARRSGTNDK
                     AGSAWNLLRWVSPRTVKETHLPPTGHAYPHMQR"
     CDS             392077..393192
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204184.1"
                     /locus_tag="CT3_03520"
                     /product="branched chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="BBL22897.1"
                     /transl_table=11
                     /translation="MTFKMRSFYAATALLGTLSVTPVVQAQETVNMGAVLSLTGANAT
                     VGEDVRRAVMLAVDKVNADGGVLGKKFGVIVEDSGGNPTTALNAARKLASVDKVPVVI
                     GEYSSGITLPMAQYLVKEGVGHINVASTSTKVRELGASSFNLIGLENLGNQFSAADTW
                     ALGYRKVAMIAPNNAYGQGVAHGFKQEFEKLGGKVVTELLYTAGQSTYRRELQQVSRS
                     APDAYIYTAYGQESAVLNREAYELGLRKSPWYAILLSMSLSDTPANIANGQLGMEVGN
                     VYGDAGKAYQAAFNAKYKEGTKTSYTGYAYDAVLMTAAAMNKAKSTDTDKVQAALKDL
                     GKGGYVGVTGPIVFDAERQRIDPPYAKLKYDGKVVPR"
     CDS             393268..394161
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003809695.1"
                     /locus_tag="CT3_03530"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BBL22898.1"
                     /transl_table=11
                     /translation="MLQFLVDTLLRASDLALIALGLSMVYGLVKFPNIAHVQYAMFGA
                     YVTYAMHASGVPLVLAIAISCAVTGALTLGLHLLVFRRLLRAGPAIAMIGSLAVAMLV
                     VAFMQGFAGSFPRMFNLPLTEPILIGEARVTATQLYFVGTTVVLLLLFAMLLFFTRTG
                     RAMRALASNPALAAASGLNAEGITRGVAFASGAIAGLGGSMLALSTGAHINLGYDLLL
                     PVFAAAILGGLGNPLGAVAGALLIAATETAVTNIDFGGLVGGDPLFMPVAYISAASFL
                     ILLLALLFKPYGLFDREVRRV"
     CDS             394154..395041
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391162.1"
                     /locus_tag="CT3_03540"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BBL22899.1"
                     /transl_table=11
                     /translation="MFDFLISSVTVAGIYALMALGLNLQAGYSGLLNFGHIAFAGIGA
                     YATGIAIQSGWGGFSGAAIGVCVAMALGWCIARLGRNLASDYWGIATLAIAEILRTAA
                     TNEVWLTGGAQGISAIPSLFDGLGRPWNAIAFLALVLLAVLVFALACRRVGNGRFGRA
                     LRLMREEPQLAACMGYDLRSLKSRAIMSGAALTALAGSLYAHYMSFVGPDYMLASETF
                     WLWTMLMIGGLGNTAGVLVGVVVVQGAYALVPFAKDYFGFSSDISGALRLGLIGFILL
                     ASLMWRSQGLVPEKVRKIA"
     CDS             395038..395835
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011727509.1"
                     /locus_tag="CT3_03550"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL22900.1"
                     /transl_table=11
                     /translation="MSSLLQVQSLAKAFGGNKVLEDVSFDIAAGEIVGLLGPNGSGKS
                     TLLNTVTGFERIDRGSITLEGRRIDALSAYRIVESGLGRTFQLPSMPTKMSVMEVAMA
                     AATQHHGFWETLLNTVGARAAEKAARDKAAALLDELLLSHVKDLPASGLSGGQKKLLG
                     IVCALMGDPRLLMLDEPTAGVHPNLRNDIVQVLRRLNHKGMTVVIVEHDMHFIREVCT
                     RCIVLDRGHIVASCRPDELSSNERVLQAYLGGGHAPKTETRAEVEGA"
     CDS             395832..396551
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011055908.1"
                     /locus_tag="CT3_03560"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL22901.1"
                     /transl_table=11
                     /translation="MIEIDNVVAGYTAEVDILKGMTLQVQRGEIVTLLGPNGCGKSTL
                     LKSIAGFLRPRSGSIVLESKDVSQVPVHQKIQKLGLGFVPQTENVFSSLTIRENMQVG
                     GHFMSDADCKQRMQELCTLYPVLERKFNAPASSMSGGERQILALARALMPRPRLLLLD
                     EPSAGLSPKMLQEVFKAIVQVRDKEGVTILMVEQNAMEALRMSDRAYVLSMGTVALTG
                     AANSLMSDPQVRELYLGGRAA"
     CDS             396616..398217
                     /codon_start=1
                     /gene="tsr_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205290.1"
                     /locus_tag="CT3_03570"
                     /product="methyl-accepting chemotaxis protein I"
                     /protein_id="BBL22902.1"
                     /transl_table=11
                     /translation="MFQHLSLRSRLAAAMGFLALLLAVLGALGLYSLRDSNLALQSLV
                     EQQLQPMQQLAQVTKSLDMGKFGVVSAIADPIQIDSDMDALEAQLQDSASTWEAFASA
                     LRDGQEQELAQQFAAAQQEFLQQGVRPAVAALRSMNLPGATELYTQSLAPRYPPARTA
                     LDALMALQRQRGEALYRATQQRYQQVFWLSVAAMCLGLLVAGAAGVTLVRAIARPLAQ
                     AVQAAQHVAAGDLSQDIPTSPARHETGQLLQALQQMNLRLRHIVGEVRQGTDAMALAS
                     QEISSGNRDLSQRTECQAAALQQTTASMHDLNEAVQRNAEHAQQASALAASATQIAQQ
                     GRSEVDAVAQAMGHIQGASQRIVDITAVIDGIAFQTNLLALNAAVEAARAGAQGRGFA
                     VVAAEVRELAQRSAVAAKEIKGLIQHSVHEVEQGRARVAQAGGTMATVEGRVQHMAAL
                     VQDIAQSSQAQSAGLGQLHQAIAQMDDTTQKNAALVEQASAAALALQQQASALVDTVR
                     VFRLDGVAVPAARVLPAAERTLLLA"
     CDS             398368..399309
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03580"
                     /product="hypothetical protein"
                     /protein_id="BBL22903.1"
                     /transl_table=11
                     /translation="MSDHTPFGFGKFIPGFDFLQNLSKAGQSSAGMPPLSHWVAPTVS
                     IEEISKRIEELKAVQFWLEQNSRALAATVQALEVQKMTLSTLQGMNVSMADLAKTFTG
                     KAADKTATAQPSGNADWPMSSSAAKAAKSEAPEADPQNTAAASDAQAAAQPGAAQADA
                     SAPPPGAGPAGLGDPMLWWGALSQQFQQIAATALQDPAQQQAMAQATHMATDFTKAAM
                     NAASSMVRQASEGVKAASSAAAQTTAKAAKPAASRSAGAPSATPRSAAAKKASAAKKV
                     SAAKKAPAAKKAAPQAARTAAPKAAAKPAAPARKRSR"
     CDS             399327..400562
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P9WKS7"
                     /locus_tag="CT3_03590"
                     /product="hypothetical protein"
                     /protein_id="BBL22904.1"
                     /transl_table=11
                     /translation="MAFFPCAHASHAQWQQALSQVVAQLRAQMAMQSGQAWPALGLMY
                     LTTPYAAHAADILASVAKELPEVSHWSGMAAPAILGGDMRYAGEQGALAVMLPLLGTA
                     DFRQFSGLQPIARVEVEGFEVHSVLVHGDGRMPELEELLLELASHTASGEMMGGFGSD
                     RRCGIQLAWSRKLPVAHDTGLLSGGLSGVAFSDQVHTLSRVVQGCKPIAPPMEITEAR
                     DHVILGLNGRPALDVLMQTLDVQLEVDAQAAISRVRNTLLALSLDTYTPHGSSIDVRS
                     RVRPIVGLDPLRRGIVLDETVDKGMHVAFCERSSAAAWSELRRACAEIQEELAPDIPW
                     PQAGVPAPARMVRGAIYVRSHLRGGTAATNEADAELQLIRHALGPIPLVGFVTAGEIS
                     GREVHGMSGQLTVFTQALV"
     CDS             complement(400636..400947)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03600"
                     /product="hypothetical protein"
                     /protein_id="BBL22905.1"
                     /transl_table=11
                     /translation="MSHTPALTTRLLLGAALALTAALASAQPVYRAAPGAPLAVEVRH
                     DGRHMHRPPPPPPRYERHRPRAGHAWVSGHWRWQGHRYVWIPGHWVKAPRHHRPYYGH
                     R"
     CDS             complement(401094..401825)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03610"
                     /product="hypothetical protein"
                     /protein_id="BBL22906.1"
                     /transl_table=11
                     /translation="MSTTIDLIHALKKELKAAHMTYADLARHLDMAESSVKRMLSKGD
                     MPLSRIDAICRALGVDFADLARRVADSQPLLQEMTPEQETAVVADRKLLLMAICVLSQ
                     WTLEQITATYRMTEAEGIRYLAQLDRIGIIELRPGNRYRLRLAKTFRWRARGPVMEYF
                     REHAVLDYFGGSFDQPGETMLMVHGNISRALAPSFVDRIQRLAHDFSQQHLQDQRLLP
                     EQREGYTLVLGMRSWEFTAFTALRR"
     CDS             402034..403977
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_009937746.1"
                     /locus_tag="CT3_03620"
                     /product="MFS transporter"
                     /protein_id="BBL22907.1"
                     /transl_table=11
                     /translation="MQQPDHDHHAPSEPHPNQFALLGQRRFAPFFWTQFCGAANDNLF
                     KFAFTVMVTYQLSVGWLPHAMAGLVIGALFILPFLLFSATSGQLTDKWDKTRMFRLVK
                     NLEIAIMAIAAWGFFTANVPVLLGCVFLMGLHSTLFGPVKFAYLPQVLNDRELTGGNG
                     MVEMGTFVAILLGNVAGGLLVAVPEVGHTQVAVVCVALALVGRLCAQFIPHAPATDPG
                     LVINWNPFTETWRNLQLARQQPVVFRSLLGISWMWFFGAVFLAQFPSFAKEVLHGDEH
                     VASLLLVIFSIGIGVGALLCEVFSRRQVEIGLVPLGAIGMSVFAIDLYFAAHALPPSD
                     LMGVGTFFAQSVHWRVMWDLGMLALSAGIYSVPMYALIQMRSQPTHRARIIAANNILN
                     ALFMIASSVLAGALLAAGASIPQVFLLTGIANALVAFYVFLLVPEYLLRFVAWVITHF
                     VYRFRVRGADHIPAHGAAVLVCNHVSFVDAILMMAASPRPIHFVMDHRIFQTPVLGWL
                     FKLAKTIPIAPQKEDPATYEAAFARAAQVLREGDLLAIFPEGGITADGQLQPFKPGIL
                     KILEQARADGLEVSVVPMALTNLWGSYFSRIEVRGGRNVAMVQPLRRGLFNAVGLEVG
                     DAVPAAQVTPEGLRTRVAALLAR"
     CDS             complement(403998..404714)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03630"
                     /product="hypothetical protein"
                     /protein_id="BBL22908.1"
                     /transl_table=11
                     /translation="MVLALGLGMAAHSRAQTAPPVVPAFSAMAAGAVPAPWHFASLPR
                     KKPTEFSVAPLDGQQVLRVHTQDAYGNLVLAIGSPGSSARQLHWRWRVDQPVQGADLR
                     QRAGDDAALKLCVSFDFDARQLSWSERTKLHLGQIATGEPIPTETLCYVWDGTSPAGS
                     VLHSPFTHRLRYLVLHGSNAPLGRWQEEKRDLAADYARAFGDESPQGMPALTAITVSA
                     DADNTHGEGLAYLGDIHLLP"
     CDS             404983..405504
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03640"
                     /product="hypothetical protein"
                     /protein_id="BBL22909.1"
                     /transl_table=11
                     /translation="MQITFKETFVHIPTAFTRRITAAWGRSLRHSLCALGMAGALWGG
                     AGAAHAQSDTSLVLSALPLASMVAVASQGGASEDVLAAPLLVSGVGASLLVEGVEASA
                     HGVVYVVKNVATGASAVLEVSGNAVGAASVGVGTVIQSSAIGAGVVLSAAGKVLAFIP
                     NAVGKALLHNERL"
     CDS             405536..406351
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038687.1"
                     /locus_tag="CT3_03650"
                     /product="membrane protein"
                     /protein_id="BBL22910.1"
                     /transl_table=11
                     /translation="MHPLHCSLPRLASLLCLALATLAGNAHAGRNCDAKPLNVETLTQ
                     GLNLAQRTAQVLEAEYQKNGSKVLLLARAGQDLSSYQLQYSHFGWAYRTPEGPWRVAH
                     KLNICGTADGWVYRQGLGEFFLDDLWRYVAAVQVPTPAVQQALWSYLTAPQTVLRMQH
                     QPYSMVSYAWGQKYQQSNQWAIESLAAAMEPATVQQRSQAQAWLKFKGYEPSTLTIRS
                     WTRLGGRMSAANIAFDDHPNDQRFTSRIQTVTVDSVTQWLQRAQLAGAPRVVQ"
     CDS             406420..407526
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004550375.1"
                     /locus_tag="CT3_03660"
                     /product="hypothetical protein"
                     /protein_id="BBL22911.1"
                     /transl_table=11
                     /translation="MSKSLRLPEKWFRRGLWLVAVVFASFLIGLGGLVVGNLPQAERV
                     QEVEDFIPAADAERVRAALRQAQAVERQADKARDTARLKYDAEKARYQSARESFDNWV
                     ATRRATERPEQDSELIARTQALDKIKQAENQARQLLEQVEQTSLAASQNVSAADNEWR
                     ELRDAAYPDWLARQREVELRVFLYRLAITLPLLVAAGWLFARQRKSTWWPFVWGFIFF
                     ALFAFFVELVPYLPDYGGYVRYIVGIVVTVLLGRYAILALNRYLEKQKLQEALPEVQR
                     RVELGYDVALGRLAKSVCPGCERPVDLKNTEIDFCPHCGIGLFDHCGHCNTRKSAFSR
                     YCHACGTPAKETPSALGVPLGMAGPGHSAPPSST"
     CDS             complement(407635..408819)
                     /codon_start=1
                     /gene="tgt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63R05"
                     /locus_tag="CT3_03670"
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="BBL22912.1"
                     /transl_table=11
                     /translation="MRAIMLQFDLLKTDPTSHARRGTVTLNHGKVQTPIFMPVGTYGT
                     VKGVMPRSLEEMGAQIILGNTFHLWMRPGLDIMKSFGGLHGFEKWDKPILTDSGGFQV
                     WSLGSMRKITEEGVHFQSPVNGDKLFMSPEVSMQIQTILNSDIVMQLDECTPYETNGK
                     KTTEAEARKSMEMSRRWALRSKQEFERLGNPNALFGIVQGGMYTNLREESLQALVEMD
                     FPGYAVGGVSVGEPKDEMLEIMAHTPHLLPAHKPRYLMGVGTPEDLVQGVADGVDMFD
                     CVMPTRNARNGTIFTRYGDLKLRNARHKVDHQPIDTTCTCHACAGTSGVSWDDGGRDG
                     FSRAYLHHLDRCGEMLGPMLTTIHNLHYYLNLMQEVRDALDAGTFAAFRQKFAQDRSR
                     GV"
     CDS             408929..409444
                     /codon_start=1
                     /gene="yahB_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010905090.1"
                     /locus_tag="CT3_03680"
                     /product="universal stress protein"
                     /protein_id="BBL22913.1"
                     /transl_table=11
                     /translation="MTRILVAVDGSPYALEAVRHTVALARSGLRATVVLAQVQEEASF
                     LELATQDGDAIANAAMEAGAHLAAPAVVELQLADVPHEVEVALGEPAPTLVDMAERLQ
                     CDQIVIGARGMGALRGALMGSVSQYVLKHSPMPVTVVKPRVDEARDVLGEEGAQVMAD
                     GVTPLSIQAGL"
     CDS             complement(409519..409917)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03690"
                     /product="hypothetical protein"
                     /protein_id="BBL22914.1"
                     /transl_table=11
                     /translation="MDLQYQLKAGNYYLYDMREKPSAVTGERRFKLKTADVAIAFDMH
                     TGEVHQHGNPLRIHSWALTMRRRLRSAGLWDEADDIIVISGPLPVDEINKCLWIRGYC
                     RRMFQRLATLPHGKLQSSCQGANPFRRQAA"
     CDS             complement(410156..411379)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_208542.1"
                     /locus_tag="CT3_03700"
                     /product="phospholipase"
                     /protein_id="BBL22915.1"
                     /transl_table=11
                     /translation="MQATPLTLTRALPGATALATLAICGAWGLPAPAQAAEPLTGDAW
                     RQCAATTDNQARLACFDGWAQQQQPLTPPPATMFHAPAASAQEQAAAPQQGVQQTVQQ
                     AAQEPMVVADVSGQGLQPTNGGCRDPRYSEMSRFFELEPGSDCGTFSFRGYRPMSVSL
                     TTADHVNEQPSSPGKAASTEQPYKTQEMRIQLSARTKIASGLLTDSSTGRKDSLWVGY
                     TQQSYWQVFNGDISRPFRTTDHEPEIFYVYPTDAQLPFGWRWRYSGVGLVHQSNGQSE
                     PLSRSWNRWYLMTGAELGKRWQVNARLWKRIPEGSGDDDNPGIQNYIGRGEVKLGWNI
                     NDQNYLGVTARGSLGKGKGSGRVEWLRTLGEGWNGGKSNLRLHVQLFSGYGDSLIDYN
                     YKRTVFSVGLSLLDF"
     CDS             complement(411399..411722)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03710"
                     /product="hypothetical protein"
                     /protein_id="BBL22916.1"
                     /transl_table=11
                     /translation="MGAAQLQGEWTATVAAQPDAALLQLGPHPEWKGTVKGTVERAGT
                     RHAMVGDVNRGAVTLEESANGINISGTWLGEVSDDSCAREIRGDYQAGDDAPTQPFVL
                     RKRSP"
     CDS             complement(411869..413935)
                     /codon_start=1
                     /gene="rep"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WGW8"
                     /locus_tag="CT3_03720"
                     /product="ATP-dependent DNA helicase Rep"
                     /protein_id="BBL22917.1"
                     /transl_table=11
                     /translation="MSAGLNLAQLQAVHYTEGPCLVLAGAGSGKTRVITHKIAKLIEN
                     GMAPRRIAAITFTNKAAAEMRERAAGLIGRQAKDVLVCTFHALGVRMVREDGHALGLK
                     PSFSILDADDVTGILKDCAGGTTDVATARQWQWTISNWKNAGWDSRKALALAQDDHQR
                     SIALIMQRYEERLTAYQSVDFDDLIGMPMRLLRGHPEVREKWQRILGHVLVDEYQDTN
                     ATQYELLKMLVGERAHFTAVGDDDQSIYGWRGATLDNLKKLPIDYPHLKLIKLEQNYR
                     STSAILRAANNVIGPNPKLFPKTLFSELGEGEPVRVVDCDTEEHEAERAVARIQSLRA
                     GVNPQPAWKDFAILYRANHQAKPFEKALRKANIPYKVSGGTSFFDRAEIKDLCAWFRL
                     WINNDDDPAFLRAITTPRRGIGHTTLGKLGEFSGQHKLSMFGALFSHMLEAVVPKKAH
                     ESLLEFGRYLNDLEYRARHTLGAEASRTFMLDWLKEIGYEQHLYDSEDSESVAAARWS
                     NVLEFCDWMSQRAGGQIEDAAGTTTQTEVKSLLEVAQNIALLSTISEREKEQDMVVLS
                     TLHASKGLEWPHVVLVGVTEGMLPFKLDDDNGKQEKVSDDIAARLQEERRLMYVGITR
                     AQRTLAVSWTKRRKKGRDMVQCQPSRFIKEMNLDAATAKEDPREKLRKLRAEFAARST
                     VQQPAP"
     CDS             414358..415314
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002721044.1"
                     /locus_tag="CT3_03730"
                     /product="malate transporter"
                     /protein_id="BBL22918.1"
                     /transl_table=11
                     /translation="MLSVLIVTFPFFALVLCGYIATRGGVLPLSAISGLNTFVLFFAL
                     PCMLYRFGAQTPIAQLLDPVVAGVYLLCGLALVAATLALTLRRWGWNDAAFGALVAAF
                     PNSGFMGVPLLVALLGEGSAGPVILTMALDMVITTSLCIALSRLGEGEGGAVQALRKA
                     LRGMLSNPMPWSIALGAVASALAFELPGPIDKTVAMLAGAASPVALFTIGAVLARSQM
                     NLHEQLAPRDYVPIALVKLLVHPLLVWSACQAAVALGLPLSTEAMVALVLVSALPSAS
                     NVSLLTERFGAHGGRVARIILVSTALAFVTFSAAVTWLAPAA"
     CDS             complement(415547..416731)
                     /codon_start=1
                     /gene="ansB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I407"
                     /locus_tag="CT3_03740"
                     /product="glutaminase-asparaginase"
                     /protein_id="BBL22919.1"
                     /transl_table=11
                     /translation="MRLAPRTARFTLHRLAAASVVTASLLLAGCATQSSSTAAPMAAA
                     PAAAPAPAAPAAPATQPVAAGPKANVVVLATGGTIAGAGASTINSATYTAAKVPVDKL
                     LAGLPELAQVANVRGEQVFQIASESFTNDNLLALAKRVSALSKQGDVDGIVVTHGTDT
                     LAETAYFLSLVVHTDKPIAVVGSMRPGTALSADGALNLVNAVSVAASKDARGKGVLVT
                     MNDELNTARDVNKDINIQTGAFKSQWGPLGMVVEGKNYWFRAPVKRHTNQSEFNIDNI
                     TQLPQVDIVYAYGTVQPTAVNALVAGGAKAIIHAGTGNGSVADRMVKPLQDARAKGTI
                     IVRSSRVPYGFVLRNAEQPDDKYDWVVAHDMRPEKARILTMLALTRGADTKTLQRMFW
                     EY"
     CDS             complement(417032..419245)
                     /codon_start=1
                     /gene="priA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WFW5"
                     /locus_tag="CT3_03750"
                     /product="primosomal protein N'"
                     /protein_id="BBL22920.1"
                     /transl_table=11
                     /translation="MPLPPDSASPSPDSAPVFRVQVAVHTPVHSGVGGLLTYTHTTAL
                     PPGTLVRVPLGNRELLGVVWDSPADAEPVPNAQLKPVRSVLDGLPPLDARWRRLVAFA
                     AQYYQRSLGEIALTGLPPALKDMTAEQLARRLAPKSKKLSKKAQAALDAQAVADAAAP
                     APALPPTIALSAEQQGVCAQMDQHPGPFLLYGATGSGKTEVYMQRVQQALLAATDTGF
                     PTQALVMVPEINLTPQLLERFTARFAPQFGPQAVVSMHSGMTNPQRLKSWLAAHTGQA
                     RVLLGTRMAVFASLPGLQVIVVDEEHDPSYKQQEGARYSARDLAVWRARSQGAQVILG
                     SATPSLESWHASEPADSGGPGRYLRLHMPSRIGAAELPRVRLVDMRQQPRKAVFSPPL
                     IAAITERVQRGEQALVLLNRRGFAPVLFCADCNWKSDCPHCSAHQVFHKGDRTLRCHH
                     CGFTQRVPHACPECGNPDILPLGKGTEQLEEELERLLRNVQRPDGNPARVGRIDADTT
                     RLKGALEQQLDQVHSGEIDVLVGTQMVAKGHDFRRITLVAAVQPDGALFSSDFRAPER
                     LFCLLMQAAGRAGRDGSYVAAQDSRPEMWVQTQDPEHMVFQALRQHDYPRFAQRQLRE
                     REDAGMPPFAFQALVRADARTQEAAQDFLRAASDAARQGELPHLDDVFLYPPIPMAMQ
                     RVADVERAQMLIEATDRRALQRFLHAWQPWLHWVRGQPQHKSLVRWLVDVDPQSL"
     CDS             complement(419695..420807)
                     /codon_start=1
                     /gene="hemE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63PI5"
                     /locus_tag="CT3_03760"
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="BBL22921.1"
                     /transl_table=11
                     /translation="MSFAPLQNDTFLRACRRQATDYTPLWLMRQAGRYLPEYRATRAQ
                     AGSFMGLATNVDYATEVTLQPLERFPLDAAILFSDILTVPDAMGLGLTFAQGEGPKFA
                     KVVRDEAAVAQLAVPDMDKLRYVFDAVTSIRKALNGRVPLIGFSGSPWTLACYMVEGG
                     GSDDYRLVKSLMYARPDLMHRILEVNADSVAVYLNAQIDAGAQAVMIFDSWGGVLADG
                     MFQQFSLAYTKRVLSQLKRTGVDGQDVPRIVFTKGGGIWLDQMNALDCEVLGLDWTAN
                     LGQARAIVGGEVGGPGKALQGNIDPNVLFAPPEQVAAQARAVLDSFGKPHTDKTTTGP
                     AHIFNLGHGISQFTPPEHVAALVEAVHSHSRTLRQG"
     CDS             420806..421066
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03770"
                     /product="hypothetical protein"
                     /protein_id="BBL22922.1"
                     /transl_table=11
                     /translation="MKRLTRVGWHAAAKAHTSVPGPGSALAAPGKAGIRGERAVYRMP
                     FARTGMPHCGSRVPAPKLTQRKPRGAGEPAAGGRGARGGGLG"
     CDS             421102..422331
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013094878.1"
                     /locus_tag="CT3_03780"
                     /product="sodium/glutamate symporter"
                     /protein_id="BBL22923.1"
                     /transl_table=11
                     /translation="MTLPETLHIPAFQSFTLAILLFFVGQKLAAAWEPLRRYNIPEPV
                     VGGFLCACVVGLAYGVLGLRIEFDLQVRDQLLLYFFAGIGLKSDLKTLKEGGKPLAIL
                     LVLASGFIVLQNVLGMGLAGLFGLDPRAGLMTGSIALTGGVATTLTWAPHFIDRLQIA
                     NAMELGMATNMVGLIAACSIGGPIAGWLMRRHAIRGSDARPLDVGVSNKQAAVTLDYY
                     GVLRAWLWLNMALMIGGVLTPLFQEIGLQLPMFVGCLIGGIVLRNTAGRWMLGRKQHK
                     LGQFHWQSMRQGLAMISDICLGLFLTMALMGLQLWVLQGSLGFVLTVLVLQVLMAIFF
                     TAFVVFRAMGRDYEAVVICAGFGGITLGSTATAVANMTAVARSHGAAHRAFIVVPLVC
                     GFFVDIINALVVQFMAR"
     CDS             422516..423352
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004266561.1"
                     /locus_tag="CT3_03790"
                     /product="hypothetical protein"
                     /protein_id="BBL22924.1"
                     /transl_table=11
                     /translation="MDSISIPDVGALGSSPLSSTPVPQNRSVASPALSVGWARHLDEV
                     RAAQRLRHQIFAGELGAKLPTDQPHSLPGHDVDHFDDFCEHLLVRDQVTQKVVGTYRL
                     LTPSQARRAGGLYSEGEFDCSALAPLRNDMVELGRSCVHQDYRSGAAILALWGALADF
                     MQRNRLQSMVGCASLPLHHPGLTYGEGAARIWAQLPAKSHCQPQWQVRPLLALPLREA
                     EIAAQPQPVVELPPLVHGYLRMGARVLGAPAWDPDFQTADLPIMLQIADLPARYRRML
                     GC"
     CDS             complement(423465..423938)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011393898.1"
                     /locus_tag="CT3_03800"
                     /product="CoA-binding protein"
                     /protein_id="BBL22925.1"
                     /transl_table=11
                     /translation="MPHTVPMITTASDTALRDLLQAAPTIVVVGLSPQADRPSHEVAA
                     YLQQHGLRTIPVNPVVAAAGGQILGERVYASVTEAAAGLAAEGLEVDIVDCFRKSEAI
                     GPIAQEAVAVGARCLWLQQGVVNAKAAALAAQAGLMVVQDACIKLEHRRLLGAAA"
     CDS             complement(424022..424567)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03810"
                     /product="hypothetical protein"
                     /protein_id="BBL22926.1"
                     /transl_table=11
                     /translation="MTSIQLSVLIPTPRRTPRQRVLLCGAAVFGLLASVAVLPTVWNL
                     LTLLHTLPHWYLLERMLAHSPMTAWLLMLAWGAAVPLCLLATLFGGLHWRGALLTVAA
                     LLLAVVWYMHMPALQQCSLLSGMGDACRLLQAVYPLSLGLAVAVYLFGLVVLLLSSLG
                     LVSLAPADEDPLNRDRYHYGV"
     CDS             complement(424876..427086)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011405415.1"
                     /locus_tag="CT3_03820"
                     /product="thiol:disulfide interchange protein DsbD"
                     /protein_id="BBL22927.1"
                     /transl_table=11
                     /translation="MACLLLFSGSAQAQIQLKLGSAQAATAAPGASATVETPRVRAEL
                     VALAPEGIAPGQPLTLGLRIHHQPGWHTYWKNAGDSGLATQLTWQLPAGITAGDIAWP
                     MPQQIRVGDLLNYGYEGTVLLPVPATVAAGFAPDAQGMVRIQLQASWLVCRVECIPED
                     GSFTLDLPAQGSVAMAAADFAAAARQAPQALQGEARFTVLPGGERLQLQVNGLPATAQ
                     GQTLAFYPESSDTFRHAAELGKDWTQAWKGATWTAELPLSEMRGDTPASLPVVLGLPT
                     AGSDVAHAPPTQAWRMEAPVEGQWKAVQLATVSPALAAALEANRNAATPAAPAPTASA
                     SSLWLAVLGGLIGGLILNLMPCVFPVLAIKLLALAQPGTAPAARHTAGLAYGAGVVLS
                     FLALGGLLLGLRAAGDQLGWGFQLQSPAVVALLAALFTLIGLNLAGLFELRMLLPSRW
                     ASAQARHPVVDAFLSGVLAVAIASPCTAPFMGASLGFAVGMPAVQALTVFAALGVGMA
                     LPFVIVGWVPALLRWLPRPGAWMDTFRRAMAFPMFATVVWLVWVLGQQSGIDGSAALL
                     GLLLLLAALVWALTLQGRSRWALGALVLALTVWLLPTAGRLVVQPVEAATSASAGHST
                     ALWQPWSAERVASLQAAGQPVFVDFTAAWCVTCQFNKKTTLSDTEVLADFAARQVQLL
                     RADWTRRDPAITAELARLGRSGVPVYVLYAPGKAPQVLTELLSTTEVRQALAAL"
     CDS             complement(427303..428784)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036400.1"
                     /locus_tag="CT3_03830"
                     /product="MATE family efflux transporter"
                     /protein_id="BBL22928.1"
                     /transl_table=11
                     /translation="MASTPHRAPIRDLTQGPIARTLVAFALPILAGNVLQSLNGSVNA
                     VWVGKYLGEAALTATANANNILFLLIGLVFGVGMAATILVAQAMGAKNLAQARAVMGT
                     SASFFGAVSVLIAVVGFPLSRLILQWIDTPEAALPLAESYLRIIFLAMPLLYLFAFVS
                     AVLRGAGDTRTPFLFLLLVVVLDVLLNPLLIFGWGPVPRMGITGAATATLVANAISFV
                     AMLLWLYRRRHPLWIGRSELHLFRPRPAIVRTLITKGLPMGAQIVLISLAMIMVMRLV
                     NLHGVELSSAYGAALQLWTYVQMPAMAIGAACSSMAAQNVGARRWDRVDGTARAGVWA
                     NVGMTGLLIALIVLADRLVLGWFLPAGSAALEPARHLNHIAIGSFVFFGVTFVLSGVV
                     RSTGAVIPPLVILGLALWGVRVPVAQWMQPWLGVDAIWWSFPISSLCAMLLSLAYYRW
                     GHWRQAHMLPDGPATPQATPAEVGGQPPTPVCSLGGDEPEAHR"
     CDS             428997..429884
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013382904.1"
                     /locus_tag="CT3_03840"
                     /product="creatininase"
                     /protein_id="BBL22929.1"
                     /transl_table=11
                     /translation="MASRTSPPQTAAPDSSAMPRWPARHWAQVSARDFALAQTNGLAA
                     ATVAVLPVGAVEQHGPHLPLSVDSTLVDGMVAAALPHLPADTPVLVLPTQQIGLSLEH
                     ESYAGTLGLSPATLLALWTEIGACVARAGVKKLLIFNAHGGNVSSMDIVARQLRMQCG
                     LLVYHSSWFNLPLQGSDQAFSVHEHRFGVHGGEMETSMLLHLAPERVRMEHAQNFSST
                     SAQRAQHYPILGNGKSAKLGWAMQDYNPCGAAGNAAAADAARGKALVEAVGVSLAALL
                     EEIHRLPASTVGAEPTPLG"
     CDS             430103..430432
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03850"
                     /product="hypothetical protein"
                     /protein_id="BBL22930.1"
                     /transl_table=11
                     /translation="MSVYILRFFFDPGSGICLWAANDAARDKWDYPIDTRDLPLPENT
                     WRFAYHLCSWFDTSIDWTYPPDPSPWDAAERDRFNNAAQQFLEILRGQLGTDFDVVDE
                     SATSAAA"
     CDS             complement(430879..432501)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141198.1"
                     /locus_tag="CT3_03860"
                     /product="alkaline phosphatase"
                     /protein_id="BBL22931.1"
                     /transl_table=11
                     /translation="MTLPLFSRQPPTRRQLLQATGLGSALGLLPAWARSAPAGGIAHP
                     DHDPFTLGVASGDPQPDNVLLWTRLTPPAHWLGQADAPQLSALTVRWELAHDPGFRRI
                     AASGQAQALPEWGHAVHVQVNGLAAGRSYFYRFMQGNATSTTGRCCTAPAPGATVQRL
                     RLAFASCQRWEHGHYAAWRSVVQDQPDLVLFLGDYIYEYAQPAKTEGLARPQPLPTAR
                     TLQDYRDRYALHKSDPLLQAAHAQCNWSVIWDDHEVENDYAADQGLGEATAFLARRMA
                     AWQAFYENMPLRAGALQRSMQGLQLYRSLHWGSLARFHLLDGRQYRSPQACRTPGKAD
                     SGSVHADRCPELFAPARSFLGREQEAWLGRQLQADSRHRAEAARWSVVAQTTLFTARR
                     RPSGAQSTDSWDGYPAARQRLTRQIADAAPHNSVLLGGDIHQNYVCAVPTLADRPLDK
                     DNPVLASEFCGTSISSRSGTTQDKVDALRAHNPQVLLARCEERGYSLVDITPQTLRTQ
                     LRAVADPLSADSPVYTLAQFVVESGKAGPVAA"
     CDS             complement(432622..433260)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704702.1"
                     /locus_tag="CT3_03870"
                     /product="hypothetical protein"
                     /protein_id="BBL22932.1"
                     /transl_table=11
                     /translation="MSGTVLRPEQDPSLDPTPTVATMQQLRALLGPAVQAHEAVALFD
                     VGDSACYLLVSEGNQGHPTPVVHYMHLGLHMLTQRTFKRDMPTPAQLEAGIMVVEDAV
                     MPLARLVPPHTVLATRDPLLLQIARLAAGDPELGMLPPAPNCAPPAVTREAIEALFER
                     LVAQSNRHYGGLDPDLPGDPHGAAALLILREALHHWQFTHLRLLPRGMDTVG"
     CDS             complement(433376..434056)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113600.1"
                     /locus_tag="CT3_03880"
                     /product="histidine phosphatase family protein"
                     /protein_id="BBL22933.1"
                     /transl_table=11
                     /translation="MRGMGTLYLVRHGQASFGADDYDQLSPRGMEQAECLGQYWQERG
                     QPFDAVFTGTLRRHAQTLEGIARQLPGLPAAEALPALNEYDSHALIRCIHPEPLGKAD
                     TPERYRHHFRLLCDALAQWMSGVITPAGMPSWDDFSAGIRSTLERIRQQHAGGNVLVV
                     SSGGPISAAVAQVLGTTPEASIALNMRIRNSAVTEFSISPKRMMLQTFNTLNHLDTPQ
                     TRDWATFA"
     CDS             complement(434175..435092)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267624.1"
                     /locus_tag="CT3_03890"
                     /product="phenazine biosynthesis protein PhzF"
                     /protein_id="BBL22934.1"
                     /transl_table=11
                     /translation="MTVDVFTAVPYLGNPVAVVLDAAGLSDAQMQQFACWTNLSETTF
                     VLPPSAEAAAQGADYRLRIFTPEGELAFAGHPTLGSCHAWLAHGGQPHSSTHVLQECQ
                     QGLVQIARRDQRLAFCAPALQRQAVEPALLAQVTAALGLEPAQVLAAQQLYNGSPWMG
                     MLLDDPDTLLALEPDWPRLAATGQKLGLAARYPQEDAGALIGRSSREARAFAGSRVGE
                     TAPAAASVQLEVRGLVSSLAMEDPVTGSLNAALAQWLTAEGWLQAPYTANQGVCVGRA
                     GEIAITPDATGALWVGGHTVTCVHGQVLL"
     CDS             complement(435241..436425)
                     /codon_start=1
                     /gene="avtA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037008.1"
                     /locus_tag="CT3_03900"
                     /product="2-aminoadipate aminotransferase"
                     /protein_id="BBL22935.1"
                     /transl_table=11
                     /translation="MTNWTLAARAAKMNSSAIREILKLTDRPGIISMAGGLPSPKAFP
                     LDAFTAACQTVMQRDGAAALQYSTTEGLPALRQAIADFLPWNVDPEQILITTGSQQAL
                     DLIGKVFLDAGSRILVEKPTYLGALQAFTPMEPVAEGVDSDDEGMLVDDFAAKVGSGA
                     DKARVAYVLPNFQNPTGRTMSEARRQALVEKAKELDIPLIEDNPYGDLWYEGEPPLPL
                     AARNPEGVIYMGSFSKVLAPGLRIGFIVAPKSVYGKLTQAKQAADLHTPSFNQRVVAE
                     VIKDGFLDRHVPTIRAMYKAQRDVMLTALEREMAGLDVQWTRPVGGMFLWVQLPQGMD
                     AQALLAKAVERQMAFVPGAPFYAGDAQTNTLRLSYVTVSAEQINQGIAALADAIRAQS
                     QA"
     CDS             complement(436710..437309)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005482872.1"
                     /locus_tag="CT3_03910"
                     /product="amino acid transporter LysE"
                     /protein_id="BBL22936.1"
                     /transl_table=11
                     /translation="MPLHEFTALLVLASAMSFSPGPNTTLSTALAANLGLRRSMRFVL
                     AVPCGWSLLLLLCAAGIGAMVTAAPALRWLIQGVGIAYLLWLAFRLWNSGQLAQARSE
                     QLQVGFWQGVALQFVNIKAWLLALTIVAGWVAGQPDGLQRLAVVLPVMVCYAFASNLL
                     YACIGALLRGWLAQGRRLLWFNRGMAALLVLTAAWMLRA"
     CDS             complement(437570..438793)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_03920"
                     /product="hypothetical protein"
                     /protein_id="BBL22937.1"
                     /transl_table=11
                     /translation="MVQTALTSLALGYRPLWNAARKLVGVQLFMHEGGDDQPDVPHFL
                     RMLQEMAAPTAPRLILSPQSRHLLGLLLQHTVRDAQQLIEVRGEWLADSALYDLVQRA
                     QARGVRLVWRGALNDLPDADSARWFASSMLRLAPQDAIQLMQLSPGAPAPEHLALLDG
                     QIYEELHSRAIMHRCLDQHRAAAIAGWPSEDVQHKLRGERALAPSHDHVMRLLKAVDA
                     DESFETFEQILSEDPMLAYRFMVFTNSASLALRSGVDSLRMGFVMLGYSQLKQWLANQ
                     LTQASADKDLQPIRAATVMRAQLTERLLDPGVSQELRSEVYLCGLFSRLDELLDEPLS
                     QTLQRLPLSERIHEAAVEEDGPYAPSLLLAKALEKEDGPVVRELCARYDIDLEHVNRT
                     LLRTISEWPAERLAL"
     CDS             complement(438823..440106)
                     /codon_start=1
                     /gene="flgL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010946958.1"
                     /locus_tag="CT3_03930"
                     /product="flagellar hook-associated protein FlgL"
                     /protein_id="BBL22938.1"
                     /transl_table=11
                     /translation="MANVNRYSTATMYANTVNMLSKQQKELADQIEHVSAKKKVLRAS
                     DDPVGAAQAERARTRLSRLDTDQRALDAQTATITYGESTLGEMVDALQAFRDLTVQAG
                     NGSFTQTERDALVQQMESLRNQILGYANRKDSNGLPLFRGLDSQEQVISGKYQYDGQA
                     GQQSSSDYGIASTLDGALAFMSGSTGNGVLAVELGVEVTPATTPPTYTPNTGKAWSNV
                     GTIKDPSAAAAFVGPQTIQFAVDATGKTTYSVVDSAGNPVNDTAGNPMTNLAYKSGDA
                     IRVGGMDLTITGVPANGDGFTVKQSERTDLFSVLDSAIAASRNSGKMDGTTAFGELAH
                     GLAKVQAEIDTAMNRVSTVRSYAGDLMQQSDRIGKTLLARNEQMEGQRAAAEDMNDSE
                     YIAALSLLQNQQLTVSAAMQSYASIQKLSLFNFIN"
     CDS             complement(440124..442106)
                     /codon_start=1
                     /gene="flgK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037108.1"
                     /locus_tag="CT3_03940"
                     /product="flagellar hook protein FlgK"
                     /protein_id="BBL22939.1"
                     /transl_table=11
                     /translation="MSLLNVGVSALTANQAALQTIGHNIANVNTPGYSRQTVALQTVA
                     GQNRGNGYIGNGVSVATVMRNYSELLNKQSNAANAASAADAARSQSLTQMQDVYAGGD
                     AGLGAAITNMMNAFADLETSPTDSTARNVVLTRMSELASRFRASSTALEEQDYVTKQQ
                     IGNDVIVVNSLATQVATLNTQISRALAAGHSPNDLLDQRDQVVREINQYVKTTQVAAD
                     DGSINLFVGGSQALVLGASAAQLSVSESTNYPGSGKLSLYFSQPNGEKVELTAGMVAG
                     GEIAGLLKFNNEDLVEGRNLMGRLALSIGTELNKQNQLGLTLSGVPGTELFALPTSMP
                     GYSNIPGYDLGTPSASVAFTDTHALVASDYKIVFGASHPADTKIVRLSDGKTRALTDP
                     ALGYAAGPTAGSSTFTVDGLTFSLDADANSGAQGQSILFKPFSSAASDIKALVYTPED
                     LAVSNPVSAAISQDNQGTLQLLQLKSTGTGVPPIGTPVAITFTVDPGTGAITYDYPGN
                     LSGPQPYQSGKPINIDGWQITLNGTPKTGDTVQVSNALEPALGDAWKRNSGNATAFLD
                     LRDAKIFDNGTTLTDGFSSAMAVVGTRTQSAQYAAELSANVAASLENERTAVSGVNQD
                     EEAARLLQFQQAYQASAKVIQIAQSLFDSVLNAVNH"
     CDS             complement(442119..443102)
                     /codon_start=1
                     /gene="flgJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004197262.1"
                     /locus_tag="CT3_03950"
                     /product="flagellar rod assembly protein/muramidase FlgJ"
                     /protein_id="BBL22940.1"
                     /transl_table=11
                     /translation="MSSLSFNAQNALVSDVQSLNSLKTQSNDPKAAREAAKQLESLFM
                     REMIKSMRDATMKSGLLDNSATSLANDMYDQQMSVAMSGMPRGLSDAITAQISRSIGK
                     DNLAAANVTGELSSLLGDDNALAQRNFSMTSTLSFASQSRAATSLSGSSWSKGSTPAV
                     DAYAPPPKGRDSFVQAHLPSAQRVAQESGIPASFMVGQAGHETGWGKSAIRNADGSNS
                     FNLFGIKAGKGWNGKVAEVTTTEYIDGVPRKVKAKFRAYDSYEESFRDYARLITENPR
                     YEQAQNVASAGSANAYAKALQQAGYATDPQYANKLTRAIESAVAVQRSNQA"
     CDS             complement(443099..444244)
                     /codon_start=1
                     /gene="flgI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YB1"
                     /locus_tag="CT3_03960"
                     /product="flagellar P-ring protein"
                     /protein_id="BBL22941.1"
                     /transl_table=11
                     /translation="MKVLSTLPKFRTAHGIFLLAALCGSMLAPPAQAVRIKEVAAVQG
                     VRSNQLTGYGLVVGLDGTGDQTTQMPYTTQTLANYLQQMGITLPATANMNSLQLKNVA
                     AVIVTAELPPFSQPGQQIDVVVSSMGNAKSLKGGTLIVTPLRGADGEIYALAQGNMVV
                     GGAGASQAGSKVQINHLSAGRIPLGGQVERAIPTPLNEGSTIRLGLNASDFQMASQVV
                     KAINNRHGAGTATALDGRTVEVRAPELSGARVSFIADIEELTLQNSKPAAKVVINART
                     GSIVMNQAVTLGPCAIAHGNLAITINSTPVISQPGPFSQGQTVVAEKASIQVSQEPGK
                     VINMPASPQLSDVVRSLNALGATPQDLLAILQAIKSAGALNAELEVI"
     CDS             complement(444266..445009)
                     /codon_start=1
                     /gene="flgH_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6NZV0"
                     /locus_tag="CT3_03970"
                     /product="flagellar L-ring protein"
                     /protein_id="BBL22942.1"
                     /transl_table=11
                     /translation="MTTPSRFSLLSHRPTPGRPPLRTSIWIGATLVLSGCAFNDPPPV
                     EMGLPTQPLTAAAITAPAPSATTTGSLFQSNRYRPPFENRKARLVGDIVTIAITEKVT
                     ASQKQSSSVNRSNEMNSSVSAIPFMKPGASILGKLGAGMESDNKFSGAGGTESANAFT
                     GSITTTVIDVLPNGHLIVAGEKQIGVNHNVDVLRFTGTVDPYMLQPNSVIASTQVANV
                     RVESRSRGQQGSAQSIGWLSSFFLNFMPF"
     CDS             complement(445136..445918)
                     /codon_start=1
                     /gene="flgG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CNG7"
                     /locus_tag="CT3_03980"
                     /product="flagellar basal-body rod protein FlgG"
                     /protein_id="BBL22943.1"
                     /transl_table=11
                     /translation="MMNSLWIAKTGMQAQQTNMDVVSHNLSNVSTTGYKRQSAVFEDL
                     IYQNLRQVGSQADEQNTLPTGMHLGLGVRTVATTRNFTQGTPLESGKDLDVAISGDGF
                     FQIQMPDGTTAYTRDGTFSKNGTGQLVTAGGYPLLDGITVPANATRLSISKTGLVEVT
                     VSGSATPQQIGQLNTASFINPAGLEPLGENLFRETPASGTPQAGTPGSNNLGTVMQGF
                     LESSNVNVVEELVAMIQTQRAYEMNSKAISTSDQMLAKLSQL"
     CDS             complement(445962..446699)
                     /codon_start=1
                     /gene="flgF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YB4"
                     /locus_tag="CT3_03990"
                     /product="flagellar basal-body rod protein FlgF"
                     /protein_id="BBL22944.1"
                     /transl_table=11
                     /translation="MDRIIYTTMTGANAAAQRQAVLSNNLANASTTGFRSEMTTFRSV
                     PVQGQGSTTRVFALDATSGHLETPGPAMTTGKNTDLMARGNAWFAVQGMDGMEAYTRN
                     GALEVTEQGQLVTATGLPVLSDGGTPIDIPQNAKLNFGADGTVVATLPNQPPMSIGRL
                     KMVTPTADQAIKRSDDGLFRGVNGDLPNDGNARLVAGTLEGSNVNAVEQMVGMIAASR
                     QFEQQIKMLQTAESNDKTASQLLSMNG"
     CDS             complement(446733..447977)
                     /codon_start=1
                     /gene="flgE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WHA8"
                     /locus_tag="CT3_04000"
                     /product="flagellar hook protein FlgE"
                     /protein_id="BBL22945.1"
                     /transl_table=11
                     /translation="MGFYHGLSGLNASSKNLDVIGHNIANSNTSGFKSSRAEFNEMVA
                     SAMGAASGSNAGIGVSVAAVSQQFSQGVIVPTNNGLDMAINGDGFFVVNTSSGMAYTR
                     SGNFQLTKNGELQTVNGDKVMGYTVDPLTGQRNSVALTELTFPTGAPIPAKQTTSVAG
                     ILNLDARANLAAGDATATPPIEPTPRATYGTSLQVYDSLGVAHPASVYFEKTGPNSWE
                     VYDSLTATDPIGTLTFNTDGTLASATPAPPAAPTDPFELTITPTTGAASPFAVKMDLS
                     KATQFGSAWSVAKLTQDGYASGELTSVNVSKDGTLMASYSNGVTRAEAQIALAKFTNS
                     QGLIPDGNNNWLASNDSGPAVYGSAGSGSFGDIQGNALEESNVDLTAELVNMMTAQRA
                     YQANAQTIKTQDQIFSTLVNLR"
     CDS             complement(448013..448660)
                     /codon_start=1
                     /gene="flgD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CLC8"
                     /locus_tag="CT3_04010"
                     /product="basal-body rod modification protein FlgD"
                     /protein_id="BBL22946.1"
                     /transl_table=11
                     /translation="MINGVSSNSSSSSSSSSGATSAQEMQDKFLTLLVAQLKNQDPTN
                     PMDNAQLTSQMAQISTVSGIEKLNDTVSSVTSQFNQMQMLQGSSLIGHTVLTEGNGLA
                     VTEEGQATAAFELAGKAANVTVTITNASGELVDTVEMTGLDAGRNYFTWDGSKYTGDK
                     SQLQYSVKASNAESTVKVTPLTASNVVAATVSNGKLMLELGSGATVDYSGVKSVF"
     CDS             complement(448690..449094)
                     /codon_start=1
                     /gene="flgC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6NZU8"
                     /locus_tag="CT3_04020"
                     /product="flagellar basal-body rod protein FlgC"
                     /protein_id="BBL22947.1"
                     /transl_table=11
                     /translation="MSMFSIFSVSGSAISAQSQRLNVVASNLANVDAVAGPNGDVYKA
                     REVVFQTAPMGKDGSAGVKVVGVEEDNTPGRRVHNPEHPLADEQGYVTHSNVNAVDEM
                     VNMISASRSYQNNVEVMNTAKTLLLKTLQLGQ"
     CDS             complement(449125..449583)
                     /codon_start=1
                     /gene="flgB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A1JT24"
                     /locus_tag="CT3_04030"
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="BBL22948.1"
                     /transl_table=11
                     /translation="MDAIYCKREEHMLDKMTGGLNFHSNALVLRAERQRMLSSNIANA
                     DTPGYVARDFDFGKTLREATEQPTAQMQQQRAGSVSHAQHIPLPAAKTGHNQDSTLGY
                     SIASQPSMDNNTVDLDRERANFVDNSVRYEATLRFLNGSSKTMLSAITGQ"
     CDS             449759..450496
                     /codon_start=1
                     /gene="flgA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_104793.2"
                     /locus_tag="CT3_04040"
                     /product="flagellar basal body P-ring biosynthesis
                     protein FlgA"
                     /protein_id="BBL22949.1"
                     /transl_table=11
                     /translation="MSIARRAAVSVATFCRKQGVLAAACALAAVSVHAQSVEQVSQQW
                     LNNALAQGSASPQEMPLRLEVELGRLDPRLNLAPCARMEPYLPNGSKLWGRTRIGIRC
                     LEGSRLWNVFMPVTVKAWGPAWVLTNNVTLGDVLSPQDAMQSEVDWAAETAAVIALPD
                     DWVGQSAARSLSSGQTLRQGMVRAPQLFKAGSPVKVVAGGTGFQVTSSGQALSAGGQG
                     QAVRVRMDNGRIVSGTVNARGEVVVNQ"
     CDS             450588..450908
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04050"
                     /product="hypothetical protein"
                     /protein_id="BBL22950.1"
                     /transl_table=11
                     /translation="MKVGQNAERLAQLQQTQIQAAADKKAGTAGEALQRTTQTAAAGV
                     PVTVSDSARSLDVNAKNQGDIDVAKVRAMREAIANGTFSVNAGAVADKLLGDASDFLR
                     PVSR"
     CDS             451050..451430
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04060"
                     /product="hypothetical protein"
                     /protein_id="BBL22951.1"
                     /transl_table=11
                     /translation="MQLEEALNHVESQVQLMAASLTGQEGVPAPDVVSERLRSCMVAF
                     SGLAQNFTPEQFTPALRQRMQVISQTLALQREHLVRMGAITAQQAQVLVPQQRDGHTY
                     GEMASTAAPQGGRAAVSKLYHISG"
     CDS             complement(451585..452301)
                     /codon_start=1
                     /gene="fliA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63PT1"
                     /locus_tag="CT3_04070"
                     /product="RNA polymerase sigma factor FliA"
                     /protein_id="BBL22952.1"
                     /transl_table=11
                     /translation="MYTAHGQLDRDALIRQHAPLVRRIAHHMIAKLPPNVELDDLIQV
                     GMIGLAEALSRYESAQGVQFETFASQRIRGAMLDELRESDWMSRSSRKGQKDIEVTIR
                     RLEQRLGRTPRESEIAEAMDLPLDEYQSLLGKVRGTQLFYLEDLSPGQDDDEGYLDRY
                     VADSSSDPMAMLRDHRLRTALVQAIEGLPEREKYVMGMYYEHDMNLKEIAAVLEVTES
                     RVCQLHSQAIARLRTKMRPH"
     CDS             complement(452306..453061)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04080"
                     /product="hypothetical protein"
                     /protein_id="BBL22953.1"
                     /transl_table=11
                     /translation="MLESSSHQGSGLQWQAAANPLRVLSVLPGGDLAGTQALWSACTH
                     LQQQGYPVIVLDGTEQETADAPGLQDLLQPHSGSGFGALPVGTEGAHSVATLPAARGL
                     LQLAHRARQQGCRALDLLHRHLRNHALVIIIAPEQILSPVLHGASQSPLLMVPSQGRS
                     VLRSYRALKHMLMHTGLTAKLVSMSPDTGFARNLQAVVQCAMHHLHVEPLVMQLNPDN
                     PRQLQRWSLQCLEQAEAVGMPQQAAAQPTDWSH"
     CDS             complement(453054..454523)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04090"
                     /product="hypothetical protein"
                     /protein_id="BBL22954.1"
                     /transl_table=11
                     /translation="MNIQRFNAPTSREALAKARAVFGEGTLILANRATSTGVEVMATS
                     EDGLGKLDQGNRTSNRLQAAIQARDAEETRPPKALQASAKQSVAEDTEQLSMSTLSFQ
                     DYVRERMLRRRGPDAQMEEEVPALPTFARKNRLDAVRDTAPLPTTPTVVKHNPLRGMA
                     IELPVEARKPAPAAPALNTQVMGELQSMKDLIEERFNTLSWLNQTRQSPLHSNLMVKL
                     IRAGYSPTLGRTLLERMPQNAGPAEALKWLMNVLERNLHTDAKQASIYETGGVFALVG
                     STGVGKTTTAAKLAALAAQVHGAHNVGLITLDTYRVGGHEQLRAYGRMLGVVAHLAHD
                     KAALQDLLSLLSGKKMVLIDTTGVAPRDPRKDDILDVLDLPGVQRLLVVNAGSQGDTL
                     DESLGAFKRNGCKQTILSKVDEAVKLGPALDALVRHQMQLRGITNGQRVPEDFERANA
                     QELIASSMRAHTRSAFDPSALDLDFFFAESPRSAGGLHA"
     CDS             complement(454520..456628)
                     /codon_start=1
                     /gene="flhA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198639.1"
                     /locus_tag="CT3_04100"
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="BBL22955.1"
                     /transl_table=11
                     /translation="MSTAMIKNIQQMAGKHGNALQGMSAPILVIAILALMVLPIPPWL
                     LDTFFTLNIAIALMVMMVAAYMIKPLDFAAFPSVLLLTTLMRLSLNVASTRVVLMEGH
                     TGPGAAGAVIEAFGHFLIGGNFAVGLIVFAILVVINFVVITKGAERIAEVSARFTLDA
                     MPGKQMAVDADLNAGLIDEAEAKRRRAEVGEEANFFGSMDGASKFVRGDAVAGILILV
                     INIIGGFIIGMAQHGLSAGDAANSYILLAVGDALVAQIPGLLISVASAMVISRVGKDG
                     DTGKQIATQMFASPRALGITGAILVLLGLIPNMPHVVFLAMGSAFGYAAWLAHRKQQQ
                     KTEQAAGATQKQAAVAATQQDSEATWDDLQPVDLLGLELGYRLIALVDKNRQGDLLTR
                     IKGVRRKFAQEVGFLPPAVHVRDNLELKPSAYRITLRGVMVGEGEAFPGMYLAINPGG
                     ISTPLIGTPTTDPAFGLPAHWIDERQKEAAQMAGFTVVDSETVMATHLSHLMQVQASK
                     LLSRTEVQQLVEHVAKLAPKLIEEVIPKMVSITTFQKVLQLLLEDSVHIRDIRTIIET
                     LAEHAGSTQDPMELARRVRIALSPAIVQQIYGPTRELNVIAIEPGLERLLVQALANPA
                     APSLDPGVADVLTQRAAEVANRQEEMGMPACLLVPDSIRNTIAKLVRRVAPRLQVLAH
                     SEIPETHTIRIGPILKGASA"
     CDS             complement(456625..457824)
                     /codon_start=1
                     /gene="flhB_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003083056.1"
                     /locus_tag="CT3_04110"
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="BBL22956.1"
                     /transl_table=11
                     /translation="MAWTFPHAAMESSQDKNLPATERKLQKTRKDGQAARSRDLGHLT
                     VMGVGALAVLAGGPSLVGHMHEAMARQLSFNASTILSPQLMVERLVDMSILALTAVLI
                     LGVLISAASIISGVLAGGWVLSFKPITPQFNRINPLSGIKNLVSMQQLVTAAKNVLLT
                     IVLAFVGWFYLRSGIPELATLPLQPSRSALSKVGDWIAGGMALMLVVVFMVAIIDVPL
                     QNFLFKRRLKMSHQEVKQEHKESEGSPEVKGKIRQKQREMAHRASVSRVPKADFVVTN
                     PTHYAVALRYDEVTMAAPQVIAMGADLVALKIREVAKAHDIPVLESPMLARALYANAE
                     LDQAIPSTLYTAVAQVLAYVYRLKASLRGEAPPPGELVQPPVPPELDPHTKLRTAPES
                     TTESTAP"
     CDS             complement(458090..458782)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WHL2"
                     /locus_tag="CT3_04120"
                     /product="protein phosphatase CheZ"
                     /protein_id="BBL22957.1"
                     /transl_table=11
                     /translation="MDEAPNTPLPGGYDQGDVHNKLGLLTRQLHDSLRELGYADRLRG
                     SVDALPDAQSRLTYIARLTGEAAEKVLGIVDTAKDEHSQIVEQTQKMREALVADPVAA
                     VAKGHVMNHLEAMDAANARLDSRLTEIMMAQDFHDLTGQVIAKVVKLTSSLEEQLVEL
                     LLQTAPMHSAPAAAAVLATVPEVVEPAAPAAEFTADGHPALQGPVVDPDNTPNVVTSQ
                     SEVDDLLASLGF"
     CDS             complement(458787..459173)
                     /codon_start=1
                     /gene="cheY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005164479.1"
                     /locus_tag="CT3_04130"
                     /product="two-component system response regulator"
                     /protein_id="BBL22958.1"
                     /transl_table=11
                     /translation="MANPLRFLIVDDFSTMRRIVRNLLKESGFTEADEAEDGVVALHK
                     LRNSKFDFVVTDINMPNMNGFQLLTEIKADEKLKHLPVLMVTAEARKEDIVAAAQGGA
                     AGYIVKPFTKATLEEKVNLVLKKMGM"
     CDS             complement(459245..460183)
                     /codon_start=1
                     /gene="motB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_009938926.1"
                     /locus_tag="CT3_04140"
                     /product="flagellar motor protein MotB"
                     /protein_id="BBL22959.1"
                     /transl_table=11
                     /translation="MATEKKLQPIIIKRVKKAAHGAHGGAWKIAYADFMTAMMAFFLL
                     MWLLGSTAKGDLQGIAAYFNSPLKVSMAGGDGSGNSSSIIPGGGNDLAKVHGQIRRSD
                     ADENNDRRKMDSTSRQIRAQQDAQRIKSLRAKIDAMISSNATLNEYKSQIRIDVTPDG
                     LQIQIVDEQNRPMFDIGSAILKPYMRDILREVGTAMGGVENRISLAGHTDAAPYGNGQ
                     RGYSNWELSSDRANASRRELVSSGMPDDKLARVVGLAASDLLYPDQPRAPQNRRITIT
                     VLTHEAEERLLGKHAVKEPIEPADKQDNPVPGTPSL"
     CDS             complement(460216..461076)
                     /codon_start=1
                     /gene="motA_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004198197.1"
                     /locus_tag="CT3_04150"
                     /product="flagellar motor protein MotA"
                     /protein_id="BBL22960.1"
                     /transl_table=11
                     /translation="MLVLIGYLVAFGCIFGVYALHGGNMSVLAKALPFEMATIGGGAF
                     GAFIVSNQPKVLKATAAAIPLAIKGSKYTKARFMSLLALLYDLLQKARKEGLMAIESD
                     VEEPNESPLFQKYPDILADHHLVEFITDYLRMMVSGNLNSHEIETLMENEIEAHHQEN
                     HRPVAALQRLAGALPAFGIVAAVLGVVNTMGSVGQPPSVLGGMIASALVGTFLGILLA
                     YALVEPLAGVIEQIFQDGSKELECVKCTLIASMQGYNPPTAIEFGRKVLFSTERPGFV
                     ELEEHVKGQK"
     CDS             461258..462895
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04160"
                     /product="hypothetical protein"
                     /protein_id="BBL22961.1"
                     /transl_table=11
                     /translation="MVASEPAPALSHVLHDINVRLIGQNKFLPALTELMCLAKDHVMS
                     AHLWVAIGVVYVRMSNWSAAIGALETAIALDERVPGAHQLLALAVFSIGRREQACQMV
                     DEACKRSSENNAWLLRAYIHSHSSRSPEVALKVAQDWGRRFADPLTRKAKPLVVRDRS
                     PRKKLKIGYVTADFREHSVAFFMQPVLKFHNHEEYEIHVYSNGPWDHFTPQLRMHVRY
                     WEDVMALSDKELHQKIRDDEIDVLVDLSGFTHGHRLGVFAQRAAPVQVTWVGYIQPLG
                     MKAMDYRLVASGLVPPSLAPYYSETLFQLQASACYEPPSYSPLCEVPPMVRNGYPTLV
                     SPNSSAKITDQMLRLWARILHERTDARLIIMVKEGDADAAQADMQPRVEAAGFPLDRV
                     SVMHQQPLHHFMEVGHIADIMLDTAPISGGTTTLHSLWMGMPVVTLDAERGVDACSAY
                     VLRELGLEAEIAQTEEEYVQIAMRLMADPERLYVQRENIRAHMGSSIFMDYAAYAADV
                     EKSFRIMWLNWLRGDKRDLSLDVDVDAEMALAEGRAP"
     CDS             462892..464118
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001084741.1"
                     /locus_tag="CT3_04170"
                     /product="aminotransferase DegT"
                     /protein_id="BBL22962.1"
                     /transl_table=11
                     /translation="MTAAHAVPTGVDMPEPIPLLVPCVPAPHELLPWLERMHAARHYS
                     NFGPLVCELEATFATQFQVAGAQVTTVANATLGLELVLQALDLPAGSRILLPSFTFVA
                     TATAVLRAGHVPVLADVDADSWMLTPDIASAAHASMPVAAVVPVATFGMPHDMQAWQQ
                     FEAQTGLPVVIDAAAAYGSQWLHNGEGTLVFSLHTTKSMPAIEGGLVVSSRPGLTTKV
                     RQLSNFGINLEPTAGVPVGTLAGAGTNAKMSEYHAAVGLASLQQWERHAQDRKALQAD
                     LMQFLNQCSGHNLQWQGDGTGGPLKAPTLLCPRLPSAHIRSQLEQICAQEKITVRRWY
                     QPLLEHMPALHSRCLALPTPVAHQLADTLLGLPFFLGMTAAQRERVGNAVARVQWSRP
                     AGRLTACVAHPVPLAA"
     CDS             complement(464122..464877)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013096017.1"
                     /locus_tag="CT3_04180"
                     /product="type 12 methyltransferase"
                     /protein_id="BBL22963.1"
                     /transl_table=11
                     /translation="MTNVRDYNRELNDKNNATHEKYAYSFDFDVMHPYMIKAFSPYFK
                     KGNLLELGSYQGQFTERLLQHFEDVTCVEASSDAIAIAQERLGNRIQQFEGMFENIDL
                     PRQYDNIVMTHVLEHLDDPVQVLQRVNHEWLSETGRFFLVCPNANAPSRQIAVKMGLI
                     SHNAAVTPAEAEHGHRITYALDTLERDASRAGLRVVHRSGIFFKALANFQWDRLLQTD
                     IISKEYLEGCYQLGQQYPDLCSSIMLVCERGSR"
     CDS             complement(464880..465836)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013096015.1"
                     /locus_tag="CT3_04190"
                     /product="hypothetical protein"
                     /protein_id="BBL22964.1"
                     /transl_table=11
                     /translation="MRWKKLGKIFDPVEHQIPNNCVEFSQAPQSLVLQDRVRIYYSTR
                     EKDASGKYLSHVAYVDFSRDMKDIIGTSQHTVIPLGKLGCFDEHGIFPFNVLKDGDRV
                     LAYTTGCNRKSSVPVDAAIGLAISHDEGQTFSRIGLGGPIVAATLHEPFLVADAFVQR
                     YGDTFYMWYIYGTKWLKFADSGQHERVYKIAQATSPDGLHWNRDGKHIIESKLDENEC
                     QALPTVIFHAGKYHMYFCYREAHGFRKESGRGYRLGYAYSLDLIHWVRDDANAGIDLS
                     DEGWDSEMQCYPHLFECDGKIYLIYNGNEFGRRGFGLAVLEN"
     CDS             complement(465839..466810)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013096014.1"
                     /locus_tag="CT3_04200"
                     /product="glycosylase"
                     /protein_id="BBL22965.1"
                     /transl_table=11
                     /translation="MFHWKKLGRIFDPQCMASPAWMHEFAQSPATIINPHTVRVFFCT
                     RPAPSADGKYQSHIAYLDLDRKNLLNILKISATPVLELGKVGTFDEHGTYPVSVISHQ
                     NEIRAYYAGISRCESVPFNATIGLAVSQDGGDSFHRLGEGPVLPYTPDEPFLLGSPRI
                     RRFEGQWQLWYVAGKEWRITENSKKEPIYKIRMATSTDGIQWNKVGRDLIPNKLGEHE
                     CQACPDVIYRDGKYHMFFSYRDIYNYTSREGGYRIGYASSPDMETWTRNDDLIDIPLS
                     NEGWDSEMINYPHVFELDGSIYMLYQGNGMGRSGFGLAVLDKQSIWS"
     CDS             complement(466848..467600)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013096013.1"
                     /locus_tag="CT3_04210"
                     /product="hypothetical protein"
                     /protein_id="BBL22966.1"
                     /transl_table=11
                     /translation="MPDSASSRPGMPYLQHVGGMTLGIMQPYFLPYIGYFQLIAAVDE
                     FIVYDNIKYTKKGWINRNRLLSNGEAATFSLPLRKDSDALDIVHRELSESFDRKKLLN
                     QFIGAYGKAPYFQETIALIQDILLYDSSNLFYFLKNSITAVCKHIGIPTRIQDSSALP
                     IDHDLKSQDRVLAMCQATHATTYINPIGGVELYSRDAFEARGIQLKFIQSELHPYPQN
                     HHDFVPWLSIVDVLMFNPVQDVSAMLKYHRLS"
     CDS             complement(467635..468333)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04220"
                     /product="hypothetical protein"
                     /protein_id="BBL22967.1"
                     /transl_table=11
                     /translation="MNLRTPAHYQSLEFARVTQLMHDFKKQGSATLRILDYGCGTGKF
                     LDLFCSLGMDASGVDINPEYIQRAVQKGQSAYDPEYFFSTDTPPYDIIFLSHLIEHLS
                     PDELHGLIPKLCQKLSPHGKLIVLSPTHGERFYHDFTHIRPYLPQSFRHAFGATGMPN
                     SYQEIKLLQLEDIYFFKDPYRPRYWRSFYKKTGLMSFLTRCTVAALDGMWRFSRGRCG
                     VTASWLGVYVLQEK"
     CDS             complement(468330..469103)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04230"
                     /product="hypothetical protein"
                     /protein_id="BBL22968.1"
                     /transl_table=11
                     /translation="MSELFTRPEEFLAVLRQERKDVLDRLRKTKFSSLKAGLTHTQVI
                     PYASYSPWLDDSVFSALHERVKGHTMVDIYRCHELYTLARQCAHIPGDLVEIGVWRGG
                     TGALLAAGAQKRIALFDTFTGVAKSDTQHDTLYTGNEHSDTHQNLVESLFSSMQLECD
                     IYPGIFPDHTFDQLPKEISLAHIDVDTRGSASEAFDVIWPRVQPGGVVVFDDYGFFGC
                     EGITDFVNSIARNQRDAFFVHNLNGHGLLIKQLVPGSTR"
     CDS             complement(469112..470107)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011202935.1"
                     /locus_tag="CT3_04240"
                     /product="carbamoylphosphate synthase large subunit short
                     form"
                     /protein_id="BBL22969.1"
                     /transl_table=11
                     /translation="MGFHLVNGDPDTSRVTRRKSLTYQALADLPATPSVYADPADVAH
                     WPAAIKPDCGQGGQGFSIAHTASEAQAAMARIEDPLLVEYLPGQELSVDCFTSFTKEL
                     IWIGPRTRERVRAGITMRSELLEASAELREIAHGINARLSMRGPWFFQVKKDLSGHWK
                     LLEVSCRVASTTAAARARGVNLPLMAVQDFMGRRLQTLDHRFVQVIDRNITTKARLEF
                     HYDKIFIDLDDTLIIDGAAVPRAMAFVYQEHAKGKEIFLITRHAGDVETTLQRTHIPP
                     SLFKKIIHLQNEESKADFIEPHSIFIDNAFLERLDVAKKQAIPVLDVDALEFFIN"
     CDS             complement(470530..471792)
                     /codon_start=1
                     /gene="fliC_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P9C4"
                     /locus_tag="CT3_04250"
                     /product="flagellin"
                     /protein_id="BBL22970.1"
                     /transl_table=11
                     /translation="MAATINTNIASINAQRNLTLSGSSLNTTMQRLSSGLRVNSAKDD
                     AAGLAIAERMNTQVRGLSVASRNANDGISLAQTAEGALGKVGDMLQRMRELAVQASNA
                     TNSDSDRKALQAEVSQLSAEIDRVAKQTNFNGQKILDGSFAGAVFQVGANSGDNVTLG
                     ALADTRASQLSTTSYAATNSVVDLASITDISTSIPANPATASAADFASITVGTAPNAT
                     TVTLETIKAAQNPQERLGQVVTAINNKTADTGVTAYLTKIEGTETYKVELMSGKLDSN
                     GEPVAVTLSANFSAAATGIVKADFDMAGGTAAATSVINDKGIEQIDVTTQAGAWVALK
                     KIDSAVDQVNGARATLGAVQTRFENAVNNIDIQVENLSAARGRIMDADFAKETANLSR
                     TQILQQAGTAMVSQANQIPQNVLQLLQK"
     CDS             472179..473408
                     /codon_start=1
                     /gene="fliC_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P9C4"
                     /locus_tag="CT3_04260"
                     /product="flagellin"
                     /protein_id="BBL22971.1"
                     /transl_table=11
                     /translation="MAMTINTNTVSINAQRNLGLSGSSLGTAMQRLSSGLRVNSAKDD
                     AAGLAISQRMSTQVRGLTVAARNANDGISLAQTAEGALGKVGDMLQRMRDLAVQSSNA
                     TNSKSDREALQAELSQLRDEVDRVAKTTTFNGAKLLDGSFTGGVFQVGANSGDNITVG
                     ALSNTKVTELGNSVYGSGSTTAATAEALQTTLAGNGTVAAADVTIGIRGADSTTVHTI
                     TIKADANMTKEQALGKTIEAINSKTADTGVTAFLEEDAAGVMQIQIRATAEQAGNATG
                     VAITYSTGTNVTGTGANLVAAASVTDAGDKGIDQLDISTQSGSWEALQRIDGAIDSVS
                     SARAGLGAIQTRFEKSIENIESMNENLTAARGRIIDADFASETAALSRAQILQQAGTA
                     MVSQANQLPQQVLSLLK"
     CDS             473632..474861
                     /codon_start=1
                     /gene="fliC_3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P9C4"
                     /locus_tag="CT3_04270"
                     /product="flagellin"
                     /protein_id="BBL22972.1"
                     /transl_table=11
                     /translation="MAMTINTNVVSINAQRNLGLSGNSLSTSMQRLSSGLRVNSAKDD
                     AAGLAISERMSTQVRGLTVAARNANDGISLAQTAEGALGKVGDMLQRMRDLAVQSSNA
                     TNSKSDREALQAELSQLRDEVDRVAKTTTFNGAKLLDGSFTGGVFQVGANSGDNITVG
                     ALNNTKVTELGNSIYGSGATAATATDALQTILAGGGTVAAADVTIGIRGANSTAVQTV
                     TIKADANMTKEQALGKAIEAINSKTADTGVTAFLEEDAAGVKQIQLRATEDTSGTATA
                     VAVTYSSGTNTTGTGNNLVAAGTLTEAGDKGIDQIDISTQSGSWEAMQRLDKAIDSVS
                     SARGQLGALQTRFEKAVENIDIQNENVTAARGRIIDADFASETANLSRAQILQQAGTA
                     MVAQANQLPQNVLSLLR"
     CDS             475210..476658
                     /codon_start=1
                     /gene="fliD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ECA8"
                     /locus_tag="CT3_04280"
                     /product="flagellar hook-associated protein 2"
                     /protein_id="BBL22973.1"
                     /transl_table=11
                     /translation="MGVSSVGIGSGLKVDEIVSQLVELEKKPLETLQSKAEIISAKIS
                     SYGQIKSLMDDLNTAARDLTLDRTWGASKVSSSGSAATGAMTGLAAAGSYNINVLQLA
                     QSQTSVTAKLAKGATMDVSGVMRFKIGNLETKTFDLTINASDSLQNVADKINGDTNIS
                     KSVVATVIKDSSGKEQLMIRSRETGLDSKFEVSLGSGVDANGDLEAFGALDTGNLVTL
                     AGAGGVTTTQAAKNAEMELNGVKLESNTNTFAETIPGLSISVSAVGTSLLTIAPDKDA
                     VQASIQKFVDAYNAVNDLLSQSTKSVRTADGKTDDAAIKDGSGLLQGDSSTVSLQNSL
                     RMMLQRVSSNATGAYTRLSEVGMQMQQGGKLTVDTEKMTAALKDVDSLKSLFTAKADA
                     QGAGGGVATNYKTFTDELLAWEGTLNNKTDALQKQLDNNGDQQDKVNARASTLETRLR
                     AQYSALDVKMASLNALDSYVSQMVTTWNKSSD"
     CDS             476712..477131
                     /codon_start=1
                     /gene="fliS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z5S6"
                     /locus_tag="CT3_04290"
                     /product="flagellar protein FliS"
                     /protein_id="BBL22974.1"
                     /transl_table=11
                     /translation="MFSSTGFSKANAYRQVGVHSGVEDASPHMLIQMLFDGLFQSLNA
                     ARGAIERGDIEEKGQLISRSVRILQEGLIMGLDMEKGGELAANLRLLYDYCVAQLTKA
                     NLHSDASLVEEVIGVLQPVAQGWKEIGSQVDTVARGD"
     CDS             477133..477432
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04300"
                     /product="hypothetical protein"
                     /protein_id="BBL22975.1"
                     /transl_table=11
                     /translation="MEMQLLDYYKAIEAKSADMLQAAQSHDWDAVVDCEKACGVLINE
                     LRVQAEQNVLSVLERKEKTRIMQRILRNDAQIRILAEPWLAQLDHLGKVPASVMH"
     CDS             complement(477820..478140)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04310"
                     /product="hypothetical protein"
                     /protein_id="BBL22976.1"
                     /transl_table=11
                     /translation="MDLRLHSATSPVSAGGDLTARLTKPLQKAEAQGNGFSTELESAL
                     RSVSASQNHSSHLQKEVQLENPSVSLEETMVAMQKAQIGFQATLHVRNRLVQAYTDVM
                     NMQV"
     CDS             478278..480017
                     /codon_start=1
                     /gene="fliF_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63YF7"
                     /locus_tag="CT3_04320"
                     /product="flagellar M-ring protein"
                     /protein_id="BBL22977.1"
                     /transl_table=11
                     /translation="MGSVSGPHFLFVEEPMSAVAQVPVAENPPPAVTQAPASWQQRIS
                     DMDRGQRLRWGAVAAVAVAAVAAAFFFSRQPDYRVLFSNLSDKDGGAIVAQLAGMNVP
                     YKYTEGGGAIMIPADRVHDVRLKLATQGLPKGSVSGFEIMEGSKFGITQFQERVNYQR
                     ALEGELTRSIQGLSAVQNARVHLALPNQNGFFREQQKPSASVLLTLYPGRVLDRTQIA
                     GIVHLVSSSVPELLPTAVSVLDDSGKLLSQAPDGKDSPVDLQQLMFQQQLEKQYTQRI
                     LDILEPVVGKGNVKAQVTAELDFSQSESTTEQHNPNQGQAPSAVRSQQVVESTGEQKP
                     QPPTGVPGATSNQPPQQNQAPINSNNAPVLQAANGTQKADFMTIPGSKRESVTNFEVD
                     KTVRVTRNSTGGIKRMTAAVVVNYLPVAAAEGEGAAAPKALPAEQQAQMLALVRETIG
                     YNADRGDSVNLMNAPFRVEKVNVENLPLWRQPETIELAKTLAWPVGLGVAAAVVLLGL
                     LLRRRKQKKQEATAVDLLAAEELERPALAAPLKPGEPSPEQIRLEQARALAKQNPIAV
                     ANIVKTWISGEAS"
     CDS             480058..481053
                     /codon_start=1
                     /gene="fliG_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004197167.1"
                     /locus_tag="CT3_04330"
                     /product="flagellar motor switch protein G"
                     /protein_id="BBL22978.1"
                     /transl_table=11
                     /translation="MDDRGLNDAAILLMSLGEEEAAEVFKHLSPKEVQKLGETIARMR
                     AVSKEKVDFVIARFTDDCAAQSLLVEDASGYVKSVLRRALGDDKAALLLDRILQGGDV
                     SGIESLKWMDPVSVAELLRNEHPQIVAAILVHLEHEQAAAVLMQLPERLRSEVMLRVA
                     TLEGIQPSALKDLNEVLYKVLAGGDKIRKTSLGGVKTAAEIINQLGGNADVAVLDTIR
                     NYDADLAQKIMDKMFVFDDLVKLDDRSLQLVLREVPSETLIVSLKGGSMEVRDKILAN
                     MSMRASAALKEDLESRGPMRLSEVEAQQKEILKVVRRLAEENQITIGGGAEDSFV"
     CDS             481064..481915
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04340"
                     /product="hypothetical protein"
                     /protein_id="BBL22979.1"
                     /transl_table=11
                     /translation="MTSSTHHYARFIPSEEIDAQSVRHWQFGDVQKSAPGAALQPLHE
                     LATLTDLLPPPAPQGIAAQALAEDAVVAEEENAVQLREEEVHAQLEQARQESHDAGYE
                     AGMQAGHGLGLEEGKQQAGAEWQHRFDDYMAQQGRQAAEQLQALLQAAQRDVQGMQQH
                     MAPDVLQLACDIARQVVRQELRSNPQALLPVVREALDMMSAESKPATVRLNPQDWERL
                     QEPLKAAHPQPKIEWLADASVKPGDCLVESAGAQVDGSLERRWQRAVAALGLVSTWYD
                     GAPAHGQ"
     CDS             481905..483314
                     /codon_start=1
                     /gene="fliI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004197164.1"
                     /locus_tag="CT3_04350"
                     /product="flagellum-specific ATP synthase"
                     /protein_id="BBL22980.1"
                     /transl_table=11
                     /translation="MANDTDMPVADQLQRFLQLGRERLKQPLPLHSHGTLTRLTGLVL
                     EASGLRVPVGSQCHLQMPGQEPVLAEVVGFAGDRAFLMPAGDIQGLSCGATVTPAEPY
                     VPPLQLSDTEVPVLAKGVLRLPMGDGLLGRVVDSQGVPLDHAGPLANVQAETLDREPI
                     NAMERAPVRESLDTGVRAINALLTVGRGQRLGLFAGSGVGKSVLLGMMARYTKADVIV
                     VGLIGERGREVKEFVEDILGAQDRSRAVVVAAPADAPPLLRMQGANYATAIAEHFRDK
                     GQHVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSCFAKLPGLVERSGNGLHGVGS
                     ITAFYTVLSEGDDQQDPIADASRAILDGHFVLSRALAEQGHYPAIDIEQSASRVMHNV
                     VTREHFDLARRFRAVYSCYQKSRDLIQVGAYMSGSDPAVDEAIRLQPSMVQFLQQTMF
                     EAAPMEQSLVDMAAVLEQQ"
     CDS             483329..483799
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04360"
                     /product="hypothetical protein"
                     /protein_id="BBL22981.1"
                     /transl_table=11
                     /translation="MLMSSLHALMVAIEMATRKRDEARQALRERQRAHAAAQSQMEQL
                     ESYTEEMRQRWAPQEGAELKLEVMYHHEQFMARLQHAIGLQTRVMQDQAIRLEAAQKA
                     LMATELRLSSLNKVVETRRRDIALAQLRREQKQTDERAALQFIGRTFGMQFQEA"
     CDS             483802..485169
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04370"
                     /product="hypothetical protein"
                     /protein_id="BBL22982.1"
                     /transl_table=11
                     /translation="METLPSTPAPGKRATAAEGLAALQRKPRAAEGDSDSAGQTSAAG
                     FSRLLRAAAQPEASDAALTDLGATGADPSLGLMVQQTLPQPEVAVEGDATSMTLMVGD
                     AAWTVQSLVGQTARMDQSADVAVRNGSHLQTRMDAGDPLGLMRSAAQSAQGAASQVPV
                     VAQGVAQALGGGVMQAVAQGDVAGAAAWNAVSDTAQSVVDAMADAVKSDDGDALSRGE
                     RGSEGRVSLQGQWTATDRQAQPAEVMQRLLGQMSQFLSATGATEAAGLRRAGSKSVDD
                     AAASAQDAAAVPPGAGIGAGTGRLQDNAVAQAAAGQQTSNGDAQGAQAEPDMAFWMNS
                     RQQRAEVVLDRDGAPVRVQVTMEGSTAHVTFRSDEQATRSMLDASVAQLRDMLAAQGV
                     ELAGVQVGAQGSGSSQGGSSGAQEAFMPEGARRVRLPSQAGAEQTPGLQRAGSGSRQG
                     VDIFA"
     CDS             485571..486131
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04380"
                     /product="hypothetical protein"
                     /protein_id="BBL22983.1"
                     /transl_table=11
                     /translation="MSATSSAASPGKEPAKSKKLIVIGAVVALLVIVAAALGLFLVNK
                     QRHAADDDAQESKAAAVLVPTFLPMENMVVNLADTGGDRFAQIGITLELQDEKTSASV
                     KQYMPSIRNGVLMLVSQRTAEELLRREGKEKLAADILAEVSRPLGVRPSAARVEHDAD
                     DGEEEERPRRRANPVRRVLFSSFIIQ"
     CDS             486153..487157
                     /codon_start=1
                     /gene="fliM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004196784.1"
                     /locus_tag="CT3_04390"
                     /product="flagellar motor switch protein FliM"
                     /protein_id="BBL22984.1"
                     /transl_table=11
                     /translation="MSDSFLSQEEVDALLEGVTGESQKSDAGDVDEANVRNYDISSQE
                     RIVRGRMPTMEIVNERFARNFRIGLFNFIRRSPEVSVGTVSVQRYSAFLRRLAVPTNF
                     NIVAIRPLRGNGLVVCDPSLVFGIIDTLYGGAGRLQTRIEGRDFSATEQRVINRLVDV
                     ICEEYKKAWHGIYPLELAYQRSEMQPQFANIATPSEIVVSTAFQLEIGDISGSIHMCY
                     PYATLEPIRDILYSSTQGDSMEVDRRWVKVLTREIQSAEVTLVAELARADATVEQLLA
                     MKPGDFIELDREPRIKASIGGVPVFDCQYGTYNNKYAIRVEQCLRGVDANWTGDKNGN
                     "
     CDS             487147..487593
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04400"
                     /product="hypothetical protein"
                     /protein_id="BBL22985.1"
                     /transl_table=11
                     /translation="MATDQNTDAAGAGAGDDPFADWAEALGEQKKVDDQQSVLDAEQG
                     GPLSGEPAFARGTEVPVNDINMVLDIPVQLSVELGRTKVPIKYILQLAQGSVVELDAL
                     AGEPMDVLVNGYLIAQGEVVVVNDKFGIRLTDVVTPSERLRRVSRG"
     CDS             487586..487984
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04410"
                     /product="hypothetical protein"
                     /protein_id="BBL22986.1"
                     /transl_table=11
                     /translation="MDNSATASVSSFQTIAVLVLFIGVMAVLPWLLRRWQQRQMVARG
                     GQGVQTQVLSSVALSPGQRIVVVEVGQGGHSTRLVLGVTAQNIHCLHVLGSAAPAGAA
                     DAAAASSASFAGAMEQLQQASSQPAASTHP"
     CDS             488049..488807
                     /codon_start=1
                     /gene="fliP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q3V7T3"
                     /locus_tag="CT3_04420"
                     /product="flagellar biosynthetic protein FliP"
                     /protein_id="BBL22987.1"
                     /transl_table=11
                     /translation="MSRTSLLAKLAACALTCAVVPQMAWAQNAPSLPLLVGSGGGGTN
                     FSVPIQTLLFFTALSFLPAILLMMTGFTRIVIVLSLLRQALGTQSSPPNQVIIGLSLF
                     LTLFVMGPTLDRVYEDAYKPYSSGAITFEAAVGKAELPMRDFMQRQTRQSDYALFARL
                     AKLPADTKIEDAPFRVVVPSFVISELKTAFQIGFMIFIPFLIIDMVVSSILMSLGMMM
                     LSPVLVALPFKIMLFVLADGWNLLIGSLASSFAI"
     CDS             488819..489088
                     /codon_start=1
                     /gene="fliQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199882.1"
                     /locus_tag="CT3_04430"
                     /product="flagellar export apparatus protein FliQ"
                     /protein_id="BBL22988.1"
                     /transl_table=11
                     /translation="MNAQSVLTFGREALTLLLMISLPVLLTVMAVGLVVSIFQAVTQI
                     NENTLSFVPKLVAAVLVFLVAGPWMLSTVVDFIRRTIENIPLALG"
     CDS             489135..489908
                     /codon_start=1
                     /gene="fliR_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7VYF6"
                     /locus_tag="CT3_04440"
                     /product="flagellar biosynthetic protein FliR"
                     /protein_id="BBL22989.1"
                     /transl_table=11
                     /translation="MFGFSEQQIMAWLSPIIWPFLRTLAMFSVAPVFSQRAIPARGKV
                     AMAFVVALGAQATLIDQPVVSVNSPDALGTVLQQVGVGLAIGFAARLAIAAVEVSGEL
                     VGLQMGLNFASFFDPVSNAQLSAISRFLVQIFTLLFIAINGHLVVLMAVIKSFDAFPV
                     NGHFMQSVSQMRIHELGSAIFSSALWIALPMMALLLFVNLTMGIISRIAPQMNIFAVG
                     FPVTLTVGMLGITATLPMMEQPLLRMFEQALGVFGAVSF"
     CDS             complement(490090..490719)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004197176.1"
                     /locus_tag="CT3_04450"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL22990.1"
                     /transl_table=11
                     /translation="MIQVVLCDDHAVLRRGIRDTLQEATDIRVTAEAASYTELREALR
                     TAACEVLLLDINMPGRNGLEVLASVRETHPEIKVIMVSMYPEDQYALRSLKAGAQGYA
                     NKAGDPVQLIEAVRMVMQGRKYLTAEVAQMLAESVAQPQAEVLHETLSEREMQTLQKI
                     ATGRRLTDIAEELMLSPKTVSVYRARVLEKLQLANNAELTVYAIRNNLV"
     CDS             complement(490716..491747)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04460"
                     /product="hypothetical protein"
                     /protein_id="BBL22991.1"
                     /transl_table=11
                     /translation="MRRAQRVCQIDCVDQLSAFLEALAARPYDLVLADYYLPGFTAID
                     AWEGAQQISPCPPFVLLSGAIGEAAAVDAIRLGISDYLLKDDMARLPHVLERALEVHE
                     ARRARELAAAELAASERRLAELTEHLQTSIEQERTAIAREIHDDIGGALTAVKFDLSW
                     IARNTATQPQVVQHAQSALEMLQHALGASQRIMLDLRPPVLDQGLAAAIQWLAEGFER
                     RTGIPVALRLSPLHNNLASNIQLVAYRTTQEALTNVSKYAQATAVHIEMSDAEGVLTV
                     EVRDNGCGIAPAQRDKPKAFGLRGLAERARTVGGWLDVSSQIGKGSSIIVSIPLPSAS
                     GAEFAKEML"
     CDS             complement(492030..492275)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04470"
                     /product="hypothetical protein"
                     /protein_id="BBL22992.1"
                     /transl_table=11
                     /translation="MELQFRDGTAQRMAGGFELVAVHCAGTREQAVGFRKPFQQIGRG
                     MIEEPFQSMKVAHDDQQGILQFRRNHDRHLNSRFSGR"
     CDS             492156..492464
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04480"
                     /product="hypothetical protein"
                     /protein_id="BBL22993.1"
                     /transl_table=11
                     /translation="MLERFSEANGLLSGTGAVDRNELEAARHALRSAVTELQFHDMAT
                     QLIWHTTQVLQGCAFRLAAETMGVEEGELPSEPAQSMMPERPNPVTQSEMDAGSVDLF
                     "
     CDS             492510..492872
                     /codon_start=1
                     /gene="cheY5"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002719598.1"
                     /locus_tag="CT3_04490"
                     /product="response regulator"
                     /protein_id="BBL22994.1"
                     /transl_table=11
                     /translation="MQSILAVDDSPSMRKMVSFTLSGAGYKVVEAVDGMDALEKAEAQ
                     QIDLVLADQNMPRLDGIGLTKKLREHPRFKNTPILILTTESSDQMKQAGRAAGATGWL
                     VKPFDPNRLIEVIQKVIR"
     CDS             492906..495035
                     /codon_start=1
                     /gene="cheA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205291.1"
                     /locus_tag="CT3_04500"
                     /product="chemotaxis protein CheA"
                     /protein_id="BBL22995.1"
                     /transl_table=11
                     /translation="MVDTHTDAGGGADFDLTQFYQIFFEEAGENLDQMEQMLLNLDLS
                     AANDEELNGIFRCAHSIKGGSATFGFSDVAELTHKMESLLDRLRRHEITPIPEMVDVL
                     LESADASRSLLARHQAGGEGEALSTSDLVRRITELAAGNGAVPAPVAAPVVAVPVAPP
                     PPAPAPVAAVPVGGTRALEIRIGPMDNLDLADAIKELFRDIPGLGTIEDLPCTDAGCR
                     LFGVQTQSSDEDLLDLFAFHVAKEQVQIRGQASQAAPVAAAASPQAVAVEAASAPVEA
                     AAALAADMVSGNFGIFPGAPGDPETRPALAPAKASAAAKPAVAATMESTSIRVALGKV
                     DQLINLAGELVITQAMLAQNSRTLDPAANQQLLAGLADLDRNTRDLQECVMSIRMIPM
                     STVFSRFPRMLRDLANKMGKKFDLVLQGEATELDKGLVEKITDPLTHLVRNSLDHGIE
                     MPEQRIAAGKSEAGTLTLAASHQGGSIVIEVRDDGRGMNREKILRKARERGMDVSDSL
                     PDADVWQLIFAPGFSTADVVTDVSGRGVGMDVVKKNITALNGTVEIDSAEGVGMRVAI
                     RLPLTLAIMDGMSVGVGQEVYILPLSSVVESFQVNPNDVNTVAQGSQLVKVRDEYMPV
                     IAMEKTFRVPRAEGEKSSDIMVVVESDGSRVALLVDELLGQHQVVVKNLESNYRKVPN
                     VSGATILGDGTVALILDTISMVNRARY"
     CDS             495103..495591
                     /codon_start=1
                     /gene="cheW2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004191562.1"
                     /locus_tag="CT3_04510"
                     /product="chemotaxis protein CheW"
                     /protein_id="BBL22996.1"
                     /transl_table=11
                     /translation="MNVMGKNTESAATGTREYLTFRLGQEEYGIDILKVQEIRGYEQP
                     TRIANAPEFIKGVVNLRGTIVPIVDMRLKFNCTEVEYNSFTVVIILNLRNRVVGIVVD
                     SVSDVMELAPDAIRAAPDIESAIDNGCILGLGSVGERMLILLDIEKLMSNVDMGLVAP
                     AE"
     CDS             495744..496346
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04520"
                     /note="frameshifted, deletion at around 496343"
                     /product="hypothetical protein"
                     /protein_id="BBL22997.1"
                     /transl_table=11
                     /translation="MPASMGGGAAQREFAWTNADFTRVQALIYKHAGISLHDGKHAMV
                     YSRLSRRLRDTRLDSFDDYLSWLEKQPGDAPEWQEFVNALTTNLTSFFREQHHFEIFA
                     QHLRSKQQPSWKVWCNAASTGEEPYSIVMTAQEALGANAQFKLTASDIDSKVLATASN
                     GVYRLDNVKNLSQERLRRFFMKGKGANEGMVRVKPELRRA"
     CDS             496343..496585
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04530"
                     /note="frameshifted, deletion at around 496334"
                     /product="hypothetical protein"
                     /protein_id="BBL22998.1"
                     /transl_table=11
                     /translation="MIDFMQVNLIKDDWPFQESFDVVFCRNVMIYFDAPTQRRVLEKI
                     HRVLKPGGMLFVGHAENFSESRDLFTLRGKTVYERR"
     CDS             496648..497400
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04540"
                     /product="hypothetical protein"
                     /protein_id="BBL22999.1"
                     /transl_table=11
                     /translation="MSSNPLGGGFGSSLAFGERRGPVPKMAPPSAPVFHRPAAAQPPA
                     PPSSLEALKRRTPKPGEASFFYFDPHFQFNAVKVLPGEYFVTGENMAIVTVLGSCIAA
                     CLWDRTLNIGGMNHFMLPDGDAGDVSGRYGSYAMELLINEMMKLGARRETMQAKIFGG
                     GQVMANFTTMNVGERNTDFVTQYLNTERIPIVSEDVLDIYPRKVVYFPTTGKALVKRL
                     AHAHPEELVAQERRGNAATVAQSNAGGSVDLF"
     CDS             complement(498263..500455)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004550744.1"
                     /locus_tag="CT3_04550"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL23000.1"
                     /transl_table=11
                     /translation="MQTGHSLSKAALRAALDNGGNMALITLLDAQLAFGHVALLDHAS
                     FSLETNERVGLIGRNGAGKSSLLKILGGLAHPDDGNLQVQTGVRIAYVAQEPDLQPKH
                     TVFQAASTGLAEVAALRDQYLSGADGVDLDALQSRIEAQDAWNWEQRVEETLQRLHLK
                     ADALISNLSGGVRKRVALAQALVTQPDVLLLDEPTNHLDLDSIEWLEGLLKEFKGAIV
                     LITHDRSFLDNVATRIVELDRGELTSYPGNFAAYVTNKAEQLAQEAVINAKADKLLAQ
                     EEIWIRKGVEARRTRATARIVRLQELRSEHAARRTAQGSVKMDVSSGEKSGKLVSELT
                     HVSKAFGDRVIVDDFSATILRGDKIGLLGPNGAGKTTLLKLILGQLQPDPAPANAPAP
                     EPGESPWGTVRQGTNITVAYFDQMRNALDLDATLEDFISPGSEWIEIGNQRKHVKSYL
                     GDFLFSPARANSPVRSLSGGERNRLLLARLFARPTNVLVLDEPTNDLDIDTLELLEDL
                     LQNYDGTVFLVSHDRTFMDNVVTSTIAAEGNGQWREYEGGVQDWLVQSKRSKAAAEQA
                     AKAGASKPAPAKEAATASTSAPAAAPAAKRKLSYKEQRELEQLPAQIAALETEQATIQ
                     ATLADGSLYATDNARAVQLQLRDGEIEAALMAALERWQSASAAAPHRRHHGQWLRAAC
                     RRRCSWLRPAHSCSCRRPSSRASRRPRRPPCRSASRQRHCGRRRRRRT"
     rRNA            500903..502432
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00010"
                     /product="16S ribosomal RNA"
     tRNA            502523..502599
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00090"
                     /product="tRNA-Ile"
     tRNA            502630..502705
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00100"
                     /product="tRNA-Ala"
     rRNA            503087..505966
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00020"
                     /product="23S ribosomal RNA"
     rRNA            506099..506205
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00030"
                     /product="5S ribosomal RNA"
     rRNA            506548..508075
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00040"
                     /product="16S ribosomal RNA"
     tRNA            508166..508242
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00110"
                     /product="tRNA-Ile"
     tRNA            508273..508348
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00120"
                     /product="tRNA-Ala"
     rRNA            508732..511612
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00050"
                     /product="23S ribosomal RNA"
     rRNA            511745..511851
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00060"
                     /product="5S ribosomal RNA"
     rRNA            512195..513722
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00070"
                     /product="16S ribosomal RNA"
     tRNA            513813..513889
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00130"
                     /product="tRNA-Ile"
     tRNA            513920..513996
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="CT3_t00140"
                     /product="tRNA-Ala"
     rRNA            514378..517253
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00080"
                     /product="23S ribosomal RNA"
     rRNA            517386..517492
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="CT3_r00090"
                     /product="5S ribosomal RNA"
     CDS             517540..517857
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04560"
                     /product="hypothetical protein"
                     /protein_id="BBL23001.1"
                     /transl_table=11
                     /translation="MFLAVQKCMWPSQGLSIIQSTVFYLQTDNPIKKSTLRVLFFIDG
                     AEEWLEAPMESAVATSWATWVAAGILARVPARDGAGITCGAGRPQTPSTRLFQRCSTA
                     RSW"
     CDS             complement(517781..518527)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014205980.1"
                     /locus_tag="CT3_04570"
                     /product="class II glutamine amidotransferase"
                     /protein_id="BBL23002.1"
                     /transl_table=11
                     /translation="MNCNTPTDVRFSFSGFAQRAGNTGDHTDGWGIAFFEDKGLRHFV
                     DHERAIDSPVAQLIRQYPIKSQNVIAHIRKATQGVVSLQNCHPFVRELWGRNWVFAHN
                     GDLKGFAPKLHAHFHPVGSTDSELAFCWIMQELWKSHAGVPSIEELTLTLRELAARIA
                     PHGTFNFLLSSGEALWAHATTHLCYTERRHPFAQAHLADEDLSVDFASETTPSDRVAI
                     IVTSPLTKNEQWNTFEKGELMVFVDGQRRM"
     CDS             518701..519126
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815949.1"
                     /locus_tag="CT3_04580"
                     /product="MerR family transcriptional regulator"
                     /protein_id="BBL23003.1"
                     /transl_table=11
                     /translation="MHTESSPSASVSYSISDLAKEFDLTTRAMRFYEDMGLLQPERTG
                     PGGRNRVYSPRDRTRLRLTLRAKRLGLSLSEAKEIIDMYDSPRDTGMQLKKFLQVLGA
                     HRLQLEERLADLQANLEEVMEHEAEARQLLDKLGGNEVS"
     CDS             519172..519618
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530371.1"
                     /locus_tag="CT3_04590"
                     /product="thioesterase superfamily protein"
                     /protein_id="BBL23004.1"
                     /transl_table=11
                     /translation="MAADEAALDRVRESFAQQGAMGTLGAQLTHLAPGEVDISFDWAP
                     GLTQQHGFIHAGMLSAALDSACGYAGFSLMQEDAGVLTIEFKTNLLAPAKGQRFRCEG
                     RVLKPGRTIVVAEGRAYAIDNGAEKLAATMHCTLMAVQGRSGIAGK"
     CDS             519674..520855
                     /codon_start=1
                     /gene="ivd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815950.1"
                     /locus_tag="CT3_04600"
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="BBL23005.1"
                     /transl_table=11
                     /translation="MSNLPGLNFQLGEDIDALRDAVREFAQREIAPRAADIDRTDQFP
                     MDLWRKFGDLGVLGITVSEQYGGADMGYLAHMVAMEEISRASASVGLSYGAHSNLCVN
                     QINRNGNAAQKAKYLPKLISGEHVGALAMSEPGAGSDVISMKLKAEDKGGYYLLNGSK
                     MWITNGPDADTLVVYAKSEPELGARGVTAFLIEKGMKGFSIAQKLDKLGMRGSHTGEL
                     VFQNVEVPSENVLGQVNGGAKVLMSGLDYERAVLTGGPLGIMQSVMDNVVPYIHDRKQ
                     FGQSIGEFQLIQGKVADMYTVLQAGRSFAYTVAKNLDMLGTDHVRQVRKDCASVILWC
                     AEKATWMAGEGVQIYGGNGYINEYPLGRLWRDAKLYEIGAGTSEIRRMLIGRELFAET
                     C"
     CDS             520902..521567
                     /codon_start=1
                     /gene="can"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EEB3"
                     /locus_tag="CT3_04610"
                     /product="carbonic anhydrase"
                     /protein_id="BBL23006.1"
                     /transl_table=11
                     /translation="MTTSTSIDDLFVHNKEWAAQMERDRPGFFTGLMAQQKPKYMWIG
                     CSDSRVPANQITGLEPGEVFVHRNVANVVVPSDLNALTTIQYAVDHLKVEHLMVVGHY
                     GCGGVLAALEGVRLGLADNWTRHVRDVRDKHYDLIKATAVQHRHDVLCELNAIEQVMN
                     VAQSTVLQDAWARGQKVALHGWCYSLKNGHITNLHMTVPGEGGLHEVHQKAVEMVASR
                     QRD"
     CDS             521654..523459
                     /codon_start=1
                     /gene="aceK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63Y16"
                     /locus_tag="CT3_04620"
                     /product="isocitrate dehydrogenase kinase/phosphatase"
                     /protein_id="BBL23007.1"
                     /transl_table=11
                     /translation="MFPQRLDAPQAYDIAQAMMDGFNRHYQLFRAESARAKRRFEQAD
                     WNGQQCAQRERIAFYDLRVTECVQRLEAEFHAGLLPMPVWQQVKLHYIGLMVDHLQPE
                     LAETFFNSVTTKILHRTHFHNNFIFVRPAVSTEYLESRDPGDAPAYRAYYPASLQALP
                     ETLQQLIAHLALQCPYEDLERDIAALTARVQQRLEGLMLRANFQIQVLSSLFYRNKGA
                     YLVGKIITGYTELPLAIPILHSNEGKLVLHAALFGEDDLHGLFSFARAYFMVDMAVPS
                     AYVGFLRSLMPRKPRAEIYNALGLAKQGKTLFYRDFLHHLRHSSDQFRIAPGIKGMVM
                     LVFDLPSFPYVFKLIKDKFPPPKETTRELVQSKYRLVKQHDRVGRMADTLEYSLVAFP
                     RERFSDALIAEIQEFAPSQLEISDRDGDGQQEVILSHVYIERRLVPLNMYLQECFDAG
                     LDNPRAKANMERSVIEYGNAIKELVAANIFPGDMLWKNFGVTRGGKVVFYDYDEIEYL
                     TDCQFRAVPAPRNEEDEMSGEIWWHVGPRDVFPETFGPFLLGHPAVREVFMRHHADLL
                     EPSFWQGHKERIQQGHMHDVFPYDRTRRLTADAAG"
     CDS             523518..524702
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815952.1"
                     /locus_tag="CT3_04630"
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="BBL23008.1"
                     /transl_table=11
                     /translation="MHQDPVVIVSAARTPMGAFQGDFSDLAAHDLGGAAIAAAVQRAG
                     IRPEQVEEVLFGNCLMAGQGQAPARQAGFKGGLPQSTGAVTLSKMCGAGMEATILAHD
                     QLIAGSREVMVAGGMESMTNAPYLLKKGRGGYRMGHDKVYDHMMLDGLEDAYEAGRSM
                     GTFGEDCAAKYQFTREAQDAFAIASVQRAQHATQSGAFAAEITPVTLKTRKGDVTVSV
                     DEGPAKAKLDKITALKPAFKKDGTITAASSSSINDGAAAMVLMRESTAKQLGCKPLAR
                     IVAHASHAQAPEWFTTAPVGATEKALKKAGWKVDDVDLWEVNEAFAVVPMALMAELKV
                     PHDKVNVHGGACALGHPIGASGARILVTLIHALQTHGKKKGLATLCIGGGEGTAMAIE
                     LV"
     CDS             524936..526030
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04640"
                     /product="hypothetical protein"
                     /protein_id="BBL23009.1"
                     /transl_table=11
                     /translation="MQAELPEDDHHAAAPLSAPQIAAFWTEFSGQLAAWVALDGRAFV
                     EEANALLKRQAPGLSLELEGAPAQDGARLVVTAHGNIEQFENAQALVRQAPRLEGYTV
                     QAFRSRTASGNFAMGMQDFELSCDDVLVAPYDAGGIIGLDLAFAKAVPDAMQEHARHM
                     AFILLDHVLGEWDFSVRVGPVDFVEAAAEASPLSQFPAVFDAFQREVLGRTYRFPQEE
                     NDRWISLEVRSRDADEDDAPDLLTFHDSAHALATRADLSYFLTLRFPIDSQESLDSAR
                     DAQDALDAELLRQQRGILAFTRMEGMDFRVAAFYVDDPDAAAQLARQLAAEHAPGLEA
                     ALALEYDPSWREYLGMYGAIHRQDRQADQA"
     CDS             526041..526676
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000510731.1"
                     /locus_tag="CT3_04650"
                     /product="phosphohydrolase"
                     /protein_id="BBL23010.1"
                     /transl_table=11
                     /translation="MITSEEQLRQLYAMPAERALLKQQVDLDRHCLRFIALSPFCVIA
                     TGGNAGSLMDASPRGGAPGFVKAPDPRTLMIPDAGGNNRLDSLSNLLRDPRVGLLFMV
                     PGINETLRVNGTAKLRDEGHYTALFAGPHFHPKLVIEVQVQEAYLHCAKALMRSRLWQ
                     AEAQVARNVLPTMNQMIHAQIGMAAPTETQEQMEHRYRVQIAAEQPGGSIG"
     CDS             526746..527408
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004522956.1"
                     /locus_tag="CT3_04660"
                     /product="short-chain dehydrogenase/reductase"
                     /protein_id="BBL23011.1"
                     /transl_table=11
                     /translation="MALVLIIGASRGIGLGLVQAYVAQGHRVIATVRNPADKTRLQGE
                     GAEVLVVDVADPASVSGLAWQLDGEAVDLALYVAGVWSDLPADVPPSQPEFDRVMHTN
                     VLGAMQALPQVAPLVEAAGGVFGLVSSSMSRLTEAEPDAWLYRASKAALNMVVASSQP
                     QWPRARIVALDPGWVQTEMGGPGATITVEQSVQALVQTLAQVSAEDGGHLLHRNGHRL
                     DG"
     CDS             527499..528629
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003090001.1"
                     /locus_tag="CT3_04670"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBL23012.1"
                     /transl_table=11
                     /translation="MLLTPDQEMIRDAVRDFVREQITPHAARWDKEHHFPKDVHQGLA
                     ALGAYGICVPEELGGAGLDYISLALVLEEIAAGDGGTSTVISVTNCPVNAILMKYGNA
                     QQKEEWLRPLAQGAMLGAFCLTEPHVGSDASALRTTATRDGDDYVINGVKQFITSGQN
                     GDVAIVIAVTDKAAGKKGMSAFLVPTRNPGYQVARLEDKLGQHSSDTAQINFDQCRIP
                     ASHRVGAEGEGYKIALSALEGGRIGIAAQSVGMARAAFEAALAYSKERESFGQPIFNH
                     QAVGFRLADCATQIEAARQLIWHAASLRDAGLPCLKEAAMAKLFASEMAERVCSMAIQ
                     TLGGYGVVSDFPVERIYRDVRVCQIYEGTSDVQKIIIQRALA"
     CDS             complement(528682..529704)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013095314.1"
                     /locus_tag="CT3_04680"
                     /product="membrane protein"
                     /protein_id="BBL23013.1"
                     /transl_table=11
                     /translation="MNAGMRWGTLCGVAAGALWGLVFVVPLLLPDYPAPLLAFGRYLA
                     FGLIAMPLAWWDRTALAQLHRADWLQALRLAAIGSITFYLLLTSAIQLAGVPLPTLIA
                     SGALPVAIAVASNLRAGRAALPWGQLFPSLGLILGGIALVNHHELQALQHSSASQLQD
                     YGLGIGLALVAMLCWTWYPIRNADWLRAHPGVSSRTWATAQGLVTLPMALVGFAISWL
                     WLQQDGLGFTTPLGPRPWEFVCGMFAAGLVGSWLGALCWNAACQHLPTTMSGQLIVCE
                     TLSALAYGFALRQQFPPTETVAGIALLVAGVLWALHSRGTQSPQAAPAAPAVRTPQHT
                     ATHPPH"
     CDS             530008..530808
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010943778.1"
                     /locus_tag="CT3_04690"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBL23014.1"
                     /transl_table=11
                     /translation="MPFAAVNGQRLFYEDTGGSAPVLVFSHGLLMDHRMFAPQVAAFR
                     HGWRCISWDERGHGATATPGQCAPFSYYDSANDLVALLDHLGVERAVLVGMSQGGYLS
                     LRAALTHPQRVRALVLIDTQALKEDPAKMPAHQAVVARWSQQGLDADMAAGLERTILG
                     DGWEGAAAWKRIWQGVDAVNLQQCFATLDARDDISARMGEIRAPALVIHGAQDRAITL
                     ERARAMADALPRARWVEIEGAGHAPNLTHPELVNAAMQAFLGTLAPQG"
     CDS             complement(530842..531330)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015366672.1"
                     /locus_tag="CT3_04700"
                     /product="DUF421 domain-containing protein"
                     /protein_id="BBL23015.1"
                     /transl_table=11
                     /translation="MWQLAVPWWELVVRGVIVYLFLLVFLRLTGRRQTGQYAPFDLVL
                     LLILSNAVQNSMNAGDNSLVGGLVSAATLIGCHVLLARLSFRYPRLRHVIDGRPKVLI
                     REGVVQQDLLLQEQITADDLSAALRANGCLNAHAVERATIETNGQITVVLRRRIPDLD
                     GI"
     CDS             complement(531403..531924)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04710"
                     /product="hypothetical protein"
                     /protein_id="BBL23016.1"
                     /transl_table=11
                     /translation="MALLAEGILKTHWDQSVPVNLARMAKAMRLVVALGDTGEACAVL
                     DISPQRKACVTIGRQHPITLQRYGVAHAIAHLALHHLRPGMQRAICISGSYHADHSQR
                     QDSEANDFALQLLMPESVLRFTVEGGHARTLQELAHLFEVPEILVKQRLADLDLPIPK
                     TLAQRLDPSVAWD"
     CDS             532124..532936
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011337348.1"
                     /locus_tag="CT3_04720"
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="BBL23017.1"
                     /transl_table=11
                     /translation="MPITNLRGQRIHYEDTCGAKPVLVFAHSFLMDGSMFHGLAQRFC
                     SQWRCISWDARGHGRSEGPPQDFSYDDLADDLDALLAHLDIRKAVVVGVSQGGQVALR
                     CALRHSARVRALVLMGTQASTEDPQKLPGHTSLVQEWAAGGLSDPMAKGVAHRLVDAG
                     WHGITEWQAKWARWQPAQLLRCFAAFAGRDDLTGRVAALEQPALVIHGGRDVCVSIPR
                     AQAMAQELPNARWLQIPGAGHAPHLTHPAEVEAAMARFLAHVGESDMHLVAA"
     CDS             533146..533850
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003098644.1"
                     /locus_tag="CT3_04730"
                     /product="hypothetical protein"
                     /protein_id="BBL23018.1"
                     /transl_table=11
                     /translation="MQRRDFHHAATGFAGTLLLGAWSQAQALDLSQLTNAEASSGVKA
                     ALTQGAEAAVALLGKPNGFLSNPQVRIPLPGQLADAAKLLKRFGMGQRVEELETTLNR
                     AAEAAVPEGKAVLLQAVQSMTVADAKSILGGGDTSVTQFFASKTRAPLAERFLPIVTR
                     ETDKLGLVAQYNQLAGKAAGFGLLKAEEANLAQYVTGKTLDGLFTTIGEQERALRRDP
                     VGAGSALLQKVFGALK"
     CDS             533913..534263
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P3B7"
                     /locus_tag="CT3_04740"
                     /product="UPF0225 protein"
                     /protein_id="BBL23019.1"
                     /transl_table=11
                     /translation="MAYSACCGRFIDHWEAAPAPDAEHLMRSRYTAFVCENAPYLLAT
                     WHRNERPPELTFEPGAKWLGLQVKDFVATGADTAEVEFVARFRVAGRPVRLHERSRFV
                     QEAGRWYYVDGAQF"
     CDS             534378..535046
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010925735.1"
                     /locus_tag="CT3_04750"
                     /product="haloacid dehalogenase"
                     /protein_id="BBL23020.1"
                     /transl_table=11
                     /translation="MQFEAILFDCDGVLVDSETITNRVLHGMLNASGWALGEDECMRI
                     FVGHTVRSKAPLIEAETGQPLTDAWMAEFYERRNQRLRAELEPIDGAVPAVAQLFTRL
                     AGKMAVASGADKPKVVMQLEKVGLSPFFGEHVFSGHDLPRTKPWPDVYLAAAAAVQAD
                     PARCLVIEDSVPGLTAGVRAGATVWGFCPKVGAHSTPAQLLEAGATQVFDDMADLPRL
                     LGIL"
     CDS             complement(535214..538159)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04760"
                     /product="hypothetical protein"
                     /protein_id="BBL23021.1"
                     /transl_table=11
                     /translation="MNRIYHSIWNATLGTWVAAPETARTGSTSRRRTRLALSSPPAHL
                     PAWKPLAAALAMGLASMHASAVSSETINVPAGATQTVLNDYFSTDFLGGFIAATGEFV
                     VDSNATLQSSGTLDNHGVLRNTSALTNNGTFNNHIGSQLTNEGGDELRNKGTLTNDGT
                     LTNSDGQLVNDAFSTLDNNGTLNNNAGQQLNNYGTLNNHTGATLMNTGGMLSNYHTLN
                     NSGTLTNNGSLSNANDLQASPGSGLFNTGTLINNGVLYNGTTGNASSVLRNEGTLTNN
                     GSLVNYAALDNTGTLTINDILTNHGLLTNGGTLHLSNAMQGYSGLVNSGTLLNSASGQ
                     LNIDSGSWLHNNGTLTTEGTISNAGTLKNNATGTVSVGTGGTSGTLVGNVVNDGALVF
                     NRSDAAVYSGAISGTGTLQKDGAGILVLSGNSSSYSGSTLVAAGTLLLGSTGKLGGNL
                     TVASGATLAGTGSLGGTGSVTTIASGGTITTGLMAAASTPYGTLRVLGDLVMQSGSTY
                     LVQTDPNSDASSLIKVAGQATLAGSAVHVGVQSDAATDYQVGKTYTILEASHIVGTFD
                     SATSNYAYLDATLGYTSHEVTLQLQRKSSGGGQMEFAELAETRNQSSVANAISSLSSS
                     SALYQFVEKLPTGTPAAVLASLSGDVQASVGSSLVGLGAYAPSVSGQHLRNNMTAGLR
                     AGAPVAQSDGPLPVSAWPSSKALPAWAEVVGHWQRYDGDGNAAQLKQRTTGLFLGMDE
                     EVGTSGWRLGGSLGYTNASGKVADRSSESDVNSYSAAVYGGKSFGTGTGPRINVLGGL
                     AYTWHDIETTRRVTSLGQTLKADYSAHTAQLFAEVGYAIGQYDKVGFEPFAGVSLGQQ
                     RTGSFQERGGFAALQGRSSTDDLASTTLGLRVHSDFQLAGKEGRLRATVGWRHAFGDV
                     TAKKTMAFEGGQNFTVAGTPLARNTAVLGLEADVVLSRSAALVLGYQGEMGSGQRDHS
                     VNAKLRWAF"
     CDS             complement(538569..539624)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011087190.1"
                     /locus_tag="CT3_04770"
                     /product="transcriptional regulator"
                     /protein_id="BBL23022.1"
                     /transl_table=11
                     /translation="MYTPSLVPETASALHASPALTPMAFVQAVVWAYAKRDLDPIAAL
                     QAAQIAPEQVAKTRARITALQMELLCAHAMRELDDEALGWFGRRLPWGSYGMLARASI
                     SSPTLGLAMARWCRHHGLLNDDVTLELVRHGELAELRLQERRDLGPVREFCTVSLLRN
                     AHGVASWLIDARLPLLEASFPFAAPPHADAYPLMFPGTVTFDAPWASLRFEARLLDLP
                     LARDETALQQMLQRALPIQVLPYRREKQWSARVRQLLVADTQLLHTADTLARALLVSP
                     RSLHRQLQTEGQTLQALKDSVRLDRATTLLLRSDRPLKRIAQACGFASDKSFLRAFKA
                     WTGHSPAEYRALHRVAD"
     CDS             539744..541456
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530360.1"
                     /locus_tag="CT3_04780"
                     /product="AMP-binding protein"
                     /protein_id="BBL23023.1"
                     /transl_table=11
                     /translation="MDATLLSTSHARGATDQPLIEQTIGDFFAQMAARQPGREALVSR
                     HQGLRYTYAELHRSARQLASALLGLGLAPGDRVGIWSHNNAEWVLMQLATAQVGIILV
                     NINPAYRTAEVEYALNKVGCKALVAMPQFKTSNYLGMLRELAPELSDHTPGQLEAVRL
                     PTLRTVVWIDVADEGDDQPGMVRFSDLLAEGHAEDARIDQIAATLQNTDPINIQFTSG
                     TTGFPKGATLTHRNILNNGFFIGECMRLTPEDRLCIPVPLYHCFGMVLGNLACFTHGS
                     CIVYPNDGFDALSVLEAVQAERCTGLHGVPTMFIAELQHPQFQTFDLSTLRTGIMAGS
                     PCPIEVMKRVVRDMHLSEITIAYGMTETSPVSCQSDAGTPLEKRVATVGKVQPHLEVK
                     VIDPDTGATVAPGTSGELCTKGYSVMHGYWGDEAKTREAIDAEGWMHTGDLATMDAEG
                     YVNIVGRIKDMVIRGGENIYPREIEEFLYRHPKIQDVQVVGLPDSRYGEELCAWIIAK
                     PGESLDEDGVRSFCQGQIAHYKVPRYIRFVDAFPMTVTGKIQKFRIREEMVEQLQLTT
                     DRTA"
     CDS             complement(541501..543231)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004522967.1"
                     /locus_tag="CT3_04790"
                     /product="sodium/hydrogen exchanger family protein"
                     /protein_id="BBL23024.1"
                     /transl_table=11
                     /translation="MHTVETVLLVLMLGAVTGIAARYMRAIPLPLIQIALGAVIAWPQ
                     KGLHISFNPELFLLLFIPPLLFADGWRIPKREFFALARPILLLAFGLVCFTVLGLGYF
                     IHWMIPSIPLTVAFALAAVVSPTDAVAVSAITRNLGMPHKTMHMLEGESLLNDASGLV
                     AVKFAVAATLTGAFSWGAVAKDFTWMAVGGLGIGALMGWGFSTARDAITRRVGDLAAT
                     QMVLLLVLLPFAAYLAGEKIGVSGILAAVAAGIATNFADLDRGNFISERLQTEGTWSM
                     VESAFNGAIFLLLGLQLPSIIGVTLLDAGDDWWQLVAYVVVISFALLLMRWVWITLGV
                     HGALRRAHQEGKMLEKPSHLLNLATTMAGIRGAVTLAAALSIPVHMRSGLPFPSRDLL
                     IFLATGVILFTLILGSIALPLLLRRMPAHEDTETQHEERSARAAACKAAIASLTMTEE
                     EAQKHDEAWIAQYQEVVGRITQEYRNRIHLLDDSGVATSTEAQRDTPEMVHERRLRYL
                     REMELRLHCIHVERDTLYAERQAHRINDETLRAMVSELDMSEVALRKRLVVARRAAGL
                     PPLPHAGGAH"
     CDS             543324..544931
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004528747.1"
                     /locus_tag="CT3_04800"
                     /product="biotin-dependent carboxyl transferase"
                     /protein_id="BBL23025.1"
                     /transl_table=11
                     /translation="MNILGTQLNPRSADFLANAAAMQTVVDDLRARCEQVALGGGEAA
                     RAKHVARGKLLPRERVQRLLDPGTPFLELAPLAALNMYGNDAPGAGLIAGIGRVSGVD
                     CMVVCNDATVKGGTYYPITVKKHLRAQEIAAQNHLPCIYLVDSGGANLPNQDDVFPDR
                     EHFGRIFFNQANMSAQGISQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPL
                     VKAATGEVVSAEDLGGGDVHTRLSGVADHLAQNDMHALALARQAVANLNKNKAPAQGD
                     STPAAPLFDARELYGVIPVDTRKPFDVREIIARIVDGSQFDEFKARFGSTLVCGFARI
                     EGMQVGIIANNGILFSESAVKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIAR
                     HGAKLVTAVATAAVPKFTIIIGGSFGAGNYGMCGRAFSPRFLWMWPNARISVMGGEQA
                     ASVLATVKRDGIEAKGGSWSAQEEEAFKSPIRQQYEDQGHPYYATARLWDDGVIDPAD
                     TRRVLALGLSASRNAPIEDTQFGVFRM"
     CDS             544945..545730
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004201022.1"
                     /locus_tag="CT3_04810"
                     /product="enoyl-CoA hydratase"
                     /protein_id="BBL23026.1"
                     /transl_table=11
                     /translation="MTHRYLTLTVNAGVATVTLTQPEIRNAFSDEVILEITEAFRVAG
                     ERPDVRAIVLAAEGTAFCAGANLNWMRRMADYDRAENLQDAGALAEMLRTIYHCPKPT
                     IARVQGDVYAGGMGLVAACDMAVAAENAGFCLSEVKIGLVPGTIAPYVLRAMGARAGH
                     RYFLTGERFDAAEALRIGFVHQVVAAEQLDDAVDSLLKALLVAGPDAVRTCKKLVLDV
                     AEREINAQLIASTVEVIADIRASEEGKEGVQAFLSKRKPSWLS"
     CDS             545762..546535
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04820"
                     /product="hypothetical protein"
                     /protein_id="BBL23027.1"
                     /transl_table=11
                     /translation="MTEYWNAFLQWLHRVGLHPDREAVEQAARQAGDAMASAGGAVAD
                     TAGKALSGMDMASLLALAAALGWASGFRLYIVVFLVGLLGATGLVVLPGGLHVLEHPA
                     LLFASGSMLCVEFLADKIPGVDSLWDLLQSVLRVPAGAALAAGVFGADNATMATVAAL
                     MGGTLAATSQAAKTSTRALINTSPEPFSNVGASLVEDTTAVGAIWLALAHPLVFGVAL
                     VVVVIAMWVVTWMLWRFVRGAVRRLRGWFGAEADALPKT"
     CDS             546613..548655
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004555739.1"
                     /locus_tag="CT3_04830"
                     /product="biotin carboxylase"
                     /protein_id="BBL23028.1"
                     /transl_table=11
                     /translation="MFTKILIANRGEIACRVAATARRMGVRTVAVYSDADANAKHVAA
                     CDEAVHIGGSAPKDSYLRWERILEAARQTGAEAIHPGYGFLSENEDFANACAAAGLVF
                     IGPPASAIRAMGLKAESKQLMEKAQVPLVPGYHGAGQDPSMLHQEADRIGYPVLIKAS
                     AGGGGKGMRLVEKSQDFAAALESCKREAINSFGNDAVLIEKYVLRPRHIEIQVFGDTH
                     GNCVYLFERDCSVQRRHQKVLEEAPAPGMTEALRKKMGEAAVAAAKAVNYVGAGTVEF
                     IVEQPGGYDQPDAMQFYFMEMNTRLQVEHPVTEAITGEDLVAWQLLVAAGQPLPKPQS
                     ALKIIGHAIEARICAENPENNFLPATGSLNVYRKPDCTSFAIGDVRVDDGVREGDAIS
                     PFYDSMIAKLIVHGDDRAQALARLDAALQQTHIVGLATNVQFLRQVVKSKAFATAKLD
                     TALIERERAVLFGQDAVGRQLAIAAAVAATLEQEKTTQTADPFSQRDGWSMYGRSQRY
                     FQFAYQGVELAATLAYAQGGAPAQLSVTEVGAQAAGEAQTLQWRALGAGGLDLQLGAQ
                     RCSVQVYVQGEAVTVFTPAGSAQLTEVDLLAHAGDSGTEGGRLTAPMPGKVVSFAVQA
                     GDSVTKGQPLAVMEAMKMEHTIAAPADGVVQELLYAPGDQVAEGAELIRITSAVAA"
     CDS             548962..549828
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003813179.1"
                     /locus_tag="CT3_04840"
                     /product="glyoxylate/hydroxypyruvate reductase A"
                     /protein_id="BBL23029.1"
                     /transl_table=11
                     /translation="MRAALPDADISVWAPGAPQADYAVVWAPPQQFMDEQPGLKALFN
                     IGAGVDALMKLRLPANAQVVRLDDAGMSVQMAEYVTQAVIRHFRELDGYEADMRAGKW
                     AFRKPRTREDFTVGVMGLGVLGERVAKALTVFEFPVLGWSRSPKAVDGVRTLHGSDGF
                     TEFLSQTRVLINLLPLTPETENILNRENLGRLQAGAYVINVARGGHLVEDDLLALLAE
                     GQIAGATLDVFRQEPLPAGHPFWSEPRITMTPHTSARTLRDESIAQIVGKVVDLSQGK
                     PVKGMVDPQRGY"
     CDS             549921..551543
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011339030.1"
                     /locus_tag="CT3_04850"
                     /product="phosphatidylethanolamine--Kdo2-lipid A
                     phosphoethanolamine transferase"
                     /protein_id="BBL23030.1"
                     /transl_table=11
                     /translation="MNMRPHATLAPLNARHSASRGGGWVTALAWLWLFLPLVWMWPSS
                     RTLGDVALSALLWCGCLLWRPLTRVAAWVLVLVGACYLGYFYAVRSAPDEFFWYSVLG
                     ASTTEAWEYASSYRLQDLASLLCWLLPAVAAAVHLWRRAPLLTGRLLRGVGWASWLVW
                     GVLATTGVAKGYGLEGTLRRVDRVYPMTLGESYARYAHAAESIYRIPPMAPPAAAPMA
                     DVVVMVIGESASAQRWSLLGYQGNDTNAALRPWRDGLVTLPVTANGNNTGKTVPVLLT
                     GQRMAEMPESGVVTVLDQGRSAGFRVETLSNQSASGMSLSFAHAAFRQRSDRFVNLQD
                     GLQDGALTELLASSLQQQAAGQPALITLHMYGSHPRVNKRYPPEFAKWEDPYDNSIAY
                     SSSLLADWISRLDALPGVRAALVYVSDHGQNFPQCGGSYTHGSTRSAYEVPLLVWGNA
                     ALRQQQPQWWGQLQKVAAHAVAPDGSLRQTNLLYTGVVQDLLGYQVHAVDKGTASHVS
                     PAGDGPYPPTAAHNGCDDWFAQVAQQHPAATP"
     CDS             551626..552558
                     /codon_start=1
                     /gene="hmgcL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015038737.1"
                     /locus_tag="CT3_04860"
                     /product="hydroxymethylglutaryl-CoA lyase"
                     /protein_id="BBL23031.1"
                     /transl_table=11
                     /translation="MTSYPQRVKLVDVGPRDGLQNEKQPVPAAVKVELVHRLQNAGLT
                     EIEVTSFVSPKWVPQMADNAEVMAAIARKPGVRYSVLTPNLKGYEAAVLSRPDEIVVF
                     GAASEAFSQKNINCSIAESIERFAPVVEAARAAGIYVRGAMSCTVGCPYEGEVAPERV
                     AYLAGLMRGIGVQHIGVADTIGVGTPVKVRKAIEATLQHFDINDVSGHFHDTYGQALS
                     NTLAALAMGVWQYDTSVAGLGGCPYAKGATGNVATEDVVYMLHGMGIDTGIDLDQLID
                     AGAFISEHLGRPTQSRVAKAVLAKRASSAVCEAV"
     CDS             552558..553070
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004525946.1"
                     /locus_tag="CT3_04870"
                     /product="cys-tRNA(pro)/cys-tRNA(cys) deacylase"
                     /protein_id="BBL23032.1"
                     /transl_table=11
                     /translation="MCGSELHSLPEGVQRVARYLQQAGHAHGPQMLDGAARTSQEAAD
                     QLEIAVGQVAKSVVFKRKEDGVHVLVVAAGDRRVDEKKLAALVGKVGRADADYVKART
                     GFAIGGVSPVAHLQPPVTVIDASLARFEVLWAAAGHPHAVFPLDMVALQQLTGAPVVD
                     VVELPAGEGA"
     CDS             553067..553330
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04880"
                     /product="hypothetical protein"
                     /protein_id="BBL23033.1"
                     /transl_table=11
                     /translation="MSCPLPPDALLDKARTVLGQGLLDAHAVEAPPSPCISVCRMDDD
                     RSHCVGCLRTLDELRQWGKSDAATQRQIWGAVLQRCGMAQPTL"
     CDS             553366..554010
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004186002.1"
                     /locus_tag="CT3_04890"
                     /product="isomerase"
                     /protein_id="BBL23034.1"
                     /transl_table=11
                     /translation="MRDITFYLDFVSPYAWLAFAQLPAQLEGISCHVRYRPVLLGALL
                     KQHANPGPAGIPPKRAWTYRHAEWLGHAQGTTLQMPQRHPFNPLPLLRLALECSEDGC
                     INRFTADALFRHVWEGGGDALGAERIAALRERLAAQLRTDAQAAERAKGLLRTNTEEA
                     AAAGVFGVPTVSVDGHTFFGVDGLPMLRDYLQGGDWFTQGRWEAAASVEQGLQA"
     CDS             554022..555839
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011086890.1"
                     /locus_tag="CT3_04900"
                     /product="hypothetical protein"
                     /protein_id="BBL23035.1"
                     /transl_table=11
                     /translation="MPNAFNFAVSPFDCLTPDEQALVCSGVDIAYFPEGAVVLDRGMA
                     PTHLFVIIKGHVEQTEGEQLLASYGPEDCFDGRALVAGRASSRFVVVEELVAYQLAHE
                     TVNELIARNTAFGALLFADLGHKLGTLAQRADQHERQSLTLMRVEQAFVRPAHVVDAA
                     TDIVSVTRLFQEQRTTSVLVSGLPQGIGIFSNTTLQRAILDGRPLAQLAVGEFASSPV
                     ISVRASDQLGDAMALLLRARVHRLAVLDGDGQVCGMLEALDLFSFLANHSHLILVQIE
                     QAGDLQALEHPAAQITQLLSALHRGGTRIALMAQLVQQLNARLFERAWQMLAPADLVA
                     NSCLFVMGSEGRGEQLLKTDQDNGLLLRDGYTPPADLDAICHAFSAVLQRFGYPECPG
                     HIMLNNPEWRGSVSDFGQRAREWLLMPSADSLMRLAIFLDAHAVAGDAALLAGVRQQL
                     QSLATDNDALIARFASVIDSFGESGGWWNRLLGRSDAFSSVHLKKAGIFPLVHGVRSL
                     ALARHVDTTSTVDRIEALVADGTLDAPLGREMRESLHLLMGLRLQAGLSEIERHRPVT
                     GEVDPSTLSSLERDLLKDALAVVRRFRTLLQQRLRLDAL"
     CDS             555836..556504
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388391.1"
                     /locus_tag="CT3_04910"
                     /product="3'-5' exonuclease"
                     /protein_id="BBL23036.1"
                     /transl_table=11
                     /translation="MSTRPYPWHPLRHWLEGWRRQRLLRQLADPALAFVLDPAPPDEW
                     VSLDCETTGLDVRRDHIVSIGAVRIQGQRILTSQRLELLVRPPHGVSADSVRIHQLRE
                     RDLAQGLPVQDAVLQLLHFIGSRPLVGYYLEFDLAMINRVLRPLLGIALPQPRNEVSA
                     LYYDHKFRQLPPHRQQSPEIDLRFDTLMRDLGLPQSRAHDAVNDAVMAALAFIKLRQL
                     QGAR"
     CDS             complement(556637..558379)
                     /codon_start=1
                     /gene="actP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_639396.2"
                     /locus_tag="CT3_04920"
                     /product="acetate permease"
                     /protein_id="BBL23037.1"
                     /transl_table=11
                     /translation="MKSSLQRTLATTLATSLMLSATGSALAAGGDIGDTAKQATNWTA
                     IVLFVAFVAGTLWITKWAASKTRSAADFYTAGGGITGFQNGLAIAGDYMSAASFLGIS
                     AQVMISGYDGLIYSIGFLVGWPILTFLLAERLRNLGKFTFADVAGYRFAQGPFRMFAA
                     SGTLVVVAFYLIAQMVGAGQLIKLLFGLDYWIAVVLVGVLMMVYVLFGGMTATTWVQI
                     IKACMLLAGVTFMGFMIMSKYGFSFETLFAEGVKVKTAIAEAGGKEPDVAAKLGLSIM
                     GPGGFIKDPISAISFGMALMFGTLGLPHILMRFFTVPDAKEARKSVGWATVWIGYFYI
                     LIFIIGFGAITMVLTNPEMADTVKGVIKGGAGTANMAAVLVAKSVGGDVFYGFISAVA
                     FATILAVVAGLTLSGASAVSHDLYATVFKNGKADSASELRVSRLTTLTLGVIAVLLGI
                     VFEKQNVAFMVALAFAIAASANFPVLLLSVLWKGCTTKGAVIGGFLGLVSSVGLTIVS
                     PSVWEATFGNPPGSAWFPYTSPALFSMTIGFVGVWLFSVLDKSGQADKERAAFEAQQV
                     RSETGFGASGASGH"
     CDS             complement(558376..558690)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011039127.1"
                     /locus_tag="CT3_04930"
                     /product="membrane protein"
                     /protein_id="BBL23038.1"
                     /transl_table=11
                     /translation="MTDTVVTKIQRNPKYLELRSKRNRLGLVLTVLMLLVYYGYVALI
                     AFDKEFLAQPLSSSGVTTLGIPIALFVIVFTVAITLFYIRRANNEFDQLTQQILKDAQ
                     SK"
     CDS             559002..560690
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064062.1"
                     /locus_tag="CT3_04940"
                     /product="MFS transporter"
                     /protein_id="BBL23039.1"
                     /transl_table=11
                     /translation="MAINAAKGVGAQGAGTARPMTPEERKVIFASSLGTVFEWYDFYL
                     YGSLAAIIAKQFFSGLDAGSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLV
                     TILIMGVSTFIVGILPNYAAIGVAAPVILIVLRMLQGLALGGEYGGAATYVAEHAPHG
                     KRGAYTAWIQTTATIGLFLSLIVILGVRTTVGEEAFQDWGWRIPFLVSLVLLGISVWI
                     RMQLSESPAFQKMKAEGKVSKAPLSEAFGQWKNLKVVILALVGLTAGQAVVWYTGQFY
                     ALFFLTQQLKVDAVTANLMIAAALLLGTPFFVVFGTLSDKIGRKPIIMMGCVLAVVTY
                     FPAFKMLTEAANPALAAAQAANKVVIVADPAECSFQFNPTGTTKFTSSCDVAKQALSN
                     RSVSYESEVAPAGTPAVIKIGSHTIPSYSLKGLSPDELKAKGAEFNKAVSETLKNDGY
                     PEKADPAKMNKVMMIVILFYLVLLVTMVYGPIAAILVEMFPTRIRYTSMSLPYHIGNG
                     WFGGLLPTMSFAIVAQTGNMYNGLWYPIIIAGATAVIGTLFLRETKDVDIYAED"
     CDS             560956..561987
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004529519.1"
                     /locus_tag="CT3_04950"
                     /product="porin"
                     /protein_id="BBL23040.1"
                     /transl_table=11
                     /translation="MKIQRLMLAVLAVCGTSAALAQSSVSIYGRLNTSIERQKIGDQS
                     TTGMFNNASRIGFKGVEDLGGGLKAGFQLEAGFGSDDGSGPLNFKRQSELNLSGNFGM
                     LRLGRWTAESNYAVADYGVLDEPNHDTGFFSDQLYSYLMRDDNKIAYRTPVLGGFTLE
                     GAMSFHEKADGINATGPYANKNAYDVAANWESGPLALGAGYTKLGDAKQYGLRAHYTI
                     GDFQIGGYYQRSDNVGFDSGITGTGGFGALGDFGKRNLFRLTGGYTFGASQIAVGYGH
                     AGNIGGRDDTGASQFILGYNYNLSKRTKVYAAYTKINNKDNATYGGVGTAGAGKNASS
                     FGVGVRHNF"
     CDS             562153..562380
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_04960"
                     /product="hypothetical protein"
                     /protein_id="BBL23041.1"
                     /transl_table=11
                     /translation="MWKIVVGFVVFAAVSLFVIMKAGDKVDMSGEKHGADAVHVPEPA
                     PAAPAAPAAEAPAAAPAAEAPAAPAAPAEAK"
     CDS             562607..568546
                     /codon_start=1
                     /gene="uvrA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63P87"
                     /locus_tag="CT3_04970"
                     /product="UvrABC system protein A"
                     /protein_id="BBL23042.1"
                     /transl_table=11
                     /translation="MTQGQIRIRGARQHNLQNVDLDIRTGELTVVTGPSGSGKSSLVF
                     DTLFAEGQRRYVETFSAYARQFLDRMDKPAVDRVEGVPPAIAIDQTNPVRNSRSTVGT
                     MTELNDHLKLLFARAAHLFDRATGLPVQHDTAETIYAALQQRCEAAGDPRIALTFPVE
                     LPANTSAEEVEQWLSASGFTKVQAEREVERAHAAADVPAKGKKAKAVAPEKIKVLDVV
                     ADRFRTSRVERARAMEAIEVALKRGSGRLTVYVMPEEGEHYLWKFSEGLHCPESNLSY
                     TAPMPSLFSFNSAVGACDSCRGFGRVIGVDWGLVIPNDKLTLRTGAIKAIQTPAWKEI
                     QDDLMRHAEAEGIPRDIAWSKLTAEQKHWVIDGSPQWNGKWNQTWYGIRRFFEYLETK
                     AYKMHIRVLLSKYRSYTECPACQGARLKTESLLWRIGGKPQADAVLPAEQRFMPVGVD
                     WSPAQLQALPGLNLHDLMRLPITRLSQFFDSLKLTDQMGLAEGELQALKLLNEEIGTR
                     LRYLVDVGIGYLTLDRQSRTLSGGEVQRINLTTALGTSLVNTLFVLDEPSIGLHPRDM
                     ERITQAMHRLRDAGNTLVVVEHDPAVMFAADRVIDMGPGPGAKGGHIVFDGTPEELKR
                     ADTLTGAYLGGRKQVGFGIKRMVTESTPRLILEGAREHNLQNLNVDFPLQRLVTVTGV
                     SGSGKSTLIQDILAPALMRHFGKPTDSPGAHDRLLGADHLADVVFVDQSPIGKTARSN
                     PVSYVGAWDSIRELFALTPLSQQRSYNAAKFSFNSGDGRCPTCGGSGFEHVEMQFLSD
                     VYLRCPDCNGSRYRSEILEITLERGGRSLSVADVLELTVAEAALLFSQDADVIRALQP
                     IVDVGLEYVKLGQPVPTLSGGEAQRLKLAGFLAEAARTASKSKQKLARKGTLFLFDEP
                     TTGLHFEDIAKLMRALRKLLEAGNSLIVIEHNLDVIRASDWLIDLGPEGGDGGGQIVA
                     QGTPEEVRQVKTSHTAQALREYDQAMGVGGQRVEEVAPMLTKTERSKRAATASASVAK
                     NAIEIVNAKEHNLKNLSVDIPRGKFNVVTGVSGSGKSTLAFDILFNEGQRRYLESLNA
                     YARSIVQPAGRPEVDAVWGIPPTVAIEQRLSRGGRKSTVGTTTEVWHFLRLLYVKLGT
                     QHCVHDGAAVEPQTPERIAAQLLGHFKGQHIGLLAPLVIARKGVYTELADWARPKGYT
                     HLRVDGAFLPTTGFPRLDRFKEHTIELPVASVKVTAANEAALRTQLAKTLEIGKGVVH
                     VLSGIDNLETAIAAADQGKGVGTLQVFSTQRACPICATSYAELDPRLFSYNSKHGWCP
                     DCVGTGVKLTKEQRKVYDDSTLAEDNRGRELTFDGQEVEDLQETTCPTCKGTRLNPTA
                     RAVLFHGLSVTALGQMSVTSLREWFQALQPTGREADIARDLLPEILGRLEFLEEVGLG
                     YLTLDRGAPTLSGGEAQRIRLAAQLGSNLQGVCYVLDEPTIGLHARDNHILLNALHKL
                     GDKGNTLVVVEHDEDTIRRADHVIDIGPSAGKRGGELVAQGTPADIMAAANSQTGRYL
                     LHAMRHPCQARRPVLGMVDAATLYTGAAAAPADGAKPKKRTKKQIAADAAAALQAASA
                     EANAQLGQPVSTTGPLHWLTVAGAQLHNLQEVEASVPLKRLVAVTGVSGSGKSTLARD
                     VLLANVATLVAQNSTRAGREEMEAGKRIKLVGAKTVTGTEVIDRVLEVDQTPIGKTPR
                     SCPATYIGFWDTIRKLFADTLEAKARGYGAGRFSFNTGEGRCPACEGQGMRTIEMSFL
                     PDVKVPCETCHGARFNVETLAVTWRGKSIGDVLQMEVDEAVAFFASMPNIAHPLQLLK
                     DVGLGYLTLGQPSPTLSGGEAQRIKLVTELTKVRDDVTKRGNKAPHTLYVLDEPTVGL
                     HMADVDKLIRVLHRLVDAGHSVVVIEHDLDVIAEADWIIDLGPEGGTGGGQIVAAGTP
                     EDLVKAGTHTGKALAPVLART"
     CDS             complement(568751..569929)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011083083.1"
                     /locus_tag="CT3_04980"
                     /product="MFS transporter"
                     /protein_id="BBL23043.1"
                     /transl_table=11
                     /translation="MPLSLLALAAGAFGIGTTEFIIMGLLTQVSSDLGISIPRAGTLI
                     SGYAVGVAVGAPVLTLLTRHWPRKRLLLGLMLIFIAGNLAAVIAPNYLSLMAARVLTS
                     LTHGTFFGVGAVVATGLVPAEKKASAIALMFSGLTLATLLGVPAGAWIGQHFGWRMAF
                     AAVAAIGVVAFAILVAFVPRDQGRPVVPPLQQELAVLRNPQVWLGLGITVFGFAGVFA
                     LYTYIEPLLTQITHMDGSLVALTLLLFGAGLAAGNLLGGKLADRGVMRALVLSIATLA
                     VVLAAGRWAFGHSAVAMVYVVLLGTVAFATVAPMQMRVLQQAGAQGANLASSLNIAAF
                     NLGNALGAWVGGLVLSGIGLLSLGWSAAALTVVGLLLVGWSQRLPSTAGAMPVAVVGH
                     "
     CDS             570051..571031
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003115019.1"
                     /locus_tag="CT3_04990"
                     /product="transcriptional regulator"
                     /protein_id="BBL23044.1"
                     /transl_table=11
                     /translation="MPAMPDTARLSPLVAPGSEVNRSGELEVLVLVAEQGSLSAAARL
                     LGVSPSAVSKTMSRLEARLGVQLLQRSTRRVQLTAEGAQLVERGKRLLADLNELEAAV
                     AARSAPQGVVRISASSATGQRLLVPLVAPLLEAHPGIRLELLFTDQVVDLVEDSIDIA
                     IRWGQLPPSDMVARRLGATLQVIVGAPDYLARHGVPLHPDELSAHRRLGWTYQRAVPH
                     WPFLVDGRRVAVEIGDVLRVNDGDVLRSLAVQGAGLARLSLFHAWEDLQAGHLQVVLE
                     DFNTGDLEPIHAVYPGKPDRLPPRTRAVLDFLQARVELRHAAQLPPPWRA"
     CDS             571093..571452
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05000"
                     /product="hypothetical protein"
                     /protein_id="BBL23045.1"
                     /transl_table=11
                     /translation="MTAPEQRTIYLQPAAPPKPAMGAACNGCGLCCLAEPCPLGIWVS
                     RRRTGACKALQWDEAGQHYRCGMVSDPGAVLGWQQPWAVRLVARLAQRWIAAGAGCDA
                     DWEAQKAQETQEAPPRR"
     CDS             complement(571458..571895)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05010"
                     /product="hypothetical protein"
                     /protein_id="BBL23046.1"
                     /transl_table=11
                     /translation="MASASRRATVQAQQKVLDLGIAAPQVVAHRLARMALAGPVPSAR
                     DQKEFAGMVLEKQMAFAQSWWAAWNAMLQGPWSMAWSTWQTALSGGMLGGSPWAMWKL
                     TERSSAPVAKVVNAALTPIERKASSNARRLARTPLVGKPRKRS"
     CDS             572203..573180
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003810803.1"
                     /locus_tag="CT3_05020"
                     /product="exported protein"
                     /protein_id="BBL23047.1"
                     /transl_table=11
                     /translation="MAFTFRTLTLGAIAAAAACSTGLALAQDPAQWPTKPIKLTVPYT
                     PGGSTDIVSRTVFDAVSKKLGQPVIVENRPGANSTIGVTQLARAPADGYSFVSVLAAY
                     TVNMSLYKKLPYKPTDFVAVSHMADLPMFLFAANKLPVKSAKELAEYGKTHPLNYASS
                     GTGASAHMIGARFTQENGLNAQHVPYNGSAPILSDLISGQVDVLFDPALVPMPHAKSG
                     KIKVLAVASKQRWPGEPNVPTMEESGFPGFVMNSWVGLLAPKGTPQPIVDKLSRTIAD
                     AVQSPEVKNKLEQLGFGAVGSTPAQFQALIDKDTAMYKKVIETAKVSID"
     CDS             complement(573343..574137)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010931500.1"
                     /locus_tag="CT3_05030"
                     /product="haloacid dehalogenase"
                     /protein_id="BBL23048.1"
                     /transl_table=11
                     /translation="MSQEFLQPLSALPVPANVLGVLTDIDDTLTTEGVVPAHVVAAIA
                     RLKAAGLKVVPITGRPVGWSVPFASAWPVDAIVAENGAVALRRNGQGGLDKLYQQDED
                     SRAHNFARMQEVLSQIESTVPGASRATDSMGRECDIAVDHSEFTHMPQAQIDQCVQIM
                     KAAGMNATVSSIHINGWFGAHNKLEGARWIVRELFDIDLDATLGQWIYIGDSTNDQLM
                     FQNVPLSVGVANIARFVPQLHHLPRYVTAAERGDGFVQLADHILAA"
     CDS             complement(574208..576004)
                     /codon_start=1
                     /gene="prfC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P7B0"
                     /locus_tag="CT3_05040"
                     /product="peptide chain release factor 3"
                     /protein_id="BBL23049.1"
                     /transl_table=11
                     /translation="MPPRRIFSARQGLPPCLQRFAAKVKMAGFRPSAVLADQWPPFYP
                     GRPALPSRALNTVSYASETRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQIAGAVKGR
                     KASRHATSDWMEIEKQRGISVASSVMQMSYRDHVINLLDTPGHKDFSEDTYRVLTAVD
                     SALMVIDAANGVESQTRRLIEVCRQRHTPIITFVNKFDREVRDPLDIMDEVERELGMP
                     CCPITWPVGQGKSFGGIINLRTQSMTVFTPGSDRGPKDFEVIPLSDGDKLRARFGKAF
                     DDALESMELAVGASAEWDHEAFLAGKLTPVFFGSGVNNFGVMEVLDAVVDMSPPPGQR
                     IAFTELNRTREERVVKPEDSGFSGVVFKVQANMDSNHRDRIAFVRVASGKYTPGMKMK
                     VQRTGKELRPTSVVTFMSQRREAVDEAYAGDIIGFTIHGGVQLGDSITDGPSLQFTGL
                     PFFAPEMFMTVVLKNPLRTKQLQQGLMQLGEEGAIQVFKPDVGGNMLLGAVGQLQFEV
                     VQHRLKTEYDCDVRLEGCQYTGARWITADSPAELREFENAYPLRLAHDAADTLAYLCT
                     SPYDVRLAQERFPKIHFHPLREHAGLALGSAH"
     CDS             576050..576409
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05050"
                     /product="hypothetical protein"
                     /protein_id="BBL23050.1"
                     /transl_table=11
                     /translation="MALAATVVTALIALLHLYILVLEMFLWDKPVGRRAFGMSLEQAQ
                     ATKTLAANQGLYNGFLAAGLLWGLWWGGAEGLAVQRFFLGCVLVAGLYGAATANRKIL
                     WIQAVPAALALLLGGWR"
     CDS             576766..578472
                     /codon_start=1
                     /gene="kdpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9RZN7"
                     /locus_tag="CT3_05060"
                     /product="potassium-transporting ATPase potassium-binding
                     subunit"
                     /protein_id="BBL23051.1"
                     /transl_table=11
                     /translation="MWLPWMEFAAVLTVATLLTIPMGKWLARCFTSEHHGWLERLSYR
                     AMGVNPQERMGWQRYGAALVLSNAVMMLLGYLLLRLQAGLPLNPLAIAAQSPDLAFNT
                     AASFITNTNWQAYAGENSLSNATQMVVITFLMFAGATTGVAAGAGFVRGLARSSAQDI
                     GNFWVDFVRVFWRVLLPLSFLLALVYVWQGIPQTLHTEAVATTLEGARQQLLVGPVAS
                     LESIKHLGTNGGGFFSMNAAHPFENPTPLTNLLHILAMLLIPAGMTYAFGAMLLRRKQ
                     GWVLFAACMVMFIGFLSLVFVAEQQGSQLLARAGADQQWSPTQSGGNMEGKELRFGIA
                     DTALFVTVTTAATTGSVNAMHDSLTPLGSITPLAQMMLNCVFGGDGVGLINLIQYAIL
                     TVFLAGMMIGRTPEFLGKKIEVREIKLVMLAVLVPPACILGFTALAVLWPDAAASLNN
                     RGPHGFSEILYAYASGTANNGSAFAGLNANTPFFNTTIGLAMLAGRFLTLLPMLAVAG
                     SLAAKATVPAGPGTFPTATPLFMGLLVFVVLVVGGLTFLPALALGPVIEHLQMLVGHL
                     YA"
     CDS             578646..579242
                     /codon_start=1
                     /gene="kdpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9RZN6"
                     /locus_tag="CT3_05070"
                     /product="potassium-transporting ATPase KdpC subunit"
                     /protein_id="BBL23052.1"
                     /transl_table=11
                     /translation="MLVMVVSGIAYPLLTTGVAQALFPQAANGSLVERQGQIVGSALI
                     GQQFTGAQYFHGRPSVTMAPDPQQDGASIPAPYNAGLSGASNQGVTHQDLSAAVAQRV
                     AQYRADNGLAADAAVPVDAVTASASGLDPHISLANALLQLPRVAQARQLPPERVQVLM
                     EQATAPRSLGVLGEPRVHVLQLNLALDALQSSHQPGKE"
     CDS             579246..581336
                     /codon_start=1
                     /gene="kdpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZD97"
                     /locus_tag="CT3_05080"
                     /product="potassium-transporting ATPase ATP-binding
                     subunit"
                     /protein_id="BBL23053.1"
                     /transl_table=11
                     /translation="MRAQKMGAGHSLLDAQLVKLALWDAVRKLSPRTQWANPVMFVVY
                     LGAVLTSLLWGQSLLAPDGQSDGFVLAIALWLWFTVLFANFAEALAEGRSRAQAASLR
                     GMKRDTVAKVLQQPQVGSAWIPIRASELRKGVVIYVEAGDTIALDGTVIDGVASVDES
                     AITGESAPVIREAGGDFSSVTGGTRVLSDWLVVEVTVNPGESFLDRMISMVESAKRQK
                     TPNEMALTILLVGLTLVFLLVIVTLWPFSAFAVAQAGTGSVVGMAVLIALLVCLIPTT
                     IGGLLSAIGVAGMSRMMQANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLP
                     APGVSAAQLAEAAQLASLADETPEGRSVVALARERHALPERRSADFPGVFVPFTAQTL
                     MSGVDLQGPQGERSLRKGAADAVRRHVEALGGSFPAPVQLSVDNVSRKGSTPLVVADG
                     ARVLGVIELKDVVKPGMRERFAELRRMGIQTVMVTGDNPLTAAAIAAEAGVDDYLAEA
                     RPEDKLQLIRSHQAAGRLVAMTGDGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLD
                     SNPTKLIEVVETGKQMLMTRGALTTFSIANDVAKYFAIIPAAFVGTYPQLASLNVMQL
                     HSADSAILSAVIFNALIIIALVPLALRGVQYRAVGAAILLRRNLLIYGLGGLVVPFVG
                     IKLIDLLLTALGLV"
     CDS             581365..584061
                     /codon_start=1
                     /gene="kdpD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004526440.1"
                     /locus_tag="CT3_05090"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBL23054.1"
                     /transl_table=11
                     /translation="MPLTPSTSSAPARPDPDVLVAQLQAQQAQAGRGKLRIYFGSNAG
                     VGKTYAMLAAAQRERLAGRRVLVGLVETHGRAETEQQLHDLELLPRRPLNYLGKQLAE
                     FDLDAALARHPDVLLLDELAHSNVAGSRHPKRWQDVQELLEAGVEVWTTLNVQHLESL
                     NDVVSGIVGIKVHETVPDHLFDDADEVIVVDIPPEELLKRLKAGKVYPLEQAERASRN
                     FFRQGNLLALRELALRRTADRVDEDMRDYRRERAIGDVWPTRERLLVGVGGRAGDDAL
                     VRQVARLARRLEADWVVVYVDAPQRQHRPRAAQEAVLKTLALAARLGAETATIPGAQV
                     AQALVDFARERNASHLVLARVDQPWNRWLPWRPASLSEQIALLDPGLDVLLLSVKKVK
                     PDSSVRFPVVREQAIPWKGYGGVTLACLAATALAELLLQVFDPANVVMLFLLVVVLSA
                     VRWGRGPGAWAALLSVLLFDFYFVPPRNSFSVNDTQYLFTFCLMLGVALVCGQLTARL
                     RHEARVAAERERRAGALARLARDLSGALTQQQVTQIALTTISGVFGAQTGLLLPDADE
                     QLQLAQGSAGAIDASVGRWSMEHGQMAGQGTDTLAAAPALYVPLMAPVRSRGVLVLQL
                     SAPQKLRVPEERRLLDACASQIALALERVHFVDVAQQTQIAMEGERMRNTLLSAVSHD
                     LRTPLTGILGAAQAALPHAPQGPVHSMLVQIRNQAQALQQLVDNLLAMARLQQGGVHL
                     KREWLPVDELVGSALAQMRERLAGHVLHTALPTGLPLLELDAVLMERVLVNLLDNAIK
                     YTPAGTAITVAAGVEGGDCVLSVQDAGPGLPAHLSAQQLFEPFTRGQSESAVFGMGLG
                     LALALRIVQAHGGRLEVEAAEPGPGAVFRVRLPVPEQPSMDD"
     CDS             584097..584804
                     /codon_start=1
                     /gene="kdpE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004185947.1"
                     /locus_tag="CT3_05100"
                     /product="DNA-binding response regulator"
                     /protein_id="BBL23055.1"
                     /transl_table=11
                     /translation="MTTVAPRILLIEDDASIRRFVRLALEDEGWQVFEAETAKRGLIE
                     AASRQPDAVVLDLGLPDADGKTVIAELRGWSLLPILVLSAREREEEKVAALDAGADDY
                     LTKPFGVPELLARLRAMLRRRQQASATDKPGTSARFGSVTVDLAAHDVVRDGVPVHLT
                     PIEFRLLAALVAGHGKVLTHRQLLLQVWGAEYLDRPHYLRVHMANLRQKLEQDPAQPA
                     HLVTELQVGYRLVGLAA"
     CDS             585004..586434
                     /codon_start=1
                     /gene="acyH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K0M7Y2"
                     /locus_tag="CT3_05110"
                     /product="adenosylhomocysteinase"
                     /protein_id="BBL23056.1"
                     /transl_table=11
                     /translation="MNAAVRFNPADSAITDISLAAWGRKEIKIAETEMPGLMAVREEF
                     AAAQPLKGARITGSLHMTIQTAVLIETLTALGAQVRWASCNIFSTQDHAAAAIAETGV
                     PVFAIKGESLKDYWDYTHSIFEFGAAGTDNEGPNMILDDGGDATMLMHLGKKAEKDLS
                     VLANPGSEEEKIVFAAIKAKLAVDPTWYSRKSAQILGVTEETTTGVHRLNEMSANGSL
                     LFRAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGDVGKGCAQA
                     LSALRAQVWVTEIDPINALQASMEGYKVVTMEYAADKCDIFVTTTGNKDIIRHEHMLA
                     MKDEAIVCNIGHFDNEIDVASIEKYEWEEIKPQVDHITFPDGKKIILLAKGRLVNLGC
                     ATGHPSFVMSNSFANQTLAQIELFTRPDAYEVGKVYVLPKVLDEKVARLHLKKVGAQL
                     TELTEAQAAYIGVKKEGPYKPETYRY"
     CDS             586590..588572
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05120"
                     /product="hypothetical protein"
                     /protein_id="BBL23057.1"
                     /transl_table=11
                     /translation="MRGLFQPAVALMSRLRLGPKFLLAGIPLLLMLGLVGAMAVQRYQ
                     ARVQALEAKRAAVALMADLVEWNQVLIESRRVAITGQAGDAALMQSFQRQAAVVDKTL
                     AKIEARVAAQQRYYDMRKETEGLQQGWKELQGKIAALPADADFAQKAFAAHAPEYARL
                     YAFMRDLGNRSGLAQDPDADIFYLGYPLANHTPSTAGIAVRIAAYALLNVSRGVVDTK
                     DKVFYEVTEARLNDTFSGVETQLSQSMQANAAVQQALGARFDALKATSKELLGYVRKH
                     FTLVDQVAVSQQEVQTAAQPTIDAAWALVSQNGAVLDQLLAERGAEAATQRNLLVLLL
                     ALGIGASVYLYVGVYLSMAASLAQASQAAKAIAAGDLGTVQAPVSKDEFARLLEDLRS
                     ADRALAQVIAGVKESSESIATATSEIASGTQSLSSRTELTASSLQQTAGSMAQLTDAL
                     SHSRGSADSARQLSVSAGDVARRGGTVVQQVVQTMDAINQSSRKIADIIGVIDGIAFQ
                     TNILALNAAVEAARAGEQGRGFAVVASEVRALAGRSAEAAKQIKDLIGSSVGKVDEGA
                     RLVSEAGATMHEIVDSVVRVDAVIGEISVAAGEQSQGIAEINTAVGQLDDMTQQNAAL
                     VEQSAAAAESLREQARLLAEVVGNFRIHGGGERRLT"
     CDS             588752..589747
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05130"
                     /product="hypothetical protein"
                     /protein_id="BBL23058.1"
                     /transl_table=11
                     /translation="MRADVFLVEAGHAATRSQAQRLIAAGVQWRTMPLAPWTQVAKNG
                     DDIPAGAQVQLLDASEAKYISRGGLKLEGALAAAGLQVSGLRCLDVGQSTGGFTDCLL
                     QAGAAQVIGVDVGHDQLHERLKSDPRVVGVEGLNARAMTAESLVQGCEDALSEVIEEQ
                     EDNDTQPQAPYAWMRNGGMVDEDYDDSEDAKEQDIESFKAERAAKDKARADGTAPVER
                     RRKPGTEDIDITPVFDFVTGDVSFISLTLILPQLVPLMGPGAPLLMLVKPQFELQPGQ
                     IGKGGIVRDPALYAEVEQRIRACCKEVGLKVVGWYDSAIEGGDGNREFFVHATKA"
     CDS             589759..590598
                     /codon_start=1
                     /gene="metF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WGJ7"
                     /locus_tag="CT3_05140"
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="BBL23059.1"
                     /transl_table=11
                     /translation="MAQNDSTAFPVSFEFFPTKTAEGAAKHVNVRQELYARKPEFCSV
                     TYGAGGSTQEGTFRMVQAIQDEGVAAASHFSCVGATHAKVREELAQLQTMGVKRIVAL
                     RGDLPSGYGLGGEFQYASDLVAFIRKEFGDWFHIEVAAYPETHPQAKSPDADLQAFAT
                     KVKAGADSAITQYFFNAYYRFVEGIQALGIQIPVVPGIMPITNSSQLMRFSDATGAEI
                     PRWIRLRLQAFGDDVASIRAFGLDVVTHLCEQLRSQGAPGLHFYTMNQSTATLELCRR
                     LGL"
     CDS             complement(590595..590831)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05150"
                     /product="hypothetical protein"
                     /protein_id="BBL23060.1"
                     /transl_table=11
                     /translation="MGAPAWVGVAVAVPSGVVGSGAQPLMNNVTVQAAAQRWRAARET
                     IPAVWQMDGMQCPLSRTDGGATTAGGISGTNRSP"
     CDS             590743..591438
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05160"
                     /product="hypothetical protein"
                     /protein_id="BBL23061.1"
                     /transl_table=11
                     /translation="MTLFISGCAPLPTTPEGTATATPTQAGAPIPEGTNARPSRWGWW
                     SHDRKGAEALAKAAPKPPKLSDKLDPAAQTAPDARDSDQKGLASWYGPGFHGKLTANG
                     ERFNSGELTAAHRSLAFGTRVCVRSSVTGKTVVVRINDRGPFAKNRVIDLSQGAAEQL
                     GMVGLGIKPVELWALADDESQCPGEDDDLDGQLEARLSDLSPDARRAVEAHRQAHGES
                     TSTVAKQVSKKKK"
     CDS             complement(591558..592460)
                     /codon_start=1
                     /gene="rlmJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P3L3"
                     /locus_tag="CT3_05170"
                     /product="ribosomal RNA large subunit methyltransferase J"
                     /protein_id="BBL23062.1"
                     /transl_table=11
                     /translation="MFSYRHAFHAGNHADVLKHTVLIATLQHLTQKDTALSVIDTHAG
                     AGLYRLDGDYANTSGEATEGVQRLLDTPFDQLAPALQDYLQVLASFNQGNKLRVYPGS
                     PFISHSLLRPQDKMHLFELHPTDSRTLAGNIAQLDPGKRILIAQEDGFTGVKKLLPPP
                     SRRGLVLCDPSYEIKTDYLRVADMVQDALARFATGTYAVWYPIIARQDAHDLPRRLKT
                     LATKAGKGWLHATLTVKSSKMQSAALSATEDEPSKRPGLPASGMFLINPPYTVKDKLK
                     TALPQMVKLLGQDKHAAFTLESGQ"
     CDS             592768..593196
                     /codon_start=1
                     /gene="rplM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q63QW3"
                     /locus_tag="CT3_05180"
                     /product="50S ribosomal protein L13"
                     /protein_id="BBL23063.1"
                     /transl_table=11
                     /translation="MSTFSAKPAEVQHEWFVIDATDKVLGRVASEVALRLRGKHKAIY
                     TPHVDTGDFIVIINASKLKVTGTKNLDKVYYRHSGFPGGITATNFRDLQAKFPGRALE
                     KAVKGMLPKGPLGYAMIKKLKVYGGAEHPHTAQQPKALEI"
     CDS             593207..593599
                     /codon_start=1
                     /gene="rpsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6PCU2"
                     /locus_tag="CT3_05190"
                     /product="30S ribosomal protein S9"
                     /protein_id="BBL23064.1"
                     /transl_table=11
                     /translation="MIGDWNNGTGRRKSSVARVFLKKGSGKITVNGKDIQQYFGRETS
                     IMIAKQPLVLTGNVEAFDIQINVHGGGESGQAGAARHGITRALIDYDASLKSALSQAG
                     YVTRDAREVERKKVGLRSARRAKQFSKR"
     CDS             593865..594230
                     /codon_start=1
                     /gene="erpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HB8"
                     /locus_tag="CT3_05200"
                     /product="putative iron-sulfur cluster insertion protein
                     ErpA"
                     /protein_id="BBL23065.1"
                     /transl_table=11
                     /translation="MSAVAENTITEMPAPILFTDSAAAKVADLIAEEGNPDLKLRVFV
                     QGGGCSGFQYGFTFDEITNDDDTTMTKNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQF
                     VIKNPNASTTCGCGSSFSV"
     CDS             594360..595766
                     /codon_start=1
                     /gene="emrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037970.1"
                     /locus_tag="CT3_05210"
                     /product="MFS transporter"
                     /protein_id="BBL23066.1"
                     /transl_table=11
                     /translation="MSESLAPHRERLLWLVAIAFFLQSLDATILNTALPAMAQSLGQS
                     PLKMQSVIVAYSLTTAMLIPASGWVADRFGTQRVYATAIALFVLGSVLCALSPNLGFL
                     VAARVVQGVGGALMMPVGRLAVLRSHPKGEFIRAMSFIAIPGQVGALLGPTLGGALVE
                     VASWHWIFWINVPVGLFGMWATRRWMPVGAEQPRRSFDGWGYALLSFGMVAVSVALDG
                     LSGMGLGTALVAVLMVFGLASLAAYWMHALRVPEPLFPPALFSVRSLRVGLLGNLFAR
                     FGSGAAPFLIPLLLQVGLGMSPFHAGLMMLATVVGSMLVKRIAVRTVQRYGYRRVLQV
                     NSVLLGLVLASFGLVSPQQPLGLLLAQLFVFGGINSMQFSAMNSVTLKDVEGEFASSG
                     NSLLSMVQMLSMGMGVALAGALLGGFSDVWSALGDQSLRAIHATFATVGLMTLASTLV
                     FSQLDGDERVRPAPDSGD"
     CDS             complement(595872..597008)
                     /codon_start=1
                     /gene="anmK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HB5"
                     /locus_tag="CT3_05220"
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="BBL23067.1"
                     /transl_table=11
                     /translation="MTVATPASDLFIGLMSGTSLDGVDGVLVDFRHGTRVLQHASCGF
                     TPGLRAELLALNTPGGQDELHRAALAANALVAHYAQVVQQLLQRSGVATDQVAAIGAH
                     GQTVRHRPQLFDGTGYTLQLNAPALLAERSGITVVADLRSRDVAAGGQGAPLVPAFHQ
                     GVFGQAGRTTLVLNIGGIANLSVLGADGAVQGFDCGPGNALMDGWCLHHTGQPYDDGG
                     RWAASGRVLQPLLQRLLAEPFFAQQPPKSTGRDLFHTDWLTAHLAAIPEAAAAAAADV
                     QATLTELTAASCADAVRRWGRGGSALLVCGGGALNAHLMQRIASLLPGVQVGSTAARG
                     LPPLEVEAAAFAWLARQCLRGLPGNLPAVTGARGPRVLGAIYPA"
     CDS             complement(597105..598463)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010931221.1"
                     /locus_tag="CT3_05230"
                     /product="hypothetical protein"
                     /protein_id="BBL23068.1"
                     /transl_table=11
                     /translation="MISAGSALLARLALLVQKHPKRVTSGVAALLLSGGGAAFAVASL
                     GPDVADMPVRTITQTVPSLVEDTSLADLADLNSFTLYRSDYTRGTDTAEALLQRLGIA
                     DPSASAFLRADSNVRQNLLGRAGRLVSAEATNDHQLQKLTARWTTSDDSDEFQRLVVE
                     RDANGKFTASIETAELTVGSRLAGGTIRSSLFAATDAAFIPDSVAVQMADVLSGSIDF
                     RRSLRKGDRFSVVYESLEADGEPLRAGRLLSVEFHNNGKTHQAMWYQPEGASRGSYYD
                     LDGRSLRQAYLTSPVEFSRVSSGFAMRLHPIQKTWKAHLGTDFAAPTGTKVRTIGDGV
                     VEFAGVQNGFGNVVFVKHANADHVTVYAHLSRIDVRKGQSVEQGQTIGAVGSTGWATG
                     PHLHFEFRVNGKHEDPLVVMAKNAADAPIDRRNEAAFKQYSAQMRMQLDSAQTVQQAS
                     AQ"
     CDS             598661..599893
                     /codon_start=1
                     /gene="tyrS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q62HB4"
                     /locus_tag="CT3_05240"
                     /product="tyrosine--tRNA ligase"
                     /protein_id="BBL23069.1"
                     /transl_table=11
                     /translation="MNQDSVKTFPLTEGVGQALEVTLRGVDELLPKDEWIQKLAKSEA
                     TGVPLRIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHQVIFLIGDFTTLIGDPSGRNS
                     TRPPLTAEQIKANAETYYTQAAKVLDPAKTEVRYNSEWCDQLGARGMIQLSAKYTVAR
                     MMERNDFHTRFTEGSSISLHEFLYPLLQGYDSVALKADLELGGTDQKFNLMMGRHLQA
                     EYGQEQQCVLTMPLLVGLDGVHKMSKSKNNYIGITEDANTMFAKVLSISDDLMWDWYT
                     LLSFQSLEHIAQLKADIAAGGNPKHAKVALAKEITTRFHSAAAADAAEQDFTNRSKGG
                     IPDDIPEVSLSGAPLGIGALLKQANLAPSTSEANRLIDGGGVRIDGTVISDRGLKLDA
                     GSFVLQVGKRKFARVTLA"
     CDS             complement(600085..601152)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007243946.1"
                     /locus_tag="CT3_05250"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BBL23070.1"
                     /transl_table=11
                     /translation="MSTTAQPLHESYRLLIRFCAVVVCLVHLAFIPIFAGTGVHALAA
                     GNVLSVLAYGYAYWQSRPQGNVRLAADVIALEIGLHAVAATLAIGWSSGFHYLMIPMV
                     PVCMLSATRPRAARMGIVLCISLAYIGLRFWSSRHPPFYRLSDGLLQALEYGCLVTLF
                     LAFITIALRYHDIIVEAHEMLRHEAFTDPLTGALNRRRLAQVATLPPAADTHSALLLC
                     DLDHFKLVNDQYGHSVGDQVLQAFYRQLLECTRGGDHVCRWGGEEFLVLLPQTDMAVA
                     RMVAYRLRASVERTSVRLLSGELLFITVTVGLTHLGPGEPLQAAVHRADEALYRGKAA
                     GRNQVQDSTVERPVPVAELQV"
     CDS             complement(601264..602250)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064889.1"
                     /locus_tag="CT3_05260"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBL23071.1"
                     /transl_table=11
                     /translation="MSTASSSSASGLTLRTRPIAIGHVRAFLAVARHLNFRAAAEELA
                     LTQSAVSRQIQGLEDEVGLPLFLRHTRAVELTSAGAQLLRAWTPAVERIDTAVRSVRQ
                     SAGRKSVSITTWASFAAMWLIPRLEDFQRQHPDIDIRIDTTDSLVDLETTDVDLAIRY
                     SRPTAALRGVTELFGEQLAVVASPWLLQSATAPRRPQDLVGWSLIEATDADQHPHLQW
                     LSWHRWLRDQDCADLQPRRWVYLRYAHQIVQAALAGQGLALTRLPLVAEALADGRLVE
                     VFPRQRLDSPLAYWLLTGPRSGQRPEVQAFAQWLQQQAHDTRQAMAPVDDPA"
     CDS             602521..603924
                     /codon_start=1
                     /gene="glmU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6PAY5"
                     /locus_tag="CT3_05270"
                     /product="bifunctional protein GlmU"
                     /protein_id="BBL23072.1"
                     /transl_table=11
                     /translation="MAAGKGTRMKSRHPKVLQKLAGRALLQHVLHTAGQLQARSAVVV
                     TGHGAADVEAALASGPGADAGFELKFVRQEPQLGTGHAVQQAVPALAGDGMAIVLSGD
                     VPLTQADTLQGLLDAAGGDKMALLTVAMPDPTGYGRIVRNSAGTVQRIVEQKDASEVE
                     RAITEIYSGIMAVPVRHLTQWLAKLNNNNAQGEYYLTDIVAMAVADGVPVVGHRISDV
                     LQVAGVNSPLQLAELERAHQLRAAKALMEQGVRLADPGRFDLRDDARGTLAQLQCGQD
                     VDIDVGCIFTGQVRIGDGAQIGAYCHISNATIAAGAVIHPFTHIDGEKAGASVGEGAL
                     IGPFARLRPGAQLGREVHIGNFVEVKNSTLADGAKANHLAYLGDATVGERVNYGAGSI
                     TANYDGANKHRTVIEADVHIGSNCVLVAPVTIGAGGTVGGGSTITKSTEPGALSVARG
                     KQISKANWARPVKPPKA"
     CDS             603928..604722
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05280"
                     /product="hypothetical protein"
                     /protein_id="BBL23073.1"
                     /transl_table=11
                     /translation="MERDCLPDGAAVPSPQETVRAELAACQQQLAQLQDAHEGLLRAV
                     SHDLRAPLRHLTSFAPLLRESVEQLAAAAPGEAADEAQEFLGTMEQSAHKMGRMLDAL
                     MQLSRAVRQPLDPQPVDVCGVLQSCAARSLPQGDTVAWELPAQPALLQADPTALHTVL
                     GELLGNAAKFTARQMLPQVQVSLSMPVPRLWRIAIRDQGVGFESSRMAVSWPPFQRMH
                     RENDFAGMGCGLALVHALAQRHGASLQLHSRPGEGCTAVLEWPAAG"
     CDS             complement(604823..605359)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004521850.1"
                     /locus_tag="CT3_05290"
                     /product="AsnC family transcriptional regulator"
                     /protein_id="BBL23074.1"
                     /transl_table=11
                     /translation="MKENKENETLDYTDLQLLDTLQRDASLSNQTLAERLGLSAPTCL
                     RRVRRLHALGLIERSVTVLQPERAASLLGHGLQALVEITLDRQSAEALDAFEALAVAE
                     DAVQQCWRVSPGPDFMLVLHCWDMPAYLALSQRLFAQHANVRNVKAFFATKRAKFSPH
                     LPLLAAEPDRGDQHTLPR"
     CDS             605497..607395
                     /codon_start=1
                     /gene="glmS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0C6P7J4"
                     /locus_tag="CT3_05300"
                     /product="glutamine--fructose-6-phosphate
                     aminotransferase [isomerizing]"
                     /protein_id="BBL23075.1"
                     /transl_table=11
                     /translation="MCGIVGAVSTRNIVPLLVQGLQRLEYRGYDSCGVAVHRLVQGSP
                     ISQGLQRARSTSRVAELLEQVRTEDLQGLTGIAHTRWATHGAPAVHNAHPHFSYGPGL
                     TAESGKPARVALVHNGIIENYEQLRAKLQDKGYIFASQTDTEVIAHLLDSHYNGDLFD
                     ALKATRAELHGAYALAVMHKDEPHRVVGARAGSPLILGVGVDNSEFFLASDAMALAGV
                     TDQIVYLEEGDLVDLQPGRYWIAAKDGHVVLPEQRPVKTVHAHSGAAELGPYRHYMQK
                     EIFEQPRAIGDTLEGIVNIAPELFDGADGTAAWRVFKEIDQVLILACGTSYYSGCTAK
                     YWLEAIAGIPCAVEVASEYRYRTSVPNPRTLVVTITQSGETADTLAALRHAQSLGMTH
                     TLTICNVGSSAMVRECKLAYITRAGVEIGVASTKAFTTQLAGLFLLTLALAQSKGRLS
                     EEKEQQYLTAMRHLPVALQAVLALEPQVISWAEDFAKMQNALFLGRGAHYPIALEGAL
                     KLKEISYIHAEAYPAGELKHGPLALVDSAMPVVTVAPNDELLEKLKSNMQEVRARGGV
                     LYVLADAKTNIESEEGMHVIRMPENYGALSPILHVVPLQLLAYHTAVARGTDVDKPRN
                     LAKSVTVE"
     CDS             607769..607939
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05310"
                     /product="hypothetical protein"
                     /protein_id="BBL23076.1"
                     /transl_table=11
                     /translation="MLEPFYRLEHSRNADSGGMGLGLSIAQTVAHAQGGQLLLRNEPE
                     GGLEVTLKLPQR"
     CDS             complement(608135..609079)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P39879"
                     /locus_tag="CT3_05320"
                     /product="hypothetical protein"
                     /protein_id="BBL23077.1"
                     /transl_table=11
                     /translation="MLILLAMLVLASVLPVRGVYADYASTVTNMAIALLFFLHGAKLS
                     LNAIVKGMGHWRLHSLVFACTFLLFPLLTLALKPVLLPLLGQDLFRGMLYLSALPSTV
                     QSSIAFTSIARGNIPAAICSAATSSLMGIFITPLLVLLMLGQSAHSLPFGDAVLKIML
                     QLLLPFVLGQLARRWIGAWVDRRKAVLKHVDQTSIYLVVYTAFSSAVVEGLWSQLPLQ
                     QILVLALACCVLLALVLGTTWWLGHRLGFDLPDRITILFCGSKKSLATGVPMAQVLFI
                     GGSMGTLLLPLMLFHQIQLFVCAVLSKRLADRTDEVQA"
     CDS             609225..610034
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003083886.1"
                     /locus_tag="CT3_05330"
                     /product="transcriptional regulator"
                     /protein_id="BBL23078.1"
                     /transl_table=11
                     /translation="MNIAETTKRRDLASRPVPVLARLPRTVYARAEQMQRKAATVAHA
                     HDWVQFSYASQGVLQVQTHQGLFIAPPQWAILIPQQLVHSVVNAPRTEIRSLYIATPA
                     LQDLGGACRVLEVSPLLREMIRHFATLPVEYAEEGADGRLVQVLLDQIHAAPQAALRL
                     PWPEDERLRAWCRHLLDVPDAPLQLAQWSQELGVSERTLGRWFQRQTQMSFRQWRQRA
                     RLLAALPQLQDLQSVTEVALVCGYDSTSAFIAAFRQLFGRTPGQLLRAAAA"
     CDS             610318..611316
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015040733.1"
                     /locus_tag="CT3_05340"
                     /product="hypothetical protein"
                     /protein_id="BBL23079.1"
                     /transl_table=11
                     /translation="MVKSWNQAGWMAWTVAVAAGWSAGAMAAETFPSKPIRIVVGNAV
                     GGVDDIWARRYAQQMSERLQQTVVVDNRPGASGTLAAMEVLKAPKDGYTLLYGGMASL
                     IQFPSAGGTVRYKPKEDFEPVAMATLGYPVLTAGSNSWAKSIQDLVHKAKAAPANADA
                     YSCGTSGQAATSHFACMMVAKAVGAEFKPVPYKGGSLAATDAASGHVDFAVGFYGEIS
                     PLTLGKRLTPLVVFSPKRFPLYPDTPTVKEVGLEGLEMVSFSAFFAPKGTPAEVVQRL
                     NTTVIQSFHTPQMERWLSDAGAFYQDMSPAELKAFYFKEIDLWKQRSVEHGIRVEQ"
     CDS             complement(611535..613163)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011389764.1"
                     /locus_tag="CT3_05350"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBL23080.1"
                     /transl_table=11
                     /translation="MSALLSIQNLTIDLPAGGDRPHALQQVSLDLHPGEIVCVVGESG
                     SGKSLTTSAVLGLLPEGVQVRSGQILWRGQDLLQLGAEGLRKLRGSEIGMIFQEPMTA
                     LNPLRTIGDQIGEVFRTHTRLPRKTIRARTLGLLESVKIPDPDKALKAYPHELSGGQR
                     QRAMIAMALALEPAMLIADEPTTALDVTTQAEILHLIHDLQRRKGMAVLFITHDFGVV
                     AEIADRVAVMQHGVLVESGKAQDVLGRPQHAYTRALIAAVPPLQAPVRGVASQTPTAL
                     SVARLSKTYHQRNWLGRTSRTTHAVKDISFSLPAGTTLGVVGESGSGKSTLARNLIGL
                     LVPDEGEFRVGNDTVQLRNIAERRLHATRVQMVFQDPYSSLNPRQRVGDIVTQGPIAH
                     GESRAQALAHARELFALTGLSPDALDRYPHEFSGGQRQRIGIARALAMRPQILIADEP
                     VSALDVSVQAQVLDLLTRLREQMGLSMVFITHDLRVAAQICDQLIVMKSGEIVESGHT
                     ARVFSQPQHPYTRALLEAIPGRHWIPDACAQKAA"
     CDS             complement(613222..613986)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003811645.1"
                     /locus_tag="CT3_05360"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBL23081.1"
                     /transl_table=11
                     /translation="MSGFDLSGKTALVTGASRGIGRSIALALAQQGAQVFIHYHQAAD
                     AARSLEAEIAQIGGQASVLAADLSLPQGADQLADALTGQLQAAGLGGLDILVNNAGVG
                     LKARIADVQPADFDHVLQVNLKTPFFLIQRLLPVLRDGGRIINISSMGTRAAYPEMSV
                     YAPAKAGLEALTLLLASELGVRGITVNAVLPGATATDLNTRARDPAQAAVIAQSVALG
                     RVGQPDDIAGIVAFLASDAARWVTAQRIDASGGQRI"
     CDS             complement(613983..615521)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064659.1"
                     /locus_tag="CT3_05370"
                     /product="acetyl-CoA synthetase"
                     /protein_id="BBL23082.1"
                     /transl_table=11
                     /translation="MTSHRYNLGDLNDPALSLESTAIIDLREPALPRHYSHAEVRALA
                     GGVARWLTEQVFPPGSRVAIASLNRAEYLITYFGIMRAGHVAVPINIKQSPEILEYVL
                     QDADVVLAFTDGARRAALASHVPVIDFDDAGPDGFTARMVPADLDSVRPAHDDVAQML
                     YTSGSTGKPKGVPLTHAGQLWALQATTEVPGPVQARYLLAQPLFHMNGLFMSKRAFAV
                     HGLLVIQPGFDVDAYIDALERYRITVLTAVPTMFARIIKDPLKLQGRDFSALKRVMLG
                     SAPMTLDLLQRIQHAFPDARVTHGYGTTEAGPAVFGPHPAGIPTPGLALGHPIDPAQV
                     RLVDGPSDDEGVLLMRNPALLSGYHNLPEKSAQVLQNGWYYSGDVMRRDVDGFYYFIG
                     RADDMFVCAGENIYPVEVEKLLEKHPDVAQCSVVPLPDEERAQVPVAFVVRREGTSVD
                     AETLKQHALAHGPAYQHPRRVCFVQDLPWAGTNKVDRHALVQLARDLEKRQAWHQHGT
                     EVLA"
     CDS             complement(615551..616456)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011389765.1"
                     /locus_tag="CT3_05380"
                     /product="ABC transporter permease"
                     /protein_id="BBL23083.1"
                     /transl_table=11
                     /translation="MRSISTPIPAGPSASQAARKAAGAIGPFLRRFARNRGAVIGAVI
                     LCTIAAVALAADLLFPTDPLRIVATPEIWPFSQWSHPLGTDSLGRDIAAMIAHGARAT
                     LLIGLVAATTATLLGVGIGAASAWAGGWVDEVLMRVTELFQIIPNVVFVLTVVSILGP
                     HIEAITLAIGLVSWPPIARLTRAEFLSFKEREFVQACRSVGLHPAHIIFKEILPNALP
                     PVIVMSSLVAAGAILYESVVSFLGLGDPNVASWGRLVGEGRSLIRTSWYLCAVPGVAI
                     MLAVLSLNLVGDGLNDALNPKLRKR"
     CDS             complement(616458..617429)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011389766.1"
                     /locus_tag="CT3_05390"
                     /product="ABC transporter permease"
                     /protein_id="BBL23084.1"
                     /transl_table=11
                     /translation="MLVNLILRRLGQAVPLLLGVVVLNFLLIQMVPGTFLDVMTAERQ
                     VTDPALIERLRVTYGMDQPASVQLLKYIASVAQLDLGYSYRHNTQVIDVIGAHLPATL
                     VLMLSALAIAVLVGVAAGIVSSIKVNTWWDTAVSLFATLCFAAPSFWLGIMLIVLFAV
                     KLGWFPVGGMVTIGLDGGLWQQTLDVLHHLALPAITLGLFYSASYARVMRASMLEVSR
                     MDYVRTAKAKGLKDVAIVLRHMARNAVLPIVTLLGLQLGAVLGGSIVVEAVFSWPGIG
                     SVLFDSVMSRNYPVVLGILVLSSAVVILANIAVDILYARLDPRIKAL"
     CDS             complement(617439..619061)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011970501.1"
                     /locus_tag="CT3_05400"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBL23085.1"
                     /transl_table=11
                     /translation="MTQPTALSRRDVLIRSAAGLTAAASYSWGLPAQAQATAPRRGGT
                     LVISWGGLEPQALYVPGGGGSAPYQTSTKILERLLRIDDKLQFQPVLAESVTPSADFK
                     QYTIKLRQGVKWHDGKDFTAQDVVFNALQHWKPISAGIALKALTDAKAVDSHTVLLTF
                     QTPVPEFFLKSTLAGAYQLVLPRHLYEGKDIITNPANNTPVGTGPWKYGQWVRGSHVQ
                     YQRNEQYWRQGQPYIDKLIVRWWADAASRGAALETGELGLAYSSPVPARDIDRLVKTG
                     KVTLETRGYENAAWTVTAEFNQRREHVKRREVRQAILHAINRQFIVDTIYYGRGKPAI
                     SPIFSSNPIFFTDDVPRYAFDPKKAGALLDAAGLPLKDGKRFSVNLLAAAWFEENAKL
                     GQYLKQALEDVGIAVKLDSVDRATALKRIYSDYDYDIAISNFTAPLEPVPTVTQYFTT
                     DGIVRGGAFRNATGFSSPEMDALVGRITVETKPQERKKLVHAFAKLASTEVPLVPLVE
                     IQAFTLASKKLHNFTSVADVQGGSLDDVWLGA"
     CDS             complement(619085..619546)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003809022.1"
                     /locus_tag="CT3_05410"
                     /product="thioesterase"
                     /protein_id="BBL23086.1"
                     /transl_table=11
                     /translation="MSEAATLPAQAQASAPPECLDLQQIQAHFDSSPFIAWLQLQALE
                     VDHEAGELTVHAPFQDALGRSANTGQWHGGPLAAVIDTVGDFAVGMLVGRGLPTINFR
                     VDYLRPAIDTNLKAVAKARRVGKTVGVADVDLFNDQGVLVAIGRASYATLG"
     CDS             complement(619543..620556)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015038776.1"
                     /locus_tag="CT3_05420"
                     /product="zinc-binding dehydrogenase"
                     /protein_id="BBL23087.1"
                     /transl_table=11
                     /translation="MKALVLREHGDNEKLTLEPQFPNPTPGADDVVIRVKASSLNYHD
                     VFTRRGMPGIRLSFPVIIGLDVAGEVEQVGTNVTDWKPGDRVLVDPIDRVDGGLVGET
                     IHGGLAELCRVPAHQLIRLPDQVSFGEAAALPVAYGTALRMMNRIGQVKAGEKVLILG
                     ASGGVGVCAVQLAKLAGATVIACAGTPEKAEQLRQLGADDVILYTEEDFLKAVQTRYG
                     KPARRRGQAGGGVDVVVNFTGGDTWVKSLRCLRLGGRALTCGATAGFDPKEDLRFIWT
                     FELQIRGSNGWEREDLHELLELVQSRQLKVLIDRQWPLDDGAKALASLEDRKVFGKVL
                     VAA"
     CDS             complement(620583..621692)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064658.1"
                     /locus_tag="CT3_05430"
                     /product="hypothetical protein"
                     /protein_id="BBL23088.1"
                     /transl_table=11
                     /translation="MSTVLEIWEAFANDYNDGRQRFIAQAQRAGAELSHYAHPTLSTP
                     DGQPLTLDVARLGPADATRTLLLISGTHGLEGAAGSAVQNAWLASQTAQSLPPDTNVL
                     LVHALNPFGWSHDTRTNESNVDLNRNFIDHAAPRPSNTAYDALHEQLVPDSWTATGRQ
                     GVQSAIQAFRDAHGADATFNAMASGQYRHAQGLAFGGQQREWSNLTLERILGEHLPHT
                     ERVALIDWHTGIGEYGEPFFLCFNADGSEEQQQAAQWWSHERVLGQRPHGLARPDYQG
                     LVFRGVEAFLPGRKVAGAVIEFGTRGSNTSESLRLDQWLRFRAPQQADAARDAQLRHD
                     LIDTFVPYSGIWRQSVLRHGVEITDQALHGLAQWN"
     CDS             complement(621689..622552)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010929879.1"
                     /locus_tag="CT3_05440"
                     /product="dioxygenase"
                     /protein_id="BBL23089.1"
                     /transl_table=11
                     /translation="MSLPSVTGLDHYIIRVNDLNAATVQYRKLGFALAPQGVHHQGTR
                     NQTLILDANYLELLYFPPALQSTSRFAHYPESYQGPVAVALQTTDSAAVHRELAQVGI
                     HAEAPEGGGRPVHLQDGSEDAAWLNTRFPTGTLGAPDFFTCGHLTRHLVYRPEWQDHP
                     NTARRIEALVVVHPDPLSLRSAYEQAFGRISIGNTGPDGWTLRRGSLRLLFLTPQAFQ
                     ARFPGIPQPATADGTWFAGSIIGVRDLVQTRHVLATNGVQAQDNAYGELVVNPADAAG
                     ALQVFVQESHA"
     CDS             complement(623100..624011)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004523363.1"
                     /locus_tag="CT3_05450"
                     /product="hypothetical protein"
                     /protein_id="BBL23090.1"
                     /transl_table=11
                     /translation="MLIFALLTFAAVMLTAGALFFWLTPTAAAQRLQALAPTAGHSNW
                     TETAVRLIGPFAHLSSPTAGIDATPLRLRFLNAGIRHHSAPMLYFGIKTLLPVGAALA
                     VYSFMLTVSKASSNERMFYPLVAALVACYLPNLVLRWMASRRKREIFENFPDAADLML
                     VCVEAGLGLDAALTKVAEEIRLQSDALAEELHWTNLEMRAGSAREKALRNLAARTGVD
                     EIHTFAAMLTQADRFGTSIGESLRVFSEDLRHKRQMRAEELASKIPTKMLLPLVTCIF
                     PAIVMVVLGPAVIRIIRMALPMVAGTA"
     CDS             complement(624038..625027)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004537325.1"
                     /locus_tag="CT3_05460"
                     /product="hypothetical protein"
                     /protein_id="BBL23091.1"
                     /transl_table=11
                     /translation="MSSFFSTHSALVIVALVFVALLLLLEACQVLWRQYKSPEAKQLE
                     RRLRALSAADDRSTPSKLVKERVLSDMPGLQRTLQRMPHAHQLDRLIVQSGLEWTVSG
                     LLLTSAVLWAAGALTLSMLRQPLELAVAAGAALAALPWLYLQRKRHQRLVLMERQLPE
                     ALDLIGRALRAGHAFSAGLQMAGDELPDPIAGEFRLVHDEINYGTSLQQALNNLGERV
                     PITDLRYFIVAVLVQRESGGNLTEILSNLSHLIRERHKLYAKVRVLSSEGRMSAWILG
                     LMPFALAALLNLMNPEFMSAMWKDPIGITILKWLAVMMVIGMLMLRRIIRIRV"
     CDS             complement(625049..626467)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004537977.1"
                     /locus_tag="CT3_05470"
                     /product="type II/IV secretion system-related protein"
                     /protein_id="BBL23092.1"
                     /transl_table=11
                     /translation="MSLRDFLATSAARNPKPSLQLVADNADTPDAPAAEAVQPPAPPL
                     YGQSAAYLTLRGRIHAKMVERFDLAALETLPKPTLLQEIAGMTERLLSEDSAAVNDLE
                     RKLLIRDIQHEMLGFGPLELLMADPAVSDILVNRHDQIYVERLGRLELTPVVFTDEKH
                     LLRIIDKIVSRIGRRIDESSPMVDARLPDGSRVNAVISPVALDGPMMSIRRFAHTPLR
                     MENLIQDLKSLTPNMALVLEALAKAKVNMIISGGTGAGKTTLLNILSGYIPEAERVVT
                     IEDAAELQLQQPHVVRMETRPPNIEGRGEITQRSLVRNALRMRPDRIIIGEVRGAEAV
                     DMLQAMNTGHEGSLTTIHANTPRDSLSRLENMIGMAGLNLPHQAARQQIASAITVIVQ
                     ALRLTDGKRKITSIQEITGMEGDVVTMQEIFAFTQTGIGSGGDVQGYFHATGVRPKFA
                     ERLKGFGIALPDTVFDPTRHYQ"
     CDS             complement(626496..627656)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004523366.1"
                     /locus_tag="CT3_05480"
                     /product="pilus assembly-related protein"
                     /protein_id="BBL23093.1"
                     /transl_table=11
                     /translation="MKIVIISPRPAHLQEMVQVLQTHSHQVHVFEGGKTRMPAIAEHE
                     RPDLMMVDGMCCDPADLAPVEQVTTRYPRTAVLLLCAQQSPEFLLQSMRAGVREVLPS
                     TAAPQTLLDAVQRIAAKLQDATPHVAQGRTVALLPCKGGAGATFLATNLGWALARRHS
                     VLLIDLNLQYGDALSYLHEGRPSLTLGDIATDIHRLDASFLTACAVKVNPNLHVLAAP
                     DNAIQAMGVTPEHVDAIVALATAHYDFVLLDMGRVLDPLALRVLDRAQTIAPVLLPNV
                     PAVRNAQKLLHMLQELGYAEDRLHPVLNRVDKRSDIGLNEVRRTLGQTLQWQTISDAP
                     QEVQAAINAGVALADSSRNCAVVRELGAWAETLSPTLHEGHSGLLNRLFRRA"
     CDS             complement(627675..628124)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05490"
                     /product="hypothetical protein"
                     /protein_id="BBL23094.1"
                     /transl_table=11
                     /translation="MRASHHRRTERGATIIEFALALLVFLMFLLGILDFSRMLFTWVA
                     ANETARAGARYAAVCDDTTKQAQVLARMQALLPQIQSISTSWTPTGCTAATCQSVTVA
                     VTGLQFQWISPIVGSGMQAAIPTPSFATALPREIMRQDPNSNTACTN"
     CDS             complement(628121..628564)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05500"
                     /product="hypothetical protein"
                     /protein_id="BBL23095.1"
                     /transl_table=11
                     /translation="MRAHHRQQGVELVELALILPFLILLSMLVVEFGRALYEYNTVAK
                     SVRDAVRYLSVQLPNTNCAQAQNLVVYGKTTAGTTPLARGLTTGSVTCSWQTAGTYPL
                     INTVTVTVNSYRFQFMTASVFGLKLGDANDGLTLSNIAATMRTQT"
     CDS             complement(628569..629825)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205742.1"
                     /locus_tag="CT3_05510"
                     /product="hypothetical protein"
                     /protein_id="BBL23096.1"
                     /transl_table=11
                     /translation="MSTRTLAPRLARPAGLTGCRGHRRQRGAIIITAALALLLLLGFM
                     GIALDFGRLFIVKTELQTALDSCALAAARELNGKSDAITRAVSAGSTAANVNGVNLQS
                     ATWNGQGKVTAADITFRNSSYIDTTAPTAAVYAQCTHTQPNIRLWLLQAMGAFSGNTA
                     DFPSTRSVRTTAVATRASAQSACPIPVALQPKTPGATSPNYGYTVGDWLTLLSKSNGG
                     STFGWANLDGSNSASETANELNGHCGSKIGDTLGTPGVQASVVEIWNYRFGIYKNNSD
                     PAVNRPDYTGFIYTSASWSAGRNAYSGTSGSTPNFLAQRLAFTRCGNNASQCGMQGGG
                     FSKIATSAEHQAYGADRRIVTVPIVNSSRRLIDFACMLMLQPMTIPVNDVQLEFLGNA
                     GAVGSPCTTSGLAGGSAGPLVPVLVR"
     CDS             complement(629923..630120)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05520"
                     /product="hypothetical protein"
                     /protein_id="BBL23097.1"
                     /transl_table=11
                     /translation="MYLSPQWRGAVHHFLKDEEGAQVVEYALIIAVVSIALVLALQGL
                     AGGQFADFITRVSDCLTGTCT"
     CDS             complement(630168..630377)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05530"
                     /product="hypothetical protein"
                     /protein_id="BBL23098.1"
                     /transl_table=11
                     /translation="MSHIAHQFGNSLLSFVRDEEGAQVVEYALIIAVVSIALVIALKA
                     LTEDGGGFSDFIDRVSACLTTSTCE"
     CDS             complement(630536..630868)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05540"
                     /product="hypothetical protein"
                     /protein_id="BBL23099.1"
                     /transl_table=11
                     /translation="MSIRTTLLPLATAALLAGCGSTTPHYDARFGDAVRSARMQMTIN
                     PDAGKTPGTGADAASGMDGRATRHTLERYQQSYKSPPQAVNVINIGGSLSGAGGGGGG
                     GGGSGGTP"
     CDS             complement(630882..632480)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="CT3_05550"
                     /note="frameshifted, insertion at around
                     632568,632668,632687, deletion at around 630923,630902"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBL23100.1"
                     /transl_table=11
                     /translation="MKYHHLCAAVNLLLVSASSALAADAQPAGASPAMAMAAPAAASA
                     APRAASPTRQCTAIRMEEPATVTLGKSVVIPLSSPMARILVSGQTPAAGQAAPATAMG
                     GQAQAQNGIADIEVQLLSPRDLFFRGRKSGAMNVILQNAQGTCFIKDVVVTIDPGPLQ
                     AKLAELMPEERGIRIQGADNALVLSGEISNPLRLDDIVTLAGAYSDSKKIVNLLRTTS
                     PHQVMLEVKIAEVSKTLLDKLGSSFSGQRITSGGMNSYSVVSNFLSGGGGLLSALRVG
                     KGALNIDGQKDDGLVRILAEPNIMAISGQQASFLSGGKIFIPVAQTNTNGVPVMTLEE
                     KEFGIGVKFTPTVLGNARVNLKLVSEVSDLSQTGSPFTAINGVTSIIPSLSVRRADTT
                     VQLNDGQSLVIAGLIKNNITEAIKRFPGLGEIPVLGALARSTEFQTDQTELMFIITPR
                     LVQALAQAPSVPTDNHVPPSRAEVYLNGALESSTPPPSPTPAPAPAPASMATPVPAAA
                     TPDMQTLPSAEPPASRPAPQNPPT"
     CDS             complement(632521..633369)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004523372.1"
                     /locus_tag="CT3_05560"
                     /product="pilus assembly-related, exported protein"
                     /protein_id="BBL23101.1"
                     /transl_table=11
                     /translation="MKNLKALGLFVLAALASLAAAVYAANWVAQRGSIDADKVIVAAS
                     DIPLGSKILPTMLSTVDWPRGSIPNGAFHDIQQLQDRVVKVGVLRGEAVLEGKLAPVG
                     TRGGLAAVIAPGKRAMTVRVNDVVGVAGFALPGNHVDVVVNAQTEQGGKSDDARQISK
                     TVLENVLVLAVAQEADRDETKPKVVSAVTLELSPEEAEKLDLARSVGNLSLVLRNQID
                     KDPVSTTGITKHQLFGTAEPTPPSAPVKVAVAKPAAPRARPAPLPSAATCVEVIQGGT
                     STLNCF"
     CDS             complement(633399..633989)
                     /codon_start=1
                     /