LOCUS       AP019715               84215 bp    DNA     circular BCT 12-JUN-2019
DEFINITION  Bacillus subtilis subsp. subtilis NBRC 13719 plasmid pBSU1 DNA,
            complete genome.
ACCESSION   AP019715
VERSION     AP019715.1
DBLINK      BioProject:PRJDB8042
            BioSample:SAMD00169822
KEYWORDS    .
SOURCE      Bacillus subtilis subsp. subtilis
  ORGANISM  Bacillus subtilis subsp. subtilis
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 84215)
  AUTHORS   Miura,T., Furukawa,M., Shimamura,M., Ohyama,Y., Yamazoe,A. and
            Kawasaki,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2019) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Biological Resource Center
            National Institute of Technology and Evaluation, Biological
            Resource Center, NBRC; 2-5-8 Kazusakamatari, Kisarazu, Chiba
            292-0818, Japan
            URL    :https://www.nite.go.jp/en/nbrc/
REFERENCE   2
  AUTHORS   Miura,T., Furukawa,M., Shimamura,M., Ohyama,Y., Yamazoe,A. and
            Kawasaki,H.
  TITLE     Complete genome sequence of Bacillus subtilis subsp. subtilis NBRC
            13719
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.4
            Genome Coverage       :: 698x
            Sequencing Technology :: Illumina MiSeq; ONT GridION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..84215
                     /culture_collection="NBRC:13719"
                     /db_xref="taxon:135461"
                     /mol_type="genomic DNA"
                     /organism="Bacillus subtilis subsp. subtilis"
                     /plasmid="pBSU1"
                     /strain="NBRC 13719"
                     /sub_species="subtilis"
                     /type_material="type strain of Bacillus subtilis subsp.
                     subtilis"
     CDS             complement(396..944)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010963621.1"
                     /locus_tag="NBRC13719_42360"
                     /product="guanylate kinase"
                     /protein_id="BBK74891.1"
                     /transl_table=11
                     /translation="MIYVLLGATCSGKTTALETLISQGHQTVISYTTRPKRPHEIDGV
                     DYHFVTQDYFEWLDESGLLVAKNSFRSAFGDIWSYAINNQDIKLFEDQIVITEPSGYG
                     DLTQKYGSSNVIGIYLMAPYDVRLARGLNRKDNSDELLRRLAADEKDFEGFELEVDYT
                     IVSLDKDQVIEDIRNIMNGDIK"
     CDS             complement(941..1237)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42370"
                     /product="hypothetical protein"
                     /protein_id="BBK74892.1"
                     /transl_table=11
                     /translation="MVKVIWIYKVNDPLNDFLERQINAADLQGSEFEKVSIDEHPELI
                     EKYEIEKTHTLVFFDREGDRIANYDGPFNSKELEELIKVIQFFDYVSNYHGDEL"
     CDS             complement(1397..1606)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42380"
                     /product="hypothetical protein"
                     /protein_id="BBK74893.1"
                     /transl_table=11
                     /translation="MTTTMQTTTKYFADTKVAAEAIVDQQKAEHGEYLKSHTITKKTK
                     KEVEYYIVLVTVEYYKDKDLVVTEQ"
     CDS             complement(1643..1774)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42390"
                     /product="hypothetical protein"
                     /protein_id="BBK74894.1"
                     /transl_table=11
                     /translation="MIKKILETLLIHSIGYLICLGWISLGFILGYFGDMILHHIFSF"
     CDS             complement(1780..2109)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42400"
                     /product="hypothetical protein"
                     /protein_id="BBK74895.1"
                     /transl_table=11
                     /translation="MGHDLDNMTLQEKATYIKTMMLWTIDELSEALHELPYAKEWSSK
                     YEKEDYDLEKQQQLFKEEIIDALHFFTNILIAAQMTEEEILKLYKEKNRLNYRRQEDP
                     KLGYVRG"
     CDS             complement(2441..6283)
                     /codon_start=1
                     /gene="yorL_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:O31902"
                     /locus_tag="NBRC13719_42410"
                     /product="putative DNA polymerase YorL"
                     /protein_id="BBK74896.1"
                     /transl_table=11
                     /translation="MARLLRSINRSIENYKKKPFLTHSHTDASNFRLRDAINKPEELI
                     DYCHEIGLSGVVITDHETLSSHVKAHKYVEENKERLGDFKLGFGNEIYLVDKEDTMEK
                     KSLNQKISFHHFILIAKSQKGYEGLKKLSSKAWYNSFFYRGMERVPTYKDELMSLMQE
                     YQGEIIACTACVGGELPQSLISYHDKPTPENKKRVHDFIVWLKGVFGEDLYFELQPSK
                     NRDQLVANEMMLKVSEAYNVKCIVSTDAHYLNKKYAPAHKIYLTASEGEREVDEFYAT
                     TYVMGYEELLEYFDEELLDVLVDNTNEIRSKLGTITFAQETKVPKAHIPKYEMSQLFV
                     PHYMEYEYIRKYAESRYDIDRYYLHLIAEGMVAKKQDLNKENLSRINTELDELYHITE
                     NLGQPLSSYFVLSKDVVDLMWQVSLVGVSRGSACCFYLNYLLDIVQLNPIKFNLPHWR
                     FLSKERPELPDIDLDSEGSKRHEIIQITKDHYGEENVLNMGTFTTEGTRSTVLTSCRG
                     LGIDKDIAHNIANLIPTRKGGIWSLHECFYGNPKEGTKPAKEFCREVDKYEGLKEAML
                     SIEGLISGRGQHASGVIIFPDGYIKQNAMMKTTSGLPITQFDAEDSIYMGGLKLDYLS
                     INALDRIRTALDLLLEHGKIEWQGSLRATYNKYFHPDVLEMESPKMFDLLFKGHVLNA
                     FQFETAVGQQALTKINPRSFDELCAGNSLMRLSTDGEQPLDKYVRFKNNIQDWYEEMK
                     TAGLNEEEIKILEEHLLDRYGICDTQEGLMLLAMDERIAGFSLTQANKFRKAVAKANQ
                     KLIEDQRIKFYEGGEKTGARKVFLDYVWNKELKPQFGYSFSLPHIAGYTMILMIEMNI
                     CHRYGAIYWKTACLSVNAGMIGETEKGTKYGAIAKAVGDMKGDILNPDINLSNKEFTP
                     LEEENKILFGLKPIAGLGTDAIEKIIEHRPYKSFGDFFKKIVDPGLISEAKVVSLIKA
                     GCFDSFYPNRRLLMIDFVKAITPKKEKLTMVQLPTIIHLADKQRFGTELEVYKFRNKL
                     FGRNKVPMTREIEQEFMDFLQAYPYQVDYEFKDGKLCVDQKTFDKAYKEIIEPLRMWV
                     TSPEAAEQFNKIKMKEFWAKHCQGTIEAWEMETLLFYSKKHELDYMPLHNYFNIANFN
                     DLPSNPVITGYKKNRRGNDVPQYKIDVIAGTVVEKNKQKSLVHVLTQDAGVVTVRYSK
                     GQFAHYDKKVVRVHGKEKEVLDPSWFERGSKLVLVGFRRGEEFVLRTTGTQFKHSTMK
                     IKGYDSEKLYLQMAKVAE"
     CDS             complement(6399..6851)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42420"
                     /product="hypothetical protein"
                     /protein_id="BBK74897.1"
                     /transl_table=11
                     /translation="MLQFPRIPSVGELEYLKENDEMILYESFTMINPQTRNTFPDSDE
                     PYYTSLEMQLRHLLYKYDKGWISSERQVMLSSDECISAVHFIFDNEKRVIGINVFQRS
                     SNLFNLEDDVQFFNYFIDKYLKGHKKIKLTYFVSQPHIFKNKNKKIED"
     CDS             complement(6851..7825)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42430"
                     /product="hypothetical protein"
                     /protein_id="BBK74898.1"
                     /transl_table=11
                     /translation="MPKNNNLEPVKLPMPIRFGEKPDFEFKNDLENIKVTLVDYTPWE
                     SIIHYLPGYVNATWADEPEETYSMAQVVDDIEKAFTFKTLPSILETIRLTFRIEGISV
                     QDVTHLIRHRTFSFSAQCTGDRWLSHTTAVIPESIENSPEFLERYKDLTRQCRELYAE
                     MIDSRKISIMDARLILNKNHDNFYYASMNVKDLLAFCKQRIDRQIQPKSDNIIAYQMY
                     LELCRAYPIAHLDLIDFEMPSFHYIKNARNGHATNLYFPEENSDKFEWNEKDFIYQDY
                     RENINGTNPPEGPTKFQKMFQEYKNQLEEWKIASKQYMDHLAGRGEDE"
     CDS             complement(7922..8158)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42440"
                     /product="hypothetical protein"
                     /protein_id="BBK74899.1"
                     /transl_table=11
                     /translation="MNESVFIIVYEHEDEFGFKESRMETFRSQESALSFVAGFATSHD
                     DKKLVSAFSVNKEGLLTKYEVVFEGKLKFIEKNQ"
     CDS             complement(8155..8622)
                     /codon_start=1
                     /gene="rnhA_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A5HYU6"
                     /locus_tag="NBRC13719_42450"
                     /product="ribonuclease H"
                     /protein_id="BBK74900.1"
                     /transl_table=11
                     /translation="MKKVVIYCDGAARNNGKDNNVGGFGAVLRYGDHVKTIKAGFRNV
                     TNNMMEIRAAIEALKQLKTTNIPVEINTDSAYLCNCMNQGWYKKWMNNGWVTAGKKPV
                     ENRQLWIELIELVEQFPFITFNKVKGHSGIPDNELADRLANEAMDELTRGAAV"
     CDS             complement(8622..9083)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42460"
                     /product="hypothetical protein"
                     /protein_id="BBK74901.1"
                     /transl_table=11
                     /translation="MTNSTTCVVAPTPEFVKPKIIILEGVDRSGKSTLQHAINKATCY
                     KHIVVDRGPIGFKTYCDLFSRDPQLWDNYDDLEKHLAKMEDVLVIYLDCDTKVLIDRC
                     IQTGHEILDYTLHKHFYKFYFDKSPMKKIIVDTTYKTPEEIANDLVKEGVL"
     CDS             complement(9276..10064)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42470"
                     /product="hypothetical protein"
                     /protein_id="BBK74902.1"
                     /transl_table=11
                     /translation="MDTEKLSNSMIRLFNENGNIPMNQYEALTATNILGRSARSGDYK
                     YIAFICPGLKGFFNWHSHVRHGVKATVVKAGQAKIVYKEGLEVIDELVLKYYDSEVDV
                     SAIEPPNSAYYAEQCINYVCKALIELQRSDLIKYIYSSEVISDEPENDDYGGLQWIYI
                     FRHPKVRNELKIGMTTRPWQERYAEANMNTYTSRDLEVVATFPCKDGKAVERLIHSQF
                     EEYRLPPKTGQTKQPEWFEFPEDKVDEVITRIEKFMKSIDLLAI"
     CDS             10131..10325
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42480"
                     /product="hypothetical protein"
                     /protein_id="BBK74903.1"
                     /transl_table=11
                     /translation="MLIAYSGGKKFKDEDVSFFVMFLRHKINDINKHKNIYVAVQIFH
                     CLNGDPYWTHYNFVDTITIY"
     CDS             complement(10920..11480)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42490"
                     /product="hypothetical protein"
                     /protein_id="BBK74904.1"
                     /transl_table=11
                     /translation="MTYYNRGKVRTLGDTQILGLGEIIRYNNRPKIKHENVAEHTFYV
                     ITTVLKICQMYNIDDYIKLKALEFAAVHDIPEIFLGDVPYDTKVDNPDLTEILERAEV
                     VSLKKNMPEYAESYEKFLKEEKEETIAYLIVKLADTVSVLQYSNSEIELGNKTNQMKS
                     INEGAQERVLNLIEKLEKAIESKFEN"
     CDS             complement(11549..11827)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42500"
                     /product="hypothetical protein"
                     /protein_id="BBK74905.1"
                     /transl_table=11
                     /translation="MKVIKFKQNACRPCQMLENFHTFELGVEPDITYNLSNGDDESIN
                     AAMKFGIMAAPVLVLVDDDENEIERIVGFDGKQDLIRDMFLKAGKIEG"
     CDS             complement(11932..12390)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003646330.1"
                     /locus_tag="NBRC13719_42510"
                     /product="nucleoside deoxyribosyltransferase"
                     /protein_id="BBK74906.1"
                     /transl_table=11
                     /translation="MTQTTKSLSPGKKQHVYIAAPFFKPDQITRVALVETLLEKHGLT
                     YFSPRKQSAIGPISSPEVRKKSFDMNVRGIEESELVIAITDDKDMGTIFEAGHAYASG
                     VPVIYVAFTLGKDGMFNLMLAESGKAACKTVEELEAAILGQEIYYEGLIE"
     CDS             12550..13074
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42520"
                     /product="hypothetical protein"
                     /protein_id="BBK74907.1"
                     /transl_table=11
                     /translation="MNVFAGVDDVARELGLSPSTIKKYYLLIEENGYRFTRSRTGKVI
                     FSERDLEIFKRLIQIKNEKGIKVVDAVKTVISSITDVTVWKESAVATEFEEPPVDITV
                     MKETMEQMHEIIKNQQKQIDQLLESQNQTQKLLESGSTDRDKLLLQSIRETQELKQLI
                     LENNKKKKWWQFGK"
     CDS             complement(13147..14898)
                     /codon_start=1
                     /gene="yorK_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:O31903"
                     /locus_tag="NBRC13719_42530"
                     /product="putative SPBc2 prophage-derived single-strand
                     DNA-specific exonuclease YorK"
                     /protein_id="BBK74908.1"
                     /transl_table=11
                     /translation="MKIKQISSYNGDIIDTILKNRNIKDIDTFLNPNSSEDLNPFDLH
                     NIELGANVLLAHLLINDHIGILVDADADGFSSASIIYQYIKKIEPDSHVSYFLHDRKA
                     HGLTDEISQKIADSSIDLIIIPDAASNDVDELQRLYYMGIDIIVLDHHEVDKMPTHGI
                     LINNQLDENKSTNKNLVGAGMAYKFCQALDRILDTHYADDLLDLVAIGQIGDTSDISE
                     NEVRNLVFRGLETINNPLVKVAVMDVFGSLEGIAPKDLSFSIIPMINAVVRVGTEDEK
                     DLLFRALNKIGDGRVWNVEKRKKNKKTGKFNKILVEQDLYEYAFDMMKKVKGRQNSMI
                     KKSLEKLRSSTYNEGGISIALLDSSDEAAITGLVANKVAKKYQKPALVLYYKDKKYIG
                     SGRGDEKVLSSLKDWCNETGLVEFAQGHANAFGISIPEDNFEEFKKRTHEVEQNEFVY
                     EVDLIVKENVDRSLIEDVTDNKHLFGGKVQEPLLAFVGIKINKNFIRQKGSMLTFYEN
                     GVEFVMYGAPEGLYESLKNNFDRQITMDFVGTPSVNVYGNKRTLQLVLVDCERNESGQ
                     YDFIEVPDEITAETIIF"
     CDS             complement(14888..15091)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42540"
                     /product="hypothetical protein"
                     /protein_id="BBK74909.1"
                     /transl_table=11
                     /translation="MRSVIKIEIDRPLNSEEIEYVNKLSAEEKEEQIKRMNYAIKDML
                     ELEGIHPQFLRITNKIVGESNED"
     CDS             complement(15152..16192)
                     /codon_start=1
                     /gene="yorJ_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:O31904"
                     /locus_tag="NBRC13719_42550"
                     /product="hypothetical protein"
                     /protein_id="BBK74910.1"
                     /transl_table=11
                     /translation="MDANEVKQSLSENDIFTLLQELGAQPKLKGSNIICKTICHNGHS
                     HKLTYYSNSHSFYCFTECGHMDLYGLIGKIKGLTFFESFKFVCQRFGLSYGNSKYGSD
                     KVDMSFFEKFEPKDMAAEIKLLDKKILDSYYDYYHKSWIEDNISPKTMKKFNIKYSVL
                     DNQIIIPHYDLKGNLVGVRARNLNQELVNSGKKYMPVFYKNRFLKHPTGACLYGLNFN
                     LEQITDYGAIILCESEKSVMQIDTMFPDMSIAVALSGSTLTDTQLEIINDLGIERVII
                     ALDKEFTEVGSIEEKYYIEKINSVFINKLSSRFETSVMWDVEGLLDLKDSPSDKGPET
                     FMKLFHNRILVA"
     CDS             complement(16272..17864)
                     /codon_start=1
                     /gene="yorI_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:O31905"
                     /locus_tag="NBRC13719_42560"
                     /product="hypothetical protein"
                     /protein_id="BBK74911.1"
                     /transl_table=11
                     /translation="MTEVNSATTDNVMKALNPTRAVYSVIGSLCKNPHLLRDSEIIIT
                     EKDFAHEFHQIVFSSIYNIAYSNYEVTKIDEIDLDNYLASFPQHYKIWEKNDGLSYIR
                     KSIAHANENTFKSSYDRLKKISLLRHYVLNGIDVTDLYDWKSTDLKVRNDGMKKIDSM
                     TVNEIIDHYTIKLTKIKDEFNIGQETKSFMAGDDLDTLLDELDEDPEYGNPFTNKFYN
                     TIFRGKRKTKLMLRSAGTGTGKTRQALADMCNASCDEIFDIDQNKYVSNGPSIPTLFI
                     STELVKREVQTIMLAFISGVDEDVIKDGKYSEVVLRRLKKAIEILKRAPIFCEYVNDF
                     SISDIETIIERHIIENNIQECAFDYIQMTPKLSRTMASAFGNHLREDQILHQFSSSLK
                     ILAEKYDIFIASSTQLNRGSKDIENRDPSALRGGQATADKVDFGILTFRAGASDHHNL
                     KHILQTGFTNKKPNYSHWVYKNRGGKYSNVIIWTYMNLGTMREEPLFVTDYDFNLLDV
                     HPMDIEYAIEATEDSAEEVPVF"
     CDS             complement(17861..18349)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42570"
                     /product="hypothetical protein"
                     /protein_id="BBK74912.1"
                     /transl_table=11
                     /translation="MSSRLVKCYGTCEQKHPQSIMQKFKSKNYCPACYKKKVKEVEDR
                     ENLYNKCKEVFGISFPTGLMLRQIKQFKEERGYTYKNIGFALDYIVRIKKIQLELKYG
                     LALIPHYYDEMIDYYKDLKRRRENMVVKKIETQKVQIKPPSLSQNRYRDKKLINMEDL
                     LK"
     CDS             complement(18440..19492)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42580"
                     /product="hypothetical protein"
                     /protein_id="BBK74913.1"
                     /transl_table=11
                     /translation="MESPKKWFVFKYEHIDYLDNIELLEPDSNKALLDELKQLFKKEG
                     WEGDGEIGQIWLPPFVLHKANSYGHWVYHVKQQNNGTSFLASRLFLPFGELLKQNASK
                     QNLSIPDDENEPVNNEGRNIIQHEVDSFKKDLFSYKDNIEKELKAIDEISNQKIKEEI
                     EEKILGYNQCMLIQLLNDFMDNCYLQLLIEVLENGNKSKLKLSKKNVKLDLNKMDGDD
                     WLTIANIISDVYDDYRRTGFTDKLSRLTKPLDYEMSKQDKELRHEIIKHVIIRNCIQH
                     HNWNLDRDSLNYSLPNADSIEVMSDENSTIEINKYKRIKLSKTELYEIIDKLNSFAET
                     LSSRVGEKIKTRYKQI"
     CDS             complement(19738..20124)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42590"
                     /product="hypothetical protein"
                     /protein_id="BBK74914.1"
                     /transl_table=11
                     /translation="MLNYATLKPGELINFKEGVGSTYDLLKKEIQGTLALTSIEELDV
                     WYDDGFLLKEEPLMPSLIIKNTPNPSITDWDVVICGNIMFASSNEDGDTISLTEEATK
                     ILSKFKLALLGTNPVWVYHNYEVKQS"
     CDS             complement(20223..20729)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42600"
                     /product="hypothetical protein"
                     /protein_id="BBK74915.1"
                     /transl_table=11
                     /translation="MTRGSIIFVRRKGIISKLIRLFDHRGKFSHVAIAISDTEILEAD
                     INIVSRVKKFNLKEYSYYEILDLGLSSEQQEKVVEISKAYIGKKYDYAQIFGYIIKNL
                     FHLKGKILFNNPNNLICSELVFNVLDHLGITNDLGITGEVRGIDLTPNELYDLLKYLS
                     KSIETSQT"
     CDS             complement(20726..20881)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42610"
                     /product="hypothetical protein"
                     /protein_id="BBK74916.1"
                     /transl_table=11
                     /translation="MFIIYLLFFYLAIPSILIKFSISRIFHYNIDFWGLYFIFIALYF
                     LRIVFKK"
     CDS             complement(20976..21401)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42620"
                     /product="hypothetical protein"
                     /protein_id="BBK74917.1"
                     /transl_table=11
                     /translation="MGSLPIILASNTGNTRTFIPFIQEYAKRDLQVIEDFNNPFPSCN
                     SLAIGAYTWGNGKIPKRLKEYLIENHLQLHGREIFIFGSGNSVYPKFCGAVEGIKKIC
                     LDCGADVIAAFKFEQRFNAEKLTKLELNKLIGSIKYWSR"
     CDS             complement(21403..22446)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Y5B3"
                     /locus_tag="NBRC13719_42630"
                     /product="ribonucleoside-diphosphate reductase subunit
                     beta"
                     /protein_id="BBK74918.1"
                     /transl_table=11
                     /translation="MEQLTKQVRVFNENLPNKGERMFDDVSGILFWDDIINQVYYELI
                     KEMREVFWIPDEVSMSKDKVQWATEMNEMEQELFLNAIGILAVLDSIATYFDNVAAYY
                     IRDSAIKALMAFVAAMETIHNESYTYILSSVSSKAVSLDVFERPKKNEFMIRRNKLMM
                     DLFDEFIQNPTPETFAKGLVAMSGLEGLCFVNGFTPFYHFNRNGKMFGTGTVIQYIQR
                     DEMKHSYFQTILVRDILTQYPELNTEEFSEFVYDFFTELVQLEREFCEDLYKNTPDID
                     IEEVKEYIGYRANLILDNLGLDQIFSAKKNPMPWITAFDPDNLNNTKRDFFEDKEVNY
                     GKANEQKNDWDDL"
     CDS             complement(22550..24919)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Y5B2"
                     /locus_tag="NBRC13719_42640"
                     /product="ribonucleoside-diphosphate reductase"
                     /protein_id="BBK74919.1"
                     /transl_table=11
                     /translation="MTVVIKDKNKKRERRMEFDRERLISFIKRGFENIEVNPTTKESY
                     ISKVVRTIERREEIESKDITKILIQNALVLTNDIKNDSGYVSPDYLVNTNWNRFARYV
                     KLQELYKRASKNRSYDSKEKYGDFYGLIVTLTEKGLYTPDILANYTREELVKAGNSIV
                     PERDELFDFAGLHSLSGRYCVKDFDKSVYELPQERFMIAALHLMMPEEKDRVEKAIEL
                     YWALSNLYLTLATPTLMNAGRVTGGLSSCFVLTTEDSLRGIFDDNTDVSTFSKNGAGI
                     GIYFGKLRATGSDIRGHKGAASGILGWIKQLDNTAVSVDQLGQRPGAVAVYLDIWHKD
                     IEDFIDLRLNTGDKSKRAYNVFTGLCIPDEFMRQVEKRGDFYLFDPHEIKQKMGFSLE
                     DFYDKKKLGEKETPNPIDHAWTYHYYLCVDNNNLDKRRVPAIELKKRYMKAQLETGIP
                     YMFYRDTVNRNNPNSHSGMIYSSNLCSEIAQNMSPSFVTQETINWETGEVIIHKQIGD
                     LVTCNLSSLVVNRTEKDGVTERVIKIQMRALDNVISLLKVPVPQAQYTNMKYRAVGAG
                     EQGIAALLAQEGIMWDSEQAIEYISKLEEKIMLNCIKASALLGKEKGSYPVFEGSKWQ
                     TGEWFEERDLNSPEWLEVKELASKYMRNGYLRAIAPTGGTSVIAGSTPGIDPIFDVIY
                     FERKKDFHLPILVPELNQKTWFFYKPTMKMEYENEKQLAHLWAIKHNAARQKFVDQAI
                     SHNFYIPQDIKAKNFYKLHMENWKAGVKTSYYTRSWDQKHESSCLACSA"
     CDS             complement(24990..26024)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42650"
                     /product="hypothetical protein"
                     /protein_id="BBK74920.1"
                     /transl_table=11
                     /translation="MAINLLNLEPIKASTDLASYTSFIYGVPKIGKTSFVHKLYGDRV
                     LFIATEKRHKVLVGANVQYVSNWIEYLQVLAQLQNKKIKERYDVVCIDTVENLYAMLE
                     TYILSKYDKTEFGQVEWGKDWVDLKNDWKKNLQQIERLGYTPVFIAHATQVTTKIPVS
                     GVLQEQVNDTMTLVTDKKTKEQYYQFEKYVPDLKDKVMAPINKMVDNILFMTVTTDEH
                     MNEHRVIHLRETLQWQAGSTFEGIAPVIPLDAEAYKKAVTDAINLIDPSQLKEEKESV
                     GLQEEQLDYDALMQEARELGVQFHKANRMDEVNRIVDEVFGAGNKLTDASKEQVQPLF
                     VAIQKMKEIL"
     CDS             complement(26093..26332)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42660"
                     /product="hypothetical protein"
                     /protein_id="BBK74921.1"
                     /transl_table=11
                     /translation="MKNPYKVGDKAIIIRQFCGHEFEIGEIVTILHDAGHSDFFQASD
                     GKNTWYVSINEPYPYELIKKKIQEEFKKTPAKFIN"
     CDS             complement(26421..26783)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42670"
                     /product="hypothetical protein"
                     /protein_id="BBK74922.1"
                     /transl_table=11
                     /translation="MINFLLNWLPVLGTVFLTICYLPQIRKTYVIKDVNGMSVLFWLS
                     LNVALIFMLVNAIMIFIKFGTWGTMITEALNEALALIMLIMVLKYRKNSSYVVPQALI
                     TAEWLKQKFNEENDKRQG"
     CDS             complement(26780..27301)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003566035.1"
                     /locus_tag="NBRC13719_42680"
                     /product="nucleoside 2-deoxyribosyltransferase"
                     /protein_id="BBK74923.1"
                     /transl_table=11
                     /translation="MKLYLANGLFGIADRNFNDTLAAKIREEIPELEVYLPQENVVVN
                     DKKASATSTQIADADTEHLLSSDILVAVLDGVEIDSGVAAEIGVFSTTGRPILGLYTD
                     VRQLGNDNAKKVLTLVDDITENQFQYRNLYVIGLIKKTNGGIFSTVDDLVAALKKKTD
                     ELKKSVEKEVAPQ"
     CDS             complement(27376..28341)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42690"
                     /product="hypothetical protein"
                     /protein_id="BBK74924.1"
                     /transl_table=11
                     /translation="MENKELRQLQNNVQVIGTLKSKDLEVKTSKKGNKYMSGNLVVLS
                     KFDNHVQEIKISVFMMESSKLFKGIETVKNEYKTIEDDGADAADRIEVNGELTLNEYY
                     NAQGNLVQFNQVKGIFFNRLDETNDRPDKAIATIDTVVQGFEPVIKNDLPTGEYKVKG
                     FTVGWGNEVIELKNTIVGAELAEAFMDLYPVGSTGQLNFKINNYAVVDEVKESNQVSH
                     GFGSTEKAEARQVTNYVNNIEVIGGEIPYFGDKAYTEEEIETALQIRKLKLQELSQPA
                     EDTPPSGFGSNGNDLPPGSLPTGMEPPQDDNPFSDAPNTDDMPDF"
     CDS             complement(28401..28610)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42700"
                     /product="hypothetical protein"
                     /protein_id="BBK74925.1"
                     /transl_table=11
                     /translation="MLNEIEKLYAYLQFRQAGMDQDEAMQAIGDLEFLILMDQLKSIL
                     DEVQEEVTEESEASEIEDLLKEIFS"
     CDS             complement(28889..29143)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42710"
                     /product="hypothetical protein"
                     /protein_id="BBK74926.1"
                     /transl_table=11
                     /translation="MFKSKLKKVVGMGIITTGLFISALPASAITEYVWIRDVPEYQDA
                     YDFVFDANKKEVTLYFKGKVPKIVKCDKVQNGMCYVKVER"
     CDS             complement(29376..29705)
                     /codon_start=1
                     /gene="yxcD_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P46334"
                     /locus_tag="NBRC13719_42720"
                     /product="hypothetical protein"
                     /protein_id="BBK74927.1"
                     /transl_table=11
                     /translation="MRLILNEQEIVDGICVFISNDAAISPEDVEIKELTYNNHKGFIA
                     EVHYGPFRRQFLGTTQISEGIIQFLEEYHNFNPNLTVVELKYDEKLGFHAEVLVNEGE
                     DQCFHLL"
     CDS             complement(29708..29893)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42730"
                     /product="hypothetical protein"
                     /protein_id="BBK74928.1"
                     /transl_table=11
                     /translation="MTSMMHPWGYTYHPVGGPGYVSYGASPIAWIVDVIALIIILIIV
                     IAIIRAYKSSKTYKRRF"
     CDS             30042..30287
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42740"
                     /product="hypothetical protein"
                     /protein_id="BBK74929.1"
                     /transl_table=11
                     /translation="MAPENDPDDFLAVFFLDSVDFVLLEDFFVKEIDFDFDLYDFVDF
                     LNDPPKNDLKLELKLDFLELDPELELELELVLELGLE"
     CDS             complement(30524..31102)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42750"
                     /product="hypothetical protein"
                     /protein_id="BBK74930.1"
                     /transl_table=11
                     /translation="MQKVNFKNLTTTELNEFISKAAEELTKRANKSPRVITARKKVIE
                     DAKSDLENLKDSTMCDGYEVGSYATVPEYHINRKKRVVTVLLKGYRSGRIYAKGIAKC
                     DPRDTFNEHIGKAIALYRALSKKVPTKYLTVENPVEPEIGDIILTSYPEFENERIRVV
                     KSMSEAMDEDAAMLRSPVVKNFTFIVDDSKSE"
     CDS             complement(31107..31631)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002355230.1"
                     /locus_tag="NBRC13719_42760"
                     /product="haloacid dehalogenase"
                     /protein_id="BBK74931.1"
                     /transl_table=11
                     /translation="MKEEKGLDYTKSQVEEFHRAFHHPISEKPTPIPEDVALARTIWT
                     AEELVEFLYATAGGNKTKFYGLVTELIRGITAAESKVIKKGPVEDILVDQMDALTDVN
                     YFVQGSFVVAGVKPQPLFDIVQDANMAKLFPDGKPRYDLGNSGKILKPEGWQPPEPKI
                     KAEIENQIKKSEEH"
     CDS             complement(31643..31873)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42770"
                     /product="hypothetical protein"
                     /protein_id="BBK74932.1"
                     /transl_table=11
                     /translation="MSTPGYETLTRKVKSFRENLSTRTKNDKTWLLYESVNELSEEDL
                     KDLGLTIVDLAEIVSNEIDQNPFTLKKEHLVH"
     CDS             complement(31903..32601)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42780"
                     /product="hypothetical protein"
                     /protein_id="BBK74933.1"
                     /transl_table=11
                     /translation="MFKYGLEAECHDAVIKGKDGKGHIDFYLAKYVTFKLIERDPFIK
                     PIEILNFIWKHYYPGEITRFLNNATKHYGDRGEVERNYIKYFFQRIGRPIFQEIVVRN
                     LVNSCLMFWFEIPSSKEDRNSKIDGTVLHLKDSNISIPLQIKNHRHMDSKDQKEKQEQ
                     IKCYGRPAEYLEVHFFNDDMVNGELYWIEGDIKVLFTNRGLDKTSIQSFETKILKEMA
                     KKAENQFTFSKAQI"
     CDS             complement(32658..33692)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42790"
                     /product="hypothetical protein"
                     /protein_id="BBK74934.1"
                     /transl_table=11
                     /translation="MSFTSQRNFKGRLDGTTVHEINKKIDFEKTTLEERKKVVEEILN
                     ETNFYSEYFDGYFKTGITTKDFLSHQNNVCKSLDRMATYLLTSDEIKKEEEQEKTEYI
                     FYSDERYFQKKVEKEQSIESLTNSDSNDFSENVIHFLKKEERNKILLRPQSITASDLE
                     RDDWLGEILRSYKPFYDFVTQKLKNKEGNRFILSRIKGQLQHDMIYSKDTLLGVFGYN
                     LKYFSQSTEYDIDVFDFTNPLHLKGDVVETESGKTISAKGLLFLKPYFDPNDDFSFIL
                     LDLKSTIEKAELTDFEKEVLRQTQNGLTQEEIAANFNTYQMKISRTIDRIVKKVAAVG
                     DKYDAEETEV"
     CDS             33960..34523
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011459363.1"
                     /locus_tag="NBRC13719_42800"
                     /product="site-specific integrase"
                     /protein_id="BBK74935.1"
                     /transl_table=11
                     /translation="MNMVSPIRDKKQLELLKMYLREKSKRDYLMFMVGISSALRISDI
                     LKLKVGDIWDGRKPKEFIYLHEEKTGKYKRFPITENLQKAIREYMKEYQLDQESYLFF
                     SRKGNKPISRQQAAHILSSAADYIGIKEPVSTHSMRKTWGYWAYKKGYSLALIMEALN
                     HSSIAITKKYLGITQEDLDDVYMSMNL"
     CDS             34561..34896
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42810"
                     /product="hypothetical protein"
                     /protein_id="BBK74936.1"
                     /transl_table=11
                     /translation="MEIKRITRKKFESFPKFKGVEEAIKFFKEKYGDHFIEQACGPLE
                     EIELGRYYPHMLIIDKEVHKRLSEWMNKQKYPTYPGDNPDTKGFGESFQTIIIFEDGR
                     VQVSNLAEE"
     CDS             complement(34947..35210)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42820"
                     /product="hypothetical protein"
                     /protein_id="BBK74937.1"
                     /transl_table=11
                     /translation="MLFLSSKFIFSTSKTGLPGLKYSWAGLFAQAVFGTFYHKKPTRY
                     YSTTQYLAYDKKYRYTIVDMYVYKDSKYSKQIGYDYKVFRTPR"
     CDS             complement(35561..36082)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42830"
                     /product="hypothetical protein"
                     /protein_id="BBK74938.1"
                     /transl_table=11
                     /translation="MKKLIAVSTLVVSMLIASPTFAQEVKPGDTMSKIARENNMSLQE
                     LAEANPQIKNLSLIFPGQEINTKVGVEKHKSGVYEGYKHFTSTAYSMGTVTATGTKVQ
                     EGRTIAVDPSVIPLGSKVEIKFPEGYEHLNGVYTAEDTGSAIKGNKIDVYLNANDKCI
                     EFGVRDIQVKILK"
     CDS             complement(36231..37511)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42840"
                     /product="hypothetical protein"
                     /protein_id="BBK74939.1"
                     /transl_table=11
                     /translation="MMKKYVEIFKEIKNESSRKGKEELLRKYENVEGLKEIFKFVYDP
                     LVKTGLAKKKIEKEVCLPTYTQLETIFDAMAYVILYNTGSDQIIQSIQIFLKQLKTEE
                     ERELAKSILTKDLPIGISSTTLNKVYGKGFISKHKVMKGQKYNPEKHLTKGEEFIVSL
                     KVDGFRSTTKNLEEGSEFITTTGAKYEGLIELEELMKKLPTGFVYEGELVNVNRDNLS
                     SSDLFRATQSRLKKHGIKKDVRFLLFDMIPIDDYEKGVFDVPYKTRRSFLEETIKKSL
                     PADSLISVVPKFYVGNDKDVIDDLFLEAIGRGEEGLIIHLSDGIFELKKSPSILKVKP
                     EEEADLRCLDVVEDIRGGKCGSIIVDYKGHRVAVAGLKEKWKVDFWKDPSLVVGKIVE
                     IKYFQESKNEHGGLSLRQPSLNRIRDDKDEVSYS"
     CDS             complement(37641..37940)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42850"
                     /product="hypothetical protein"
                     /protein_id="BBK74940.1"
                     /transl_table=11
                     /translation="MFEDFIITNHVIQRYEQRVGECRKNIESRIKRDVRNLNIKQIVN
                     NGNVRHIFTRNSKEFIFVKERNRWILTTVIKRSRNNNHEAIEKRKRMAKRMAACV"
     CDS             38891..39730
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42860"
                     /product="hypothetical protein"
                     /protein_id="BBK74941.1"
                     /transl_table=11
                     /translation="MYYRIGTIKTIKEGEHKVDIKRDFTQEEQEKYFQYRKYLGLHIN
                     NKNLYNLIVRNGEELEHFLDTIKDKDSSEIGSPDYVVFEANRLFMNYLSMIRTYIDHI
                     PSSLSKTFDSKVKDEFDNFLSVIYDNYFEYRFLYKLRNLAQHFGIPISNLISNEHGNH
                     ITMSQSYLLSYKKWGTVKDEIKDMEESIPVKGLALRMNVIMNTVYLFVMKFYVEGIIE
                     SIEWFDSLQGELGGSTILAVSDSAEEYGKGKFNFQPMNTDEFINAVHDLNENPGINIK
                     LIK"
     CDS             complement(39882..41045)
                     /codon_start=1
                     /gene="rapI_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P96649"
                     /locus_tag="NBRC13719_42870"
                     /product="response regulator aspartate phosphatase I"
                     /protein_id="BBK74942.1"
                     /transl_table=11
                     /translation="MSVSDLIPYHYVTTDINHWYVVIKQGRVEKAKEMKRKVEKEFDM
                     MEKNEKVAVYLQLLKLRHEIMLSYLEPDSVKNIDGVYSDLKKTRENMAPESLTNTIEF
                     YYNFFTGMYHFRTRDLVIALTYYREAEKYLDLLDANANTDKAEFYFKVSEVYYYMKET
                     HFSMNYAQRAYSIFKEQKDAQGNLTYGKEMVQCQFVIFGNWLDKMCYEDALETAEKAL
                     KDALEIGEQHLIGSAHFTVGLCYNNLEELDNAEKHFQIAYEIHKDRKHIYESKAIFNL
                     AYVKAKKNDLKAALELYQEGQKVAARHNNQEVTEKLKLVKGLYLSFDLQTLREVFKFF
                     EEKNLYGDMEEYAVAVADFLTNKEDRHDAVDFYQMAIEARKQIQRGKHLNEKM"
     CDS             complement(41195..41515)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42880"
                     /product="hypothetical protein"
                     /protein_id="BBK74943.1"
                     /transl_table=11
                     /translation="MKTEAYSKLETILGFLNYIENVEGVVHPETIYEQILDPKVEIVQ
                     VIDGNLFNLRYSKSYKELKFVFGDVQEREIDSHIINCLDVIYKSLNDIGSLLDQLTIN
                     SKAS"
     CDS             41722..41901
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42890"
                     /product="hypothetical protein"
                     /protein_id="BBK74944.1"
                     /transl_table=11
                     /translation="MKDNRTKLICSKCNSPIITYRKKKKVIYECSYCGIQPDDLNFDD
                     LSPNDWEDDYEEENM"
     CDS             42301..42792
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42900"
                     /product="hypothetical protein"
                     /protein_id="BBK74945.1"
                     /transl_table=11
                     /translation="MARPRKPASLKQGHSESKAQLEERAEAEQELLGNDDLVNEIPEH
                     LDELAQEYYKFLTTELEISNILCNLDIPLLEQTADCLSKMRQADEIINKEGLILNTID
                     RYGNALIKEHPAVATKQKYLNQFRALSTQLGLSPASRAQLAGLKIEQKNEEEDPLLKL
                     LKS"
     tRNA            42844..42920
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NBRC13719_t00880"
                     /product="tRNA-Asn"
     tRNA            42922..42995
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NBRC13719_t00890"
                     /product="tRNA-Trp"
     CDS             42936..44726
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010938795.1"
                     /locus_tag="NBRC13719_42910"
                     /product="terminase"
                     /protein_id="BBK74946.1"
                     /transl_table=11
                     /translation="MVKRQSPKLKMLVRFLQPLPINKILRVSDNMVSSYLKAHPAYQY
                     ARDVVEGKLTAGKYVKKACCKFISDVHNPDCEFFIDEDELKKIDGLTKLINMATGLKA
                     GTPTHDALAPFQWFFLVNALCWKYKQNPIKRRYEKSVLLIGRKSGKSFLVALIFILLL
                     LIEPEYSEFYSVAPDKELSSIVKKEVEQTITASHPSIQKQFQITRSEVRCLLTKSKFI
                     PLANSENRMDGRKANVFVADEVGALRNRYPIDAMQSSQMNMVNRTGILISTAYESLNN
                     PMTEEVEYAQKVLDDLIDDPTLFALLYKPDDPKDWLSDKSLIEANPLAEVLEDNLEYL
                     KKQRRTALDMPSSKKNFLTKHMNIFVDGDDSEVYIPSDELKKNMITTYDWTGREVFVG
                     VDLSQTTDNTAVSMVTYDHDKDEYVAQSWAFIPEDSAENKSKVEKVDYFTMRDNGYCY
                     FCGDKVISHRFVENFVLDLEKKYGVIIKGIGYDRWNCVASANRWYEEGYDTIEIKQHS
                     SVLHPATKLVKERVLKGSFKYLQNRLLEINFSNAREVKDSNLNTYVNKKKSTGKVDMV
                     ISILNAMALWNKEVEENLTSNFEERELIIL"
     CDS             44749..46128
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42920"
                     /product="hypothetical protein"
                     /protein_id="BBK74947.1"
                     /transl_table=11
                     /translation="MGIFSRKNKQKEDRSMQYSYGGGYSITSYFGDGGPITEEEAMRI
                     PTVVSALELITSSIASLPIYLYKEDRKGAVIKIPDNRVSLLNDEPNDLINGYNMKKRM
                     VKDYLLYGASYIKIEKIRNEVTNFYPLPIKYISVTTYSQGYKKWATINYFYNNKTGTY
                     EFTPDELIILTRDSEDGVTSSGILQNNSKLLRLALDEIEYSNGILKNGALPIGVLKAT
                     SRLSQKAIDNLRSSWENLYSGPKKAGKTIILEEGLDYNPISMKPSEMDLTNSKKNTVS
                     EIARVFNIPESMLNSSANKYASNEQNNLYFLQYCVGPIISAIESALNKSLLLETEKEQ
                     GYYFRFDVSELLRTTEKEKIDATVSAVKGGLISLNEGRSRIDMPEIKDDFFMWGLGQI
                     FYNPKTGKMTIPNMGETIDPNNPQPSAQKQNHSPTPSNLDPNKPPIENEQTSEDKDDS
                     KIKDEPVDQ"
     CDS             46170..47111
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42930"
                     /product="hypothetical protein"
                     /protein_id="BBK74948.1"
                     /transl_table=11
                     /translation="MKFELLSRKVELRANNDNDSMTVSGYVNKTGELSEVLGSGKKFV
                     EKIAPGAFTRALSRNPDNIDFLAEHNSKHILASTRNGSLRLFEDSTGLYMEATISPTT
                     WGHDYYQLIDDKILRNMSFGFRTLDDSWDVRDDGIYERTINDLELLEVSVVRDPAYSQ
                     STISARGIDVIEDIEIPTDLEEGEQRNMDEIKELFEGLEERLLTSLKESINEIRSEQK
                     EFIEQATAELREKVNEQDPEKAAENSGEQTEVKDNDSEQDEPETKDKSENVDETKPDE
                     KDPKEDKFDEDPDEEKKRSLVSEELSELRNKLTGLSN"
     CDS             47132..48280
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42940"
                     /product="hypothetical protein"
                     /protein_id="BBK74949.1"
                     /transl_table=11
                     /translation="MNLKALKEKRNALLDEADELLKNAEKEVRSLSADEKSKFDELTA
                     DVTDLNNQISELESRQKDGEKNEKTMEERKVDNKEKELRGIEQYLRRQDGEEVRALQT
                     TSQGGAVIPENVEGTIVLKMEETSPVFARATKFPSVAGTLKIAKESLNSVAGFVGEGE
                     DVSELQISFDEVKLAQKRVGAAISLSNQLINDAAVNIVDYSLNLLGRRVGKAVEKSIL
                     VGAGGEEFSGIVNDAEVQKIPVSGAVTIDNLMDLYNSIHPEFLASSSFIMQRGFFNQI
                     AKMKDSMGHYYMQNGVVNGKLTYTLFGAEVIVTDQLPDGTPAIFGSVQDAYAVLVKKG
                     FALQHVTGDTTQAIRGSQLLVLDGYMDGAVYNPQAISVLKVDTATTSA"
     CDS             48382..48597
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42950"
                     /product="hypothetical protein"
                     /protein_id="BBK74950.1"
                     /transl_table=11
                     /translation="MPKVKFLQSAYLPSHKTVFNHNEVVEIENKDLAKSLVKNGHAEE
                     VKETKKGKKEPKVVEKPDESQVDNNVE"
     CDS             48587..48919
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42960"
                     /product="hypothetical protein"
                     /protein_id="BBK74951.1"
                     /transl_table=11
                     /translation="MLSNVKITELDLDFVKNYLKVDHDADDALISMMIISAQNYIQTY
                     LNKKFDEFDPLPAEFTIAALSLISQWYEHREIQTASISSKSELSYVFSGLLDVYRNWN
                     DESYEVDA"
     CDS             48919..49257
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42970"
                     /product="hypothetical protein"
                     /protein_id="BBK74952.1"
                     /transl_table=11
                     /translation="MPSKRPDISGLNKRITFLKQTQGKDSYGAPTMVYKEVTSCWASV
                     ESQQLKEFITTYGTELQNIITFLIRSKQRVPITDDMMISFQGQKYKIVEIQPDLKSSM
                     YDLIVAKAVS"
     CDS             49257..49637
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011475950.1"
                     /locus_tag="NBRC13719_42980"
                     /product="head-tail adaptor protein"
                     /protein_id="BBK74953.1"
                     /transl_table=11
                     /translation="MGLDIDTSGIELALKQMAGRETKVRNRALKAAAHVVAEKLEDNT
                     PVWPVDKHKHLKDDVVISGVDAFGQIKVGYSKETEWRAKFVEFGTMGGSRIAPQGFIQ
                     RTEEESRSEAMSVMTDELKKGLGL"
     CDS             49634..50038
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_42990"
                     /product="hypothetical protein"
                     /protein_id="BBK74954.1"
                     /transl_table=11
                     /translation="MSLSVKTVYDLLMNDQELGNLMNKDMIFSINVPEDFQKVENAPI
                     ICITQISDFQSRFVSNKAFSSEISVQITVWAADLAKIDQFKTRLDTLMGENNWSQYTG
                     MLDRDPTIDLFMLARRYRTTEILNDLSLLKHE"
     CDS             50069..50719
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011475952.1"
                     /locus_tag="NBRC13719_43000"
                     /product="tail protein"
                     /protein_id="BBK74955.1"
                     /transl_table=11
                     /translation="MATLGFEEVQIAILNDQEQVVKVHKINAQVGGAVEAKISGLAPT
                     TNTVYASNVPFYVSAVGVSNPKLELNTADLTEEMIADISGAKTNENGITTLGADTVAP
                     YCAVIMKTKGLANDDIYIALAKGKFGHPDGFDLKTGEDKGQEADTTDGALTGEFVARH
                     SDGIVYAKGRTSTQGFTVSAFTQLLFPGWNGTTAEGQTSTNTSTTTPTETSDTTTA"
     CDS             50797..51123
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43010"
                     /product="hypothetical protein"
                     /protein_id="BBK74956.1"
                     /transl_table=11
                     /translation="MLKIELYNPELDKVETFTEGFVSARALRRVIEFGVKQETEVMNE
                     LEQLDELVALVASLFRSEKVNFDTIYDGIASDKIAEVLSGILQDVLGGEAKKKKSQME
                     LAKVTE"
     CDS             51321..56405
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43020"
                     /product="hypothetical protein"
                     /protein_id="BBK74957.1"
                     /transl_table=11
                     /translation="MATTGTPLGNMVIQLSMDGTQFSNTLQGIKREIRVAQTAMKANL
                     EILSNAGDEYALLENKIKDLTQIMDANKRKIDELRRQHQNAIQTYGEGSKQVQLLASQ
                     INSAITRQAAWERQLRTTEGRLEDLKSGTADLRQEISNITRATQENVASLNASGRVYS
                     AQRARIDGLSQTVNRYNNLIEAQRQRINNLSNTFGENDSRVEAARQELQRYTEQQQRA
                     QERLDQLRNRFDRLSPSVGELSDNLGQVSSRMREVSDRARKTGEKIHDIGSNIKESVV
                     PMTGALTLGLGFATKSAMDFESQMSAVKSVMAPDEVNKYGKALEELAVIQGAKTKYSA
                     LEAAQAEEELVKAGVSVKDIINGGLSGALSLATAGGLELKDAAEIASTALNAFRDDNI
                     SVADAANILAGAANASATDVGELKYGLSMVSAVASGVGLSFRDTSTALAAFAQNGLKG
                     SDAGTSLKTMLLNLSPHTKAASDMMDSLGLATANTKVAYQWLVDRGIKPASTEFKDVS
                     AAVQKLAKIQAGHGASAAKVAKEYDKLATYSGLASSAFYDENGNLKSISEIAALLKDR
                     LKDLSNEQRQQALNTMFGTDAIRAANILYKEGAKGMDDMAAAIGKISADDVAKTKLDN
                     LKGTIEQLKGSVETAGITIGQNLTPALKVVATVIQKVVDVFNALPSPVQHFLVIGAAL
                     VAVLGLIATAIGFTMIGIGGAIKGFGEFGAIVASATRKIAESEAIMATLGSVMNFALG
                     PIGLAIAAISTLGIAFAVAYQKSETFRNFINGIGASIGTAFSKVKQAVSGIFALFKGD
                     QSKGKSLLSSLMPPEMVKVIVDSVNKIKSAFYNMTAPLTSAYGKVKTVITGIFALFSG
                     NTKKGTSILSGVLSAKDISSIRSMVAQVRQVIMSVITYIKAKTTEIRAFWQQNGPMIT
                     KAFINIFSGIVKTVTTVMTTIFQIVGPILKSLVALFKVLLPPISVVFKLVFTVALALI
                     KSVLNNIKGVIDGTLNVIMGIAKVFGGLFTGNWKKMWEGIKQLFFGAFQLIWNAIQLM
                     WFGKMIKGAALFIGSFKALFVGLWNILKSVFKTPIKWIVNFLKDNFNIMKRTASTVFG
                     GIKTVISKVWGGIKLVFTTVIKYIVKFLKLEFNGMKVIVTTIFKVISKVISTTWSVIK
                     KIFVTTAKFLYNTVRTRFGNIKDFIGKVFSWIWNFAKKAWSGISNVIIKPVVNVFKTV
                     VKYFTNIKQNALKIFDGLKKGAQNIWTKMVDGIKSLPRRMGDGLKNGAKAIGKGAKAV
                     AKILIEGLAKGVNGVTGGVNWILDKVHAPKKLRIPKWDVPKYARGTDNHPGGPAIVSD
                     GKGPNKQELIALPNGRMFLSPKKETMLNLPKGTSVLDGNKTAALLKMAPKYSTGIGWL
                     DSAWDKTKEFASSAASKVTNVAKDIWSYATHPTKLLEMAISKFTKLDALKDPTLGMVK
                     GAVTSVKDGAVNWIKGLLTADNPPGKGVQRWKPLVKRALEMNGLSTSTEMVNKVLRQI
                     QTESGGDPKAVQHGYTDINTIRGDLAKGLMQTISSTFNAYKFKGHDNIFNGFDNLLAA
                     LNYAKHRYGPTLSALGQGHGYANGGIVTRAQVANIAEGNKPESIIPLDPLKRTRALQL
                     LSKTQQILGVPNGSQVTVNNDYSEVIARQDAQITLMQQQITLLTQLLAKDNSLYLDGK
                     EVYNTNKKYADQKTKLRNLAKGVVTT"
     CDS             56402..58066
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43030"
                     /product="hypothetical protein"
                     /protein_id="BBK74958.1"
                     /transl_table=11
                     /translation="MNEVTFNFCGFNSNTDLDLIVNDIKRNVGPEISENVQDVPGMMG
                     KIFQGNSYGQRVFEIDATIKATSEADRVDKIQRLSNLITITGDGEYPMVFSDDAEYTY
                     YGHFSQISQVSRLSQSSFDGTLTLTFSCSDPRGYGQYISQDITESPETITPQGNSVTY
                     PIFTCIPKKDVTKIAISDEDDNYVYIGQDVDPDTGDSPIDKEPRVLKDPCNTLATWTE
                     ITSSNLTFYIENGVPGGTMTSTPNVLKPSSFGSKVDGKWHGPVRQQWLPASYKDFRVR
                     ARMKIVSYYPRAMGKIEVYLLDSNGRRIGKLMLKDLGSTGEITMAQVQVGYDSNGVHH
                     EIYASNGSVKKKKKTTKTIKVKNGTKKVKVKGKTVTQQQWKTIKLDVDNSTSTFTDFY
                     GYLQMTKIGNKYTAEIMKLDENCNPAWSKPIKKTWTDTKNTFGDALAGVAFYTAKYDI
                     KEDKVDPAVSYKNDYLALCDIEVWNIIDGGNSSSSKPAVIAREGDEIKINSEDRTVYK
                     NGDLFMENFYIGSKFFDMDGGVPKSFAFEPNLDDAEWYMEYTPTTL"
     CDS             58082..60412
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43040"
                     /product="hypothetical protein"
                     /protein_id="BBK74959.1"
                     /transl_table=11
                     /translation="MYTILDPDLRVCGVLDLEGNLGCKFYNDLRSTKIADDQGKVWLD
                     TLQLSVPYGFPQTDMMTSGYHLLVEGNDGYHYCYRIYNWQDEAVGPVHVKTVQAYNLA
                     IWDFNHKIVPAKTFSNANSTDAFSYILQGTGWQIGTDNFFGGDKSLEIGSGNNAQYWL
                     DQLISQYEVEVRAYVQVYNGQVVNKLIDIVPELGESNGRRLEYSHDLTGITRTGDDTQ
                     LYTLLHVYGGNDKNGNPTTISSVNGGKDYVVDDEANDLYNNGGPYLEGYITNDQILNP
                     SGLLDWGKKQLANYNHPKYTYNVSVAHLNYEVSLGDHIRVVDYSMQPELTLSARVIQY
                     DESKANPENTQVVIGEYVEIAAVTPAEIWALRAQASQAQQAAEEAKSYKVEYFTPDGT
                     DFADGTSTKRIIIRVYSGMKEVTTSIDDSSYVWQKINPDGSHDLEWESSMVGVGNVIT
                     VGSEVAGSTIRCQVNNGISSPILFASEEDAAYFATLPLTNNSGDVNKRVAQYAQVDAI
                     NGNIYWSQEYSGPKKSQYGGWQSYNITRTSIDGTYKDQMWVIGGGHGSQFGIEHVGSD
                     IYIWSAIIDTKRSTLNGTHYWGIARFKYIPNKVIQFGDSNLQFYMIGSSTKYHRINYD
                     EKNQYIFASTGEVDFYVCKRSDIERDKWKPIYTMSGDDVGFDGKTQTFQSSALDFPYA
                     YFCAGDVNGEDPRIMYCCDIRSKSLVYSINYTFDKGTINQIGEYDEPECISYYYDTDG
                     KKWVIQGFSWGNEDTYETQRTNQLYRLNEHKRGEES"
     CDS             60415..60801
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43050"
                     /product="hypothetical protein"
                     /protein_id="BBK74960.1"
                     /transl_table=11
                     /translation="MGSVDIAFTNSSQVAQNAQTIATTTQENLNEVKNNIVYKIDILS
                     TNGTSFKNGLIDTTLIAVAFKGKDNITNNLPPSSFIWTKTNADGTSDDEWNQAHVGVG
                     NTITITSDDIYSRATFQCDLDIEDEV"
     CDS             60819..62486
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43060"
                     /product="hypothetical protein"
                     /protein_id="BBK74961.1"
                     /transl_table=11
                     /translation="MAIVASGQTTIMDMNDAIISGTAPTSPTVGTLWIDSSVSPNVLK
                     TWNGSSWVTQSLALSGLDPAANTTLTNTTKTANEAKSTADSAKSTADAAKTAATTAQS
                     TANGKNKAYRQSTQPTGTLTAGDLWFDTANGNRVSIYDGSKWVVSQFGNAAVDNLDAG
                     SITTGTLQAIDISASFVDSNGQVNGTYFDGDEFRFMKFKSGVSNPDLKNPNISEIEQL
                     SKIFVDGFAYATSTSAYGLGAAGLFYEGVGEENIGAWSIGSSAAGTMTVVSDSNIDIE
                     VGSDQTISLYGNVFLGGDLNANNHNLNNVNHITINDAGGGEGIEWLGGNGWKIVESDN
                     NLSNVSAGALQIASGGQRRMSISTAGNVYLSGTTFKGESGGTTHFASQGAARLVSDGG
                     AEFLVGSDGTGSRVWSMDIYNRTYSSSPNLHITSAGTLGRSTSARKYKLLEEQISEEL
                     PYNILKLNPKTWFDKSAVEQLAGAIERSEDLTDSDIPYLERIGGLIAEDVEDAGLSLF
                     VHYSNPDENGHREVEGLMYDRLWVLLIPLVRELFNRVETLEEKLKRR"
     CDS             62495..62974
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43070"
                     /product="hypothetical protein"
                     /protein_id="BBK74962.1"
                     /transl_table=11
                     /translation="MITRIEQQMLDKGISSFTQYDMNTLIVRIADKLGKLPYEITEDV
                     ILQHHKNLKNDLLSEACEEEIIKGFTASNGHVYRTNRDDQVNMIGQKDILDDTDSAEP
                     IKWRTEDAGWIDHTKDEWLQIYKEAFDFKKSTLLKYASLKDQVNNATTHDEIVKITV"
     CDS             63013..63219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43080"
                     /product="hypothetical protein"
                     /protein_id="BBK74963.1"
                     /transl_table=11
                     /translation="MNVNPIELHQLIIEDLKQQNSILSEQRSTQVAINKLALKRIEEL
                     QGTVAQLELKVKNLEEELGKSSKK"
     CDS             63261..63530
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43090"
                     /product="hypothetical protein"
                     /protein_id="BBK74964.1"
                     /transl_table=11
                     /translation="MEQKDYERIATLETQLETLSKGLERIETKLDAYSTNFITRLEAD
                     IHFKNLEKEIDEIKQNKRANSALIVSCLSVILSTVFALINLIGGK"
     CDS             63532..63828
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43100"
                     /product="hypothetical protein"
                     /protein_id="BBK74965.1"
                     /transl_table=11
                     /translation="MMKYLSDIEWWKHLATNVGGVLTAILGFLSILNLHFDWFSPGSI
                     DAFTAIIIAIGTLFVGSFSTIVNTYLTKHSKEKAKQVADKYEEELVEKTAQKSN"
     CDS             63842..65158
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43110"
                     /product="hypothetical protein"
                     /protein_id="BBK74966.1"
                     /transl_table=11
                     /translation="MNKLIKTVSALALSLGLAFSFVAPSYASSLPSVDFIDVSHHNAE
                     NGLPLSFYQTIKGSGVQGVVVKVSEGSYYVDPAASVNIANARQAGMIVNAYHFARYTS
                     NFAAKKEAIWFDKKLQLVGFDKKKDGYVTIDVEASGLGTASQVTEYTNTFIKQMKALG
                     YSRVDLYTGSYYYNGQLIPSKLVVNKPWLASYPANPVKNKPTANFTNGKGAWQWASDY
                     KFIGMSRYGNFDVSEDYAGKYTKKTSSTQVVTKGVGTIKVVSLVDYMKSKGMNASFSN
                     RSKLATAYGIANYSGTQAQNLALLEKITTGTPVAKSNTSNSKLTTSNSKSFASSSLKT
                     STYKVKSGDTLSEIALKYKTSVLKLVSLNKLKNPNKLYVGQKLKVPAKTSVTKKAASK
                     TYYTVKKGDSVSKIAVKYKTTVSKIKSLNKLKNPNRIYVGQKLRVR"
     CDS             65266..66243
                     /codon_start=1
                     /gene="xerC_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q73NE4"
                     /locus_tag="NBRC13719_43120"
                     /product="tyrosine recombinase XerC"
                     /protein_id="BBK74967.1"
                     /transl_table=11
                     /translation="MAKRNAIYSDELYAQVNRENKDLLDDYILEMKSRRKSEKTIYQY
                     TADIKMFYCWAVKNLDNKSILKMKKRDFRRFFLELQDSGTSAARINRVQCSLRNMLEF
                     ATEDEDEYDYEINAMRSIKGLQKEEVREIFFLTDEQIRLIVDYLLEKGKYQKALYLTL
                     SYESAGRRNEVYQVKKHGFLENSKTNEVVGKRGKKFKLLYFSKSKEIARLYFDQRGED
                     DIDSLWVVGKGESKRPATYETLYNWTVSFRSILEELTGEYIAFNPHSFRHSALTNYHD
                     GNHYVLKELGKDKFDLKVLKTLANHTSVETTEGYLPDRDQEILEEAFGI"
     CDS             66358..67977
                     /codon_start=1
                     /gene="yqcG_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P45942"
                     /locus_tag="NBRC13719_43130"
                     /product="ribonuclease YqcG"
                     /protein_id="BBK74968.1"
                     /transl_table=11
                     /translation="MKVFEAKTLLSESENRAKEYKELKSKMVKLKKAFKAVADLDDSE
                     FSGKGADNIKSFYEDQAGIADQWIDLIEMKIAFLTSIPGILEDANLSDAYIEESFLEH
                     ELVNANTKSKAIMSEQKKAIKDILNDIHDILPLDVFSTEDFKDKLSSADKERKNTVEK
                     ISEVDENLTSEYALSESNEQMIQADYQALIGATSKGKSASPIYYDAKAYRDSEVHKMA
                     EDVKKQSTDYISFKDQQAEQRRIAKEQEELENRPWYEKTWDVVCNFTGEVSGYYDYKR
                     AADGVDPVTGEKLTEGQRVAAGAMAAAGYVPIVGWAGKLGKGVKAVYSTGKAISKAEK
                     ALEVYKTPKTFYALQNSSKGLYGLASANGFSEAITGRDMFGNKISDEQRQNSLNQALG
                     VLGGFGLRGVNKKLNATNPSVPKRPSWRQSEKDVGKDYPDYSEQKSFINGKEVPYGKK
                     GSSRPDFYKDGHSIEVKNYKITTSSGRSRLVNNVSKQVEKRLTDLPGNTKQTIIIDIR
                     GQSVSEEIMDDLYDKIMKKTNGKADIKFKTN"
     CDS             67989..68405
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43140"
                     /product="hypothetical protein"
                     /protein_id="BBK74969.1"
                     /transl_table=11
                     /translation="MAVGFKVKYYWYQVGHGDFLHSFFSTVSYHLEEHGWGSKYPHLL
                     NELYQGKLETKNIEAALEELKDIKERLKEYSPSQVIWDIEDINKRPPWGDNISDEITD
                     LSNYFVTSDGEDFINLLKNALEKGLKTKSEVLIDSI"
     CDS             complement(68496..68669)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43150"
                     /product="hypothetical protein"
                     /protein_id="BBK74970.1"
                     /transl_table=11
                     /translation="MKKILYFLILLIVAGSFIINIFVDNESISTIVNIIGLIAIIIMG
                     IVLRIPFGNSSEK"
     CDS             68753..69376
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43160"
                     /product="hypothetical protein"
                     /protein_id="BBK74971.1"
                     /transl_table=11
                     /translation="MKKSIKQLVIVICFSLIFTTITIPIANAKENSNEVSSEQVNVEA
                     QNMKRTLEPLLELIDQMPEDVAEQGIHSGVEWLNVHKGNEFEGYEFVADGENLTAVKT
                     VQDNIGPFIALNAWSCISSAAKAIAVNAIPWAKILKVKKAAKLMGGLNSMTKTIIRAY
                     KHQRNLGLSRTNAIKKAVKVSTKALPAETQKAVLEFFSLGDVVNNCF"
     CDS             69524..69703
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43170"
                     /product="hypothetical protein"
                     /protein_id="BBK74972.1"
                     /transl_table=11
                     /translation="MFHTRNSSQNAAEFVLLDQLVEEDQLLRKIDQYIDFSLIIEKVK
                     PYYSENKGRPSLVIH"
     CDS             complement(69799..70557)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43180"
                     /product="hypothetical protein"
                     /protein_id="BBK74973.1"
                     /transl_table=11
                     /translation="MDNERLEGDFKKIILLKGIRNEKQYIEDAKNEKLYFTNAEVFRK
                     MGREHKEDLFGDALEGYYIRPYKEKKNFLNIKKGQKYAFDKEYLAKIDTRMKEVYISS
                     FFYITIEEFKNNKIPESIINVFRNEFSDRKIAVFYGVQNLLDGLKRKHPNSFSWANYV
                     LYQGIDEKPLIAEKAYDKDPRLGYRLKRKGLYENQREFRICFHKSSFNDKFIEKNKDG
                     FNLSYGYIGEEEAPSVTILDDINDLKHISIEEKK"
     CDS             complement(70675..70953)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43190"
                     /product="hypothetical protein"
                     /protein_id="BBK74974.1"
                     /transl_table=11
                     /translation="MTDELLKLMQSLSEKFDKGFEQIDKRFDSVEKRLDNIEQRLEMM
                     TEKESNTNEDVIVLLKKIDKQTIDITKDIEYLSGQVGKHDMILNRFKN"
     CDS             complement(71054..71383)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43200"
                     /product="hypothetical protein"
                     /protein_id="BBK74975.1"
                     /transl_table=11
                     /translation="MSNHSKGDIWMYHDPDSGKRRPGIIVGYSGPNEFDVTIAKLSSQ
                     PPRTKFDLVLENWKEIELIKPSIVRTNKLYTINANRLIFKVGKIEGEQLKWITDSVVN
                     YIIGESH"
     CDS             complement(71383..71520)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43210"
                     /product="hypothetical protein"
                     /protein_id="BBK74976.1"
                     /transl_table=11
                     /translation="MEETAYEFLEKIKNMEPAERWKLLDLMYDLYFNKGIQILDEGDE
                     Y"
     CDS             complement(71645..71920)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43220"
                     /product="hypothetical protein"
                     /protein_id="BBK74977.1"
                     /transl_table=11
                     /translation="MLTKQETNEKESNLVFGNLKLINQSSTICYNKDNQSNLKVIIMK
                     QYTADEMLKLIEELPEEEKKKVLDKVYDEYFLGGGAKRYESVNGEAK"
     CDS             complement(71910..72368)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43230"
                     /product="hypothetical protein"
                     /protein_id="BBK74978.1"
                     /transl_table=11
                     /translation="MTTTELSAKSVKELRNIAKEMNITGRWDMNRTQLVYAIERAQLI
                     SEAKDLGIETAAILNNDQIKKVIEAERNVTTEEEKTSHKKRGAKKRKIEVYKDGQLIQ
                     TIDGLMETFNWVTENKITNVGWVKRSLKTGEETAAGYKYREGGYLFKYAN"
     CDS             72402..72662
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43240"
                     /product="hypothetical protein"
                     /protein_id="BBK74979.1"
                     /transl_table=11
                     /translation="MIYLSYINYYTILWKISTYVRTIKFYFHGLKLDNYKKVRIKNHI
                     PSPKKDALQHPFYIYSIKHVYNDAEHPSEYTEHNKNDHPHNI"
     CDS             complement(72579..72800)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43250"
                     /product="hypothetical protein"
                     /protein_id="BBK74980.1"
                     /transl_table=11
                     /translation="MDFILQISKKKSVTVWKKIGTLTFPFLFLIQSAFESVCDYFELS
                     TKSDVMWMIIFVMFCVFTWMFCIVINMFN"
     CDS             complement(72865..73158)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43260"
                     /product="hypothetical protein"
                     /protein_id="BBK74981.1"
                     /transl_table=11
                     /translation="MKKLIAGVLAAGLVFTTVAGVHPEKADATKKRKVYHVKGKFNGY
                     ADPTFFEIKVGKKYKVLMSNNGWYRKHLKEGRTYTYFYYKDKYGQLKVVKINK"
     CDS             complement(73211..74107)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263960.1"
                     /locus_tag="NBRC13719_43270"
                     /product="DNA primase"
                     /protein_id="BBK74982.1"
                     /transl_table=11
                     /translation="MSKVYEYVQDRIIRALEEAIENGGPAPWRKPWKGGIPKNYITKI
                     PYQGINLLLLEGGSYLTFKQIQELQRKNPEVKLKKGSKSYKIYFWKPVERGEDEESEK
                     DRPNFIFRYYNVFHTSDVDGIADDTADFINDPIESAERVVSAYKRECQINIKVGSDRA
                     YYNPTLDSITVPSINQYENVTEYYSTVFHEMIHSTGHITRLKRFEDAPGQTIFGSESY
                     SKEELVAEIGANMILSMLGIEDQNQQKNSVSYLHNWLCRIKEDRGLIISASQHAQKAS
                     DFILNFIEGKYIENDLKLTEAI"
     CDS             complement(74232..76226)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010877972.1"
                     /locus_tag="NBRC13719_43280"
                     /product="DNA gyrase subunit A"
                     /protein_id="BBK74983.1"
                     /transl_table=11
                     /translation="MTTTNKNIEQIIENNMMEYSAYILLDRALPDLRDGLKPVHRRIL
                     YSMYLQKAFKFTKSANVAGQVMKLHPHGSSYGSMVGMVQKDRHIIPMLEGKGNFGQYT
                     SRDLMPAADRYSEVKLSEISIDMMQNFDKNVVDFIDNYDGTMKMPEVLPVKFPSILAY
                     SNSGIGVGFSSSIPSFNLKELTEAIVKYIETGEKTVLVPDFATGGLIVKEDNVFRQLN
                     EEGRGTVKIRGKAEIVKNEIHITEIPYSTTREAIIEKIVELNKAGKLKEVTDVKDLTG
                     LKGMLITITARRNTDMNVLLEKLYKFTPLQSTFSANMNMLVDDLPKVLGVWQTIDKWL
                     EWRTTCIKRGLSHDIETMTRKLHLLQGLEKVLLDIDEAIEIIRRSSQDQIEPNLQKHF
                     GIDFEQAKEVANMKLRNINREYIIKKIEDIDKFEKTIENYKMIVKSQDKINQIIIKGL
                     NETKEKYGKERRTKIVELTEVKPVRLVEEVPNYAVTIYLTKEGYCYKFKGNQEPNLKP
                     GDEVLKVFETENKAEILIFGSDRVCHKVELKDIDETRANALGTYLPNMIRDKNITIVS
                     YSILDSTHKFIIAAYSNNRIAKINLEAFQGNRTILKNSYCLKQDLLDMITLEDDVSLN
                     LLTDKSKLTVDTKNFNLTNGRNATGVYASPSRKLKKIEVA"
     CDS             complement(76347..78263)
                     /codon_start=1
                     /gene="gyrB_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8YAV7"
                     /locus_tag="NBRC13719_43290"
                     /product="DNA gyrase subunit B"
                     /protein_id="BBK74984.1"
                     /transl_table=11
                     /translation="MTTTNQDKIKRLDDREKSREKIAIWYGSADNYYHGLKEILANGT
                     DEVINNFDEGIVTLELFDDLQTVRVTDTGRGIPIDGETDGVKNYELLFRTLFASTKYE
                     TSEQTTTGTNGVGATVLNFTSLFFHIESYYDGYKHALKFENGGELVQDLTKEKISEDR
                     HGTVITFKLDPEVYPVVTYDKDVVREIVRRFAIGSHKIKLIFIHNGEEETFHYESVEE
                     YFEELIGSTTTSPVITAPESLYEEDGERTQIKLTFSTTTDPIQESYLNLTYLSDGGSF
                     NDGVITGIKTFCNKYARENKLFPKGINSFTTEDIESSVSFVLVALSNKVEFKNQTKLS
                     TDKKLYRKLAQRHTTQLLEVFQIENEKGFKKFVNHLLEVQKHNTQSQKAKQQLKKKLS
                     EKVDGIGNKVANLVDCKKHGKDSEIFIAEGQSALGSIVLARDAVYQAAYPLRGKILNC
                     LKADYTTIFKNQIITDLIKVLGCGIQTDKKNKDLDTFNINNLRYGKIIIATDQDSDGA
                     QIACLIITMIYRLMPKLIEEGYVYIAQTPLYEIKLEDDSMIYFYSESEKDQKINTLKG
                     KYTIARCKGLGELDAVTMAETAMNEETRNLIKVTVEDAENMIESLETWMGSSVDNRRE
                     YISENLYKYVEEAI"
     CDS             complement(78377..79240)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43300"
                     /product="hypothetical protein"
                     /protein_id="BBK74985.1"
                     /transl_table=11
                     /translation="MSKYFTANNLDSLVFYQVPKVLLIGDKYKTMNPNAMKLYIILID
                     RIKLSMMNNWKDELGRYYVRLSIEKGSELLGFSDSTFKRAKKELAKYELLEEKREGMN
                     KSNILYPLMLEYTEEDIYRLNNEVDDLLIKAEETAKNIDKNWMGQNELSSNEGIGQNE
                     LSGKVQIEPSREVKLNHPDSSKRTTNNNNSIKNNFNNNENNLVNKLLTREETIHNLIS
                     EYMKKGLPKEVCIMVLDEVEKTPDVKNFGAYLRTCLDNALHKRNLKYGNIDFKGKKIN
                     GQVPFYNWLDN"
     CDS             complement(79599..80120)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43310"
                     /product="hypothetical protein"
                     /protein_id="BBK74986.1"
                     /transl_table=11
                     /translation="MHYVLITITMMKKLFNFLLKKWAFSLTFYLFSYIKCYNKYREIN
                     KLYSVGDKMKIKIRRNAADIYRNENTDLSGVYIGDPVWEDRLQKISGKTLEVDTETLF
                     KYEFNTKPIKGVSKEGIRIPEEYVEEVIDDVRKGKAYCELCNQTSNSDKVCTNCGKTD
                     YLEAFFDDDDYES"
     CDS             complement(80074..80661)
                     /codon_start=1
                     /gene="tdk_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q3Y084"
                     /locus_tag="NBRC13719_43320"
                     /product="thymidine kinase"
                     /protein_id="BBK74987.1"
                     /transl_table=11
                     /translation="MDITFNTGLMGSGKSKKLIDDYLIDPKEKVVLSVSLTEDTFSRG
                     KIESRDGRSLKSINLNRDQFKQNISLLEIIIFMTNTQTIYIDESQFLPKETVEKFVSL
                     SESYHVPIHFYGLDLTFTGELFDSSSHLLTILPSENINRISRGCEASKCSKIAQYNAR
                     IVDGKVSRSGETFVEEKSYYLALCSDHYYNDEKII"
     CDS             complement(80778..80993)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43330"
                     /product="hypothetical protein"
                     /protein_id="BBK74988.1"
                     /transl_table=11
                     /translation="MKKLTIELLKEETLKAIEMAKEDFGVEIDPSSIDYESMLENIKY
                     DFSEEEIKNKPVACASKEAFRKVKILI"
     CDS             complement(81133..81288)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43340"
                     /product="hypothetical protein"
                     /protein_id="BBK74989.1"
                     /transl_table=11
                     /translation="MKIEIKEKDLLEIQDLIMRSYSFIKDGPVPELEKELYETVHKID
                     RIIRNEE"
     CDS             complement(81285..81566)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43350"
                     /product="hypothetical protein"
                     /protein_id="BBK74990.1"
                     /transl_table=11
                     /translation="MSREDNFMYQINWNKKKYPEICKALEDAKNRTGGIAWYLRELIQ
                     KDLEEKRGGVVRSTPVYETVDQEVQNDPPKPSKAKIETIELPDDSGGFL"
     CDS             complement(81563..82390)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010964474.1"
                     /locus_tag="NBRC13719_43360"
                     /product="heat-shock protein Hsp70"
                     /protein_id="BBK74991.1"
                     /transl_table=11
                     /translation="MTLTTVIDIGNFSTKYAYKDKKQIKVGSFPSILHSYKPLEDYEG
                     MERVEYNGLDYYVGETVKNFYFGREEQMYFGNTRKGHMEGQIRLVYALYTIFKETGKK
                     EFNLILTCPYESMVTDKKYFVQHFEGEREVIVEGKSFKFTVHNIVMAAEGLGALNFSD
                     SLNCVIVDAGSKTLNVLYLINGSISKMDSHTINGGTIDNSIMDLAKTFAKTCSNIDYD
                     YPIVCTGGKAEEMKECLENVGYSTVSSAELGEDKPSYYVNSVGLLLKYGRKFEEMFA"
     CDS             complement(82944..83543)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NBRC13719_43370"
                     /product="hypothetical protein"
                     /protein_id="BBK74992.1"
                     /transl_table=11
                     /translation="MKKKEILFSNGLSIQMTFEEVRERFLPMVYKTMKQANSKFMFNQ
                     VEEEDFQQELELELWRAYEAYDSDTGYCFTTYLYPKLRKGVRNATYSRYAQKNQSNGV
                     FSISSPIGDDDLKIEDMLAANDTSFDNIATNELLSIILKNVKEDEMDLLKIIIDVKNN
                     PVNAYAKKHGLTRQAANQRVIKLKKKLRSVIAKEYLEIA"
BASE COUNT        26680 a        15317 c        14255 g        27963 t
ORIGIN      
        1 accaatattg gaagcctcat aaatctcaaa ttccagtctc gggttttgac tatcaatata
       61 agccctttct gcaactggta gagccacatc gtcatcaaga taaacgccgg cttccgtaaa
      121 aacatcgaat gggaccttta agaaattgtt ggggtctttt ctcttgcgat ctaagaaaaa
      181 cttgattttt acaaacacta atttcccttt ttcaggttgt tcccattctt gttcattcat
      241 ttggtctttt acatagtcag taaagaagga tttgtatatc ttagtctctt ctgatggata
      301 tgcctgaaca aatttacgtc ggccatttga agaaactttg taattaagat agttgttaac
      361 cgatgggggt aatggtgaaa ctaactggag ggtcttcatt taatgtcacc attcataata
      421 ttacgaatgt cttcgataac ctggtcctta tccagtgaaa caatagtgta atcaacttca
      481 agttcgaatc cttcaaaatc tttttcatct gcagccaatc ttcttaaaag ctcgtctgag
      541 ttgtcttttc tattcaatcc cctggctaat cgaacatcat aaggcgccat taaatagatt
      601 cctataacat tacttgaacc gtatttttga gttaaatcac catacccaga aggctcggta
      661 atcacgattt ggtcttcaaa gagttttata tcttggttat tgattgcata gctccaaatg
      721 tctccgaacg cacttctaaa gctattcttt gcaactaata aacctgattc atcaagccac
      781 tcaaaataat cttgagtaac gaaatgataa tcgactccat caatctcgtg aggtcttttt
      841 ggacgagttg tataggatat aaccgtttga tgtccttgac tgatcaatgt ctctaatgct
      901 gttgttttac cagaacatgt tgctccaagt agaacatata tcataattca tcaccgtgat
      961 aattggaaac atagtcgaaa aactgaatca ctttaattaa ttcttcaagc tctttgctgt
     1021 taaaaggacc atcatagttt gcgattctat cgccttccct atcaaagaaa accaatgtat
     1081 gagtcttttc aatttcatat ttttcaatta gctcgggatg ttcgtcaatt gacactttct
     1141 caaattcact gccttgtaaa tctgctgcgt ttatttgtct ttccaagaaa tcattgagtg
     1201 gatcgttcac tttatatatc caaataacct taaccatagt gtattcctcc gattagtagt
     1261 tgagtaaggg atcctccgat ccctttatgt gcgtttcatt aacttgtaaa tgaagtaacc
     1321 aataagaaaa atgataaata ggttataagc tgtgattaat gtacaaaata aagcaatagc
     1381 taatacatac ttcatcttat tgttcagtca ccacgaggtc tttatctttg tagtactcga
     1441 cggtaactaa gacaatataa tattccactt cttttttagt cttcttcgtg atcgtgtggg
     1501 atttaaggta ttcaccatgt tccgccttct gttggtctac aatggcttct gcagctactt
     1561 tagtatccgc aaagtattta gtagtggttt gcatagtagt tgtcatatta atttcctccg
     1621 atttatttaa tgatttaaag tattaaaatg aaaagatatg atgaaggatc atatctccaa
     1681 aatagccaag aataaaacca agactgatcc atcctaaaca aatcagataa ccaattgaat
     1741 gaattaaaag tgtctctaag atttttttga tcactaagtt tacccccgga cataaccgag
     1801 ttttggatcc tcttgccggc gataattcaa ccggttcttt tctttataca attttaaaat
     1861 ttcttcctct gtcatttgtg cagcaataag aatatttgta aagaaatgca aagcatcaat
     1921 gatctcttcc ttaaatagct gctgctgttt ttcaagatca taatcttctt tttcatactt
     1981 gctggaccat tctttagcat aaggaagttc atgaagagct tcactgagtt catcaatcgt
     2041 ccaaagcatc atagtcttga tgtatgtggc tttttcctga agagtcatgt tatcaaggtc
     2101 atgacccata cgtttttgaa actctttctg actatcaaga ataaattgat tcatagtagt
     2161 agttgagtcc tttctccaac ttaaataata ttttatttat attattattt aagttgttat
     2221 ttaaatcttt atatttatat ctggttattg aaaaacgtaa atcatttatt acattatttt
     2281 ttaaataaat tacttatgac cgtcatgact gagggtatta tatcggttat aacagaaatg
     2341 taaattatga ctgcgatatt ttgcatttag atggttggtt atattattaa agcaaactaa
     2401 tttccttgta gagccctgta gaagcaacaa aagccgcaga ttactctgcg actttagcca
     2461 tttgaaggta taacttctcg gagtcataac ctttgatttt cattgtgctg tgcttaaatt
     2521 gagttcctgt tgtccgaagg acgaattctt ctccacgcct aaagccaacc agaacaagtt
     2581 tacttcctcg ttcgaaccaa gatggatcaa ggacttcttt ttctttacca tgcactcgaa
     2641 cgaccttttt atcatagtga gcaaactgac ctttagaata tcttacagtt acaacgccag
     2701 catcttgagt taggacatgg acgagagact tctgcttgtt tttttcaact acagttccag
     2761 caataacatc gatcttgtat tgagggacat catttcctct tctatttttt ttgtatccag
     2821 ttatgactgg gttagacggc agatcgttaa aattagcaat attaaagtag ttgtgtaatg
     2881 gcatgtaatc taactcatgc tttttagagt agaatagtaa tgtttccatt tcccaagctt
     2941 caattgttcc ttggcagtgt ttggcccaga actctttcat tttaatcttg ttaaattgtt
     3001 cagcagcttc aggagaagta acccacattc ttaatggctc gataatctct ttgtaagctt
     3061 tatcgaaggt tttctgatca acacaaagtt ttccgtcttt aaattcataa tcaacttgat
     3121 aagggtacgc ctgtaagaaa tccataaatt cttgttcgat ttctcttgtc atagggactt
     3181 tatttcttcc aaaaagttta tttctaaact tatagacttc aagctcagtt ccaaatcttt
     3241 gcttatcagc taagtgaatt atggttggta gttggaccat tgtaagcttt tcttttttag
     3301 gggtaattgc cttaacaaag tcgatcatta agagtcgcct gtttggataa aaagaatcaa
     3361 agcaaccagc ttttattaac gaaacaactt tagcttcaga aattagacca ggatcgacta
     3421 tcttcttaaa gaagtcccca aagctcttat aaggccgatg ttcaatgatt ttttctattg
     3481 catctgttcc taaaccggca atcggcttga gaccgaataa gatcttattc tcttcctcta
     3541 aaggtgtgaa ttctttattt gaaaggttaa tgtccgggtt taaaatatca cctttcatat
     3601 ctccaacagc tttagcaatt gcaccgtatt ttgtgccttt ctcagtttca cctatcatcc
     3661 ccgcgttaac tgataagcaa gctgtcttcc aataaatcgc tccatatcta tggcagatat
     3721 tcatttcaat cattaagatc attgtgtacc cagcaatatg aggtaatgag aaagagtatc
     3781 caaactgagg tttaagttct ttattccaaa catagtccag gaatacttta cgagccccag
     3841 ttttttctcc accttcataa aatttaattc tttgatcttc aattaatttt tggtttgcct
     3901 ttgcaacagc tttccggaat ttattagctt gagttaggct gaacccagca attctttcat
     3961 ccatagcgag caacattagc ccttcttgag tatcacaaat gccataccta tcaagtaaat
     4021 gttcctcaag aatcttaatt tcttcctcat tcaaaccggc tgttttcatt tcttcgtacc
     4081 aatcttgaat gttgtttttg aaacgaacat atttatcaag tggctgctct ccatcagtac
     4141 tcaatctcat taaagagttg ccagcgcata actcatcaaa ggatcgaggg ttaattttag
     4201 taagtgcctg ctgaccaaca gctgtctcaa attgaaaagc atttaaaaca tgacctttaa
     4261 atagtaaatc gaacattttt ggtgattcca tttcaagaac gtctggatga aaatatttat
     4321 tgtaagttgc tctcaatgac ccttgccatt caattttccc atgttccaga agaagatcta
     4381 aagctgttct aattctatca agagcattaa tggacagata atctaatttg agcccaccca
     4441 tatagatact gtcttctgca tcaaactgag tgataggcag cccagaagtt gttttcatca
     4501 tggcattttg ttttatatat ccatcaggga aaataataac tcctgaagca tgttggccac
     4561 gtccagaaat taatccttca atagagagca ttgcttcttt taaaccttcg tatttatcaa
     4621 cttcacggca aaattctttt gctggtttgg ttccctcttt tgggtttccg taaaaacact
     4681 cgtgtaagct ccagatgcca cccttacgag taggaattag gttagcaata ttatgagcaa
     4741 tatctttatc aattcctaat ccacggcaag aagttaaaac agttgaacga gtaccttctg
     4801 ttgtaaaagt tcccatgttc aagacgttct cttctccata gtgatccttt gtgatttgaa
     4861 taatttcatg acgctttgat ccttcagaat ccaaatcaat atcaggtaat tccggccgtt
     4921 cttttgataa gaacctccaa tgaggaagat taaatttaat tggattcagc tggacaatgt
     4981 ctaaaaggta attcagataa aagcagcatg cagatccacg actcacacca actagcgaga
     5041 cttgccacat caaatcaacc acatcttttg aaaggacaaa ataagatgaa agtggctgac
     5101 caagattttc agtaatatgg taaagctcat caagctcagt atttattctt gaaaggttct
     5161 ctttattcag atcttgtttc ttcgcaacca taccttcggc aattaaatga agataataac
     5221 gatcgatgtc gtatctgctt tcagcatatt ttctaatgta ttcgtattcc atatagtgag
     5281 gaacaaatag ttggctcatt tcatatttcg gaatatgagc tttcggaact ttagtttctt
     5341 gggcaaatgt aattgttcca agtttggatc ttatctcatt cgtattatca acaagaacat
     5401 ctaatagttc ctcgtcaaag tactcaagca attcttcata tcccataacg taagttgtgg
     5461 cgtaaaattc atcaacttct ctctcccctt ctgatgctgt aaggtatatt ttatgtgccg
     5521 gagcatattt tttatttaga taatgggcat cagtagagac aatacattta acgttgtaag
     5581 cttccgacac ttttagcatc atttcattag ctactaattg gtcacggttt tttgatggct
     5641 gcagttcaaa ataaagatct tctccaaaaa caccttttaa ccaaacaatg aaatcatgta
     5701 ctcgtttttt attttcagga gtaggcttat catgatatga aattagagac tgaggaagtt
     5761 ctccaccaac acaagctgta caagcaataa tttccccttg gtactcctgc attaaagaca
     5821 ttaattcatc tttgtacgta ggaacacgtt ccattccacg gtagaagaaa gagttgtacc
     5881 aagctttaga gctaagtttt ttcagacctt catatccttt ttgtgacttg gcgattaata
     5941 taaagtggtg aaaactaatc ttttggttta atgatttttt ctccatggta tcttctttat
     6001 caaccaggta aatttcattg ccgaacccta gtttaaaatc tccaagacgc tctttattct
     6061 cttcaacata cttatgagct tttacatggg atgataaagt ttcgtgatct gttatgacta
     6121 ctccactcaa tccaatctca tggcagtaat caatcaattc ttctggttta ttaatcgcat
     6181 ctcttagtcg aaaatttgat gcatcagtgt gtgaatgagt taagaaaggt tttttcttat
     6241 agttttctat acttctattg atacttcgta gtagtcgagc cattgttaat acctcatttc
     6301 ttttgtatta caaagtattt atatctggac cggcaaaaac gtaaattgga tgactgaaaa
     6361 atgtaaaaaa aataaccact cagatgagtg gctatttgtt aatcttctat ttttttattt
     6421 ttgtttttaa agatgtgtgg ctgcgacaca aagtatgtca gcttaatctt cttatgtcct
     6481 tttaagtact tatcaatgaa gtaattaaag aattgaacgt catcttctaa attaaacaag
     6541 ttagaagatc tttgaaaaac gttaattcca attactcgtt tctcattgtc gaatataaaa
     6601 tgaactgctg agatacattc gtcacttgat aacataactt gtctttcact tgagatccac
     6661 cctttatcat acttgtaaag taagtgtctt agttgcattt cgagtgaagt ataataaggt
     6721 tcatcagagt caggaaaggt attcctggtc tgaggattaa tcatcgtgaa ggattcatac
     6781 aagatcattt catcattttc ttttaaatat tcaagttcgc ctacagatgg gattcgagga
     6841 aattgtaaca ttactcatct tctcctcggc ctgcaaggtg atccatatac tgttttgagg
     6901 caattttcca ttcttcaagt tgatttttat attcttggaa cattttttga aacttagttg
     6961 gcccttctgg agggttggtt ccattaatat tttcacggta gtcttgataa ataaagtctt
     7021 tttcattcca ttcgaattta tctgagtttt cttctgggaa gtacaggttt gtggcatgtc
     7081 catttcgagc attcttgatg taatggaaac ttggcatttc aaagtcgatc agatctaaat
     7141 gagcaatagg atatgcccga cacagctcaa gatacatttg atatgcaata atgttatctg
     7201 acttcggttg aatctggcga tcaatacgct gcttgcagaa tgccaataaa tctttaacat
     7261 tcattgaagc ataataaaag ttatcatggt ttttattcag aataagtcga gcatccataa
     7321 ttgaaatctt cctagaatca atcatttcag cataaagctc acgacattga cgagtaagat
     7381 ctttgtatct ttctaaaaac tcaggggaat tttcaataga ctcaggaata actgcagttg
     7441 tatgagataa ccaacgatcc cctgtacatt gagccgagaa cgaaaatgtt ctatgacgaa
     7501 ttaaatgggt tacgtcttgg actgaaattc cttcaattcg gaatgttaaa cgaatcgttt
     7561 caagtattga aggtagcgtt ttaaaggtga aggctttttc aatatcatca accacctgtg
     7621 ccatgctata tgtttcttca ggttcatcag cccaggtagc attcacatat ccagggaggt
     7681 aatgaatgat gctttcccaa ggagtataat caacaagagt aactttaata ttctctaaat
     7741 catttttgaa ttcaaaatca ggcttttcac caaagcgaat tggcataggc aatttaacag
     7801 gctcaaggtt attgttttta ggcatagttt aattcctccg atttttcaat atttttttca
     7861 ataagaatta caatatattt atatctaaaa gtatgaaaac gtaaatcgat ttaataattt
     7921 tttattgatt tttttcaata aattttaatt tcccctcaaa aacaacctcg tactttgtaa
     7981 gtaatccttc tttattaact gagaacgcac tcaccagttt tttatcatca tgtgatgttg
     8041 caaaccctgc gacgaaagat aaggcggact cttgacttcg gaaagtttcc atcctggatt
     8101 ctttaaatcc gaattcatct tcgtgctcat aaacaataat gaagactgat tcattcatac
     8161 ggcagcacct cttgtaagtt catccattgc ctcatttgct aatctatcag caagttcatt
     8221 atccgggatt cctgaatggc ctttaacttt gttaaaagtg ataaacggga attgttcgac
     8281 cagttcaatt aattcaatcc ataactggcg attctccacc ggctttttac cagctgtaac
     8341 ccatccgtta ttcatccatt tcttatacca accttggttc atacagttgc acagatatgc
     8401 agaatcagta ttgatttcta cagggatatt agttgttttt aattgtttaa gggcttcaat
     8461 agctgcacga atttccatca tgttattagt cacgtttcta aagccagcct taatggtttt
     8521 aacgtggtca ccatatcgaa gaactgcccc aaaacctccg acattgttat cttttccgtt
     8581 atttcttgct gcgccatcgc agtaaattac aacctttttc attaaaggac tccctccttg
     8641 acaagatcgt tggcaatttc ctcaggagtc ttatatgttg tgtctacaat gatcttcttc
     8701 attggggact tatcaaaata aaatttataa aaatgtttat gcaaagtata atcaagaatt
     8761 tcgtggccgg tctgaatgca tcgatctatc aggacttttg tgtcacaatc aaggtaaatt
     8821 acgagtacgt cttccatctt agctaggtgt ttttctaaat catcatagtt atcccataat
     8881 tgaggatccc gactaaacag gtcacagtat gttttaaaac caatcggtcc cctatcgact
     8941 acaatatgtt tgtagcaagt ggctttattt atagcatgtt gtaaagttga ttttcccgaa
     9001 cgatcaacac cttcaaggat gatgattttt ggcttaacaa attcaggagt cggcgcgaca
     9061 acacaagtag ttgagttagt cataattgtt atatcctccg atttctttaa tctctttgct
     9121 ttactttgta tttatatctg gtgattcgaa aacgtaaatt gaaatataaa aaagactact
     9181 atagcagtct ttattggcat aacttttata tccgacataa cttttatatc tgctttataa
     9241 aaaacaaaaa aggctggaga caaatctcca accttttata tagctaacaa atctattgat
     9301 ttcataaact tttcaattcg agtgattact tcatcaactt tgtcttcagg gaactcaaac
     9361 cactctggtt gcttagtttg accagtcttt ggtggaagtc tgtattcttc aaattgagag
     9421 tgaatcaatc tttcaactgc tttaccatcc ttacaaggga aagtagcgac gacttccaag
     9481 tctcttgagg tatatgtatt catgtttgct tcagcataac gttcttgcca aggccgggta
     9541 gtcataccaa ttttgagttc atttctaact ttagggtgtc taaaaatata tatccattgg
     9601 agacccccat aatcatcatt ttcgggctcg tcagagataa cttctgatga atatatatat
     9661 ttaatcaaat cggatctctg tagctctata agggccttac aaacataatt tatgcattgt
     9721 tcagcatagt aggctgagtt aggtggttcg atagctgaaa catcaacttc tgaatcataa
     9781 tatttcaaaa caagttcatc tataacttcc aagccttctt tgtagactat tttagcttgt
     9841 ccagctttaa ctaccgttgc ttttactcca tgcctaacat gagagtgcca attaaagaag
     9901 cctttcaagc caggacatat aaaagcaatg tacttataat ctccagacct tgcactcctt
     9961 ccaagtatgt ttgtggctgt taaagcttca tattggttca taggaatatt gccgttttca
    10021 ttaaacaacc tgatcattga atttgataat ttttccgtat ccatagcaga ataattttaa
    10081 cataaaatag tgtttttatt atagagtcac tttttcgttt tattcttcat atgctaatag
    10141 catacagtgg tggtaagaaa tttaaggacg aggatgtttc attttttgtt atgtttctgc
    10201 gacacaaaat taacgacata aataaacaca aaaatattta cgtggctgta caaatttttc
    10261 attgcctcaa tggggatcca tactggacac actataactt tgttgataca atcactatat
    10321 attaagtata tattacgtag taatattaca tgataatgtt acatgataat gttacatggt
    10381 aatgttgcat tgttgcattg ttgtttatcg ttttcgaatg aataaaatat tcgtaaacga
    10441 ataaaataaa aaagaccgaa gatggtgcaa catcttcgat ctgtaataga atagctcctg
    10501 agggagacgg ctttgtctaa aaagctaaat taaatgtagg aacgctctga ccgtcacatc
    10561 attcgttcct actttttttt gttggaattg gcaagcgaca agattccgac aataaggaga
    10621 ccaaattgaa acatcaatcc aagtgcgctt tctactggca tattctcacc tccttctttc
    10681 tagacatgga ggtgtgccgt ctgccctttt ccaaaagccg tatctattac gttacttata
    10741 ctttaaatga aaatctttca aattacaata tatagactga gcttggaacg caaattagga
    10801 gatttgagtt ttgtactttg tgtaaaagcg cttacacatt ctgcgaaagg aggatttctc
    10861 tttcttacaa aataaaaaag aagccgaaaa atcgacttct ctacaaaaat actacagtat
    10921 caattttcaa atttactctc aattgctttt tccaatttct caattaagtt taaaacacgc
    10981 tcttgtgccc cctcattaat actcttcatt tgatttgttt tattcccaag ctcgatttcg
    11041 ctattggaat attgaaggac agaaaccgta tcggcaagct taacgattag ataagcaatt
    11101 gtctcttctt tttcttcttt gagaaatttt tcataagatt cagcatactc aggcatattc
    11161 ttttttaagc taaccacttc agctcgctcg aggatctctg ttaagtcggg attgtccact
    11221 ttcgtatcat atggtacatc gcctaagaaa atctccggaa tatcatgaac tgcagcgaac
    11281 tctaaagctt tgagcttaat ataatcatca atgttgtaca tctgacagat cttcaggacc
    11341 gttgtaatca cgtaaaacgt atgttcagca acattttcat gtttgatttt cggacgatta
    11401 ttgtatcgga taatctctcc aagtcctaag atttgtgtat ctcctaaagt ccgtactttt
    11461 ccacggttat agtaagtcat aactgttgtg tctccttttt gtgagtaatt gagttaagtt
    11521 atatctgtta taaaagttac gagggatgtt atccctcgat ttttcctgct tttaagaaca
    11581 tatctcgaat cagatcttgc ttaccgtcaa atccaacgat tctttcaatc tcattttcat
    11641 catcatcaac aagtaccaag actggggctg ccataatacc aaacttcata gcagcattta
    11701 ttgattcatc atcaccattt gaaaggttat aagttatatc tggctcgact cccagctcaa
    11761 aagtatggaa gttctcaagc atctgacaag gacggcaagc attttgttta aatttaatta
    11821 ctttcatgtt ggttcctcca tatgtactga tagatgatta ttgaataaaa ccaataaaaa
    11881 attatttaat cagttatctt ttgatattaa ttattgaatt tattaaataa attattcaat
    11941 taaaccttca taatagattt cttgaccaag tatggcagct tccaattcct caaccgtttt
    12001 acacgcagct tttccggact cagctagcat taagttgaac attccatctt taccgagtgt
    12061 gaaggccaca taaattactg gaacacctga tgcataagca tgtccggctt caaaaatggt
    12121 tcccatatct ttatcatcag tgatggcaat aacaagctct gattcttcaa ttcctcttac
    12181 attcatatca aaagactttt tgcgaacttc aggcgatgat attgggccga ttgctgattg
    12241 ttttcttggt gaaaagtaag ttaatccatg tttttcaagt aatgtctcga ccaaagcaac
    12301 acgagtgatt tgatctggct tgaaaaatgg cgcagcaatg taaacatgtt gtttcttgcc
    12361 tggagataat gatttagtag tttgagtcat aattattcct ccgatttaaa tatggtgttt
    12421 tctctttatt tatatctggt gattcgaaaa cgtaaattaa tgtcgaaact tttattacgt
    12481 tttttctaaa aagctatttt gtctatgata tgattgttat gactactata atcggaggtt
    12541 ataactgtta tgaatgtttt cgctggtgtc gatgatgtag cccgagaact tgggttatct
    12601 ccatcaacta ttaagaagta ctatctcttg atagaagaga acggatacag atttacgaga
    12661 agtcgcacag gaaaagtaat cttctcagag agagatttgg agatttttaa gcgactgatt
    12721 cagattaaaa acgaaaaagg aataaaagtt gtagacgctg ttaagacagt tatatcttct
    12781 ataactgatg taactgtgtg gaaagagtcg gctgtcgcca ctgaatttga agaaccaccg
    12841 gtggatataa cagttatgaa agaaacaatg gaacaaatgc atgaaattat aaaaaaccaa
    12901 cagaaacaaa tagaccagct gttagaaagc caaaatcaaa ctcaaaagct tttagaaagt
    12961 ggctctacag atagagacaa gttattactg cagtcaatta gagaaaccca ggaattaaaa
    13021 caattgatct tagaaaacaa caagaagaaa aaatggtggc agttcggtaa ataaagatag
    13081 ccataacaat tacaactact gctgtaactg ttatggctga cgttgtgact gtcataactg
    13141 ttgtacctaa aaaataatag tttctgcggt aatttcgtca ggtacctcaa taaaatcata
    13201 ttggccagat tcatttcttt cacagtcaac caatactaat tgaagagttc gtttattacc
    13261 ataaacgttc acagatgggg taccaacgaa atccatcgtg atttgcctgt cgaaattatt
    13321 tttaagactc tcatataatc cttcgggtgc tccgtacata acaaactcaa caccattttc
    13381 ataaaaggtt aacatggaac ctttttgacg gataaagttc ttattaattt taattccgac
    13441 aaaggctagt aggggttctt gaactttccc accaaataag tgtttattat cagtaacatc
    13501 ttcaattaga gaccgatcaa cgttttcctt tactatgagg tcaacctcat aaacaaactc
    13561 attctgctca acttcatgtg ttcttttttt gaactcctca aagttatctt cagggataga
    13621 gataccaaaa gcattggcat gtccttgagc aaactcaact aagccagttt cattgcacca
    13681 gtctttaaga gaagacaaaa ctttttcatc tccacgtccc gatccaatat atttcttatc
    13741 tttataatag agcactaaag ccggcttctg atattttttc gcaactttat tagcgactaa
    13801 accggtaatc gcagcttcat cggaagaatc aagtaaagca attgaaattc caccttcatt
    13861 gtatgtactg cttctaagtt tttctaaaga ctttttaatc attgagttct gacggccctt
    13921 aacttttttc atcatatcaa aggcatattc atatagatct tgctcaacta atatcttatt
    13981 gaatttaccg gtctttttat ttttcttccg tttctctaca ttccaaactc gtccatcacc
    14041 gatcttattt aaggctctga acaggaggtc tttttcatct tcagtcccaa cacgaacaac
    14101 agcattaatc attggaatga tagagaaaga gagatctttt ggtgcaatgc cttctaggct
    14161 tccgaaaaca tccattacag caactttaac cagaggatta ttgattgtct caagaccacg
    14221 gaagactaga tttctgacct cattttcact tatatctgaa gtatctccaa tttgaccgat
    14281 agcaactaag tcgagtagat catctgcata atgagtatct aaaatcctat ctaaggcctg
    14341 gcaaaactta taggccatac ctgcaccaac taaattctta ttagtgcttt tattctcgtc
    14401 taattggtta ttaattaaaa ttccgtgcgt cggcatctta tctacttcat ggtgatctag
    14461 gacgataatg tcaattccca tgtaataaag cctttgaagt tcatcaacat cattagacgc
    14521 tgcatcagga ataataatta aatctattga tgagtcagca atcttttgag aaatttcatc
    14581 ggttaatcca tgagcttttc gatcatgaag aaaatatgaa acatgcgaat ctggttcgat
    14641 tttttttata tattgataga ttattgatgc agacgagaat ccatcagcgt cagcatcaac
    14701 taaaataccg atgtggtcgt ttataagcaa atgagcaaga agtacattcg cgcctagttc
    14761 aatattatga agatcaaaag gattaagatc ctcgctgctg ttaggattaa ggaatgtatc
    14821 aatatcctta atatttctat tcttcaatat ggtgtctatg atgtctccat tgtaagaact
    14881 gatttgttta atcttcattg gattcaccaa caattttatt agtgattctc aggaattgag
    14941 ggtggatgcc ttctagctct aacatatctt tgattgcata attcattctt ttgatttgtt
    15001 cttccttttc ttcagctgat aatttattta catattcaat ttcctcactg tttaaagggc
    15061 gatcgatctc tatttttata acacttctca taaatttttc ctcctagtag ttgaatcttc
    15121 gttattatat ctggggtttt taaaacgtaa atcaagctac taggattcgg ttatggaata
    15181 atttcatgaa agtttctggg cctttatctg aagggctgtc ttttaaatcg agaagacctt
    15241 caacatccca catcacactt gtttcgaacc tggaactaag cttattaata aaaacactat
    15301 tgattttctc tatgtagtat ttttcttcga tactcccgac ttctgtgaat tctttatcta
    15361 gtgcaattat gactcgttcg atgcctaagt catttattat ttctaactga gtatcagtga
    15421 gagttgaccc acttaaagct acagcaatag acatatcagg aaacatagta tctatctgca
    15481 tgactgactt ttcagattca cacaagatga ttgctccgta atctgttatt tgttctaggt
    15541 taaaatttaa tccataaagg caggcgccgg tggggtgctt taaaaaacga tttttgtaaa
    15601 acacgggcat atattttttt ccggagttca ctaattcctg atttaagttc cgggctcgga
    15661 ccccaacaag atttccttta agatcatagt gaggtatgat tatttggtta tctaaaactg
    15721 agtacttaat attaaacttc ttcattgtct ttggagaaat gttgtcttct atccaagact
    15781 tatgatagta gtcataataa gaatcaagga ttttcttatc taacaactta atttctgctg
    15841 ccatatcttt tggctcaaac ttttcaaaaa aagacatatc cactttatca gagccatatt
    15901 ttgaatttcc gtatgataat ccaaatctct gacaaacaaa tttaaatgac tcaaaaaaag
    15961 ttaacccttt tattttccct attaatccgt acaggtccat gtggccgcat tccgtaaagc
    16021 aataaaatga atgagagtta gaatagtagg taagcttatg actatgaccg ttatgacaga
    16081 tcgttttgca tataatattt gaacctttta attttggttg ggctcctaac tcttgaagta
    16141 aggtgaatat gtcattttca ctcaaggatt gttttacttc gttggcatcc aaaccaattc
    16201 acctcttaac cctgtttaag ttattttatc tgactaaata aaaacgtaaa aaagagaaga
    16261 attatcttct cttaaaaaac gggcacttct tcagccgaat cttcagttgc ttcgatagca
    16321 tattcaatat ccattgggtg aacatctagc aaattaaaat cgtagtctgt aacgaataat
    16381 ggctcttctc tcatagttcc taaattcatg taagtccaga taattacgtt actgtacttt
    16441 cccccacgat ttttataaac ccaatgagag tagtttggtt ttttgttagt aaaaccggtt
    16501 tgcaaaatgt gctttagatt atgatgatct gaagctcctg ccctaaatgt aagtatgcca
    16561 aagtcaactt tatctgctgt ggcttgtcca ccacgaaggg ctgaagggtc tctattttca
    16621 atatccttag aacctctatt taactgagtc gaagaagcaa taaaaatatc gtacttctca
    16681 gcaagaatct ttaatgatga tgaaaactga tgaagaatct ggtcttcccg aagatgattc
    16741 ccaaacgcac ttgccattgt tctggagagt ttcggggtca tttgaatata gtcgaaggca
    16801 cactcttgaa tattgttttc aataatatgt cgttcaataa ttgtttcaat atctgaaatt
    16861 gagaagtcat ttacatattc gcagaagata ggagccctct ttaaaatttc gattgctttt
    16921 ttgagccttc ttaaaactac ttcagaatac ttaccatctt taattacgtc ttcatcgact
    16981 ccagaaatga aagcaagcat aattgtttga acttctcttt ttacaagctc cgttgatatg
    17041 aatagggtag ggattgatgg accattgctt acatatttgt tttggtcaat atcaaaaatt
    17101 tcgtcacacg aagcattaca catatcagct aatgcttgac gagttttccc cgtccccgta
    17161 ccagctgaac gcagcataag ctttgttttc cgttttccac gaaatattgt gttatagaac
    17221 ttgttcgtga atgggtttcc gtactcagga tcttcgtcta actcatccag aagagtatcc
    17281 aagtcatcac cagccataaa gctttttgtc tcttggccga tattaaattc atctttaatc
    17341 ttagtcaact taattgtgta atggtcgatt atttcattaa cagtcatgct gtctattttt
    17401 ttcattccat cattccgaac ctttaagtca gtagacttcc aatcataaag atctgtcaca
    17461 tcaattccat ttaatacgta gtgtcttaat aaagaaatct ttttcagtcg atcatagctg
    17521 cttttaaagg tattttcatt tgcatgagct attgattttc ttatataaga taaaccatca
    17581 tttttttccc agatcttata gtgctgagga aaagaagcta ggtaattatc gaggtcaatt
    17641 tcatcaatct tagtgacttc ataatttgag taagcgatat tatatattga agaaaacaca
    17701 atttgatgaa attcatgagc aaagtctttt tctgtaatga taatctccga atctcttaaa
    17761 agatgagggt ttttacaaag tgagcctata acagaataga ctgcacgagt agggtttaaa
    17821 gctttcatta cattatcagt agtagctgag ttaacttctg tcatttcaat aaatcctcca
    17881 tgtttattaa tttcttgtct ctatatctgt tttgagacag ggagggtggc tttatttgaa
    17941 ccttttgggt ttctattttt ttaaccacca tattctctct tcttcttttg agatccttat
    18001 agtagtcaat catttcatca taatagtggg ggataagagc caaaccatac tttaattcca
    18061 attgtatttt tttgattctt actatgtaat caagagcgaa acctatattc ttgtaagtgt
    18121 atcctcgttc ctctttaaac tgtttgatct gcctaagcat taaacctgta ggaaaagaga
    18181 taccaaagac ttctttacac ttgttataaa ggttttctcg atcttcgacc tctttaactt
    18241 ttttcttata acatgcaggg cagtagtttt tgcttttgaa tttttgcata atagattggg
    18301 gatgtttttg ttcacatgtt ccgtagcatt taactaatct gctgctcatt ttcaaatgct
    18361 cctttatttt ttgttattat atctggatca cctgaaacgt aaatttttga aattaaaaaa
    18421 gacgaccaat atatggccgc taaatttgtt tatacctggt tttaatcttt tcaccgacac
    18481 gtgatgataa tgtttcagca aatgaattga gtttgtctat aatttcatat aattctgttt
    18541 tggaaagttt aatacgttta tacttattta tttctattgt tgaattctca tcactcatta
    18601 cttcaattga atctgcgttt ggcaagctat aatttaatga atccctgtct aaattccaat
    18661 tatgatgttg aatacaattc ctaatgatta catgctttat tatttcgtgc cttaactctt
    18721 tatcttgttt actcatttca taatctaaag gttttgttag tctggataat ttatctgtaa
    18781 aaccagttcg tctataatca tcatagacat cactaataat gttagcgatt gttagccaat
    18841 catctccatc cattttattc agatctaatt taacattttt ctttgataac ttcagtttgc
    18901 ttttattacc gttctctaat acttcaatta acagttgtaa gtagcagttg tccataaagt
    18961 cattcaaaag ttgaattaac atacattgat tgtatccgag tattttttct tcaatttctt
    19021 cttttatttt ttggtttgag atttcatcaa ttgcttttaa ttctttttca atattatctt
    19081 tgtaagagaa gagatctttc ttgaaagaat ccacctcgtg ttgaattatg ttgcgtcctt
    19141 cgttattcac aggctcattt tcgtcatcag gtatagataa attttgttta gaggcattct
    19201 gctttagtaa ttccccaaat ggaaggaata atcttgaagc gagaaatgac gtgccattat
    19261 tctgttgttt cacatgataa acccaatgtc cataactgtt agctttatgt aacacaaaag
    19321 gaggtagcca tatctgcccg atttccccgt caccctccca accttctttt ttaaataatt
    19381 gctttaattc atctaaaagt gctttattac tgtcgggttc taaaagctcg atattgtcta
    19441 agtaatctat atgttcatat ttaaaaacaa accatttttt tggtgattcc ataagtgttt
    19501 tcccctcttt aattttcact atccttaaca tataaaacca ttttttctcg gttctggttc
    19561 atttaattat aaaataagta ttttataatt aaaaaccccg acatcggaat aatgtcgaga
    19621 tttttgtcat aaccatatag catacataca ctgctatgat tctcataaga tggggttggt
    19681 agaatcatag caagagattg ctattttctt aggttaaatc ggtcgattaa agttgaatta
    19741 tgactgtttc acttcataat tgtgataaac ccaaacaggg ttggttccta acaaagccag
    19801 tttaaacttg cttaatatct ttgtggcttc ctcggtaaga ctaattgtat ctccgtcttc
    19861 attacttgaa gcgaacataa tattcccaca gatcactaca tcccaatcgg tgatagatgg
    19921 atttggggtg ttttttataa taagggatgg cattaggggc tcttccttta aaagaaatcc
    19981 atcgtcgtac cacacgtcta actcctcaat gcttgtcaaa gcaagagttc cttggatttc
    20041 tttctttaga agatcataag tgctgccaac gccctcctta aaattaatca attctcctgg
    20101 ctttaaagtt gcgtagttga gcatttgtgt ctctctcctt aaagttattt atctcttaca
    20161 tttaaattat acaatatctg gaatataacg tacatatgtt cgtatttaaa aagccaaact
    20221 ttttaggttt ggctcgtttc aatgctttta gataaatatt tgaggagatc atatagttca
    20281 tttggagtta gatcaattcc tcgtacctca ccggtgatcc caagatcatt agtaattcca
    20341 aggtgatcta gaacattaaa cactaactcc gagcaaatta aattgttggg attgttgaat
    20401 aaaatctttc ctttgaggtg gaataggttt ttaatgatat aaccaaaaat ttgtgcatag
    20461 tcatatttct tgcctatata cgctttgcta atctcaacaa ctttttcctg ttgttctgaa
    20521 ctcaatccta aatcaagaat ctcataatat gagtattctt tgagattgaa ctttttaact
    20581 cttgaaacaa tgtttatatc ggcttctaga atttctgtat cagatatagc aatggccaca
    20641 tgactaaact ttcctcgatg atcaaataac ctaatcagtt tagaaatgat accttttctt
    20701 cttacaaaaa taatacttcc tctagtcatt ttttaaacac aattcttaag aagtatagtg
    20761 caataaagat aaagtaaaga ccccagaaat caatgttgta atggaaaatt cgtgatatgc
    20821 taaacttaat caatatgcta ggaatggcta aataaaaaaa taaaagataa ataataaaca
    20881 taaatatctc tcccttctga aatctttgtt attttatctg ggtaaacaaa aacgtaaatc
    20941 ataattcaat aaaaaattaa ataaaaaagg agccgttaac gactccaata tttaatgctg
    21001 cctattaatt tattcaattc taacttagtt agtttctcag cattgaatct ctgttcaaat
    21061 ttaaaagcag ctatgacatc agcgccacaa tccaaacaaa ttttctttat tccctcaact
    21121 gccccacaga atttaggata aactgaatta ccactcccaa atataaaaat ttctcttcca
    21181 tgcagctgta aatggttttc aataagatat tctttgagtc tcttaggtat ttttccgtta
    21241 ccccaagtat atgccccaat agccaaacta ttacaactag ggaaaggatt gttaaagtct
    21301 tcaataacct gcagatccct tttagcatac tcttggataa acggaataaa ggttctagtg
    21361 ttacccgtat ttgaagcaag aataattggg agcgaaccca tctcataggt catcccaatc
    21421 attcttttgt tcattcgctt tgccatagtt tacttcttta tcctcaaaga aatctcgttt
    21481 tgtattattc aaattatcag gatcaaaagc tgttatccaa ggcataggat ttttctttgc
    21541 tgagaatatt tggtcgagtc ccaggttgtc taaaattaaa ttcgcccggt acccgatgta
    21601 ctcttttact tcttcaatat caatatcagg agtgttttta taaagatcct cacagaactc
    21661 tctttcaagt tgtacaagct cagtgaagaa atcatataca aactcagaaa actcttcagt
    21721 attaagttca ggatattgag ttagaatgtc acgtaccagg attgtttgga agtaagagtg
    21781 cttcatttca tcacgttgaa tatactgaat aacagttccg gtcccaaaca tttttccgtt
    21841 tctattaaaa tgatagaacg gtgtaaatcc atttacgaaa cataaacctt ctaggccact
    21901 cattgcaacc aatccttttg caaaagtctc cggagtagga ttttggatga actcatcaaa
    21961 cagatccatc attagcttgt ttcttctaat catgaattcg ttcttttttg gtcgttcaaa
    22021 tacatctaaa gagacagctt tcgagctaac cgaacttaga atatatgtgt aagattcgtt
    22081 atgaattgtt tccattgcag ctacaaaagc cataagggct ttaattgcag aatctctaat
    22141 ataatatgca gcaacattat caaaatatgt agcaatagaa tcgagtacag ccaaaattcc
    22201 gatagcattt aaaaacaact cttgttccat ttcgttcatt tcagtagccc actgtacttt
    22261 atccttactc atggatactt catccggaat ccagaatact tctctcattt ctttaataag
    22321 ttcgtagtag acttgattaa taatgtcatc ccagaagaga ataccactta catcatcgaa
    22381 cattctctcg cctttgttag gtaaattctc gttaaaaact ctcacttgtt tcgtcaattg
    22441 ttccatataa gcgttcctcc gtattcataa aaatctctta atatttatat ctggagtatt
    22501 aaaaacgtaa atcaaaaaag ggagctttcg cccccacttc tttaatatat taagctgaac
    22561 atgccaggca tgaactttca tgtttttgat cccaagatcg agtgtagtaa gaagttttca
    22621 caccggcttt ccagttttcc atatgaagct tatagaaatt cttagcctta atgtcctgag
    22681 gaatatagaa gttatgagaa atagcttggt ctacaaactt ttgacgagca gcgttgtgtt
    22741 taatagccca aaggtgagct aattgttttt cattttcgta ttccattttc atagttggtt
    22801 tgtagaagaa ccatgttttt tgatttaatt ccggaaccaa aataggaagg tggaagtctt
    22861 tttttcgttc aaagtagata acatcaaaga ttgggtcgat tcctggagtt gatccagcaa
    22921 taactgatgt tccaccagtc ggggcaatag ctcttaggta tccatttctc atgtacttag
    22981 aagccaattc tttaacttcc aaccactcgg gagagtttaa atcacgttct tcaaaccatt
    23041 ctccagtttg ccatttcgaa ccttcaaaaa caggatagct acctttttct tttcctaata
    23101 aagctgaagc tttaatgcaa ttcaacatga ttttttcttc aagtttggag atatattcaa
    23161 tagcctgttc tgaatcccac atgattcctt cttgagctaa taaagcagca ataccttgtt
    23221 ctcctgcccc aacagcacga tacttcatat ttgtgtattg agcttgagga acagggacct
    23281 ttaagagaga aataacgtta tcaagggctc tcatttgaat tttgataact ctctctgtta
    23341 ctccatcttt ttctgttcta ttaacaacca aggaactgag gttgcatgtt actagatcac
    23401 caatttgttt atgaatgatt acttctcctg tttcccaatt aatcgtctct tgagttacaa
    23461 acgaaggtga catattttga gcgatttcag aacacaagtt agaagaatag atcattcctg
    23521 aatgagagtt tggattatta cggttaaccg tgtcacgata aaacatatat ggaattccag
    23581 tttctaattg agccttcatg tatctctttt tcaattcaat tgctggtaca cgtctcttat
    23641 ctaaattgtt attatcaacg cataagtaat agtggtaagt ccaagcatga tcaattggat
    23701 ttggtgtttc tttttcacca agttttttct tatcgtagaa gtcttcaaga ctgaatccca
    23761 tcttttgttt gatctcatga ggatcaaaaa gatagaagtc accacgtttt tcaacttgtc
    23821 tcataaattc atccggaata cagagaccag tgaaaacgtt gtaagctcgt tttgatttat
    23881 caccagtatt gagacgaaga tctatgaagt cttcaatatc tttgtgccat atatctagat
    23941 acacagcaac ggctccaggt ctttgtccta actgatcaac ggaaacggcc gtgttatcaa
    24001 gttgtttaat ccatcctagt attccactgg cagcgccttt atgtcctcga atatctgatc
    24061 cagttgctcg taattttcca aaataaatac caataccggc accattttta gagaacgtag
    24121 aaacatcagt gttatcatca aaaattccac gaagtgagtc ttcagttgtt agaacaaaac
    24181 aacttgataa accaccggta acacggccag cattcattaa agttggagta gcaagtgtaa
    24241 ggtaaaggtt agaaagcgcc cagtatagtt caattgcttt ctccactcgg tctttttcct
    24301 ctggcatcat caggtgaagg gcagcaatca taaatctttc ttgtggcaat tcataaactg
    24361 atttgtcaaa gtctttaaca caatagcgac cagatagtga atgaagccct gcaaaatcaa
    24421 ataattcatc acgttcggga acaattgaat ttccggcctt aactaattct tctcgcgtgt
    24481 aattagcaag aatatcggga gtatacaagc ctttttcggt gagagtcacg ataagaccat
    24541 agaaatcacc atacttctct tttgaatcat aagatctatt tttagaagct cttttatata
    24601 actcttggag ctttacataa cgggcaaatc tattccagtt agtgtttaca aggtaatcag
    24661 gcgacacgta tccagaatca ttcttaatgt catttgtaag aaccaaagca ttttgaatga
    24721 gaattttcgt aatatctttt gattcgattt cttctcttct ctcgattgtc cggaccactt
    24781 tagaaatgta actctctttt gtggttggat taacctcaat attttcgaat ccacgtttaa
    24841 taaatgaaat caatctttct ctatcaaatt ccattcgtcg ttcacgtttt ttattcttgt
    24901 ctttaattac aactgtcata acctatttcc tttcttgcag tagttgagtt aaagcaagag
    24961 aggacgacat aatcatcccc tcgcaattat taaagaattt ctttcatttt ttgaattgca
    25021 acgaataacg gctgaacttg ttctttggaa gcatcggtta acttattgcc ggctccaaat
    25081 acttcatcta caattctatt aacttcatcc atacgatttg ctttatggaa ctgaacacca
    25141 agctcacgag cttcttgcat cagagcatca taatccagct gttcttcttg taatccaact
    25201 gattcttttt cttctttcaa ttgagaagga tcaattagat taattgcatc agtaacggct
    25261 tttttatatg cttcagcatc caaaggaatt actggagcaa taccttcaaa tgttgaaccg
    25321 gcttgccatt gaagtgtttc tcgaagatgg attacacgat gttcattcat gtgttcatca
    25381 gttgtaactg tcatgaacaa gatgttatca accattttat tgattggagc catgacttta
    25441 tcttttagat ccggaacata cttttcaaat tgatagtatt gttctttggt ctttttatca
    25501 gttacaagag tcatagtgtc gtttacctgt tcttgaagga cccctgaaac aggaatctta
    25561 gttgtgactt gagttgcgtg agcaataaac acaggagtgt aaccgagtcg ttcaatttgc
    25621 tgaagatttt tcttccaatc atttttaaga tcaacccagt cttttcccca ttcaacctgg
    25681 ccgaactctg ttttgtcata ctttgaaagg atatatgttt caagcattgc gtaaaggttt
    25741 tctaccgtat caatgcaaac aacatcgtat cgttctttaa tttttttgtt ctgcaactga
    25801 gctaaaacct gaagatattc aatccagttt gaaacgtatt gaacattggc accaacaagc
    25861 actttatgcc gtttttctgt ggcgataaac aaaactcgat ctccatagag cttatgaaca
    25921 aaagatgttt taccgatttt aggaacacca taaataaatg aagtgtagga tgctaaatcc
    25981 gtacttgcct taatcggctc taaatttaat aagttaattg ccatagttga gttcctccga
    26041 tttgtttaat gtgattactt tttatttata tctggttctt ggaaaacgta aattaattaa
    26101 taaattttgc cggcgttttt ttaaattctt cctgtatttt tttctttatc aactcatatg
    26161 gataaggctc gtttattgaa acgtaccagg tatttttccc atcacttgct tggaaaaaat
    26221 cagagtgacc agcatcatgt aagatggtaa caatctcacc tatctcaaat tcatggccac
    26281 aaaattgtct gattataatt gctttatcac caactttata tggatttttc atctataaac
    26341 ctccgtcttc tttcaagtcc ttttgtattc tatttggata gtgaaaaacg taaattaaag
    26401 cacaaaaaag aaacaaggaa ttatccttgt ctcttgtcgt tttcttcatt aaacttttgc
    26461 tttaaccatt cagctgtaat taatgcctgg ggaacaacat atgaagagtt ttttctatat
    26521 ttcagaacca tgatcaacat aattaaagca agagcttcat ttaaggcttc agtaatcata
    26581 gtcccccatg taccgaactt gataaagatc ataatggcat taacgagcat aaagatcaaa
    26641 gcgacattta gagaaagcca gaataatacg ctcataccat ttacgtcttt tattacatac
    26701 gtttttctta tttgaggtag gtaacaaatt gtcaggaaca ccgttcctag tactggcagc
    26761 caattcaata gaaagtttat cattggggag ccacctcttt ttcaactgat ttttttaatt
    26821 catcagtttt cttttttaaa gcagctacta aatcatctac ggtagagaat attccaccat
    26881 ttgttttctt gatcaagcca ataacataaa gattacgata ttggaattgg ttttcggtaa
    26941 tatcatcaac taatgttaga acctttttag cattgtcatt tcctaactgc cgaacatcag
    27001 tatacaaacc aaggataggt cgtccagttg ttgagaaaac tccaatctct gcagcaacac
    27061 cagaatcaat ttctacccca tctaaaacgg caactaaaat atcacttgat aggaggtgtt
    27121 ctgtatcagc atcggcgatt tgtgtacttg ttgcacttgc ttttttatca ttaacaacaa
    27181 cattctcttg tgggagatat acctcaagtt cagggatttc ttctctgatt tttgctgcta
    27241 atgtatcgtt aaaatttcgg tctgcgattc caaataaacc gttagctaag tatagtttca
    27301 tttttatcaa cctcgtctca tatttgttca aagagaagcc aacgagaatt tcttctcatt
    27361 ggcctgatta aaatattaaa aatctggcat atcatctgta tttggagcat cactaaatgg
    27421 gttatcatct tgtggtggtt ccattccagt tggcagagat ccaggaggaa gatcatttcc
    27481 gttcgaacca aaaccacttg gtggtgtatc ttcagctggt tgagaaagct cctgaagctt
    27541 aagtttgcgg atttgaagag ctgtttcaat ttcttcttct gtataggctt tatcaccaaa
    27601 gtaaggaatt tctccaccaa ttacttcaat attatttaca tagtttgtta cctgacgagc
    27661 ttcagctttc tcagtagatc caaagccatg tgaaacttgg tttgattctt taacttcgtc
    27721 aacaacagca tagttattaa tcttgaaatt taattggcca gtagaaccta cagggtataa
    27781 atccataaat gcttcagcaa gttcggcacc aacaattgta tttttaagtt caataacttc
    27841 attcccccaa ccaacagtga agcctttaac tttatattct ccagttggaa ggtcattttt
    27901 aataacaggt tcaaatcctt gaacaaccgt atcaatagtt gcgattgctt tatctggtcg
    27961 atcatttgtt tcatctaaac ggttaaagaa gattccttta acttgattaa actgaacaag
    28021 gtttccctga gcattgtagt attcatttaa tgtaagttct ccattaactt caattcgatc
    28081 ggctgcatct gccccatcat cttcaatagt tttgtattca ttttttacag tttcaatgcc
    28141 tttaaagagt tttgatgatt ccatcataaa cactgaaatt ttgatttcct gaacatggtt
    28201 atcaaatttt gaaagaacaa ccaggttacc agacatatac ttattgcctt ttttacttgt
    28261 tttgacctct aaatctttcg atttaagggt gccgattact tgaacattat tttgaagttg
    28321 tcttaattct ttattttcca tgtgattttc ctccgatttg atagtagttg agttatttat
    28381 ttttataaga ctcccatgag ttacgagaaa atttccttca atagatcttc aatttctgat
    28441 gcttcagatt cctctgtaac ttcttcctga acttcatcaa gaattgattt aagttggtcc
    28501 ataagaataa gaaattctaa atcaccgata gcttgcatag cttcatcttg atccatacca
    28561 gcttggcgaa attgaagata agcgtagagt ttttcgattt catttaacat aagaatttcc
    28621 tccgatttat gagtgatttt tattacatat cttttatatc ttgggtttta gaaacgtaaa
    28681 tcaaaaaata aataatttat tacttatttt tttcaataat catcaaagtt ccattagctt
    28741 atatgttcaa tagagatgta attaaaccaa cttatgtttc tttatgtgga atcattgtat
    28801 ttatatcgtg agagttgaaa atgtaaatct aaatcggatc aaataaaaaa agtgtaggcg
    28861 ttaagcccac actttttgct gtttatcttt atctctcgac tttcacataa cacataccat
    28921 tttgaacttt gtcacattta acgatttttg gtactttacc tttgaagtaa agagtaactt
    28981 cttttttatt ggcatcgaat acaaagtcat aagcgtcttg atattcaggt acatctctaa
    29041 tccatacata ctctgtaata gcgcttgcag gcaaagcaga aataaataaa ccagtggtaa
    29101 tgatacccat tccaacaact tttttcagtt ttgatttgaa cattttcaac actccccacc
    29161 tttttatttt cctgattaca aaacaggaca aggaaatttt accatgtatt tggtggggaa
    29221 aaatgtcgat ttctgtaaaa aagaacaaac tttttgtgaa ttttaagacc atttaatcag
    29281 cataaaatct gaattttata tctgaattta gctttaatcc tctgattttc cgtctaaata
    29341 tccaatacta taggataaaa agaagcaaat aaacgttata ataaatgaaa gcattgatct
    29401 tctccttcgt ttaccaagac ttcagcatga aatcctaatt tttcatcgta tttcaactct
    29461 acaaccgtta aatttggatt gaagttgtgg tattcctcta agaactgaat aatgccttct
    29521 gagatctgag ttgttccaag aaattgtctt ctgaaaggtc cataatgaac ctcagcaata
    29581 aaccctttgt gattgttata tgttagttct tttatttcaa catcttctgg agaaatggct
    29641 gcgtcatttg aaataaaaac acaaattcca tctacaattt cttgctcatt taatattaat
    29701 ctcataatca aaatctcctt ttgtaagtct tagatgattt gtaagcacgg atgatagcaa
    29761 tgacaatgat taaaataatg atcaaagcga tgacatcaac gatccaggca ataggtgaag
    29821 ctccatagga aacataacct ggtcctccga ctggatgata ggtgtaaccc caggggtgca
    29881 tcatgcttgt catgaacatt cccatcgtaa aaccgttata atatccaaac caacctgaag
    29941 gagaaaatcc tgcattgtag taatgattaa cagaaacggt tctgccacca acataagctt
    30001 ttgtggttct tccactatag gtttttcctt ttacctttga tgtggcgcct gagaacgatc
    30061 ccgatgattt tttagcagtc ttcttcttag atagtgttga cttcgtttta cttgaagatt
    30121 tttttgttaa agaaattgat tttgactttg atttatacga ctttgtagat tttttaaatg
    30181 atccaccaaa gaatgattta aagctagaac taaagctaga tttccttgag cttgatccag
    30241 agcttgagtt agaactagaa cttgtgctgg aacttggttt agaataactc gatttgtaac
    30301 tcccactata tgatgatcca gaactccgac taccactact gaagcttgat ttagatgaag
    30361 aaaatgatga agaaacccgt gaacttccac cactaaaacc ggctgcttct gatattgtag
    30421 atggcaacag taaacctaag gcaacgaatg ctgccactaa ggatttaata tatttaagtt
    30481 tcatttgtat tcctccaagt aattaggccg cctaagcgac ctattattct gattttgaat
    30541 cgtcaacgat aaacgtaaaa ttcttaacaa ccggtgatct taacatcgct gcatcctcat
    30601 ccatcgcttc actcatgctt ttcacaactc taattctttc attttcgaat tccggataag
    30661 atgtgagaat aatatctcca atctctggtt ccacaggatt ttcaactgtt aagtactttg
    30721 taggaacttt tttagataaa gcccggtaca aagcaatcgc tttaccaata tgctcattaa
    30781 aggtatctct cggatcacat ttagcaatac cttttgcgta aattcttcct gacctgtaac
    30841 cttttaatag aactgttacg acacgttttt ttctattaat gtggtattca ggaacagtgg
    30901 cataagatcc aacttcatat ccatcgcaca tagtggaatc ttttaagttt tcaaggtctg
    30961 acttagcatc ttcaataact ttctttctag cagtaataac tctaggtgac ttattagctc
    31021 tcttagtaag ttcttctgct gctttagaaa taaattcgtt taattcagta gtagttaagt
    31081 ttttgaaatt taccttctgc ataatattag tgttcctccg attttttgat ttgattttca
    31141 atttcggctt tgatctttgg ttcaggtggt tgccaacctt ccggtttaag tatctttcca
    31201 ctattgccta agtcatatct cggtttacca tccggaaata acttggccat gtttgcgtct
    31261 tgaacaatat caaagagtgg ttgtggttta actccagcaa cgacaaatga tccttgaaca
    31321 aaataattaa catcagttaa tgcatccatt tgatcaacaa gaatatcctc aaccggacct
    31381 ttcttaatca ctttagattc tgcagcagta attccccgga ttaactctgt taccaaccca
    31441 taaaattttg ttttgtttcc acctgctgtt gcatataaga attcaactaa ctcttcagcc
    31501 gtccagatgg ttctggccaa agcaacatct tcaggaatag gtgttggttt ttctgagatt
    31561 gggtgatgga atgctcggtg aaactcttca acttgagatt tggtatagtc taaacctttt
    31621 tcttctttca tgatcattct cctcaatgta ctaaatgttc tttctttaat gtaaaggggt
    31681 tttgatctat ttcattgctg actatttcag ccagatcaac aatcgttaaa ccaaggtctt
    31741 taaggtcttc ttcacttaat tcatttactg attcatataa gagccaggtc ttatcatttt
    31801 tagttcgagt cgatagattc tcacgaaaac tcttaacctt cctggttaaa gtttcgtaac
    31861 ctggtgtgct cacttatcat cacctcacgg taatttttgt tattatatct gtgcctttga
    31921 aaacgtaaat tgattttcag cttttttggc catttctttt aatatttttg tttcaaagga
    31981 ctgtatcgac gttttatcaa gacctctgtt tgtaaataga acttttatgt ctccttcgat
    32041 ccaatataat tctccattaa ccatatcatc attaaagaaa tggacctcta ggtattcagc
    32101 tggtctaccg taacacttaa tttgttcttg cttttctttc tgatctttag aatccatatg
    32161 tctgtgattt ttaatttgaa gtggaataga aatgttggag tcttttaaat gaagaaccgt
    32221 tccatcaatt ttcgaattac gatcttcttt tgatgaggga atttcaaacc aaaacattag
    32281 gcagctgttg acgaggtttc taacgacaat ctcttgaaaa atcggccgtc ctattctttg
    32341 aaagaaatac ttgatgtaat tcctttctac ttctccccta tctccatagt gctttgttgc
    32401 gttattgaga aatcgggtaa tctctcctgg atagtaatgt ttccaaataa aatttaggat
    32461 ttcaattggt ttaataaatg ggtctctttc aatgagttta aatgtaacgt acttggccaa
    32521 ataaaaatca atgtgtcctt tgccatcttt gccttttata acagcatcat gacattctgc
    32581 ttcaagtcca tacttaaaca tacattcagt ctcctgttct caatattttc tgattcaaac
    32641 gaaaaataca gagatcctta gacctctgtt tcttcagcat cgtatttatc tccaactgca
    32701 gcgaccttct taacaatacg atcgatggtt cgagatattt tcatttgata tgtgttaaaa
    32761 ttcgcagcga tttcttcttg agttaatcca ttttgggttt gtcttaagac ttctttttcg
    32821 aagtcagtga gttcagcttt ttcgattgtc gattttaaat ctaataagat gaagctgaaa
    32881 tcatcatttg gatcaaaata tggttttaag aataataacc ctttagctga gatggttttt
    32941 cctgattctg tttcgactac atcacctttt aagtgaagag gatttgtgaa gtcaaataca
    33001 tcaatatcgt attctgtact ctgggagaag tatttaaggt tataaccgaa cacgcctaat
    33061 aatgtatctt tagaataaat catatcgtgc tgcagctgac ctttaatgcg agataaaatg
    33121 aaccggttcc cttctttatt cttcagtttt tgtgttacga aatcatagaa tggcttataa
    33181 cttcttaaaa tttcccccaa ccaatcatct ctttcgagat ctgaagctgt aatcgattga
    33241 ggtctaagca gaattttgtt tctttcttct tttttcaaga agtgaataac attctcggaa
    33301 aaatcattgc tatctgagtt cgtcaatgat tctatagatt gttctttctc aactttcttt
    33361 tgaaagtacc gttcatctga ataaaaaatg tactccgttt tctcttgttc ttcttctttc
    33421 ttaatttcat cactagttaa taaatatgtg gccatacgat ctagtgattt gcaaacattg
    33481 ttttgatggg ataaaaagtc tttggttgta atccctgttt taaaataacc atcaaaatac
    33541 tcggaataga aattagtctc atttaggatc tcttccacaa ctttttttcg ttcctctaat
    33601 gttgtttttt caaaatcaat ttttttgtta atttcatgaa ctgtcgttcc atctaatctc
    33661 cctttaaagt ttctctgtga tgtaaaactc atttatttgt tcctccgtaa atttgttcta
    33721 tttattttga attaatttaa tgttcgaagt tatataacga ttatatccgt aattttccat
    33781 atgtaaatta atggaaggcg gaatttataa gtctgcgaat cttacacaat gacattatgt
    33841 aaagtattaa atcccttcat atcaatgttt ataagagatg ccgacttttc attgtttttg
    33901 aatcttacat aacatataat tatcttataa tatgtcatat tggttagaag gtgatcattt
    33961 tgaatatggt tagtcccatt agagacaaaa aacaactgga attactaaaa atgtatttga
    34021 gagaaaagag caaaagagat tacttaatgt tcatggttgg aataagttct gccctcagaa
    34081 ttagtgatat tcttaaattg aaggttggag atatttggga tggaagaaag ccgaaagaat
    34141 tcatttatct tcatgaagaa aagacaggaa agtataaaag atttccgatc actgagaacc
    34201 tccaaaaagc aattagagaa tatatgaaag aatatcagct tgaccaggaa tcctatttgt
    34261 ttttcagcag aaaaggaaat aaacccatct cccgtcaaca agctgcccat atattatctt
    34321 cagctgcaga ttacattgga attaaagaac cggtatcaac tcatagcatg agaaagacat
    34381 ggggatattg ggcgtataaa aaaggatact ctttggcttt aataatggaa gctttgaatc
    34441 attcaagtat tgcaattaca aagaaatact taggtattac acaggaagat cttgatgatg
    34501 tatatatgag tatgaattta taatatataa tagaagaaac tcggaattat gaggtgaatt
    34561 atggagatta agagaataac aagaaaaaaa ttcgaaagct ttcctaaatt taaaggtgtt
    34621 gaagaagcaa taaagttttt caaagaaaag tatggggacc attttataga acaagcatgc
    34681 ggtccattgg aagaaataga gctcggaagg tactacccac atatgttaat cattgataag
    34741 gaagttcata aaaggttgag tgaatggatg aataaacaaa aatatccaac ttatccaggt
    34801 gataatcctg atacaaaagg gtttggtgaa agctttcaga cgattattat ttttgaagat
    34861 ggaagggttc aagtatctaa tttagctgag gaataaaaaa tcaaaaaagc agacataaac
    34921 tgtctgcttt taatcactcc aaatgtttat ctaggagttc tgaaaacttt ataatcatag
    34981 cctatttgtt tgctatactt gctatcttta tatacgtaca tgtctacgat tgtatatcta
    35041 tattttttat cgtaggctaa gtattgtgtt gttgaataat atcgtgttgg ttttttgtga
    35101 tagaatgttc caaacacagc ttgggcgaat aaaccagccc aggagtattt aagaccaggt
    35161 aaccctgttt tggaggttga aaatatgaat tttgatgaca aaaagagcat attaaagacc
    35221 gtgggaaatg tatttatggt tcttgttctt atctctttat ttgtttacgc gttttcttct
    35281 aaatcaattg gatggtatgt taagattact tctattgtga tgttgaccat atcatatatc
    35341 tgttatgctc taatttctct acaagagaag tggtttattg caactttagt ggtctcttgg
    35401 ttggtcatta ttttttgggt gttttaaatc aaagattata caataaaaaa atgatccgga
    35461 ttaaccggac catcaatact ttcgactgcc gttatattct ctcccaacaa tggctatagc
    35521 gaggtagaaa gtgaaatggc agcctttatt attattccct tcactttaag attttaactt
    35581 gaatatctct aacaccaaat tcaatgcact tgtcattagc atttaaatag acatctattt
    35641 tgtttccttt aatagctgat ccagtatctt cggccgtata tacaccatta aggtgttcat
    35701 atccttcagg aaatttaatt tcaactttag atcctaacgg aattacactt ggatcaactg
    35761 caatcgtacg accttcttga actttcgttc ctgtcgccgt aacagttccc attgaatatg
    35821 ctgttgaagt aaaatgttta tatccctcat aaacccctga tttatgtttt tcaactccaa
    35881 ctttcgtgtt tatttcttgt cccggaaaaa tcaaagaaag atttttgatt tgtgggttag
    35941 cttctgccaa ttcttgcaga gacatattat tttccctcgc aatttttgac attgtgtccc
    36001 caggtttcac ttcttgagca aacgtgggag aagcaattag catcgatact actaatgtcg
    36061 atacggcaat tagttttttc ataggttctt gccctcctgt ttttatttgg ttcattcttt
    36121 ttctttcaga accttttata cttatatcta tgaatatgaa ttcgtaaatc aaaacagtat
    36181 tacatttgga ttacaaagaa aaggcctgac acaaagccaa gcccataacg ttatgaataa
    36241 gacacttcat ctttatcatc tcgaattcta tttaatgaag gctgccgtaa agataaacct
    36301 ccatgttcat ttttactttc ttgaaagtat ttaatctcaa caatcttccc aaccaccaag
    36361 gatggatctt tccaaaaatc aactttccat ttctctttta atccagctac ggccactcga
    36421 tgtcctttgt aatcaacaat aattgatcca catttacctc cacgtatatc ttccacaaca
    36481 tctaaacaac gtaaatctgc ttcttcttct ggttttactt ttaaaatgct aggagacttt
    36541 ttcaattcaa atattccatc cgataaatga attattaatc cttcttcccc acggccaatt
    36601 gcttcaagaa acaagtcatc aataacatcc ttgtcatttc caacatagaa tttaggaaca
    36661 accgaaatta acgaatctgc cggcagagac ttcttgatcg tttcttctaa aaaagagcgt
    36721 ctagttttgt aaggaacatc aaaaacacct ttttcataat catcaattgg aatcatgtcg
    36781 aacaacaaaa atctaacgtc ttttttaatt ccgtgtttct tcaaacgact ttgagttgct
    36841 cggaataagt ccgatgagga aaggttatct ctattcacgt ttacgagttc tccttcataa
    36901 acaaatcctg tcggaagttt tttcattaac tcttcgagtt caattaatcc ttcgtatttg
    36961 gcaccggtgg ttgtaatgaa ttcgctgcct tcttccaagt tcttcgttgt tgatctgaag
    37021 ccatcgactt taagtgagac aatgaactct tctccttttg taaggtgttt ttcaggattg
    37081 tatttttgac ctttcataac cttgtgttta ctgataaacc ctttaccgta tactttattc
    37141 aaagtagttg aagagattcc aatcggcaaa tcttttgtta atatagattt ggccagttcc
    37201 cgttcttctt ctgttttaag ttgctttaaa aagatctgaa ttgattggat tatttgatca
    37261 gatccggtat tgtaaagaat tacgtaagcc atagcatcaa atatggtttc aagttgagta
    37321 taagtcggca aacaaacttc tttttcgatc ttcttttttg ctaaacccgt tttaacaagt
    37381 gggtcgtaaa caaacttgaa aatctccttt aaaccctcaa cattttcgta ttttcttagt
    37441 aattcttctt ttccttttcg gcttgattca tttttaatct ccttaaaaat ttcaacgtat
    37501 ttcttcatca tagtagttga gtcctccgat ttttctttat ttatttcgag taacgaaata
    37561 atattatcac ttcttttttg agtcgtacac attgattaca gaatattgca aaaataatag
    37621 ctagatattt gaatctagct ctatacacat gcagccattc tttttgccat cctttttctt
    37681 ttctcaatag cttcatggtt attattacga gatcgtttaa taacggttgt aagtatccag
    37741 cgatttcttt cttttacaaa gatgaattcc ttactatttc tagtaaagat atgcctcaca
    37801 ttaccgttat tcacgatctg ctttatattt aagtttctta catcacgctt aatcctactt
    37861 tcaatattct tacggcattc gcctactctt tgttcatatc gctgtattac gtgattagta
    37921 ataataaagt cttcaaacat cctatctccc tccgattaat gtatgtagta gttgagtgaa
    37981 agtggtgctg ctgaattggt tatctaacaa caccacttta gaaatgtctg ataattggta
    38041 tgattatatc tggctctatt aaaacgtaaa ccacattagc gaattaattt aatatgccaa
    38101 tgctaaagca ttgtctattc gaaattactt acgtaatttc tcatatgttt atttaattta
    38161 ttatttaata tattcattat taattaattg atatataaag accatagcta ttcgtaagca
    38221 tccatgaaga ttaagtttag aattcttacg accacatcta aacaactata cgttcttctc
    38281 cagtgttgat ttataagtta attcttattg gctcaaacac ttaaagcaca tgacaacgga
    38341 taacattact aatcaactgc aagtcaatga taaggatggt caatgacgat tgattagtct
    38401 atccatcgat cccagcgaag atgaagaatc ttcaccacca ttaattgctt aatggtattt
    38461 gcaacggcga gataaccttg gagttatttg ataaaggagt gaactctcag cttcaaatgt
    38521 ctccgtgatt attgagttgt gcaatatatt tatatctgag aatggtgaaa cgtaaattgg
    38581 tagggagaaa tcaaacaaga gtgaggaaaa ttcacacacg aaaaattcgg gtggagttga
    38641 aaatgattgc cgcctgctct gagagttgga tcgaggtttg aaaaagtagc cgcctaccct
    38701 ttcgggaaaa aaatcggtct cgacaggaat aactggagga ggtccgttca caccaaccat
    38761 cccaaaacgc ccaaattgtg ttgaaattta ggagaaggaa caagaatttt gtcattcttt
    38821 gttatagaat aatagttaga tggatataat aaacatatag agaaaataac ctagttgagg
    38881 gggaaaattt ttgtattata ggattggtac cattaagaca ataaaagaag gggaacacaa
    38941 agttgatatt aaaagagact tcactcaaga agaacaagaa aaatattttc agtacagaaa
    39001 gtaccttggg ctgcatataa ataataagaa tttatataat ttaattgtaa gaaatggaga
    39061 agaacttgaa cattttttag atacgattaa agataaagac tcgtcagaaa taggcagtcc
    39121 agattatgtt gtatttgaag cgaatagact atttatgaat tacttatcga tgattaggac
    39181 gtacattgat catattcctt cttcgttgtc taaaaccttt gattctaaag tcaaagatga
    39241 atttgataac tttttatcag ttatatatga taattatttt gaatatagat ttttatataa
    39301 attaaggaac ctggctcaac atttcgggat tccaatttct aatttaatca gcaatgaaca
    39361 cggcaaccat ataaccatga gtcaaagtta tttattaagt tataaaaaat ggggtactgt
    39421 taaagatgaa attaaagata tggaagaaag tataccggtt aaaggattag ctctcagaat
    39481 gaatgtaatc atgaatacgg tatacttgtt tgtaatgaag ttctatgttg agggtattat
    39541 tgaatcaata gaatggtttg attcattaca aggagaatta ggtggtagca ccattcttgc
    39601 agtttcagac tcagctgaag aatatggaaa aggaaaattt aattttcaac ctatgaatac
    39661 tgacgaattt attaatgcag tgcatgattt aaatgaaaac ccaggtataa atattaaatt
    39721 gataaaataa aaaccccatt ggactttcca aatggggttt tcctttatca tattaagttg
    39781 ctgctctatc tgcgacctta taagtggact gctcagaaag agcatatgaa gcgctagata
    39841 ctccaacaat gccaagcaag agcgctaaac aaattgcaat tttacatttt ttcatttaaa
    39901 tgtttccccc tttgaatttg tttgcgtgct tcaattgcca tttgataaaa atcgaccgca
    39961 tcatgtctgt cttctttgtt ggtcaaaaaa tcagcaacag caacagcgta ttcttccata
    40021 tcaccataaa ggtttttctc ttcgaagaac ttgaacactt ctctaagtgt ttgtaagtcg
    40081 aatgataaat aaaggccttt aaccagtttt aatttctcgg ttacttcctg gttgttgtgc
    40141 cgggcagcaa ccttctgacc ttcctgatat aattctaatg cagcctttaa atcattcttc
    40201 tttgctttga catatgccag attaaaaatc gcttttgact cataaatgtg ctttcgatcc
    40261 ttatgaattt cataggcgat ttgaaaatgt ttctcagcat tgtcaagttc ttcaaggtta
    40321 ttataacata atcccacggt aaaatgagct gaaccaatta aatgttgctc ccctatttct
    40381 agggcatctt ttaaagcttt ttcagctgtt tctaaagcgt cctcataaca cattttatct
    40441 agccagttcc cgaagataac aaactgacac tggaccattt cttttccata tgtaagatta
    40501 ccctgagcat ctttttgttc tttaaatata gagtatgctc gctgagcata attcatggag
    40561 aaatgagtct ctttcatata gtaatagacc tctgatactt taaaatagaa ctcggcctta
    40621 tctgtatttg catttgcatc taataaatca agatattttt cagcttcacg gtaatatgtt
    40681 agggcaataa ctaaatctct tgttctgaag tgatacatac cggtaaaaaa attataatag
    40741 aactctattg tattcgtaag ggattcagga gccatattct cccttgtctt tttaagatca
    40801 gaataaacac catctatatt tttaacagag tcaggttcaa gatacgacag cattatttca
    40861 tgccgcagct ttaatagctg aagatagact gctacttttt catttttctc catcatatcg
    40921 aattcttttt caacttttct tttcatttct tttgctttct caactcgacc ctgctttatg
    40981 acaacatacc aatgattaat gtctgtggtt acataatgat atgggattaa atccgaaaca
    41041 gacaatcaaa tacctccttt tctttacata tatttaatat tataccacca aaggctcata
    41101 cgaatagaat cattttttga aaaatccctc aattcagatg aatacaaagg tcagaataag
    41161 cataaataag gaccatatcg tctgatatgg tcttttaact ggctttagaa tttatggtaa
    41221 gttggtctaa aaggctccca atgtcgttta atgacttata aatgacatcc aaacagttaa
    41281 ttatatgaga atcaatctct cgctcttgaa catctccaaa tacaaacttc aattctttat
    41341 aagacttaga gtaccttaaa ttaaagagat ttccatcaat cacctgaaca atttcaactt
    41401 tcgggtccaa tatttgttca taaatagtct ccggatgaac cactccttca acattttcaa
    41461 tgtaatttaa gaaccccaga atcgtttcaa gtttagaata agcttcagtt ttcataactt
    41521 atcccctccg atttagtagt tgagtaactt acatttaaaa ttataaaacg caaacatagg
    41581 ttcgtacact ctatttaaga aattatttaa aaaaatcaat aaaaactgtt tagaattttc
    41641 gacttgtgta catttatatt agagacataa acagtattgt tcgagatatt gagcttcaaa
    41701 aaaggagatc aatatgaata aatgaaagat aatcgaacta aattaatctg ttctaaatgt
    41761 aattctccta ttattacata tcggaaaaag aaaaaagtca tttatgaatg ctcttattgt
    41821 ggtattcaac ctgatgattt aaactttgac gatctttctc caaacgattg ggaagatgat
    41881 tatgaagaag aaaatatgta ataattgcgg gatgattatt ggttcaaatg aaacttgctc
    41941 ttgcaagcaa aacagaaatc gaaatcaata ccaacgcaaa tattatcaaa agaataaaga
    42001 atacttaaaa cccctttcca ctgcacgttg gaaaaaatta agaagtctca tcatccacag
    42061 agacaaaggt tgctgccaac gatgcctaat caaatatagc atcgttaatt cttcagaatt
    42121 gcaagttcac cacataaaac ctcgaattga ttaccccgaa ttaatgtttg aagaaagcaa
    42181 tcttattacc ctttgtaaaa cgtgcaacct ccaattaggt acttccggtg aacttgattt
    42241 taaaccaaac attaatcttg aaaatcacaa ttatgacttc aaactttaag aggtgatgtg
    42301 atggctcgtc ctagaaagcc agcttccctc aaacaaggac attcagaatc aaaagctcaa
    42361 ttggaggaaa gagccgaagc agaacaagag ctacttggaa atgatgattt agtgaatgaa
    42421 attcctgaac atcttgatga attagctcaa gagtattaca aattcttaac cactgaacta
    42481 gagataagta atatcctctg caatttagat attcctctac tcgaacaaac tgctgattgt
    42541 ctaagtaaaa tgaggcaagc agatgaaatt attaataaag aaggacttat tttaaacaca
    42601 attgataggt atgggaatgc cttaataaaa gaacatcccg cagttgctac aaaacagaag
    42661 tatcttaatc agtttagagc tttatctacc cagcttggat tatctccagc atcaagggct
    42721 caacttgcgg gtttgaaaat tgaacaaaaa aacgaagaag aagatccgtt actcaaatta
    42781 ttaaaaagct aattataatc cctgctgttt tttactccga ttttcagtgg ggattttttc
    42841 tatgtgctcg tagctcaggt ggttagagca tcggtctgtt aaaccgagtg tcgtaggttc
    42901 gaatcctacc gagtacgcca tgagggttta gtttaatggt aaaacgtcag tctccaaaac
    42961 tgaaaatgtt ggttcgattc cttcaaccct tgccaataaa taaaatactg agggtgagtg
    43021 ataatatggt ttcttcgtat ttaaaagccc atcccgccta tcagtatgct agagatgttg
    43081 ttgaaggtaa attaactgcc ggcaagtacg ttaaaaaggc ttgctgcaaa ttcatttctg
    43141 acgttcacaa tcctgattgt gaatttttta tcgatgaaga tgaacttaag aaaattgatg
    43201 gcttaacaaa gcttataaat atggctacag gattgaaagc cggaacacca actcatgatg
    43261 ctttggctcc attccaatgg tttttcttag tcaatgcttt atgttggaag tataaacaaa
    43321 atccaattaa aagaagatat gaaaagtcag tactcctaat tggtcgtaaa tccggtaaat
    43381 cattcctcgt tgctttaatt tttatcctct tgctcttaat tgaaccagaa tactccgagt
    43441 tttattccgt tgccccagat aaagagcttt cttcgatagt caaaaaagaa gttgaacaaa
    43501 caattacagc ttctcaccct tctatccaaa aacagttcca aataacaaga agtgaagtac
    43561 ggtgtttact cacaaaatct aaattcattc ctttagctaa ctctgagaac cggatggatg
    43621 gaagaaaagc gaatgttttt gtagcagacg aagttggagc attaagaaac cgttacccta
    43681 ttgatgccat gcaatcttct caaatgaaca tggtaaaccg taccggaatt cttattagta
    43741 cagcctatga atcattaaac aatcctatga ctgaagaagt tgaatacgct caaaaagttc
    43801 tggatgattt aattgatgat cccactcttt tcgccctcct ttataaacct gatgatccta
    43861 aagattggct atctgacaaa tccctcattg aagcaaatcc acttgctgaa gttctcgaag
    43921 ataacttgga atatttaaaa aagcaacgta gaactgcttt agatatgcca agttcaaaaa
    43981 agaacttctt aacaaagcat atgaatattt tcgttgatgg tgacgactca gaggtttata
    44041 tcccttcaga tgaactaaag aagaatatga ttactacata tgattggaca ggtcgagaag
    44101 tgtttgttgg tgttgactta tctcaaacta ctgataatac agctgtttca atggttactt
    44161 atgatcatga taaagatgaa tacgttgctc agtcctgggc ttttattccg gaagatagtg
    44221 cggaaaataa gtccaaagtt gagaaggttg attactttac catgagagat aatggttatt
    44281 gctatttctg tggtgataaa gttatcagcc ataggttcgt tgaaaacttt gtcttggatc
    44341 tcgaaaagaa atatggagta atcattaaag gcatcggtta tgaccggtgg aactgcgttg
    44401 cttcggctaa ccgatggtac gaagaaggct atgacacgat cgaaattaag cagcattctt
    44461 ctgtcttgca ccctgctact aaacttgtaa aagaacgtgt tttgaaaggc agctttaagt
    44521 atctacaaaa cagactgctg gaaatcaact tttcaaatgc tcgtgaggtt aaggattcca
    44581 acctcaatac ttacgttaat aagaaaaaat ccacaggaaa agttgatatg gttatctcaa
    44641 tattaaacgc tatggcccta tggaataaag aagttgaaga aaatttaacc tccaactttg
    44701 aagaaaggga actaattatt ctctaagaaa ggaggataac caacctaaat ggggattttt
    44761 tcgagaaaaa ataagcagaa agaagaccgt tccatgcaat attcctacgg tggtggatat
    44821 tctattactt cttactttgg tgatggtggt ccaataacag aagaagaagc tatgagaatc
    44881 cccactgttg tttcggctct tgagcttatt acatcatcaa tagcatcact gccaatctac
    44941 ttatataaag aagatcgaaa aggtgcagta attaaaattc ctgataaccg tgtttctctt
    45001 ttaaatgatg aaccaaatga tttgataaac ggttataaca tgaaaaagag aatggttaag
    45061 gactatttac tgtatggagc tagctacatc aagatcgaaa aaattcggaa tgaggttact
    45121 aacttctatc ccttgcccat taaatatatt tcagtgacaa cttatagtca gggatataaa
    45181 aaatgggcga cgatcaatta tttttataat aacaaaactg gaacttatga atttactcca
    45241 gatgaattga ttattcttac aagagacagt gaagatggag ttacttcatc aggaatactc
    45301 cagaataata gtaagcttct cagacttgcc cttgatgaaa tcgaatactc aaatggaata
    45361 ttaaagaacg gagcccttcc tataggtgtc ttaaaagcta catcaagatt aagccaaaaa
    45421 gcaattgata acctgagatc ttcctgggaa aacctttata gtggtccaaa gaaagctggt
    45481 aagacaatta ttttggaaga aggattagat tacaatccaa tttcaatgaa accaagtgaa
    45541 atggatttaa ctaactccaa gaaaaataca gtctcagaga ttgctagagt cttcaatatt
    45601 ccagagtcta tgctaaattc ctcggctaat aagtatgctt caaacgaaca aaataacctc
    45661 tattttcttc aatactgtgt tggtccgatc atttctgcga ttgaatctgc tctaaataaa
    45721 tctctcctat tagaaacgga aaaagagcaa ggttattatt ttagatttga tgtttctgaa
    45781 ttgctcagaa caacagaaaa agaaaaaatc gatgccactg tttctgctgt aaaaggagga
    45841 ttaatctcgc ttaatgaagg ccgttcaaga attgacatgc ctgaaattaa agatgacttc
    45901 tttatgtggg gtttgggtca aattttctat aatcctaaaa ccggaaaaat gactattcca
    45961 aacatgggag aaacgattga tcctaacaat ccacaacctt ccgcacaaaa acagaatcac
    46021 tcccctactc catctaatct tgatccaaat aaacctccaa ttgaaaatga acaaacttct
    46081 gaagataaag atgattcaaa gataaaagat gagccagtag atcaatagat ttattggctt
    46141 ttattttttc aaggaggtgt aactaactta tgaaatttga gcttttatcc cgtaaggtcg
    46201 agcttcgagc caataacgat aatgattcaa tgactgtttc tggttacgtc aataaaacag
    46261 gagagttaag cgaagtactg ggttccggaa agaagtttgt tgagaaaatt gcaccgggtg
    46321 catttactcg agctctgtca cgaaaccccg acaatattga cttccttgct gaacataaca
    46381 gcaaacatat tctagcttct acacgaaacg gttcccttcg attatttgaa gacagcaccg
    46441 gtttatatat ggaagcaaca atctctccta ctacatgggg acatgattat taccaattga
    46501 tagacgataa aattcttcgg aatatgtcat ttggatttag aaccttagat gattcatggg
    46561 atgttcgcga tgatggcatt tacgaacgga ccattaatga tcttgaatta cttgaagttt
    46621 ccgttgtacg agacccggcc tactcacaat ctacaatctc agccagagga attgatgtaa
    46681 ttgaagacat tgaaattcca acggacttag aagaaggaga gcaaagaaat atggatgaaa
    46741 tcaaagagct ctttgaagga ttagaagaac gtttattaac ttctcttaaa gaatcaatca
    46801 atgaaattcg ttcagaacaa aaagagttca ttgaacaagc tacggctgaa ttaagagaaa
    46861 aagtgaacga acaagatcct gaaaaggctg ctgaaaattc aggcgaacaa acagaagtta
    46921 aagataatga ctctgaacaa gatgaacctg aaacaaaaga taagtctgaa aatgttgatg
    46981 aaacgaaacc agatgaaaaa gatcctaaag aagataaatt tgatgaagat cctgatgaag
    47041 agaaaaaacg ttcattagtc tctgaagaat tatcagaatt gcgaaacaaa ttaactggac
    47101 tatcaaatta atcaggaggt ttcttataaa tatgaatttg aaagcgctta aagaaaaacg
    47161 aaatgccctg ttagatgaag cagatgaact actaaaaaat gctgaaaaag aagttcgctc
    47221 attatcagca gacgaaaaat caaaatttga tgaattgact gctgatgtta ctgatttaaa
    47281 caaccaaatt tccgaattag aaagtcgcca gaaagatggc gagaaaaatg aaaaaacaat
    47341 ggaggaacgt aaagtggata ataaagaaaa agaactccgc ggtattgaac agtatctccg
    47401 tcgccaagat ggtgaagaag ttcgtgctct tcaaacaact tctcaaggtg gagccgtaat
    47461 ccctgagaat gttgaaggaa caattgtact taaaatggaa gaaacttcac cggtatttgc
    47521 tcgagcaact aaattcccat ctgtcgctgg aacattgaaa attgctaagg aatcccttaa
    47581 ctctgttgca ggatttgttg gtgaaggtga agatgtatcc gaacttcaaa tctcttttga
    47641 tgaagttaag cttgcacaaa aacgtgttgg tgcagcaatc agcctatcta atcagctgat
    47701 taatgatgca gctgttaaca ttgttgatta ctctcttaac cttctcggtc gtcgggtcgg
    47761 taaagcagtt gaaaaatcaa ttcttgtggg tgcaggtgga gaagaattct ctggtatcgt
    47821 taacgatgct gaagttcaaa aaatccctgt ctccggcgca gttactattg ataacttaat
    47881 ggacctctat aactctattc atcctgaatt cctagcttca tcttctttca ttatgcaacg
    47941 tggtttcttc aaccaaatcg ctaagatgaa agattctatg ggccattact acatgcaaaa
    48001 cggtgtcgtt aacggtaaat taacctatac ccttttcggt gccgaagtca ttgtaactga
    48061 tcaacttcct gatggaactc ctgcgatctt tggttctgtt caagatgctt atgcagtatt
    48121 ggttaagaaa ggattcgctc ttcaacacgt cacaggtgat acaacacaag ctatccgtgg
    48181 ttctcaatta cttgttctcg atggttacat ggatggtgca gtctacaacc cacaagctat
    48241 ctctgtgtta aaagttgata ctgcgactac ttctgcttaa tcatgtgaaa aacttcacaa
    48301 tataggtgat taggagctct tcggagcttc ttttcattta taaaatactg attttataca
    48361 taaccaaagg aggtaatcca tatgccaaaa gttaaattcc tacaatctgc ttatcttcct
    48421 tctcataaaa cagtctttaa ccataacgaa gttgttgaga ttgagaataa agatttggcc
    48481 aagagccttg taaagaatgg ccatgcagag gaagttaaag aaacgaaaaa aggcaaaaaa
    48541 gaacccaaag ttgtagaaaa acctgatgaa tcacaggtag ataacaatgt tgagtaatgt
    48601 aaaaatcact gagttagacc tcgactttgt aaagaattat ctcaaagtcg atcatgacgc
    48661 agatgatgct ttaatttcga tgatgattat ttctgcgcag aattatattc aaacttacct
    48721 caataaaaag tttgatgaat tcgatcccct tccagctgaa ttcactatcg cagcacttag
    48781 ccttatctcc caatggtatg aacatagaga aattcagact gcatcaattt catctaaaag
    48841 tgaactctca tatgtatttt ctggtcttct tgacgtttat agaaattgga atgatgaatc
    48901 atacgaggtt gatgcttaat gccttctaaa cgccccgata ttagtggatt aaataaaaga
    48961 ataacctttt taaaacaaac tcagggaaaa gattcttatg gggctccaac tatggtttac
    49021 aaggaagtta catcatgttg ggccagtgtt gaatcacaac agctgaaaga attcataact
    49081 acttacggga cagaacttca aaatattatc accttcttaa tccggtcaaa acaaagggtc
    49141 cctattacag acgatatgat gatctctttt caaggtcaaa aatacaaaat cgttgagatc
    49201 cagccagatc taaaaagttc aatgtatgac ttaatcgttg caaaggcggt gtcttaatgg
    49261 gactagatat tgatacgtca ggaattgaat tagctttgaa acaaatggct ggacgtgaaa
    49321 ccaaagttcg aaatcgagca ttaaaagcag ctgcgcatgt tgttgcagaa aaattagaag
    49381 acaatactcc agtttggccg gtagataagc acaaacactt gaaagacgat gtagtcattt
    49441 ccggtgttga tgcatttggc caaatcaaag ttggatatag caaagaaact gaatggagag
    49501 caaagttcgt tgaatttgga acaatgggtg gatcaagaat tgctccacaa ggttttattc
    49561 aacggactga agaagagtct cgttcagaag ccatgtcagt tatgacagac gagctcaaga
    49621 aaggattggg attgtgagtt tatcagtaaa aacagtatat gacttgctga tgaatgatca
    49681 agaacttgga aatctcatga acaaagatat gatattttca atcaacgttc ctgaagactt
    49741 tcaaaaagtc gaaaatgctc cgattatttg catcactcaa ataagtgatt tccaaagtag
    49801 atttgttagc aataaagcat tttcttctga aattagtgtt caaattacag tttgggctgc
    49861 agatctagca aaaatcgatc aatttaaaac tcgtttagac actttaatgg gtgaaaataa
    49921 ttggtcgcaa tacacaggaa tgttagacag agatccaacc attgatttgt ttatgttagc
    49981 aagacgttat cgaacaactg aaatattaaa cgatttgagc cttctcaaac atgagtaggc
    50041 ttattttttt taagggagga aatcattagt ggcaacatta ggttttgaag aagtccaaat
    50101 tgctattctt aatgatcaag aacaggtagt aaaagttcat aaaattaacg cccaagtcgg
    50161 tggtgctgtt gaagctaaaa tttcaggttt ggctccaacg actaatacag tctatgcttc
    50221 caacgttcca ttctatgttt ctgctgtcgg tgtttctaac cctaaattag aacttaatac
    50281 agctgattta acagaagaaa tgatcgcaga catctctgga gctaagacaa atgaaaatgg
    50341 aattacaact cttggtgctg atacagttgc cccttattgt gccgtaatta tgaaaacaaa
    50401 aggcctggcc aatgatgaca tttatattgc ccttgcaaaa ggtaaattcg gtcaccctga
    50461 tggattcgat cttaaaacag gtgaggacaa aggacaagaa gctgatacaa ccgatggtgc
    50521 tttgactggt gaatttgttg ctcgccattc tgacggtatt gtttatgcta aaggccgtac
    50581 aagcactcaa ggcttcactg tgtctgcatt tactcaatta ctcttccccg gctggaatgg
    50641 aacaacagct gaaggtcaaa cttcaactaa cacctcaaca acaaccccta ctgagacttc
    50701 tgatactact actgcctaat cacaaataag ctagatgcct tcggcatcta gttttttatt
    50761 tacataccaa ataaacaaag gagagaaatt ttcacgatgc taaaaattga attatataac
    50821 cctgaactag acaaagttga aacattcact gaaggatttg tctcagcccg agcattacgt
    50881 cgggtaatcg aattcggagt caagcaagaa acagaagtta tgaatgagct tgaacaatta
    50941 gacgaattgg ttgctcttgt cgcaagccta tttagaagtg aaaaagtcaa tttcgacact
    51001 atctatgatg gtattgcctc tgacaaaatc gccgaagttt tatctggaat cctccaagac
    51061 gtacttggtg gagaagctaa aaaaaagaag tcacagatgg aactagcgaa agtgacggaa
    51121 taaagtcata ccaagattac ctggataacc tcgatcagat ttacaaagat ttgatcgagg
    51181 ccggttggtc ttataaggat attgaagaaa tggacataaa tggcttcttg cgcttaatgg
    51241 gagacaaaaa gaagaaaaca aaaactgacg atattgaaga gttcttcaaa tcgatttaat
    51301 gaagtcatgg aggtggagcg atggcgacga ctggaacccc actaggaaat atggtcattc
    51361 aattatcaat ggatggaacc cagttttcta atactcttca aggtattaag agagaaatta
    51421 gagttgctca aacagcaatg aaagcgaacc ttgagattct ttcaaatgct ggtgatgaat
    51481 acgctctatt agagaataag attaaagatc ttactcaaat aatggatgcg aacaaacgta
    51541 aaattgatga gttacgtaga caacaccaga atgccattca aacttatggt gaaggttcaa
    51601 aacaagttca gctattagct tcacaaatca actccgcaat tacccgacaa gctgcctggg
    51661 aaagacagct aagaactacc gaaggtagac tcgaagatct caaatctggt acagcagatt
    51721 taagacaaga gattagtaac attactcggg ctactcaaga gaatgttgct tctttaaatg
    51781 caagtggtag agtctattcg gctcaacgtg ccagaatcga cggtttatcc caaacagtta
    51841 accgttacaa taatctaatt gaagcccaaa gacaaagaat caataatcta tcaaatactt
    51901 ttggtgagaa tgattcgagg gttgaagcag caaggcaaga actccaaagg tatactgaac
    51961 aacaacaacg ggctcaagaa cgtttagacc aattaagaaa cagatttgac cgtctctccc
    52021 cttctgttgg agaactttct gataacctcg gacaggtttc ttcaagaatg agagaagttt
    52081 cagatagagc cagaaaaact ggagaaaaga ttcacgatat tggttcaaat attaaagagt
    52141 ctgtagttcc aatgacaggt gccctcactc ttggactggg gtttgcgact aagagtgcca
    52201 tggattttga atcccaaatg tcagctgtaa aatccgttat ggccccagat gaagtaaata
    52261 agtatgggaa agctcttgaa gaacttgctg ttatccaagg tgcaaaaaca aagtatagtg
    52321 cattagaagc tgcccaagct gaagaagaac tagttaaggc cggtgttagt gtaaaagata
    52381 ttatcaacgg gggtttaagt ggtgccctat cattagctac agctggtggt ttagaactaa
    52441 aagatgctgc cgaaattgct tcaacagcat tgaatgcctt cagggatgat aatatatctg
    52501 tagctgacgc tgccaatatt ttagctggtg cggcaaacgc ttctgcaact gacgttggtg
    52561 aattaaaata cggtttatca atggtttctg cagttgcttc aggtgttggt ttaagtttca
    52621 gagatacctc aacagcatta gccgcattcg ctcaaaatgg attgaagggt tcagatgccg
    52681 gtacctccct caaaacaatg ctccttaacc tttcccctca cacaaaagct gcatcagata
    52741 tgatggattc tcttggatta gctacagcta acacgaaagt ggcatatcaa tggttagtcg
    52801 accgtggaat taaaccggct tcaacagaat ttaaagatgt atcagcagcc gttcaaaaat
    52861 tagcgaaaat ccaagctggt catggagctt cagctgcaaa agtagctaaa gagtatgaca
    52921 aattagcaac atattctggt ttggcttcaa gtgctttcta cgatgaaaat ggtaacctta
    52981 aaagcatttc cgaaatcgct gccttactca aggatagatt aaaagacttg agtaatgaac
    53041 agagacaaca agctctaaat actatgttcg gtaccgatgc aatccgtgct gccaatatcc
    53101 tttataaaga aggcgctaaa ggcatggatg atatggcagc tgcaatagga aagatttcag
    53161 cagatgatgt tgcaaaaact aaactcgata acttaaaagg aacaattgaa cagttaaagg
    53221 gatcagttga aactgcggga attacgattg gacaaaatct tactccagca ttaaaagtcg
    53281 ttgctacagt tattcaaaaa gttgtagatg tattcaatgc ccttccttct cctgttcaac
    53341 actttttagt tattggggca gcattagtcg ctgtccttgg actaattgca actgcaatcg
    53401 gatttactat gatcggtatt ggtggagcga ttaaaggttt cggagaattc ggggccattg
    53461 tcgctagcgc cacacggaaa attgctgaat ctgaagcaat tatggcaact ctaggttcag
    53521 tcatgaactt tgctttaggg ccaatcggac tcgcaattgc agccatttca actctcggaa
    53581 ttgcctttgc agttgcatat cagaaatcag agactttccg taatttcata aatggaattg
    53641 gagcttctat tggaacagcc ttttcaaaag tgaaacaagc tgtctccggg atctttgctt
    53701 tatttaaagg tgatcaatct aaaggcaaaa gtctcttatc ttctctaatg cctccagaaa
    53761 tggttaaagt cattgtcgat tctgtaaata agataaaatc ggcattttat aacatgactg
    53821 ccccacttac gagcgcttac ggcaaagtta aaactgttat aactggtatt ttcgctttat
    53881 tctctggtaa caccaaaaaa ggcacatcaa ttttatcagg tgtcttgagt gccaaagaca
    53941 tttcaagtat cagaagtatg gttgctcaag ttagacaagt aatcatgtct gttataactt
    54001 atatcaaagc gaaaactact gagattcgtg ctttctggca acagaacggt ccgatgataa
    54061 caaaagcttt tatcaatatc ttctcaggga tagttaaaac ggttacaact gttatgacta
    54121 ctatcttcca gattgtcggt ccaatcctca aatccctcgt agctcttttc aaagtcttac
    54181 ttcccccaat ttcagtcgta ttcaaattgg tatttacggt agccttggct cttattaagt
    54241 cagtactgaa taacatcaaa ggtgttattg atggaacact taatgtaatt atgggtatcg
    54301 cgaaagtttt tggtggtcta ttcactggaa actggaagaa gatgtgggaa ggtatcaaac
    54361 aattgttctt tggagctttc caattaattt ggaatgcaat ccaattaatg tggttcggaa
    54421 aaatgattaa aggcgctgcc ttattcattg gatccttcaa agcattgttt gttggtctat
    54481 ggaatatatt aaagtctgtt ttcaagactc cgattaagtg gatcgttaat ttcttgaaag
    54541 acaactttaa tatcatgaaa agaacagcga gtacagtttt tggtggaatc aaaacggtta
    54601 tctccaaagt ctggggcgga atcaaactcg tgtttaccac agtaattaag tacatcgtta
    54661 aattcttaaa acttgaattt aacggtatga aagttattgt gactacaatt ttcaaagtaa
    54721 taagcaaagt aatctctaca acttggtcag tgatcaagaa aatctttgtt actactgcga
    54781 aatttttgta taacacggtg aggacccgat ttgggaacat caaagacttc atcggaaaag
    54841 ttttcagttg gatctggaat ttcgctaaaa aagcttggag tggaatttct aacgtaatca
    54901 tcaaaccagt tgtaaatgtc tttaaaacag tggttaagta tttcaccaat attaaacaga
    54961 acgccttaaa aatctttgac ggattaaaga aaggtgctca aaacatctgg accaagatgg
    55021 ttgacggcat caaatcttta cctcgtcgga tgggtgatgg attaaagaat ggcgctaaag
    55081 caatcggtaa gggcgccaaa gccgttgcta agatcttgat tgaaggattg gctaaaggtg
    55141 tcaatggtgt aactggtggc gtgaactgga tcctcgataa agttcatgct cctaagaaat
    55201 taagaattcc taaatgggat gtcccaaaat atgcccgtgg tactgacaat cacccaggtg
    55261 gaccagctat tgtttctgat ggtaaaggcc caaacaaaca agagttaata gctcttccaa
    55321 atggccgaat gttcttatct cctaagaaag aaacaatgtt gaatcttcct aaaggaacat
    55381 cggttcttga tggaaataaa acagctgctc ttcttaaaat ggcacctaag tattcaaccg
    55441 gtattggttg gcttgatagt gcatgggata agacgaaaga gtttgcttct tctgcagctt
    55501 ctaaagtgac aaatgtagca aaagatattt ggtcttatgc aactcaccca acgaagttat
    55561 tagaaatggc aatctctaag ttcactaaat tggacgccct taaagatcca actctcggta
    55621 tggttaaagg tgcagttaca tctgtcaaag acggtgccgt aaattggatc aaaggtttac
    55681 ttacagctga taacccacca ggaaaaggtg ttcagcgttg gaaaccttta gttaagagag
    55741 cactagagat gaatggtcta tcaacaagta ctgaaatggt taataaagtt ttgagacaaa
    55801 ttcaaactga atctggtgga gatccaaaag ccgttcagca cggttataca gatataaaca
    55861 cgattcgggg ggatttggct aaaggcttga tgcaaactat ctcaagtaca ttcaatgcct
    55921 acaagtttaa gggccatgac aatatcttta atggcttcga taacctgttg gctgccttaa
    55981 actatgcaaa acatagatac ggtccaactt tatcagcatt agggcaagga catggttacg
    56041 caaacggagg cattgttaca agggcacaag ttgcgaatat tgctgaggga aataaacctg
    56101 aatcaattat tccacttgac cctttaaaac ggacaagggc attgcaactg ttatctaaaa
    56161 ctcaacagat tttaggtgtt cctaacggat cgcaagtaac agtgaacaat gattactctg
    56221 aggttattgc ccgacaagat gctcagatta cccttatgca gcaacaaatc actctcctaa
    56281 ctcaattatt ggccaaagat aactcacttt acttagatgg taaagaagtt tataacacca
    56341 ataaaaagta tgcagatcaa aaaacaaaat taagaaactt agctaaagga gtggtaacta
    56401 cttgaacgaa gtaacattta atttttgtgg ttttaactcc aacactgatc ttgatctgat
    56461 tgtaaatgac atcaaaagaa atgtcggccc agaaatatca gagaacgtcc aagacgttcc
    56521 tggtatgatg ggtaagattt ttcaaggcaa tagttacggt caaagggtat ttgaaattga
    56581 tgctacgatt aaagctactt ctgaagctga cagagttgat aagattcaac gtctatcaaa
    56641 tctaatcacc ataactggtg atggagagta ccctatggtc tttagtgatg atgctgaata
    56701 cacctattat ggtcacttta gtcaaatatc tcaggtatca agattaagcc aatcatcttt
    56761 tgatggaaca ttaactctca ctttctcctg ttctgaccca agaggttatg gtcagtatat
    56821 atctcaagat ataactgaga gccctgaaac aatcacccca caaggtaact ccgtaacata
    56881 ccctatcttc acatgcattc ctaaaaagga cgtaactaaa atcgcgattt ctgatgaaga
    56941 tgacaattac gtttatattg gtcaagatgt tgatccagat acgggtgatt ctccaatcga
    57001 caaagaacca agagttctaa aagatccttg taatactctt gctacttgga ctgaaatcac
    57061 ttcttctaat ctaaccttct atattgaaaa tggagtacca ggtggaacaa tgacaagtac
    57121 tcctaatgtg ctaaaacctt caagtttcgg tagtaaagtt gatggtaaat ggcatggacc
    57181 agttagacaa caatggcttc ctgccagtta taaagacttt agagttagag ccagaatgaa
    57241 gattgtttct tactatcctc gtgctatggg aaaaatcgaa gtttacttgc tagattctaa
    57301 tggacgacgt attggaaaac tgatgcttaa agatttagga tctactggtg aaataactat
    57361 ggctcaagtt caagttggtt acgattcaaa cggggttcat catgaaattt atgcttcaaa
    57421 tggatccgtt aagaaaaaga agaaaaccac taaaaccatc aaagtcaaaa atggtacgaa
    57481 aaaagtgaag gttaaaggaa aaaccgttac acaacaacaa tggaaaacca tcaaattgga
    57541 tgttgataat agcacaagta cttttactga tttctatggt taccttcaga tgactaagat
    57601 tggaaacaaa tatacagctg agattatgaa attagatgag aattgtaatc cagcttggtc
    57661 taagccaatt aaaaagactt ggacagatac aaaaaatact tttggtgatg ctctagctgg
    57721 ggtcgcattt tatacagcta aatacgatat taaggaagac aaagtagatc cagctgtttc
    57781 atataaaaat gactaccttg ctctttgtga tattgaagta tggaacatta ttgatggcgg
    57841 aaattcatca tcctcaaaac ctgcagtaat tgctcgtgaa ggagatgaaa ttaagattaa
    57901 tagtgaagac agaacagtct ataaaaacgg tgacttgttt atggaaaact tttatatcgg
    57961 tagtaaattc ttcgatatgg acggtggagt tcctaaatct ttcgccttcg aaccgaattt
    58021 agatgacgca gaatggtata tggaatatac cccaacaact ttataaagag gtgatagcct
    58081 aatgtataca atcctggatc cggatcttag agtttgtgga gtccttgatt tagaaggaaa
    58141 ccttggttgc aaattctaca acgacttgag atcaacaaag attgctgatg atcaaggtaa
    58201 agtgtggtta gatactttac aactctccgt accttatggt tttcctcaaa cagatatgat
    58261 gacatctggc tatcaccttc ttgtagaggg taatgacggt tatcattact gctatagaat
    58321 ttataattgg caagatgaag cagtaggtcc cgttcatgtc aaaacagttc aggcatacaa
    58381 ccttgctata tgggatttta accataaaat cgttccggcg aagacattca gtaatgctaa
    58441 tagtactgat gcattttctt atatccttca aggaacagga tggcaaatag gaacagataa
    58501 cttttttggt ggagacaaat ctttagaaat cggttcagga aacaatgctc agtattggtt
    58561 agatcaatta attagccaat atgaagtaga agttcgagct tatgttcaag tttataacgg
    58621 ccaggttgta aataaactca ttgatattgt ccctgaatta ggagaatcaa acggccgtag
    58681 attagaatac tctcatgatt taacaggaat tactcgtacc ggtgatgata ctcaattgta
    58741 taccctcctc catgtatacg gaggaaatga taagaacgga aatcccacca caatctcttc
    58801 tgttaatggt ggtaaggatt atgttgttga tgatgaagca aacgacttat acaacaatgg
    58861 aggtccttac ctagaaggat atattacaaa cgatcaaatc ctcaacccaa gtggtttgct
    58921 tgattggggt aaaaagcaat tagcaaacta taaccaccct aaatacacct acaatgtttc
    58981 tgtagcccac cttaattatg aagtctccct cggagatcat atccgtgttg tcgattactc
    59041 tatgcagcca gaattaacct tatcggcaag agtaatccaa tatgacgaat caaaagcaaa
    59101 tcctgaaaat actcaagttg ttattggcga atatgttgaa attgcagctg taactcccgc
    59161 agaaatttgg gcgctgcgag ctcaagcttc tcaggcccaa caagctgctg aagaagcaaa
    59221 atcatataaa gtagagtatt tcactccaga tgggaccgat tttgctgatg gaactagcac
    59281 aaaaagaatc attattagag tctattcagg aatgaaggaa gttactactt caattgatga
    59341 tagtagttac gtatggcaga aaatcaaccc cgatggatct catgacttag aatgggaaag
    59401 ttcgatggtt ggggtcggaa acgtaatcac tgtaggaagt gaagttgccg gaagtactat
    59461 tagatgccaa gttaataatg ggatctcaag ccctattctc tttgcttctg aagaagacgc
    59521 agcttatttt gctactcttc ccctaacgaa caatagtggt gatgttaata aacgagtagc
    59581 tcaatatgca caagtggatg ctatcaacgg aaatatttat tggtctcagg aatactctgg
    59641 gccgaaaaaa tcacagtatg gtggatggca atcttacaac ataacaagaa catcaattga
    59701 cggaacatac aaagatcaga tgtgggttat cggtggaggt catggatctc aatttggaat
    59761 tgaacatgtt ggcagtgaca tctacatttg gtctgcaatt atcgacacaa aaagatctac
    59821 attaaatggc actcactact ggggtattgc tagatttaaa tacatcccaa ataaggttat
    59881 tcaatttggt gactctaatt tgcaattcta tatgattggt tcctctacaa agtaccaccg
    59941 tattaattat gatgaaaaaa atcaatatat tttcgcaagc accggtgaag tagacttcta
    60001 tgtttgtaag cgatcagata ttgaaagaga caagtggaag ccaatctata caatgtctgg
    60061 cgacgatgtt ggatttgacg gtaaaactca aaccttccaa tcatctgccc ttgattttcc
    60121 ttatgcttac ttctgcgctg gcgatgtaaa cggtgaggat ccaagaatta tgtactgctg
    60181 cgatattcgt tcaaaatcgt tagtctatag cattaactat actttcgata aaggaacaat
    60241 taatcaaata ggtgagtacg atgaaccgga gtgcatcagc tactattacg atacagacgg
    60301 taagaaatgg gttattcaag gtttttcatg gggaaatgaa gatacttatg agactcaacg
    60361 aactaatcaa ttgtatagat taaacgagca taaacgaggt gaagagtctt gataatggga
    60421 agtgttgata ttgcttttac aaattcttct caggttgctc agaatgctca aaccattgca
    60481 acaaccactc aagaaaacct caatgaagtt aaaaacaata tcgtttataa aatagatatt
    60541 ttatctacga acggcacctc tttcaagaac ggattaatag ataccactct catcgctgtt
    60601 gcattcaaag gcaaggacaa tattacaaac aacctgcctc cttcatcatt tatttggacg
    60661 aagacaaatg ctgatgggac atctgatgat gagtggaatc aagctcatgt aggagttggg
    60721 aataccataa cgatcacttc tgatgacata tatagtcgag caacatttca gtgtgatctg
    60781 gatatagaag atgaagtgta gtaaggagag aatgttttat ggctatcgtg gcaagtggtc
    60841 aaacgaccat tatggatatg aatgatgcaa ttatttcagg aacagccccc acctccccca
    60901 ctgttggtac cctctggatt gattcctctg tttctccaaa cgttttaaaa acttggaatg
    60961 gttcttcttg ggtaactcaa tctttagcat tatcaggatt ggatccagct gctaatacaa
    61021 ctttaactaa tacaactaag acagcaaatg aagccaaatc tacagctgac tctgctaaat
    61081 caacggctga tgcagcgaaa acagcagcta caacagccca aagcacagct aatggaaaaa
    61141 acaaagctta ccgacaatct actcaaccta ctggaacatt aactgcaggt gacttatggt
    61201 ttgacacagc caatgggaat agagttagta tttacgatgg ttctaagtgg gtcgtatcac
    61261 agtttggaaa tgctgccgtt gataatttag atgctggttc gattacaaca ggcacattac
    61321 aagcaattga tatttcagcc tcattcgttg attcaaacgg tcaagtaaat ggcacttatt
    61381 ttgatggcga tgaatttaga tttatgaaat ttaagtctgg tgttagtaat ccagatttaa
    61441 agaacccgaa catctcagaa attgaacagc tatcaaaaat atttgtcgat ggattcgctt
    61501 atgcaacaag tacttctgct tatggtctcg gggcggccgg tctcttctat gaaggcgtag
    61561 gagaagaaaa tataggtgca tggtcgattg gttctagcgc agcagggaca atgaccgtag
    61621 tttccgattc taatattgat attgaagttg ggtcggacca aaccatttct ttatatggaa
    61681 atgtctttct cggtggtgac ttgaacgcta acaatcacaa tctcaataac gtcaaccata
    61741 ttacaattaa tgatgcaggt ggtggcgaag gcattgaatg gcttggcggt aatggatgga
    61801 aaatcgttga gtctgataac aacctatcta atgtttcagc cggagcttta cagattgcaa
    61861 gtggtggtca aagaagaatg tctatttcca cagctggtaa tgtgtatctt tccggaacta
    61921 ccttcaaagg agagtctggt gggactactc atttcgctag tcaaggtgca gcaagactgg
    61981 taagtgatgg tggcgctgaa ttcctagtcg gatcagatgg gactggttct cgtgtatggt
    62041 cgatggatat ttacaacaga acatatagtt cgtctccaaa cttgcatatc acaagtgcag
    62101 gtacccttgg aagaagcaca tcagctcgaa aatacaagtt attagaagaa cagatttccg
    62161 aagagttacc ttacaacatc ttgaaactta atccgaagac ttggtttgat aaatcagctg
    62221 tagaacaatt agctggggcc attgagagaa gtgaagatct cactgactca gatattcctt
    62281 accttgaaag aataggtgga ttaatcgctg aagatgttga agatgctgga ttatccttat
    62341 ttgttcacta tagtaatccg gatgaaaatg gtcaccgtga agttgagggc ctaatgtatg
    62401 acagactatg ggttttgtta attccattgg ttagagaact ctttaatcga gtcgaaaccc
    62461 ttgaagaaaa acttaaaagg agataaaagc atacatgata acaagaattg aacaacaaat
    62521 gcttgataaa ggtatctctt cttttactca atatgatatg aacactttga ttgtaagaat
    62581 tgccgacaaa ctcggaaagc tcccatatga aattacggaa gatgtaatac ttcaacatca
    62641 taaaaatcta aaaaatgatc ttctctcaga agcttgtgaa gaagaaatta ttaaagggtt
    62701 cacagcatca aacggtcatg tgtatagaac taatcgggac gatcaagtta atatgattgg
    62761 tcaaaaggac attttagatg acacagattc tgcagaacca attaaatgga gaacagaaga
    62821 tgctggttgg atagatcata caaaagatga atggcttcag atatacaaag aagcttttga
    62881 ttttaaaaaa tccaccctac ttaaatacgc ttcactaaag gatcaagtaa acaacgcgac
    62941 gacacatgat gaaatcgtaa aaataactgt ctgaaataaa actaaactct agaaatatag
    63001 ggagagaatt caatgaatgt aaacccaatt gaattacacc agctgatcat tgaggatctg
    63061 aagcaacaaa actctatttt atccgaacaa agatcaactc aggttgctat taataagttg
    63121 gctctaaaaa gaatcgagga attacaagga acggttgcac aacttgagtt gaaagtaaaa
    63181 aatctcgaag aagaattagg aaaatcaagc aaaaagtaag gcactcatta ttgagtgtct
    63241 ctttttatgg aggaaaacag atggagcaaa aagattatga aagaattgct acgttagaaa
    63301 cacaactaga aactctatct aagggacttg agagaattga aacgaagtta gatgcttact
    63361 caacaaactt tattacaagg cttgaagcag acatccattt taaaaatctc gaaaaagaaa
    63421 ttgatgaaat caaacaaaac aaacgagcaa atagcgcact aatagtaagt tgtttatcag
    63481 taatcctctc aactgttttt gcgctaataa acttaattgg aggtaagtaa gatgatgaag
    63541 tatctaagtg atattgaatg gtggaaacac cttgcaacta atgttggtgg tgttttaaca
    63601 gcgattcttg gatttttaag cattttaaat cttcactttg attggtttag tccaggatcg
    63661 attgatgcgt ttacagcaat catcattgct attggaaccc tatttgttgg ttcattctcg
    63721 acaattgtaa acacttacct aactaagcac agcaaagaga aagcaaaaca ggttgctgat
    63781 aaatatgaag aagaattagt tgaaaaaaca gctcaaaaat ctaactaaag aggcgattaa
    63841 attgaataaa ctaattaaaa ccgttagtgc gctagctctt tctttagggc tagctttttc
    63901 ttttgttgct cctagttatg cgtcttccct tccatctgtt gacttcattg atgtatcaca
    63961 ccacaatgcc gaaaatgggt tacctctatc attttatcaa acaatcaaag gatcaggagt
    64021 gcaaggtgta gttgttaaag tttctgaagg aagctattac gttgatcctg ctgcatccgt
    64081 taatattgcc aatgctcgtc aagcaggtat gattgtcaac gcttatcact ttgctcgtta
    64141 tacaagcaat ttcgcagcga agaaagaagc gatttggttt gataaaaagc ttcagttggt
    64201 tgggtttgat aagaaaaaag atggctatgt aaccattgat gttgaagcat caggtcttgg
    64261 tacagcttca caagtaactg agtacaccaa tactttcatc aaacaaatga aagctcttgg
    64321 ttatagtcgt gtagatttgt acaccggttc ttactattac aatgggcagc tgattcctag
    64381 taaactcgta gtaaataaac cttggttggc ttcttaccca gcaaatccag taaagaacaa
    64441 acctactgcc aacttcacaa atggaaaagg tgcttggcaa tgggcttctg attataaatt
    64501 tattggtatg tccagatacg gtaattttga cgtttcagaa gattacgccg gtaagtacac
    64561 aaagaaaaca tcctctaccc aagtggttac aaaaggagtt ggaaccatta aggttgtttc
    64621 tttagtagat tacatgaaat ctaaaggaat gaatgcttct ttttctaacc gttcgaaact
    64681 ggctacagct tatggaattg caaattactc aggaactcaa gctcaaaacc tcgctctttt
    64741 agagaagatt acaactggaa ctccagtagc aaaatcaaac acttctaaca gcaagttaac
    64801 aacatccaat tctaaatctt ttgcttcatc ttctttaaag acttcaacat acaaagttaa
    64861 gtctggagac accctttcag aaatcgcttt gaaatataaa acttctgtcc ttaagcttgt
    64921 atctctcaac aagttaaaga accctaataa gctttatgtc ggccagaaat taaaagttcc
    64981 ggctaaaact tctgtgacta agaaagctgc ctctaaaact tactacacag tgaaaaaagg
    65041 agatagtgtt tctaagattg ctgttaaata caaaaccact gtttctaaaa tcaaaagtct
    65101 aaacaaactt aaaaacccga acaggatcta tgttggccaa aaacttcggg ttaggtaatc
    65161 agcctggctc ctactttttg taggagtcct ttttttatta tagtcccctc ccctggatca
    65221 tcaaacagac ataaaatttc aattttataa taaggagtcg gtcaaatggc taaaagaaat
    65281 gcgatttata gcgatgaatt atatgctcaa gtgaatcgag aaaataagga cctccttgat
    65341 gattacatat tggaaatgaa atcacggaga aaaagtgaaa agaccattta tcagtatacg
    65401 gccgatatta agatgtttta ttgttgggcc gtaaagaatc tcgacaataa atcgatctta
    65461 aaaatgaaga aacgtgattt tcgtaggttc tttctcgagc ttcaagattc aggtacatca
    65521 gctgcacgaa taaaccgtgt tcaatgttct cttagaaata tgcttgaatt cgcaacggaa
    65581 gatgaagacg aatatgatta tgagattaac gccatgagaa gtattaaagg ccttcaaaaa
    65641 gaggaagttc gagaaatctt cttccttaca gatgaacaaa taaggctaat cgttgattat
    65701 ctattggaga aaggtaaata tcagaaggcc ctttatttga ctctatccta tgaatcagct
    65761 ggacggagaa atgaagtata ccaagttaaa aagcacggat tccttgagaa ctctaaaaca
    65821 aatgaggttg ttggaaaacg aggtaagaaa tttaaactct tatatttctc aaagtctaaa
    65881 gagattgcac gactttactt tgatcaacgt ggagaagatg atattgactc cctttgggtt
    65941 gttgggaaag gagaaagtaa acgaccggcc acatatgaaa ccctctataa ttggacagta
    66001 agcttcagat caattcttga agaattaact ggagagtata ttgcttttaa tccccacagc
    66061 tttaggcact cagccctcac taactaccat gacggtaatc attatgtcct taaagaatta
    66121 ggcaaagaca aatttgattt aaaggtcctt aaaactctag caaaccatac gagcgttgaa
    66181 acaacagaag gttaccttcc tgaccgtgat caagaaattc ttgaagaagc tttcggaatt
    66241 taagaaataa gtcgcaggtc caaattatca ttttaaggat taattcttcg tgaccacccc
    66301 ttcttaattt tcccatggta atattttgat attaaactat taagaaagga tatggtcatg
    66361 aaggtatttg aagcgaaaac acttctttca gaatcagaaa atcgagcaaa agaatataaa
    66421 gaattaaaaa gcaaaatggt caaattaaag aaggccttta aagctgttgc tgacttagat
    66481 gatagtgagt tttcaggaaa aggtgccgat aatatcaaat cattttatga ggatcaagcc
    66541 ggcattgctg atcaatggat tgatctgatt gaaatgaaaa ttgctttttt aacaagtatt
    66601 cctggtatct tggaagacgc taacttatct gatgcataca tagaggaatc cttcttagaa
    66661 catgagttgg ttaatgctaa tactaaatca aaggccatca tgtctgaaca gaaaaaagca
    66721 atcaaagaca tcttaaatga tatacacgac atccttcccc tagatgtttt ttcaacagaa
    66781 gactttaaag ataaattatc ttctgctgat aaagaacgaa aaaacacagt cgagaaaata
    66841 agcgaagttg atgaaaactt aacatctgaa tatgctctat cagaatccaa tgaacaaatg
    66901 attcaggcag attaccaggc cttgattggg gcaacttcaa aaggtaaaag tgcttcgccc
    66961 atctattatg atgctaaagc atatagagac agtgaagtcc acaagatggc tgaggatgtt
    67021 aaaaaacaat cgactgatta tatctccttt aaagatcaac aggctgagca aagaaggatt
    67081 gcaaaagaac aggaagagct ggaaaatcgc ccatggtacg aaaagacatg ggatgttgtt
    67141 tgtaatttta caggagaagt ctctggatat tatgattata aaagggctgc cgatggagtt
    67201 gaccctgtaa ccggtgaaaa gttgacagaa ggccaacgtg tagcagctgg cgcaatggct
    67261 gcagcaggtt atgttcctat agtgggatgg gccggtaaat tagggaaagg tgtaaaagct
    67321 gtttattcaa caggcaaagc catctcaaaa gccgaaaaag ccctagaagt atataaaaca
    67381 cctaaaacat tctatgctct tcaaaactca agtaaaggac tttacggact tgcttcagcg
    67441 aatggcttta gtgaagctat aaccggccga gacatgtttg ggaataaaat atctgatgaa
    67501 caacggcaga atagccttaa tcaggctctc ggtgttcttg gtggatttgg actgcgtggc
    67561 gtgaacaaaa agttaaatgc aacaaatcct agtgttccta aaagaccgtc ctggcgacaa
    67621 tctgaaaaag atgttggaaa agattaccct gattacagtg aacaaaagtc atttataaat
    67681 ggcaaagagg tcccttatgg aaagaaagga agttcccgtc cagactttta taaagatggg
    67741 catagtatag aggttaaaaa ctataagatc actacgtcca gtggaagaag caggttagta
    67801 aacaatgttt ctaaacaagt cgaaaaacgt ctgactgacc ttccaggtaa tactaaacaa
    67861 acaataatca tagatattag aggacaatca gtttctgaag aaataatgga cgatttatat
    67921 gataaaatta tgaaaaagac taatgggaaa gcagatatta aattcaaaac caattagagg
    67981 tgaacacgat ggctgttggg tttaaggtta aatattattg gtatcaggtt ggacatggag
    68041 acttcctcca ttcatttttt tcaactgtga gctaccattt agaagaacac ggttggggat
    68101 caaaatatcc tcatttatta aatgaacttt atcaaggaaa gcttgaaacc aaaaacattg
    68161 aagctgccct tgaagaatta aaagatatta aagaaagact gaaagaatac agtccttcac
    68221 aagttatttg ggatattgaa gacattaata aacgtccacc ttggggagat aatataagtg
    68281 atgaaataac cgacttatca aattattttg taacgagtga tggagaagat tttataaatc
    68341 ttttaaagaa tgcccttgaa aaaggcttaa aaacgaaatc agaagttctt attgatagta
    68401 tatgaaacat ggaggacacc atccgttctc accatattat caccaaaaaa gcagaccttt
    68461 aaaggcctgc tttttcattt gatctgaaaa aagggttact tttcagaaga gttaccaaaa
    68521 ggaattctta aaacaatgcc cataataata attgcaatta gtccaataat attaactatt
    68581 gttgaaatag attcattatc tacgaaaata ttaataataa atgagcctgc aacgatcaat
    68641 agtatcaaaa aatacaaaat ttttttcata aacacactcc tattttttta aaaatatgtt
    68701 attattttca tcggaaaata attctacaaa aatattgtaa aggagtttta tcgtgaagaa
    68761 aagcattaaa caattggtca ttgtaatctg tttctctcta attttcacca ctataacaat
    68821 accaatagct aacgcaaaag aaaattctaa tgaagtttct tctgagcaag ttaatgtaga
    68881 agctcagaac atgaaaagaa ctcttgaacc tctattagaa ttaattgatc aaatgccaga
    68941 ggatgttgct gaacaaggaa tacactctgg tgttgagtgg ttaaacgtac ataaaggtaa
    69001 cgaatttgaa ggttatgaat ttgttgctga tggagaaaac ttgactgccg ttaaaaccgt
    69061 acaggataat atcggaccct ttatagcatt gaatgcttgg agttgcattt ctagtgctgc
    69121 taaagctata gcagtaaatg ctatcccatg ggcaaagatc ttaaaggtta aaaaagccgc
    69181 aaaattaatg ggcggactaa attccatgac aaaaacaatt atcagagctt ataaacatca
    69241 aagaaaccta ggactttcta gaacaaatgc tattaaaaaa gccgtaaaag tttctactaa
    69301 agcactgcca gctgaaactc aaaaagccgt actagaattc tttagtttag gtgacgttgt
    69361 taataattgt ttctaattgt tttaacaaca gaaatacaag cagggtaaat acctacttgt
    69421 attcaggctg tcgtgaaaat ctcgacagcc tttaattttc cttaaaatat ccattcttct
    69481 gtaataaaat aaaagaaaga cttaaaagga cggtgtcttt ctcatgttcc acacaagaaa
    69541 ctcttctcaa aacgcagccg aatttgttct gcttgaccaa ctcgttgaag aggatcaact
    69601 gcttcggaaa attgatcagt acatagactt ctctttaata attgaaaagg ttaaacctta
    69661 ctacagtgaa aataaaggcc gcccctcact tgtaatccac tgattttatt caaaatgatg
    69721 tttatcggat acctctatgg tatccgtgca gaaagacagc ttaaaaaaga aatttactac
    69781 aatatgtcgt acagaatgtt actttttctc ttcaatggat atatgtttta agtcattaat
    69841 atcatctaga atagttacac tgggcgcctc ttcctcacca atataaccat aggataggtt
    69901 aaatccgtct ttattcttct ctataaattt atcgttgaag gaacttttgt gaaagcaaat
    69961 cctaaactcc ctttgatttt catacaaacc cttccttttt aacctgtaac ctagccttgg
    70021 gtctttatca tatgctttct ctgcaatgag tggcttttca tcaattcctt gataaagaac
    70081 gtaatttgcc caagaaaagc tgttcggatg cttacgtttt aatccatcta agagattttg
    70141 caccccataa aaaactgcta ttttcctatc cgaaaattca tttcgaaaga cattgataat
    70201 actttctggt attttattat ttttaaactc ctcaattgta atatagaaga aactacttat
    70261 atagacctct ttcatccgag tatctatttt tgctaggtac tccttgtcaa aagcatattt
    70321 ttgtcccttt tttatattta gaaagttctt cttttctttg taaggacgaa tgtaatatcc
    70381 ctctagtgca tctccaaata aatcttcttt atgttctcga cccatttttc taaaaacctc
    70441 tgcatttgta aagtacagct tctcattctt ggcatcctcg atgtattgtt tttcatttct
    70501 tattcctttt aacaaaatta tttttttaaa atctccttct aatctttcat tatccattcc
    70561 cattcctccg taaaacgttt tagcaactgt agttttagta tctaagaaga agttcattct
    70621 atgtttcccc aaaattaatt cgtatgtaaa gaaaaaggac cacaatgggt cctattaatt
    70681 tttaaatctg tttaaaatca tatcgtgttt tccaacttga ccagaaaggt attcgatgtc
    70741 tttcgtaata tcgatcgttt gtttatcgat tttcttaaga agtacaatca cgtcttcgtt
    70801 agtattgctt tctttctctg tcatcatttc tagacgctgc tcgatattat caaggcgttt
    70861 ttcaacagaa tcaaatctct tatcaatctg ctcaaacccc ttgtcgaact tctcagatag
    70921 agattgcata agttttaaaa gttcatcagt catgtagatc actcctacaa aacattatac
    70981 attaatttgt aaggtaactc atgaaataat ttacggaatt gaatattgaa tattcggaaa
    71041 attagagagc cacttaatgt gactctccta ttatgtaatt caccacgcta tcagtaatcc
    71101 atttcaattg ttccccttca atttttccaa ctttgaagat caatcgattg gcattaatcg
    71161 tataaagttt attggttctt acaattgaag gtttgattag ctcgatctct ttccaatttt
    71221 ctagtaccaa atcaaatttg gttcgtggtg gttggctcga taattttgca atcgtaacat
    71281 caaattcatt tggaccagaa taaccaacta ttattccagg tcttcgttta ccactgtcag
    71341 gatcatgata catccaaata tcacccttag agtgattact cattaatatt catctccttc
    71401 atccaggatc tgaatacctt tattaaaata aagatcatac atcaaatcga gtaatttcca
    71461 tctttcagcc ggttccatat ttttaatttt ttcaaggaat tcatatgctg tctcttccat
    71521 cgtttttctc ctttcatcta tctcttacat tattaattat accatttatt ggaagttccg
    71581 tacactcttt tttgtaagtt cttgtcgaat tttgtcagta taagtcaata aaaaatggca
    71641 aagcttattt ggcttcacca tttacggatt catatctctt agctcccccg ccaagaaagt
    71701 attcatcata aactttgtcc aagacttttt tcttttcttc ttcaggtaac tcctcaataa
    71761 gcttcaacat ttcatctgct gtatattgtt tcatgataat caccttcaaa ttagactgat
    71821 tatctttatt ataacaaatg gttgaacttt gattaattaa ttttaaattc ccaaagacca
    71881 ggttactctc tttctcattt gtctcttgtt tagttagcat acttgaacaa gtaaccccct
    71941 tcacgatact tataacctgc agcagtttct tctcctgtct taagagatcg ctttacccat
    72001 ccaacgtttg taattttatt ttcagttacc caattaaagg tttccataag accatcaata
    72061 gtttgaatta attggccatc tttataaact tcaatttttc tcttcttggc cccacgtttt
    72121 ttgtgagaag ttttttcttc ttctgtcgtg acatttcttt ctgcttcaat taccttcttg
    72181 atttgatcgt tattaagaat tgccgcagtt tcaattccaa gatctttagc ttcagaaatc
    72241 aattgggctc tttcaatcgc ataaaccaat tgggtccggt tcatatccca acgaccagta
    72301 atgttcattt cctttgcaat attacgtaat tccttaacag atttcgcgga taattcagta
    72361 gttgtcattt aagttacctc cgattttata taaaaattaa tttgatttat ctctcttaca
    72421 taaattatta taccatttta tggaagatta gtacatacgt tcgtacaatt aaattctatt
    72481 ttcatggtct taaattggat aattataaga aggttcggat aaaaaatcat attccttcac
    72541 caaaaaaaga tgctttacag catcctttct atatttattc aattaaacat gtttataacg
    72601 atgcagaaca tccaagtgaa tacacagaac ataacaaaaa tgatcatcca cataacatct
    72661 gattttgtag agagctcaaa ataatcacaa acggattcaa aagctgattg aataagaaat
    72721 agaaacggaa aagttaaggt tccgattttc ttccaaactg ttacactctt tttcttggaa
    72781 atttgtaaaa taaagtccat tatggtatat tctccttatc gacaaatcct tattagaagg
    72841 tcaggtgtgg gaacacctgg ctttttattt atttatttta acgactttta actggccata
    72901 cttatctttg taatagaagt aagtgtaggt tcttccttcc ttcaggtgtt ttctgtacca
    72961 tccattgttt gacattaaga ctttatactt ctttccaact ttaatctcaa agaaagtagg
    73021 atcggcatat ccgttaaact tacctttaac atggtagacc tttcttttct tcgtagcatc
    73081 agctttttct ggatgaaccc cagcgacagt tgtaaaaaca agtccagcag cgagtactcc
    73141 agcaattaat tttttcattt ctcatttctc cttttgttat aaaatcaaca ttttatgtct
    73201 ctaaaagcat ttaaatggct tctgtgagct tcaaatcatt ttcaatatat ttcccttcaa
    73261 taaagtttaa aatgaaatct gaggctttct gggcgtgttg tgaagccgat attatcaatc
    73321 ccctatcttc ttttatccgg cataaccagt tatgtaaata agaaacggaa tttttttgtt
    73381 gattttgatc ttcaattcct aacattgaga gaatcatatt tgctccgatc tcagcgacta
    73441 attcttcttt ggaataactt tcacttccga aaatagtttg gcctggggcg tcctcaaatc
    73501 tcttgagtcg agtaatatgt ccagtgctgt gaatcatttc atgaaatact gttgagtaat
    73561 attcagtaac attctcatac tggttaatag atggcacagt tattgaatca agagttgggt
    73621 tataataagc tctatctgag cctactttta tattaatttg gcactctctt ttgtaagcgc
    73681 ttacaactct ttcagcagat tcaatcggat cgtttataaa atcagcagtg tcatctgcta
    73741 tcccatcgac atctgaagta tggaagacgt tataatacct gaagataaag ttcggacgat
    73801 ctttttcact ttcttcgtcc tctcctcttt caacaggctt ccaaaaatat attttataag
    73861 acttgctgcc ttttttcagt ttgacttcag gatttttcct ttgaagttct tggatctgtt
    73921 taaaggttaa atagctgcct ccttccaaga gtaaaaggtt tattccctga taaggaattt
    73981 tcgtgatata gtttttaggt attcctcctt tccagggttt tctccaaggt gctggacctc
    74041 cattctcaat ggcttcctcc aaagcccgga tgatacgatc ttgaacatac tcataaacct
    74101 tcgacacaat atgacctcca ataaagtagt tgaattattt atctcttaca taattaatta
    74161 taatccaaca tatggaaatc gtacatattt tttgtagaga tttgtcgaat tttggcaaga
    74221 aaaagggcag cctaagctac ctcaattttc ttaagtttcc ttgatggaga agcataaaca
    74281 ccagtagcgt ttcggccatt cgttaagttg aagttttttg tatcaacggt taactttgat
    74341 ttatctgtca ggagatttag gctaacatca tcctctaaag taatcatgtc taacaggtct
    74401 tgctttaagc agtatgagtt tttaaggatc gtccggttac cctggaatgc ttctagattg
    74461 atttttgcga tccggttatt cgaatatgct gcaataataa acttatgagt gctatctaaa
    74521 atagaatacg aaacaatagt tatattttta tcccgaatca tattcggcag atacgtccca
    74581 agagcattgg ctcgtgtctc gtcaatatcc ttaagttcga ctttatgaca aactcggtcg
    74641 gatccaaaga taaggatctc ggctttattt tctgtttcaa aaacttttaa aacttcatcc
    74701 ccaggtttta gattaggttc ctgattccct ttaaacttgt agcaataacc ttccttagtg
    74761 agatagattg ttactgcata gttcggtacc tcttctacaa gacgaactgg tttaacttct
    74821 gtaagttcaa ctatttttgt tcgtctctct tttccgtatt tctccttagt ttcattcaaa
    74881 cccttaataa tgatttgatt tattttatcc tggcttttga cgatcatctt ataattctcg
    74941 attgttttct cgaatttatc aatatcctca attttcttaa tgatgtactc tctattaatg
    75001 tttctcaact tcatgttggc cacttcttta gcttgttcga agtctattcc aaaatgcttt
    75061 tgaagatttg gttcaatctg atcttggctt gatcttctaa tgatttcaat ggcttcatca
    75121 atatccaaca ataccttctc aagaccttgg agtaagtgta atttacgagt cattgtttca
    75181 atatcgtgag acaatccacg cttaatacaa gttgttctcc attcaagcca tttatcaatt
    75241 gtttgccaaa ctcctaagac tttgggaaga tcatcaacaa gcatattcat gttcgctgaa
    75301 aatgttgatt gcaacggagt gaatttataa agcttttcaa gcagcacatt catatctgta
    75361 tttcgacggg cagttatagt gattagcatt cccttcaagc ctgtcagatc tttaacatca
    75421 gttacttctt ttagcttgcc agctttattt aattcaacga ttttttcaat gattgcttct
    75481 cgagttgtcg agtatggaat ttcagtaatg tgtatctcat tttttacaat ttcagctttc
    75541 cctcggatct taactgttcc ccgaccttcc tcgttcaatt ggcgaaatac attatcttct
    75601 ttaacaatta atcccccagt tgcaaagtct ggaactagaa ccgttttttc tcccgtctca
    75661 atatacttaa caatagcttc ggttaattct tttaaattga atgatggaat agacgaacta
    75721 aaaccaacac caatccctga atttgagtat gcaagtattg aagggaactt aacaggaagt
    75781 acttcaggca tcttcattgt tccatcatag ttatctataa aatcaacaac attcttatcg
    75841 aagttctgca tcatatcaat tgaaatttca gagagtttta cttcagagta tcgatcagct
    75901 gccggcatta aatctcttga agtgtattgt ccaaagtttc cttttccttc gagcatggga
    75961 atgatatggc gatctttttg gaccatacca accatacttc cataagaact accatgaggg
    76021 tgtaacttca taacctgtcc agcaacattt gctgatttcg tgaatttaaa ggctttttgt
    76081 aagtacatag aataaagtat tcttcgatga acaggtttaa gtccatctcg aagatctggt
    76141 agagctcgat cgagtaagat ataggcagaa tactccatca tattgttttc aatgatttgt
    76201 tctatgtttt tgtttgtagt agtcaagtta aagttacctc ctggttattg aaaattctca
    76261 ttacgtaatc tttatatcta gtctttctaa aacgtaaatg agaataaaaa agattggcaa
    76321 tttaattgcc aaccttagaa aagctattaa attgcttctt caacatactt ataaagattt
    76381 tctgaaatat attctcttct gttatcaacg ctgctaccca tccaagtttc taaggactca
    76441 atcatatttt cagcgtcttc aactgtcact tttataaggt tccgtgtctc ttcattcatc
    76501 gctgtttcag ccatagtaac tgcatcaagt tccccaagac ccttacaacg agcaattgtg
    76561 tatttaccct ttaaagtgtt gatcttttgg tccttttcac tttctgaata gaagtagatc
    76621 attgaatcat cttccaattt gatttcataa agtggtgttt gagctatata aacataacct
    76681 tcttcaatta gcttcggcat tagtctatag atcattgtaa tgattaaaca tgctatttga
    76741 gctccatcag aatcttggtc agtagcaata ataatctttc cataacgaag gttattaata
    76801 ttaaacgtat caaggtcctt gttctttttg tcagtttgaa taccacaacc gagaacctta
    76861 atcagatcag tgataatttg gtttttaaag atagtcgtat aatctgcttt aaggcagttc
    76921 aaaatttttc cacgaagtgg ataagctgcc tgataaactg catctcgagc taaaacaatt
    76981 gagcctaacg cagactggcc ttcagcaata aagatttcag agtctttgcc atgcttctta
    77041 cagtcgacca agttcgccac tttatttcca ataccatcga ccttttcact cagcttcttt
    77101 ttgagctgct gtttagcctt ttgagactga gtattatgtt tttgaacttc aagtaagtga
    77161 ttaacgaatt ttttgaagcc tttttcattt tctatttgga aaacttcgag aagttgggta
    77221 gtatgccttt gggctaattt tcgataaagc ttcttatcag ttgaaagttt ggtttggttt
    77281 ttaaattcaa ctttatttga taaagccacc aagacaaaac taacgctcga ttcaatgtct
    77341 tctgttgtaa aagaattaat tcctttaggg aataacttat tttctctagc atatttatta
    77401 caaaaggttt ttatcccagt tataacgccg tcattaaagg aacccccatc agaaaggtag
    77461 gttaagttca aataagactc ctggattgga tcggttgttg ttgaaaaagt aagctttatt
    77521 tgagttcgtt ccccatcttc ttcgtataaa gattctggtg ctgtaatcac tggagaagtt
    77581 gttgtgctgc caatcagttc ctcaaaatac tcttcaacac tttcataatg gaaagtctct
    77641 tcttcaccgt tatgaatgaa gattaattta atcttatgtg agccaatagc aaaccttctt
    77701 acaatttctc ggacgacatc tttgtcataa gtaaccacgg gataaacttc aggatccaat
    77761 ttaaaagtta taactgtacc gtggcggtct tcacttattt tttcttttgt taagtcctgg
    77821 acgagttccc caccattttc aaattttaag gcgtgtttat atccatcgta ataagattcg
    77881 atatgaaaaa acaacgaagt aaagttgaga actgtcgccc ctacaccatt agtaccagta
    77941 gtagtctgtt cgctcgtttc atattttgta gaggcaaaca gggttctaaa caataattca
    78001 tagtttttaa caccatcggt ttccccatca atgggtatcc ctcgaccggt atctgtaacc
    78061 cgaacagttt gaaggtcatc aaacaattca agggtaacta ttccttcatc aaaattattt
    78121 ataacttcat cagttccatt agcaaggatt tctttcaaac catgataata gttatctgct
    78181 gatccatacc aaattgcaat tttttctctg gacttctctc tatcgtccaa tcttttaatc
    78241 ttgtcttgat tagtagtagt caagttaagc ttcctcctaa aatcttttcc catatattgg
    78301 gactaggttc tataaacatt atatccttcg tttatgagtt cgtaaaacga ttttaggagt
    78361 atttttaggt taatttttaa ttatctaacc aattataaaa cggcacttgc ccatttattt
    78421 tcttcccttt gaaatcaata tttccatact ttagatttct tttatgaaga gcattatcaa
    78481 gacaagttct taaataggct ccaaaatttt tcacatctgg ggtcttctct acttcgtcta
    78541 aaaccataat gcaaacttct ttaggcaaac cttttttcat atattcagag attaaattat
    78601 gtatagtttc ttctcttgtt aacaatttgt taacaagatt attctcatta ttattaaagt
    78661 tatttttaat agagttatta ttattagtgg ttctttttga actatccgga tggttcaatt
    78721 tgacctctct tgatggttca atttgaactt tcccggaaag ttcattttga cctatccctt
    78781 cattactgga aagttcattt tgacccatcc agtttttatc tatgtttttg gctgtttcct
    78841 ctgctttaat taaaaggtca tcaacttcat tgtttaaccg ataaatatct tcttcggtat
    78901 actccagcat tagaggatag aggatgttcg acttgttcat cccttccctt ttttcttcta
    78961 acagttcgta ttttgctaat tctttctttg ctcttttgaa agttgaatct gagaatccta
    79021 gaagttctga acctttttcg atgcttaaac gaacgtaata ccttccgagt tcgtctttcc
    79081 aattgttcat catactgagc ttgattcggt cgattaaaat tatgtagagt ttcatggcat
    79141 tcggattcat agttttgtac ttgtctccga tcagaagaac ttttggaacc tggtaaaata
    79201 ccagagagtc gaggttatta gctgtgaaat atttactcat ttttgttgct cctttttgtt
    79261 gaagtccgaa gcaacacctg atataattga attaaaaata gccaaaagca atgaaaaggc
    79321 atatatgtag ccctgttaaa ctttggtcgg tttgctcagg tgctgccaag cgaaaaatag
    79381 tctagcgcca actaggctat tttttattat tataatactt tgttgaactt tcgtaaatga
    79441 gtataaaaaa atcctccttt atcgtcgaaa gaaggaagaa atggttgaca tattgggtat
    79501 gtattaggta aaatgtgaat cagtagttga gttaaagtta tttatctcat agtcctactc
    79561 tttttctccg attagagtgg gattttttat gttcaatttt aggattcata atcatcatca
    79621 tcgaaaaatg cttctaaata atcagtctta ccacaattgg tacaaacttt atcactatta
    79681 gaggtttgat tgcaaagctc acagtaggct tttccttttc taacatcatc aataacttct
    79741 tctacatatt cttccggaat tctaattcct tctttagaga cccctttaat cggtttagta
    79801 ttgaattcat acttgaataa ggtttctgta tcaacttcta gagttttccc tgaaattttc
    79861 tgaagtctat cttcccaaac aggatctcca atgtatactc ctgacagatc agtgttttca
    79921 tttctataaa tgtcagcagc atttcttctt attttgattt tcattttatc ccccacagag
    79981 taaagcttat taatctctct atatttatta taacatttta tgtaagaaaa taaataaaaa
    80041 gtgagcgaaa aagcccactt tttcaataaa aaattaaata attttttcat cattgtaata
    80101 gtgatcagaa cataatgcaa gataataact cttttcttct acaaatgttt ctccagatcg
    80161 tgagactttt ccgtcaacaa ttcgagcatt atactgagct atcttagagc acttagaagc
    80221 ttcacaacct cttgagattc ggtttatgtt ttctgagggt aggatggtta aaaggtgact
    80281 agatgagtca aataactctc ctgtgaaggt tagatcaaga ccataaaaat gaataggtac
    80341 gtggtagctt tctgataatg aaacaaattt ttcaacggtt tctttaggaa gaaattgaga
    80401 ttcatcaata taaattgttt gggtatttgt catgaatata atgatttcta ataaagaaat
    80461 attttgtttg aattgatccc tgtttaagtt gattgatttt aggctgcgtc catctctact
    80521 ttcaattttt cctcttgaaa aagtatcttc ggttaaacta actgaaagga caactttttc
    80581 tttaggatca attaagtaat catctattaa ctttttagac tttccagaac ccatcaaacc
    80641 agtattaaaa gttatatcca tagataaagt cctccattgt aagatttaac tttgtaatta
    80701 tatccgtaca attgggaacg taaatgaaaa gaccaaaaaa ggtccagctt aatagctgaa
    80761 cccttaatta aaacttatta gattaagatt ttaactttac ggaatgcttc tttgctagca
    80821 catgctacag gtttattctt gatttcttct tcagaaaaat catacttaat attttctaac
    80881 atgctttcat aatcaataga agaaggatca atttcaactc caaaatcttc tttagccatt
    80941 tcaatagctt ttagagtttc ttctttaagc aattcgatag taagtttttt catggttaat
    81001 tccctctttc ttagtagttg atttgttatt tatctctctt acattattaa ttataccata
    81061 tattggaagt tctgtacata aaaaatacag aatttaggta aaaatttaat aaagacagcc
    81121 ttttggctgt ctttattctt cgttcctaat tatcctatct atcttgtgaa ctgtctcata
    81181 caactctttt tcaagttccg gaacaggacc atcctttata aaactataag acctcataat
    81241 gagatcttga atctcgagta agtctttttc tttaatttca attttcataa gaaccctcct
    81301 gaatcatctg gtaactcaat tgtttcaatt tttgctttag aaggctttgg aggatcgttt
    81361 tggacttctt gatcaactgt ttcatatacc ggagttgaac gaacaacccc tcctcgtttt
    81421 tcttcaaggt ctttctgaat caattctctt aagtaccaag caatccctcc ggttcggttc
    81481 ttagcgtcct caagagcttt acaaatttca gggtacttct tcttattcca attgatctga
    81541 tacatgaagt tatcttcgcg actcacgcaa acatctcctc aaacttccta ccgtatttta
    81601 gaagcaatcc aactgaatta acatagtaag atggtttatc ctcacccagt tcggcagaac
    81661 ttacagtgga atatccaaca ttctctaagc attctttcat ttcttctgct ttaccacctg
    81721 tacaaacaat agggtagtca taatcgatat tgctgcaagt cttagcaaaa gtcttcgcca
    81781 aatccattat tgaattgtcg atcgtcccac cattaatagt atggctatcc attttactta
    81841 tagacccatt gattaaataa aggacgttta atgtcttaga accagcatct acaatgacgc
    81901 agtttaatga atctgagaag tttagggctc ctaatccctc tgcagccatc acgatattat
    81961 gtacagtgaa tttgaatgac tttccttcaa cgataacttc tctttctcct tcaaaatgtt
    82021 gaacgaaata ttttttatct gtaaccatac tttcatatgg gcaagttaga attaagttaa
    82081 attctttctt tccagtctct ttaaagattg tatagagagc atatactaat cgaatttgac
    82141 cttccatatg gccttttctt gtattgccga aatacatttg ttcttcacgg ccgaaataga
    82201 agttcttaac ggtttctcca acataataat caaggccgtt gtactctact ctttccattc
    82261 cctcgtaatc ttctaaaggc ttgtagctat ggagaataga agggaaactg ccgaccttaa
    82321 tttgtttttt gtccttataa gcgtacttcg tactaaaatt cccgatatca attacagtag
    82381 ttagtgtcaa gttaaagcat ctccttagtt ttctttagtt ggaactcatt tcaattataa
    82441 tggaaagtta ttcatacgta aataattttt taaataaact cttaaataaa ttattatcta
    82501 atcgcaaaat gaaaaaatga acagaaaaaa tattttttca taattcttga ctaatttaaa
    82561 gaaaaccctt ttatttttat ttcccttaac ttataatgga ctttgaatag gatttggtcc
    82621 atttgtagga tattgtaaaa attcgaaaag ttggtaatgt ttctaaactt cattttaaaa
    82681 attttacgag taaataacat taatttaacg tttttcggat gtttgtgtcc tattcgtttg
    82741 tgttatatat aataataaac aaagataatt agtgagcttt aagcagaatc actttggttc
    82801 tgtggtaagt tcttacaaaa attataaatt atcgaagaaa tgctatttat taccacttcg
    82861 tgttatgtta taataattaa agcaaaataa aaagccctac cttgttggca gcaaggtaag
    82921 actttgaata agatcttttt atgttaagcg atctcaaggt attctttggc gataacagaa
    82981 cgtaattttt tcttaagctt tatgactctc tggttggcag cctgacgagt caaaccatgc
    83041 tttttagcat aagcattaac aggattattt tttacgtcaa taataatttt aagtaagtcc
    83101 atttcgtctt ctttgacgtt tttcaaaatg attgaaagaa gttcgttagt ggcaatgtta
    83161 tcaaaagatg tgtcgttggc agcgagcata tcttctatct tgagatcgtc atcacctatt
    83221 ggtgaagata ttgaaaagac tccattgctt tgattctttt gagcataacg ggaatatgta
    83281 gcatttctta ccccttttct taacttcggg tacagatatg ttgtgaaaca gtatcctgtg
    83341 tctgaatcat acgcttcgta ggccctccat aattcaagct ccaactcttg ctgaaaatct
    83401 tcctcttcaa cttgattaaa catgaacttt gaattagctt gtttcatagt cttatagacc
    83461 atcggcaaaa atctttctct cacctcttca aatgtcattt gaattgataa tccatttgaa
    83521 aataagattt ctttcttctt cactaagtct cgtcctctct ctatattgct atttcatgtt
    83581 ggtggataca agtaaaacca aaatttccat atccatcaga cttaatgatt ttatctagag
    83641 aaatagaaac gtaaacgaaa aaaatattat ttttttaact ttttgtttga gcctttttac
    83701 agattggaag tcttcagaat aggtcttttt tggtagtact tacaataatt attatattac
    83761 ataagtacta gatcgtacac ctcttttttt gattattccc catagtcgaa ggattatgaa
    83821 agtttagttt gttttgttga tatgaccttt attatgttga ccgacacgtt aatataatat
    83881 cataatacgg tgattgaggg aacatttgtt cctatttttt agcgaataag aacggatata
    83941 tgaacatata gacatgtaag gctcaaatga ccttatttaa cataaaatat tcattttatg
    84001 tatatcttta acttaataaa tgatacccca tcatttagca aaagaaaagg aggtatttac
    84061 ctccttgcta aacattcctt attagaaaga ttgaactctt gaactaccct attgtcaatg
    84121 attctcttaa atattgtaca atggtcaggt ttcttcttac atagagcaca gtttttgtct
    84181 ttgaaatctt caagatcttt tgggccatcg aaaac
//