LOCUS       AP019377             5541392 bp    DNA     circular BCT 03-APR-2019
DEFINITION  Thermogemmatispora sp. A3-2 DNA, complete genome.
ACCESSION   AP019377
VERSION     AP019377.1
DBLINK      BioProject:PRJDB7711
            BioSample:SAMD00152509
KEYWORDS    .
SOURCE      Thermogemmatispora sp. A3-2
  ORGANISM  Thermogemmatispora argillosa
            Bacteria; Chloroflexi; Ktedonobacteria; Thermogemmatisporales;
            Thermogemmatisporaceae; Thermogemmatispora.
REFERENCE   1  (bases 1 to 5541392)
  AUTHORS   Yabe,S. and Yokota,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-DEC-2018) to the DDBJ/EMBL/GenBank databases.
            Contact:Shuhei Yabe
            Tohoku University, Agricultural Science; 468-1, Aoba, Aramaki,
            Aoba-ku, Sendai 980-0845, Japan
REFERENCE   2
  AUTHORS   Zheng,Y., Saitou,A., Wang,C.M., Toyoda,A., Minakuchi,Y.,
            Sekiguchi,Y., Ueda,K., Takano,H., Sakai,Y., Yokota,A. and Yabe,S.
  TITLE     Novel natural products biosynthetic potential of the class
            Ktedonobacteria
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: HGAP v. 3
            Genome Coverage       :: 267x
            Sequencing Technology :: PacBio RS2
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5541392
                     /country="Japan"
                     /culture_collection="NBRC:113123"
                     /db_xref="taxon:2045280"
                     /isolation_source="clay soil in a geothermal area"
                     /lat_lon="38.8039 N 140.6728 E"
                     /mol_type="genomic DNA"
                     /organism="Thermogemmatispora sp. A3-2"
                     /strain="A3-2"
                     /type_material="type strain of Thermogemmatispora sp.
                     A3-2"
     CDS             1671..2030
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00010"
                     /product="hypothetical protein"
                     /protein_id="BBH91802.1"
                     /transl_table=11
                     /translation="MSIDLAKMKALLEAKRDELRADIAHLTAPPTSVEPLPQDNEDSA
                     TELQTYQQEQSILENEQALLAEVEAALARIEEGTYGLCVSCGRPIPEKRLEAIPWAAR
                     DVQCESQRQAGRESFAG"
     CDS             2386..2982
                     /codon_start=1
                     /gene="lspA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WH41"
                     /locus_tag="KTA_00020"
                     /product="lipoprotein signal peptidase"
                     /protein_id="BBH91803.1"
                     /transl_table=11
                     /translation="MSARRARLYDLLALLVMVLVVGLDQWTKALVVSYLSPPDSGHVV
                     PLLGDYLSLYYTRNSGAAFGLFANSAVLAGLIAVAVAVVITLYLRGLNSGPLSYKLVF
                     GLIIGGAVGNLIDRVRHGGYVVDFILFRIPQIGFRFAVFNLADAAISVGVVLLLLLML
                     CGALPRAAEPGKPAQGRGTAPGYWKTAEREQREEHVGP"
     CDS             2969..3964
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q45826"
                     /locus_tag="KTA_00030"
                     /product="putative RNA pseudouridine synthase"
                     /protein_id="BBH91804.1"
                     /transl_table=11
                     /translation="MSALESTFHRQQAERGESRAATPYGYEVRRQQVSPEEAHQRLDR
                     YVQQLLAPLSRTAVQRLIEEGAVLVNGEREKAGYALRAGDVVEILWRLPQRTTEVMPR
                     ALPLEIVYEDDDLLVVNKAAGMVVHPAPGHEDDTLVNALLAYRPQLREVGSGERPGLV
                     HRLDKDTSGLLLVAKHQQALTALAEMMQRHQIHKRYLALVVGQVPLDQGTIEAPIGRD
                     PRNRQLMTVTAHHSREARTHFRVVRRFSQHTLLSVEPETGRTHQIRVHLKAIGYPVAG
                     DPVYGSSSHRLPGLTRQFLHAAQLVLPHPMTGVTLKLEAPLPADLQSVLAREELL"
     CDS             4492..5361
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00040"
                     /product="hypothetical protein"
                     /protein_id="BBH91805.1"
                     /transl_table=11
                     /translation="MPVLEATDRLTPKSVLRHRPLQSESGSERPAGAGEPVAQRASRP
                     RPTPPDVAAAEIEEWKRADASDESLSGAVKRAQRRPSRTTTGSRPPSAAATKTPVPGE
                     QSGQDRGGKPAPAREEKADKARQPVARRWRFQAHPLLYLGLGMLCMLLLWCLLLPLVS
                     WGRTTLDDLRYGRPRTFQTDAFVGHNETAGIPSHFIALNLNGHIEVIELPGGDPAHAR
                     IYSGPQLYDPDADLVPVTLSFADVNGDRKPDMLLHFQSTRLVYINDGSAFRPLRPDER
                     PAVLQYLEHHPNL"
     CDS             complement(5895..6260)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00050"
                     /product="hypothetical protein"
                     /protein_id="BBH91806.1"
                     /transl_table=11
                     /translation="MTTVSSEKHHSVIGKDELIHQTAARAGLSLKETGKVIDAFTEVV
                     REELARGHEVRLMGFGTWSLRTVAPRKVKSIRGGQQITIPARKRVGFSVGAVLAQAAR
                     GPQGRAHGESERQGERRHH"
     CDS             6512..7267
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530802.1"
                     /locus_tag="KTA_00060"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBH91807.1"
                     /transl_table=11
                     /translation="MAKLVYKMSRQNRAYLQICAALEEEIRSGRLPTGQRLPGEYELA
                     RRFGVSRMTVRQALAELARKQLIQTRAGSGSYITFDHRPLDWSQGWSRALMHQGAQVT
                     TRVLYFGEMAEPELRESLQVEAERFIALDRLRLLEGREPISLERSRIPLTGQTRALLD
                     IDFAHESLMEALTGRLGLVPAVGEEWVEVTRLRTEEARLLGKAIGEAFLLSRRVTRDR
                     EGRLIEYVTSLLDPSHFRLHMTFDLGQSERQRR"
     CDS             7274..8326
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530803.1"
                     /locus_tag="KTA_00070"
                     /product="ADP-ribosylglycohydrolase"
                     /protein_id="BBH91808.1"
                     /transl_table=11
                     /translation="MREAGEAALHEQAEMERRARGTLLGLAIGDALGMPTQMLPRAVV
                     AQLFPRLEGFEAGPPQNAISAGQPAGKVTDDTQQALLVARLLLEGQGHVKSNRFVEEL
                     LRWAELAEADGSEQLGPSSRRALEAVRRGLRPEEAGRRGDTNGAAMRIAPVGIAVPLE
                     PEGRFLERVEEVCRPTHFTGVAIAGATAVAAVISAGVAGASFVEALGEAQRLARLAQE
                     RGAYVAAASVAERLIWAVDLVCHLDEESAQDAIVDLIGTGVATQEAVPAAFAIAARWR
                     ADPWRACLVAARLGGDSDTIAALVGAMLGACAGLEVFPQEARTTVVQVNDLDIDRLVS
                     GLVALRARLLQEEVRS"
     CDS             8323..9807
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003400819.1"
                     /locus_tag="KTA_00080"
                     /product="allantoin permease"
                     /protein_id="BBH91809.1"
                     /transl_table=11
                     /translation="MSAQQQQQPVADRPWAIELHGIEPIGDDERHGRPTELFWVWFAA
                     NIGILGIVYGGILTAAGLNLWQSLLVAVVGSAGSFVLVGVVSVAGKWGGAPMLTLSRA
                     PFGTRGNLGPTLVSWINLIGWETITVIVAAYALLGLLGLLGLPATPIWTLVSLLAVAG
                     LVVLFGLLGHATLVWIQRAATWIFGLLTLVIVLFLLVKTDWAKMLAAPPGRWDSGVLA
                     TLSIVIAGTGVGWVNTGADYTRYLPRESSGRAIVGWTVLGATIPLVVLIMTGVFLSTR
                     LPTLASTTNPIAAIGQELPSWMAVPYLITAVGGLVAEADLSIYSSGLNLLALGVRLER
                     YKTVLIDGVLMVVGAAYVMLVAQDFFAPFESFLQLLSDGLMAWAAVFLVDMALRRGYE
                     PRSLIETGPTSGYYYWAGVNWRALVAWVLGIIVGLLFTASPWFTGPLARGIFAASSLG
                     YVLGFAASALAYWLLAMIGGGKVVLKRPAGSQALSELAGGGKAS"
     CDS             9804..10775
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268087.1"
                     /locus_tag="KTA_00090"
                     /product="sugar kinase"
                     /protein_id="BBH91810.1"
                     /transl_table=11
                     /translation="MSELRLRPRRLVLVGSVLVDLLLYVERLPERGGDLLAQRALQAV
                     GGGFNLLAGAVRLGLPAAYAGRVGDGPMGSRVRAELEALGIPLLLPPVVGRDTGFDVG
                     FVEPDGERTFVTAPGVEAELSREELEQLILQEGDAVYVSGYDLCYPLSGAALGAWLPG
                     LAPDCLLVLDPGPLVAEIPASRLEPVLRRVDVLSLNARELRLLTGEEEPARGAAQLRE
                     RLAPQGIVVARVGAGGCWLATTEGEPQQIAARPARVVVDTTGAGDAHVVAFLAALAAG
                     TPLEEAAYAANVAASLAVERAGPATTPTRAELLEALAAEKKVRGGWE"
     CDS             10993..11487
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010887757.1"
                     /locus_tag="KTA_00100"
                     /product="heat-shock protein Hsp20"
                     /protein_id="BBH91811.1"
                     /transl_table=11
                     /translation="MTTTMVTRFDPLHEMISLREAMNRLFEQSVVRPLWHLSGEPRPQ
                     LPLDVYEGEQGYVVRALVPGVKPDDIGLEVQGQNLLIRVTYPAAVEEGRQVHWLMHEI
                     GSGPCERVVTFERPIDGEKVEARCEHGLLTITVPVAEESRPRRISVTAAEAGQRPEPQ
                     LVTA"
     CDS             complement(11725..12312)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00110"
                     /product="hypothetical protein"
                     /protein_id="BBH91812.1"
                     /transl_table=11
                     /translation="MPFKIGVYGSNIVESEHALDLARELGQALADRGCIVITGACSGM
                     PYAVARAAFERGAEVWGFTPALNLDEHRRAYPQDDVGVYRRLIYVPPGYHDLFGLAPA
                     TPEQDWGARLKYRNVISTVNSDAGIIISGGWGTLNEFTNLIYEGKPIGVLTGSGGLAD
                     ELPAWYPRLRKKTASPVLFEGNPTRLLTLVLQQLE"
     CDS             complement(12384..13571)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00120"
                     /product="hypothetical protein"
                     /protein_id="BBH91813.1"
                     /transl_table=11
                     /translation="MSRKKTASHLSGQNAAALLPLAQPVLVGVVRERQGTPPAPEEES
                     TGEGLGLLAAEDLDLLRRIADMADLYAQHEVFARYHRRLARNTRIRQLWDLKAFATFC
                     LEAGARVTGVSLQTDVATLTQALFLEASTWRFVSAGLIQLFLSWMERQGYAIDTMNVR
                     LSTLKRYCRLATDAGVLSQEELYRISRLQGYRHKEGRHIDRQRPVTRRGPKKAEPNIL
                     TEEQVAWLKNCHDPTTPEGRRARVILCLLLDLGLRVGELVALQVKDIHLSRGLLRFYR
                     EKVDKEQTHRLSADCLQALRAYLPDVAGERYLFPGYKGRHISTRLVEYLLKDLGDQLG
                     IDHLSPHDCRHYWATYHASRQRNLAQLQQAGGWNSPAMVLRYYVAAEIANEGLLPSPE
                     QGG"
     CDS             13950..14591
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00130"
                     /product="hypothetical protein"
                     /protein_id="BBH91814.1"
                     /transl_table=11
                     /translation="MRPEDSDNSGSADGNIKVWPGTWTDTSHTVSFGNQENEDIQAAV
                     MLALNDVIDALNAFSFLQGAVNLANALSDFADNLELSLGCVAVDLSVVASGLLIAAQA
                     FAGQDQTLANMWADLQKQLPYFTTGTTLTPAVVSTFSPLTIHPAYQPDPISSFFSQAW
                     HTVTSWASDAHDWVYSHASSSGAPTWVASTAAALAAGVVFVGVLLLAPKPVLP"
     CDS             14690..15832
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00140"
                     /product="hypothetical protein"
                     /protein_id="BBH91815.1"
                     /transl_table=11
                     /translation="MIGAPMPPPLVTVSYPEVPSDLATRLSDLITTLQTRSGQLQGFS
                     SQMQGFIDQVHKAVEYVASISEGHSTQALLETWLLSLNDSSQSHGGMSDVASHLSSPL
                     LSLQEQAQTVQSGMSLIADLQANRGQVPRTMASDVQKDIDDFNNALNTISIALDGAAK
                     LIKALNDAWPRTCATGFTPGNRYPTFAPGSFDQHMMRMSGDLSEAFNSSAGQRIINKL
                     GEEEGQTLIALAQEHGADLDQVARFVDQGAAPQLIDCWIQAGHPADVGDLGRLREFYV
                     KSHLDTLIPDYGSDLQEQVKLSVEGASATADFVTSKAIIEVSGGPRLSAKLLNDKMKQ
                     FSVYSKIAAQTGRRVYFMWDKSSGAPVPPELQRQAARWGVTIIEFP"
     CDS             15978..16634
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00150"
                     /product="hypothetical protein"
                     /protein_id="BBH91816.1"
                     /transl_table=11
                     /translation="MGDTLNSTFELRTERGELFWWPLLFEALSWHGFHFTAPGKPAGV
                     GYYFYRSYVQEEDSDFVCSSFRELWERIVDRQAQVMVSLWSSTADPFPLDLLIASKGD
                     AATLSVSLGCDDAYLGSDDIDPETVKERLRLLWECSKTLFVVCQPCRGELSWGEAAPG
                     TPALASFGQPLEVSEEARHWWRLQVQEQVLPGGERIFVAQPWYVRRRQGELEYWPLED
                     "
     CDS             16767..18479
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00160"
                     /product="hypothetical protein"
                     /protein_id="BBH91817.1"
                     /transl_table=11
                     /translation="MHAALRSYHVALLTGLAGSGKTTLGRAYVRRFGAQYSSVIWLDA
                     LAPETLVAGLLAHSEVLPSVREGLGKGVEGIRQIIEALLTVDGLLLVLDHATLTSEGL
                     PMASERSPKGAVLVLTQDQLPASVAAGFDLKPLEAEDGATLLLGQAGLLMAGTSLQEA
                     QAQEAPGERQRLALEISRELVGSPLALTLAAGYLALTGCSLERYLAACRSDPLWLSGA
                     GDRHAAAARVACHLLLVHLEGADPDALRLLEACALFAPPPVPRAVLQQDALLQAVFGT
                     PGAAGEERFQHALHTLLTGRLLSTVQVPGNYEALDLHPLLREFVLQTLSLQRQVILRE
                     AIAAACLRLAEASGPPCASSLALWFRLAACIREGAAADERLLLSGEQTADAYAWAASL
                     LGAQEYFSAAESLLRRAVMIWEQVATDATLAKIAGASLCLGVFNTRLQRYTLAERYAQ
                     RALTITEQLSSVPPLRLLDCIMTLAWIYEMAGKPAEARRFYQKARAFGDAAGLQAHPL
                     YLAALQAARRCSPGEPEERETLPPDNSPYSGFEAPAEAEQDAPPGVNPPYTGFDPPET
                     PDIL"
     CDS             19101..20084
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003810847.1"
                     /locus_tag="KTA_00170"
                     /product="oxidoreductase"
                     /protein_id="BBH91818.1"
                     /transl_table=11
                     /translation="MEYTTLGRTGLEVSRICLGCMSFGDPSRWIHAWVLDEEQSRQII
                     RKALDLGINFFDTANVYSLGASEEILGRALKDFAKRDEVVIATKVFFRMREGPNGAGL
                     SRKAILSEVDQSLQRLGTDYIDLYQIHRWDYQTPIEETMEALNDLVRAGKVRYIGASS
                     MYAWQFQRALFVAERHGWSRFVSMQNHLNLIYREEEREMLPLCRAEGIGVIPYSPLAS
                     GRLARDPAQQPTRRAATDQIARRKYDATASADQQIIDRVGELASRYGVPRAQIALAWL
                     LQKDPVTAPIIGATRVSQLEEAVGALTVRLSPEDIAYLEEPYVPHPVVGPE"
     CDS             complement(20172..21305)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00180"
                     /product="hypothetical protein"
                     /protein_id="BBH91819.1"
                     /transl_table=11
                     /translation="MGWFSADSDGGGQWEWSGAAPFDLERLMEGFGVSSWQPLGPLLS
                     PYSPEPLGVLLEIEGERYLLRPRPEGPAGEDSEHCYRFQRFLGLAGLPVPALRQTPAG
                     SYCLVVGEERFELQQWLGGEDFASAGPRGVRWVEAAGRTLAQLHEAALRFPGPEHRWP
                     SELRAGGLVQGWLNLARERAERCEVGAIASALQTWVEQWEAVLPAAMMTLGAAHGLPE
                     LHIHGDYQALHLRFSAEGVCSVSDFYASRWEKRIFEVAAALFAFSALDWQPATGQTRP
                     LVARGLEPERARVFLRGYGSLVRPQGQEAACLAEALTVMAPILMINGPLEDLFFEEGV
                     ELEESQERLEEMLERLAWASAWPGWLRRARRWLAELWEEAASN"
     CDS             complement(21370..22260)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WE31"
                     /locus_tag="KTA_00190"
                     /product="sulfurtransferase"
                     /protein_id="BBH91820.1"
                     /transl_table=11
                     /translation="MTMASGQRDRLLVEPAWLEEHLHDPRLRIVDMRGYVRTVEYGAG
                     EQEAVYEGARAEYEQGHIPGAVYLDWTSDIVDPDSEVKAQLAPPERFAAVLGRLGIGD
                     EHIVVAYDAHPASQFATRLWWALTYYGHREVRVLNGGFPRWLREGRPVTTEVPQFPPA
                     VFTPRVQPELRATAEEVLAALGREGVRVIDARDVGQYSGRVVRRPGRPGHIPGAINIP
                     REELVDPQTGQFRSNEELAAVFTRAGVRPEERVIAYCNGGVAATVVLFSLALLGYPHL
                     TNYDGSWNEWGVRSDLPTEV"
     CDS             complement(22283..22825)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011140118.1"
                     /locus_tag="KTA_00200"
                     /product="hypothetical protein"
                     /protein_id="BBH91821.1"
                     /transl_table=11
                     /translation="MASLNPLNAALQQLLLGSAVRQNHALEHATIVLLSRRFPDVRFS
                     GISSAVGFVVFGDVPTEEVLPAAEDALHLLRTTQPELAVHERCGTNLAVAGLLSGLSA
                     MTVARMRRPFNTFNNVVLATTAALVLARPLGLTVQRYLTTQTPSQSMRITGVKRFEFL
                     GTPAHFVSTENPEAQRLFSW"
     CDS             complement(22921..24501)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00210"
                     /product="hypothetical protein"
                     /protein_id="BBH91822.1"
                     /transl_table=11
                     /translation="MQPPENPYARQKGHADDLQALVGRSLGQFRIVEPLGAGGMAAVF
                     KAYQPALDRYVAIKVLPARYAHDPVFVKRFEQEARSIAKLANPHIVQIHDFGEQDKIT
                     YIVMEYVDGGTLRDRLKSRSLSLLEAVDFLLQAAEGLRCAHSHHIVHRDVKPSNMLLR
                     RDGHLLLSDFGIAKILEGTTQLTRAGVGIGTPQYMSPEQSTGQAVDQRSDIYSLGIVF
                     FECLTGRVPFTAENPVSVTLKHLQEPLPVDLLRQAGVPAAIEQVVVKMTAKAPADRYQ
                     SIEEVVVALATALQAAHLPMPHPWRLSAGLPTFEGGSSAGPGASTTLSPQASTWPAAT
                     GAGPQPATAPGGAAASGSFGGSSAGQGLRPTLPAYAGAGPASPASTTPSPTVALTCFR
                     CGTPNPSTRLFCTTCGYELADRKAAKDRYVDAQGRVVLASLTLQSGPLAGRSFRFHQD
                     VTTIGRTNGNDFIIAGRTVSRRHARLWFDNGHWYLEDLQSANGTLVNGERIQQTILRD
                     GDVIQFGDERLIFHIVYK"
     CDS             complement(24818..26224)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WBV2"
                     /locus_tag="KTA_00220"
                     /product="dihydrolipoyllysine-residue succinyltransferase
                     component of 2-oxoglutarate dehydrogenase complex"
                     /protein_id="BBH91823.1"
                     /transl_table=11
                     /translation="MKIDVRVPSLGESVVEATVARWHKREGEQVRQGEVLAELETDKV
                     SVEVTADHDGVVAEIVKHEGDDVAVGEVLARLDTAVVGAEAEAAPAPEASEGVASRGA
                     QPQALRTEGERQAASAPAGSRLTDGQRPPSPLARRIAAEYNVDLSQVKSSSPHGRVTK
                     DDVLQYLEQQQQARQQGQGQAQEQRQPVPAPATLAARAGVADGVAATAASGAATAGER
                     AATLEAALEPPPSLVAESRREERIRLSRRRLTIAQRLVEAQHTAAMLTTFNEVDMSAI
                     LAVRARHREEFKQRYGISLGFMSFFTKAVVGALKAFPYLNAELQGRELVVKHYYDIGI
                     AVSTDEGLVVPVVRDADRKSFVEIEKEIAELAQRARSNQLTLADLQGGTFTITNGGVF
                     GSLLSTPILNGPQVGILGMHKVQERPVVVDGQVVVRPMMYVALSYDHRVVDGREAVQF
                     LVRVKELLEDPERLLLEG"
     CDS             complement(26432..29290)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WBV3"
                     /locus_tag="KTA_00230"
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="BBH91824.1"
                     /transl_table=11
                     /translation="MDNLQTFYGPNAGYVLDLYERYRTDPSSVDEKTRAIFARWKPVV
                     VEGETETPAAGRAEGAPFAVEKVVAAVALAHAIRERGHLAARLDPLGRPPQGDPALLP
                     ESHGLSEEDLARLPASVVGGHAAEGARNALEAIQRLRAMYSGTISYEFDQVKSPQERL
                     WLRDAVGLQLFQRRLSPQASRQLLQRLTQVEVFERFLHQTYPGQKRFSIEGCDVLVPM
                     LDELIRCALESETREVIIGMAHRGRLNVLAHVLGKSYQAILAEFAHTRHEEGVPLTDT
                     FGFGWSGDVKYHLGAEHLLGGERSLALKIVLAPNPSHLEFVNPVVEGMTRAAQERRDR
                     PGLPRQEPDATLPVLIHGDAAFPGEGVVAETLNLWHLQGYTVGGTIHIILNNQLGFTT
                     EPQESRSTLFASDLAKGFSIPIIHVNADDPEAALTAIRLAHAYRDEFHKDILIELVGY
                     RRWGHNEGDEPAFTQPQLYELIRAHPTVRELYARRLQEEGVVTPQECEQMVEEAFATL
                     RRAKQEVDEDPRRFEQLGGNGQNGLAVELEPAPAVSAEQLRQFNRELLRWPEGFTVHP
                     RLSRVLQRRADALEHGSIDWGHAEALAFASILADGIPIRLSGQDSERGTFSQRHAVLH
                     DSRTGERYVPLQHLSQARASFAIHNSPLTETAVLGFEYGYSVHAPEALVLWEAQYGDF
                     ANVAQVIIDQFIASGRAKWRQQSSVVLLLPHGYEGQGPDHSSARLERFLQLSAGYNWR
                     VANCSTAAQYYHLLRQQAHSLRHHPLPLVVLTPKSLLRHPLAAATLEELTRGRFQPIL
                     DDAEAQQRADTIRRVLLCSGKIAIDLLASEQRPRASEVAVVRIEQLYPLPEEGLRQVL
                     SGYPAMQELVWVQEEPLNMGAWSYMAPRLQAMLAALPVPQVTLRVLARPESASPATGF
                     MDRYEAEQRTLIEEALLGEAGVVVEKRPTEAPAGKRRR"
     CDS             30027..30785
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011762783.1"
                     /locus_tag="KTA_00240"
                     /product="alanyl-tRNA editing protein AlaX"
                     /protein_id="BBH91825.1"
                     /transl_table=11
                     /translation="MKTKLIYLENSYTFECSAKVVATEGDELALDATVFYPGGGGQMA
                     DRGTLSWDDGRRQASVIALRKQGEVIWHLLDCPPPPVGTEVTARIDWDFRYRMMRTHT
                     ALHLLCGVIWQEFRVPVTGGQMYPDRARMDFAMEGLTKERLAFIEQRVNEAIEADLPI
                     RVYTLPREKAFAIPDLIRTRTNLLPPDLEEVRIVEIVGLDLQADGGTHVRHTKEVGGI
                     RIVRAENKGRLNKRLEIQLVDEPPGSAASMASQP"
     CDS             30941..34255
                     /codon_start=1
                     /gene="ileS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P56690"
                     /locus_tag="KTA_00250"
                     /product="isoleucine--tRNA ligase"
                     /protein_id="BBH91826.1"
                     /transl_table=11
                     /translation="MSGEASVFRPVIAADRVDYPALEHEIQRWWDENGVLQLYLHRND
                     QSDKQYSFLDGPMTANNPMGVHHAWGRTYKDLFQRFKTMQGYRQRYQNGFDCQGLWVE
                     VNVEQELGLKNKREIEQFGIARFVELCKERVFRFARRITEQSIRLGYWMDWGNDYYTL
                     SDENNYTIWHFLKRCYERGLIYKGHDVMTWCPRCGTGISNMETLSEDWHEISHLSLYV
                     LFPLVERPGEALLVWTTTPWTLAANVAAAVHPELTYVKVEQDGQIFYLAEERLSLLRE
                     LRGRDKGEYRVLERLKGEQLVGWSYRGPFDELPAAQGVSHRVIPWKEVSSTEGTGIVH
                     IAPGCGREDFALSKEFDLAVLAPVDEFGVYVDGYDWLTGQAVSQVARPIAENLAQKGL
                     LYRSQNYRHRYPVCWRCKTELIFRLVDEWYISMEKLRYEIMDVARQVTWIPAFGLERE
                     LDWLRNMDDWMISKKRYWGLALPIYECQQCGAFEVIGSKEELRERAVEGWEEFEGHSP
                     HRPWVDAVKIRCRQCGSLVSRIKDVGNPWLDAGIVPFSTLEYRHNRDYWRQWFPADFV
                     TESFPGQFKNWFYALLVMSTVLEGTTPFKTLLGYATVLDEDGEIMHKSKGNAIDFDDA
                     AERVGADTMRWLYTSQDPEQNLRFPRIPTQEDVERAAREGVPVRLSEKWMLVRRALDK
                     VWNIYWFFVTYANIDRFNPTRYQLPVERRSDLDRWILSELQQTILEVTACLERYDSAH
                     ATAALQEFIENLSNWYLRRSRERIWKSELDDDKLGAYLTLYECLTTLVTLLAPFVPFF
                     SESLYQNLVRSVNQEAPLSVHLCDWPQARQELIDEALTRDTHLVMRVVGLGRAAREKA
                     QIRVRQPLNTLYVRLPSQTDQEAVLRLKEQVLEELNIKRLELLSDDSEMLAYTLRAQA
                     RLLGPKYGPLVQKILTTLKNLDAQAASEAARQLREQGALTLTVDGREVTLTPEEVEVI
                     ATARPGYVTAEERGAVVVLETTITPELREEGLIRDLTHYIQDMRKRANLKIEDHIQLA
                     ICADEELAAMVRRHASQLQEETLADSLRVETAPFEETLPGELYRETLSPASARRLESY
                     TVQVVIAAAQSSTSAG"
     CDS             34448..35677
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00260"
                     /product="hypothetical protein"
                     /protein_id="BBH91827.1"
                     /transl_table=11
                     /translation="MGTLRSAWKEAAWVFGLSRLFLLLITYVGGVLLRPKNMASIPCV
                     QSGLRFCLLGWYRWDAEAFGRIAHVGYRSLADVAFFPLWPWLIRLGAAALGNHFPLSF
                     LLSELLLSNLFFFGALVLLYILARESLDCDPAQARKVLWYLAFYAYAIFFFAGYSESL
                     FLFLTLALFWLLQGTALWRWWLAGLLGCAAALTRSTAIVLVIPFLCFYVERFWRAPLP
                     AAAAGGAAPGQARPWRLWLRRWLAALPALLIPAGVAAYMLYLGWRFGDPFVYSRMERT
                     VWGRQFALPWMAFGPALGAVLGGPLHTEMAARNLMDLLFTLLPLGVLAAGWRQLPAAY
                     RFFSLAVVLFALSFPLTSGETLASQPRYLMVAFPLFLIMARWSKRFPGLDLVYGGFCA
                     PLFAFNALLFTLHYWVA"
     CDS             35953..36945
                     /codon_start=1
                     /gene="ydhJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:O05502"
                     /locus_tag="KTA_00270"
                     /product="hypothetical protein"
                     /protein_id="BBH91828.1"
                     /transl_table=11
                     /translation="MAEELIRDPLWGEQRLSDPVLIAVLHSAPLQRLKGVHQAGASYL
                     VRSGRDTTRYEHSLGVMLLIRRLGGGLEEQLAGLLHDVSHTAFSHVADYLFSCYDEDY
                     HERHLRQVIERSDLPALLRSSGINLEQILAFDRWSLLEQPAPDLCADRVDYTLRDLWH
                     AGYLQWLDVATFLQALRVREGRIVVAGLDAARWFVHQYVHLVTELFMHPVEMFADYQL
                     ARALRLALDGGLLREEELFLEDAELLARLRRAAHPEIERCLSLLQPGLEVREVAADQP
                     FDVYARVKPRMVDPLVLLEDGSLVRCSALDAELAALQRTVLHKARRGSYLRLCR"
     CDS             complement(37025..38041)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00280"
                     /product="hypothetical protein"
                     /protein_id="BBH91829.1"
                     /transl_table=11
                     /translation="MTLKFDRQGLIPAVIQDDESNEVLMVAFMNEEALRLTRETGYTH
                     FYSRSRQAIWRKGEQSGHAQQVRAIFVNCEENSLLIRVVQQGGAACHEGYRSCYYRRL
                     LPDDRYELVARRVFDPAEVYGHPGHQLSAGEIPAPKSATPAQPPLPEKRPAAQAGNEE
                     IADEALSGHLETLLRQLYTAYLYLRDHDLSEQSHTSRLLQERNPAYLLGRLADELQEL
                     AGVLQGTHRHQNLQADIVLEGSQVGYWLLLLAATHQVRYEDFQPHQALLAGYWAAVGE
                     EQAVEQQQACLSALASAERAHLIEGLNLGFALVGRACALAGLSPLEPARYDLEQMRRK
                     GLVP"
     CDS             complement(38038..38838)
                     /codon_start=1
                     /gene="hisF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2RGW2"
                     /locus_tag="KTA_00290"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="BBH91830.1"
                     /transl_table=11
                     /translation="MLTKRIIPCLDVAAGRVVKGVNFLNLRDAGDPVELAAFYNAEGA
                     DELVFLDITASYEQRKTMLDVVARTAEQVFIPVTVGGGIRSVEDMRATLGAGADKTSV
                     NTAAVQQPELLRAGAEQFGSQCIVLAIDARSNPAMPSGYEVYIHGGRTPTGLDAVDWA
                     CRGVELGAGEILLTSMDRDGTQQGYDLTLTARIAQAVHVPVIASGGVGTLEHLYEGLT
                     KGGADAVLAASIFHFGQYRIADAKRYLRERGVAVRWDEAEIGGGGQTS"
     CDS             complement(39064..39822)
                     /codon_start=1
                     /gene="hisA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WD26"
                     /locus_tag="KTA_00300"
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino] imidazole-4-carboxamide isomerase"
                     /protein_id="BBH91831.1"
                     /transl_table=11
                     /translation="MIILPAIDLREGRCVRLYQGDYRQATVYSHDPVAVALRWQEAGA
                     RWLHLVDLDGAAQGQPVNLDAVERIRAATRLQIELGGGLRDLASIERVLALGIERVVL
                     GTSAVRQPALLEEAVRRWGERIAVGLDARDGLIAVAGWQQTEPLRALDLAAQLCALGV
                     ARFIYTDIARDGTLSGPNLEALQTMLRVVRQVQPPRALIASGGVRALEDIRALARLGV
                     EGVIIGKALYTGDVDLAAALACAAACEPSTEDAG"
     CDS             complement(39819..40436)
                     /codon_start=1
                     /gene="hisH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F0KGL5"
                     /locus_tag="KTA_00310"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="BBH91832.1"
                     /transl_table=11
                     /translation="MIAIIDYGAGNLRSIQKALEHVGAQATVTADPGLVSRARAIVLP
                     GVGSGGAAMQRLKATGLDEAIREATARGRPFLGICLGMQLLAEHHAEGEVEGLQLFPG
                     EVRRIPQGPKIPHMGWNQVQPLRPELPIFKGIPAGAFFYFAHSYYVEPRDPAGVAAVT
                     DYGTPYCSVIVSDHLWGTQFHPEKSGAMGLRLLANFVHWVEERVP"
     CDS             complement(40577..42973)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00320"
                     /product="hypothetical protein"
                     /protein_id="BBH91833.1"
                     /transl_table=11
                     /translation="MKTLIVFDLDGVITSEDAYWDAAGLTLHELLFSPRYWNVTGQSG
                     YEPVSGAEESRRLSRATLPEEEILLYKALAINSNWDTCYAAVCWRLIALLEQVLPSAR
                     ELLLPLRPWEEEWLTRLRSALAARRAALQPQLATLLVAGPPFAEAPFAEAVGLDLLNR
                     YDAYASARLGLQIEGVFSRLSPFWDFCRALFQEWYLGEELYSRTYGHPPRQAGKPGCI
                     HFERPLLPPEALRETLDALRAAGYVLGLATGRSYQEAVLPLQAYDLLSRFDPGHLCTY
                     DAVEAAEAELRRAGDRTLLSKPHPFQFLYALDRRGPQASELARSRPPFIVVGDSSGDM
                     LGGRAAGALTVATLSGARSEEARRRLLACAPDFVIEDVRRLPSLLTEVERLETIQRLQ
                     FEDRAKAERLLRLWFAHQLDVLTEQVTLTPRPVSLNSFNGTYERDGERYFFKTHVEEQ
                     SALSEYYHAELLHEAGYNMVLPLHVVRQEGRQMVIYPLVEWPVMFDLMRAAETGAPCP
                     VPAETLVAAERRACQRLLEIYRTTGRLSDADEHATAPVHQLFWHRLTGGRLTSFYRGQ
                     SIPLPAPAGAGVGQSEIRFDDLLRCRWVVNGEPQPRTLGQLLEEAQERLHPRQAALTI
                     IGHGDAHFGNVFLEHERDYLYFDPAFAGRHAALLDIVKPLYHNVFASWMYFPQETAQT
                     LTLRVTLHRGVGGAWLEVTHTYQPAPIRQAILATKLQNLLRPLLSWLKEERALPADWE
                     RLLALALLCCPLLTINLLDRGRIPVAICWLGLTQAVTLGNAGLQPWQGLLERPAEEAF
                     "
     CDS             complement(42970..44061)
                     /codon_start=1
                     /gene="hisG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WK40"
                     /locus_tag="KTA_00330"
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="BBH91834.1"
                     /transl_table=11
                     /translation="MSEPRAAPGSEPAQLRLALPGKGTLEGATLTFLAECGLKVQRSN
                     PRQYLARISSLPELEVVFQRAADIPALVRDGDAILGITGYDLLAEFRGLAEEPDEDEE
                     NDDNLMVLERDLGYGSCRLVVAVPETWIDVNTCADLWHLAGYYQRHKGRGLRIATKYP
                     TLTRHFLRRHGISHCRIVTPHGALEAAPLTGVADLIVDLTETGTTLRENHLKLLEDGV
                     VLRSQACLIGNVRLLSQLPQAQRVARVLLELLNARLQARNRVLLTAYVPGSGEEVRSL
                     LSMHLKRLVPGFEYHIGSSESTDDPQAQRCRVSGVLQMGEAVADLVEIITALRSVGAE
                     HIDVTPLAYRFGQEPASLRLLSERTARRQ"
     CDS             complement(44058..45608)
                     /codon_start=1
                     /gene="hisS_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WK42"
                     /locus_tag="KTA_00340"
                     /product="histidine--tRNA ligase"
                     /protein_id="BBH91835.1"
                     /transl_table=11
                     /translation="MKKHIERLRGMRDVLPDTYRRQLQVVQRVRALLEKAGYEPVDTP
                     VLERSDLFQASFGQEAWQNLYAFQLHQRELCLRPEYTASICRLYLEQYQQHSLPLRFQ
                     YVGPVFRYEAPGRGRYRQHTQLGVELFGGQPLRADGEIVQLACDILHELGIARYRLEL
                     GHVGVASGFIERLHLDTQTARLLLSLMEQISRSPEGEQAARARLEALYPEQATQASLP
                     VSGGAEAASRADQWRRLVSADGPNHLVAALLNSVSLPFGDEDSRREIVERFLWKVGRS
                     EQRAQVFSALEFLRKLRALAGSPPEVFQELRQLLQGYQLDATPLEELERLVTTLMEVA
                     GVDRRQITLNLALGRGVSYYTGLLFEIHASDEEGVDLQLCGGGRYDHLIQAVGGTHEV
                     RACGFAFGLERLLPLIPASQWQAAPQRVRALVIPVGKQDLVYASRVARQARHECEIIV
                     ELDVNSQRVSNALRQASRRGFQLALIVGEEERQANTVKLHDLASGAERTVACRDLAAA
                     LREGGYSL"
     CDS             complement(45936..46826)
                     /codon_start=1
                     /gene="argB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P59303"
                     /locus_tag="KTA_00350"
                     /product="acetylglutamate kinase"
                     /protein_id="BBH91836.1"
                     /transl_table=11
                     /translation="MAIAFSRTPDGDIISDHHLIAEVLREALPYIDYLKGKILVIKLG
                     GSTLEHQQVVLQDIIWLSALGAKPVLVHGGGPYINEWLQRLQIPTRFENGLRVTDAQT
                     LEVVRMVLLGQVNQGLVLMASQMGGKAIGLCGTDAGLVRARVADERLGFVGEVEEVDP
                     TLVQVLVEQGYIPIIAPLGQGPDGTCLNINADVVAAHLAGALNAEKLIFLSNVVGICR
                     PDGSLISELTEEEALRLIDEGVIQGGMIPKVAACLDALRSVPRVHIVDGREPHVLLRE
                     LFTDKGAGTMIVRGTRQPSA"
     CDS             complement(47022..48122)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011459299.1"
                     /locus_tag="KTA_00360"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="BBH91837.1"
                     /transl_table=11
                     /translation="MFLAMVSVSIVNVTSYTGLELLRLLANHPHFRVTSVTGRSAAGQ
                     RLGQVFPQLYALAGGACQEAARHLAEVQITEEPEATELAFVCLPHAAAAEAVQVLLQR
                     GTRVVDLSADFRLRDPSLYQEWYKHTHPAPALLEQAVYGLCERYRERIRTTALVANPG
                     CYATAIILALLPALSAGLVSRDLIVDAKSGVSGAGRGLRLDTHYAEANEDLSAYSLGG
                     HRHLPEIVQELEAAARAAGQSYEPGLRLTFVPHLAPMTRGILATCYAELRPVSSGRLP
                     DRAEIQAIYRDYYADEPFVHVIDQPPHTKWTYGSNHCLLYVTLDERSGRLLVLACLDN
                     LVKGAAGQALQNANCMFGFDERTGLQVGAVYP"
     CDS             49229..50749
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010939066.1"
                     /locus_tag="KTA_00370"
                     /product="cation transporter"
                     /protein_id="BBH91838.1"
                     /transl_table=11
                     /translation="MLAAREAHREKVLVALSSVGAAVGLTALKLVAGLLSGSLGILAE
                     AAHSALDLAAALLTFLAVRVADRPADATHNYGHAKIENLSALFEAILLLVTALWIIYE
                     ALRRLILSEGHVEASILALLVMAISIAVDVTRSRALLRVARRLGSQALEADALHFSTD
                     IWSSAIVIAGLLILRLAEIWHLPSWVKQADAVAALGVSLIVIYVALRLARETVDALLD
                     RAPEELLQHLETAIRQVEGVSELRRIRVRRAGNKIFADVVVAAPRSFTFEETHALSER
                     VEQAAITGVRAHAPQAETDVVVHLEPVASAEETVREQIHYLAQQQGIRAHDIRVREVG
                     GKLEADFDIEVEADMDLASAHAAATRLEEAVLRGNAQLQRVTTHLEAAPPATIERRQD
                     VTGDYPEMVRRIRQLADAVAGPGSAHDIHLYRSCRAEECSAGATGPGSRKEQQGARGQ
                     ASANGREDELDLVLHITCAPETPLSQAHLRAEEVQRALRQEYPRLGSVAIHTEPPE"
     CDS             complement(50899..51603)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013229425.1"
                     /locus_tag="KTA_00380"
                     /product="haloacid dehalogenase"
                     /protein_id="BBH91839.1"
                     /transl_table=11
                     /translation="MITALIFDFDGLILETELPEFLAWQQLYARYGQRFELEAWLPYI
                     GIGPTSNPFDPLRELERRLGRVFSPEEREALRQSRREYCRQLLEGQAVAEGVLDYLEA
                     AERLGLRLGVASSSSRRWVVGHLERLGLRSRFQCIYCGDDVHVTKPDPAVYLAVLRCL
                     GVRPEEAIALEDSPNGVRAARRAGIFCVAVPSILTRHATFADDAAPDLRLESLSALPL
                     EALLQQVTALRASHQR"
     CDS             complement(51984..52859)
                     /codon_start=1
                     /gene="ribY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WGD2"
                     /locus_tag="KTA_00390"
                     /product="riboflavin-binding protein RibY"
                     /protein_id="BBH91840.1"
                     /transl_table=11
                     /translation="MTIGLGYIPDIQFAPFYVAKAKGYYSQAGLNVTINHGIVTDLIG
                     SMVAGRNTFVFASGDEELTARSKGVQAVNVATIFQRYPVCLIVPADSPIRTLADLKGH
                     SVGVPGPYGATYVGLLALLYHEHLSVNDIHLQSIGFTQVAALLGHKVDAVMGYSNNEP
                     LQLRRQGFAVRTFEVSDYQPLISNGIVTLQETLRQQPQMVRAFVQATLRGLQEVIAHP
                     DEALQLSKSFVPGMDLAKAREVLQATIPIWRGNGRLGYNDPAVWQATASFMTALKLVP
                     PVADVSAAYTNQFVA"
     CDS             complement(53145..54047)
                     /codon_start=1
                     /gene="ribX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WGD1"
                     /locus_tag="KTA_00400"
                     /product="riboflavin transport system permease protein
                     RibX"
                     /protein_id="BBH91841.1"
                     /transl_table=11
                     /translation="MMGIDTSSTSSKRLPLTLPSHQGRQRQGGEREELPTLAIAPMPK
                     TSRARRRASALSVVPPLVVAAVLLSLWYLGTAYGHINPLFLPAPSDVWQRLLDGLSSG
                     LYEVNALATIEESLLGFLLAVVIGLPLGYGLAKSRLIAATVQPYLAAGQAIPAIVIAP
                     FLVLWLGYTLLPTVILCMLVVLFPMVITTALGVRTIDRSILDAARVDGAAGWSLLTAI
                     EFPLALPAIMAAVRTGLTLSITGALVGEFVAGGNQGLGGLILQGQHQYDTPFMFATLA
                     LLAALAAVYYGLAWLLSKLAEAVY"
     CDS             complement(54743..55138)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00410"
                     /product="hypothetical protein"
                     /protein_id="BBH91842.1"
                     /transl_table=11
                     /translation="MIRALARLLLSLIFIKGGADAFLDPGGRPARVARFGIAQPERAV
                     ILNGATMVVAGTALALGWLPRLAATVLLGVLIPTTIVGHPFWQESDPQIRQTQQIQFA
                     KNLGLMGGLLLVLLEERRARPARSRAQGG"
     CDS             55460..56254
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259452.1"
                     /locus_tag="KTA_00420"
                     /product="F420-0--gamma-glutamyl ligase"
                     /protein_id="BBH91843.1"
                     /transl_table=11
                     /translation="MGAELRIIPVTGIGEITPGSDLGVIIYTALQAQGVTLIDGDILV
                     VTQKIVSKAEGQLINLEEVTPSAFARTIARETGKDPRHVEVILRETRRLVRMDRGVLI
                     CETHHGFICANAGVDESNLADQHQVSLLPRDPDRSAQLLREQLLSLASSDRSQSLSDR
                     ERLQRLAVVITDTWGRPWRNGQVNMAIGVAGLAAIRDYRGEADAYGRELRVSAIAVAD
                     ELAAAAELVMGKSAGVPVALIRGYSYRSAADGVKPLLRDAASDLFR"
     CDS             56461..57153
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259451.1"
                     /locus_tag="KTA_00430"
                     /product="nitroreductase"
                     /protein_id="BBH91844.1"
                     /transl_table=11
                     /translation="MTTACERAVTVSQRAGDLLTLLRSRRSVRAFQERPVPETLLEQV
                     LEAARWAPSPHGRQPWRFVVFSDRARKERLIERMSAAWEAQLRLDQQPEEIIALRLEK
                     SRQRIRQAPVLILPCLYLEDLDRYPDAERQENERIMAIQSLGAAVQNMLLMAYELGLD
                     TGWMCAPLFCPAVVCEALELDQRLHPQALITLGYAAADPKRRPRLPLEALVIRLDRQG
                     SGDGGGGEGREL"
     CDS             57226..58158
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256113.1"
                     /locus_tag="KTA_00440"
                     /product="LPPG--FO 2-phospho-L-lactate transferase"
                     /protein_id="BBH91845.1"
                     /transl_table=11
                     /translation="MIVVLAGGVGGARFLQGVVQVVPPAEVTAIVNTGDDREFYGLHV
                     SPDIDIVIYTLAGVVDERHGWGIRGDTYHVMQQLTRYGHEDWFLLGDRDLATHIHRTL
                     RLRQGRTPTEVTEELRRLFGLGLRILPMSDDPVATHIQTPAGLLHFQEYMVKRRCMDE
                     VQGVVFVGIEQAQPAPGVLEALRQAEAVLLAPSNPIVSIGSILALPGVREALRSTSAT
                     VAAISPIVGGAPIKGPADKLLRGLGHEVSALGVARCYADFLDVMVIDQQDAALAPAIE
                     ALGPRVLATDTIMRDQEAKARLAREVLRACACAV"
     CDS             58181..58903
                     /codon_start=1
                     /gene="cofC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WC63"
                     /locus_tag="KTA_00450"
                     /product="2-phospho-L-lactate guanylyltransferase"
                     /protein_id="BBH91846.1"
                     /transl_table=11
                     /translation="MAITVATQAQGAAQAAGTLHRCGALVPVKRLAAAKGRLAGHLTP
                     SQRARLVLSMLHHVVTTLQASNLLSRIVVVSADERVRACAAAWGAEAWPEEQAGHNGA
                     LEAAARRLRAEGVAALLTISADLPLLQAEEIKALLEQAQHYPIVLAPAHDGQGTNALL
                     LRPPLLLPYLFGERSLQRYSEAAQLRHLPYTRYESPGLALDIDTVEDLRRSSLAEGQA
                     TARLSHCLREMTSCQSLDIRQH"
     CDS             58873..59895
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258687.1"
                     /locus_tag="KTA_00460"
                     /product="LLM class F420-dependent oxidoreductase"
                     /protein_id="BBH91847.1"
                     /transl_table=11
                     /translation="MPVVGYSAALEQFHPSDLLRWCQEAEEAGFGGVMAADHFHPWTP
                     TQGHSPFVWSWMGALGLATKKLTFGPGVTCASYRYHPAIIAQAAATLAAMYPGRFWLG
                     IGTGEALNEHIVGGEWPEAPVRLERMIESIEIIKLLFSGKKVRYSGKHLRMESARLYT
                     RPETPPPILVAASGPKAAETAGRLGDGLITPAAPPEKLKMLLERFEKGAREAGKDPST
                     MPRLLQLHVSWAPTYEEAVNNALKEWPNGGIKAPKQDIRSPEDFEAFAQLVRPEDFQG
                     RVLISPDLEEHRRHIQSFFDLGFDEVHVHNVGRDQSSFIRAYGEAVIPALHQPASASR
                     LQASSQ"
     CDS             60075..60476
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027616.1"
                     /locus_tag="KTA_00470"
                     /product="PPOX class F420-dependent enzyme"
                     /protein_id="BBH91848.1"
                     /transl_table=11
                     /translation="MASLSERARAFLQEKPRFGVLGTVNADGSPHLTTMWFLLDGDEI
                     LMNTKVGRVKERNMRRDPRVSLCVEDGYRYVTISGRVRLIDDPAVAQMDIYRLARHYD
                     GEEAARQQMERFSKEQRVTVRLTCEQVVEHL"
     CDS             complement(60716..61768)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00480"
                     /product="hypothetical protein"
                     /protein_id="BBH91849.1"
                     /transl_table=11
                     /translation="MRYIQAYFTGSLLQRIIRVVLLVAGLAVVAALVWQGITAEGNPD
                     PTTPHLSPGAAILDTGLLVFREGLETILVLAAITASMMGKHEKYRRPIAVGAGLALLA
                     TLITWFVVVGILSSVNAPELHIQAATGLLAVIVLLIIMNWFFHRVYWTGWISFHNRRR
                     RSLLSLGEDEEARIVWGMVVLGFTSVYREGFEVVLFLQNLRMQVGSEIVLIGVLIGLA
                     FTATVGALTFVAHHRLPYKRMLVLTGVMLGVVLIVMVGESVQEMQLAGWLSTTPVPLP
                     IPDWMGLWFAVFPNVEGLVAQALAAILVIGSYFLAEYVRVWRPRQRGEQPALRPEAPP
                     AVEVATPAASATEASS"
     CDS             62504..63421
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00490"
                     /product="hypothetical protein"
                     /protein_id="BBH91850.1"
                     /transl_table=11
                     /translation="MPWWFFKHGGGSDPEPEGESAPAAGRLSSGSFSPKGPAADYSLP
                     YPLPLPKDVREIDRLDLQHYALRAVLRANYLAPVSKPRRILDAGCGTGQWAYELCQEF
                     PQALVVGLDIEQIKQTTSPPSNFRFVRANLLDGLPFANDSFDFVHQRLMALSLPITCW
                     PVLVRDLARVTAPGGWIELVEGGPDVAPAGPATQEVFTLIGQYLAARGLDGHGVIAHS
                     LGRYLEDAGLSAIEQQVIAVPLGEWGGSLGRLIALDFRETFVALSERVSQRFQIPREA
                     FVALLQTMQRECNELHTSYHFTVAYGQKR"
     CDS             complement(63537..64415)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00500"
                     /product="hypothetical protein"
                     /protein_id="BBH91851.1"
                     /transl_table=11
                     /translation="MPWFANDRFDDHDEADPASELTIPDSSYDLADLAGLRSADEPTE
                     PSSWQQSETASPSLPRARPTRRLSTPLLPWLPSEPEAEGWQPPPPPPQQSRARGWLPL
                     GTFLLGMLCGACALLVTLFLFLGADRPPLASAPPDRSELVLQLSSAYLTALVTRSLPQ
                     VGLPGQVSHVRLTLQPGALIEVMGDETLTLLGVSVTRPLTLQIQPLTSACHLQVHLLH
                     ADWGGLPVTWLAAPLEARLNELLTRQPAPAGLPSGFRYCAVAARTTADALWITYSAEP
                     TALRPLPADRRQALAL"
     CDS             64865..66295
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2RG53"
                     /locus_tag="KTA_00510"
                     /product="glutamine synthetase"
                     /protein_id="BBH91852.1"
                     /transl_table=11
                     /translation="MTPEEVLQFAKERGAKMVDFKFVDLPGTWQHFSVPLHELDEETF
                     VEGKYFDGSSIRGFQTIDDSDMLVIPDPDTAFMDPFTSVPTLSLICTVAHPGPGAHKQ
                     PYTRDPRTIARKAEEYLRSSGIADVSYFGPEAEFFVFDNVRFTSTQNVQYAEVDSDEA
                     HWNNGRNGGVNLGHRLRPKEGYFPVPPSDTLQDLRSEMVLTLEELGIPVEAQHHEVGG
                     AGQCEIDIRYNTLVKTADNLMIYKYVVKNTARKHGKTATFMPKPIFGDNGSGMHVHQS
                     LWKDERPLFYDPEGYAGLSQTARYYIGGLLMHAPALLAIAASTTNSYKRLVPGFEAPV
                     NLVFSKANRSAAVRIPNTDCPSAKRIEFRPPDPTANPYLTFAALLMAGLDGIRRKIEP
                     SEHGFGPIDRDLYHLPPEELREIGSVPGSLEEALNALEADHAFLLEGGVFTTDVLEHY
                     IELKRAQVNEVRMRPVPIEFALYYDA"
     CDS             66688..67680
                     /codon_start=1
                     /gene="moaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7UT69"
                     /locus_tag="KTA_00520"
                     /product="GTP 3',8-cyclase"
                     /protein_id="BBH91853.1"
                     /transl_table=11
                     /translation="MDPLIDSYGRRIRNLRISITDKCNFRCTYCMPAEGLPWLKKAEI
                     LTYEEIERLARLAVRMGIEQIRLTGGEPLVRRDVPELVRRLRQIEGLRSLSLTTNGVL
                     LKQLAGPLAEAGLTRINVSLDSLVREKFARLTRRDQLDRVLEGLEELEKYPSIRPIKI
                     NAVAMRGFTEEEVLDFVRLARRKGYVVRWIEFMPLDADQIWRKEDILTGAEIKAIIEA
                     EYGPLVPIQGDPSETARRYTFSDGIGEVGFINPVSEPFCATCDRIRLTADGQLRTCLF
                     ATEETDLRTPLRSGASDEELTEIIRRAVWHKELKHYIGDTRFKRANRTMSMIGG"
     CDS             67945..68175
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00530"
                     /product="hypothetical protein"
                     /protein_id="BBH91854.1"
                     /transl_table=11
                     /translation="MEHEAVDLLTVREVARQLRVDDTTVRRWIKTGMLEAITLPHRGR
                     RQAYRIRRATLEALLATPLVSSAPASPPRDRE"
     CDS             68557..69477
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00540"
                     /product="hypothetical protein"
                     /protein_id="BBH91855.1"
                     /transl_table=11
                     /translation="MTQRSAEELFHELQGELHAGFAAIHVPVQHSPAGVPYLTAPGVV
                     LLARPQTNLQGLAPFLEGFDSAYRFSEYVHDPTILPDGAQLCKVAGQTCYLSFGPRRT
                     LNAQAHRYFDHLKASRHGSVLEHATFSFFVYGVSRSLTHELIRHRAGFSYSQTSQRFV
                     DGRTLRFVERPEYRQDEHLHRLFLQRIERAAAEYAELSEYLLTRQQAGDPLLSAEART
                     DLRKRVQQCSRSLLPNETEAPLVVTANARAWRHVIEERTAPHAEIEIRELLVRIFVCL
                     ALVDPILFGDYTLERLPDGTYSVRTPYEKV"
     CDS             complement(69556..70116)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00550"
                     /product="hypothetical protein"
                     /protein_id="BBH91856.1"
                     /transl_table=11
                     /translation="MRVREARPGDLPQLRDLRQLAESIDGCLFSRAAWDDWQASLGQG
                     EPGPALFVLLDDDDDLNTWGQGGTLEGLEGELIGYTLLHLVRDAEGYHLRCEGTVHPR
                     HRRRGGGRALLICALNRARLWGAELEGESQQHGQPLWFEVLFPQRDPAAARLAARCEL
                     EAVAATTSAGQHAADDGLRLYRRPLL"
     CDS             70430..71599
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011058160.1"
                     /locus_tag="KTA_00560"
                     /product="cysteine lyase"
                     /protein_id="BBH91857.1"
                     /transl_table=11
                     /translation="MRDSGVQRLQAIREAMPATTAHTYLNTGTFGPLPRCVVEAMHER
                     LQEEWHQGRLGAEAQASLLACYREARQRCATLLNASEEEIALTDNTGEGLNIIAFGLN
                     WREGDEVITTNHEHISALAPLYQLRDRYGIRLRIADLGERGERSAVEEIARLITPRTR
                     LIVLSHVSYMTGARFDVSAVTALGRRHGVPVLIDGAQAAGAIAVDVQALDVDFYAFPM
                     HKWLCGPDGTGGLYVRRTALSQVQSTYVGYYSLKHEQSGAWELHETAQRFELGGRQTA
                     ALVGQSRVLRWLAEEVGHHWLQERIAALNRYAADLLSDVPGVRILTPQPGASGLLSLT
                     FERAEPETVVRRLAQEHNVLIRSIPERQALRLSTGFYNTEEELERVAGILRAWSS"
     rRNA            complement(71836..71945)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="KTA_r00010"
                     /product="5S ribosomal RNA"
     CDS             complement(72141..76013)
                     /codon_start=1
                     /gene="smc"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WFD8"
                     /locus_tag="KTA_00570"
                     /product="chromosome partition protein Smc"
                     /protein_id="BBH91858.1"
                     /transl_table=11
                     /translation="MYLKRLELLGFKSFATRTCLEFSPGITAVVGPNGAGKSNIADAI
                     RWVLGEQSMRQLRGRKSEDIIFAGGHGKAALGMAEVSLTIDNSTGWMPSEYSEITVTR
                     RSYRSGENEYFINKQKVRLKDVLLLLAQARIGHDSYTVIGQGLIDAALSLRPEERRSL
                     FEDAAGIRPYQVQRAEAEQRLRQTEANLQRLHDIVNEIEPRLGPLEEQARRAREYARL
                     QDELRQALVAWYHLQWHRLEAAAARAEAAETEQAARLRQLEQALQEAERLRSELLRLR
                     QEAQQQISAARRAAGEATGQLQRLERELAVAEERVTGMQRQREEQQRQERQLRERLIA
                     TEQRLTDLEEAREQAREALDEAAQALASLEATVAQVQKEYELDERRLRAAQNDLIQTQ
                     ARLGAAQTELGRQQKHLGERNRTLATRREAVAQAQQALRSLETRLAEQRSQLQVARDE
                     EQQLTQRKQALQRLQQEAQQELERLKGLVAEAERTRRTLADRLAMLRNWQRDLSGYSE
                     GVRALLRAPREQVPGLIAPLPRLLLAPAGLERAIEAALAEALQGVVVSTRAEAERCLS
                     YLEHQRAGRALLLWLHETSPSPGSVASPAALPPQADQERAALERLLEQSPDLRPGVLG
                     LAWQFTECEDQYRPLCYRLLTGVLLVEDLSTASRLQAQASAFSSWAGCPLRALVTRKG
                     EVLSLQQGWLSGGHAQGEQSGGLLHYERELRELPAQLEAQTAHIDRLNGLLSEIQRAQ
                     EGRRAEQASLDRELQKNAARLQELNRALAHSEREQERLQTELKMATSVEQQLAAEIAG
                     LEQELQATRERVQAHERAQQELQGLVEELQAQVEERAAVYRRQQEELGRLRTQMAVKR
                     QEAKTLERQVSEVQQQLQELRTQLDQQQLRLRQAEEQQQRLRESIARQQGELEQAREQ
                     ARQAGLRVQQREQALRELEQRLAASEQELAALRQEQSQCEVLYRRCLLESQRARDALE
                     ALQSQLQEDLGLNQPQELRQLLSQLAPPSAEEAERAEHEEDEEAKLRRLRRQIEQTRS
                     RLKALGGCDPDAPRQYEEERQRFEFLSSQIADMEQAAEQLHTIIGQLDATMTRQFETT
                     FEAVNARFREHFRTLFNGGQARLELVTSKGGERSSEGAEGRSAGRHSPSSQAARNGHG
                     AAPEEEPASAEEAASMARSGLPFGVEVIVQPPGKKVQDLSLLSGGERALVSAALLFSL
                     LEINPPPFCLLDEVDAALDESNVSRFCDILKRLAERTQFIVITHNRVTMTAAQAIYGV
                     SMGSDSVSRLASLRLSEAEAVVARQRSG"
     CDS             76359..77045
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00580"
                     /product="hypothetical protein"
                     /protein_id="BBH91859.1"
                     /transl_table=11
                     /translation="MLRWLICLTGLLVVGLGLLVGWQSHQVTYRSSGRAAIAHYLSDP
                     QTHEGYLQLAGSPTLYLVREQDFTPPIRGTATLKDLMLVGLVYRPDESTAIDVQARMG
                     THLVGQAYTVVALTLYDLNGTVTQAFTSTLYREHPQGFYENDWPLGAAISLPGAAIAV
                     GGGISLWGRRGRKEPTRQPIAATGGAQPAPAVLPPGSFAPALRLPTKPGPARPPGSGP
                     PEPQPPVQRH"
     CDS             77286..78596
                     /codon_start=1
                     /gene="arsB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006315676.1"
                     /locus_tag="KTA_00590"
                     /product="arsenic transporter"
                     /protein_id="BBH91860.1"
                     /transl_table=11
                     /translation="MFFLVPLPALTRTLLTTLIALLTLVGIMTRPFRWNEALIALAGA
                     ALLLLLGLISPLVALQTLLGDWNVFLFFLGMMALSAFADQAGLFDWLAIVAARLARQR
                     ARLLLLNVFLIGSLISLVLSNDATALILTPVVYTLVTRLRLPVIPFLFACTFIADTAS
                     FLLPVSNPINILVLSRFQLDLWTFLRLLWLPALAVIAINVGVFCWLYRREVRGSFDLK
                     RLPSPQEAIKVPGYFRYCCLVLIAVAVAYVLASASGFPLSCVALAGAALLLVGALRWQ
                     QFRPRELAGHISWSLFGFIAGMFIIVQAVEETGLTRLFGELLLHLSGGSTLGAVLVGT
                     LGAALGTNLINNVPMAVVLSASLQALHGQLAPTTQLAFVAATIFGCDLGPNLTTVGSL
                     ATVLWLLILRQRQLEVSGLDYFKVGILVTPPMLLVGAFLIWLLL"
     CDS             78713..79219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00600"
                     /product="hypothetical protein"
                     /protein_id="BBH91861.1"
                     /transl_table=11
                     /translation="MSTLRILGCLDGVNAELLGQAIAQLWPSAGEQRLQVGLLYVIDT
                     RPLGELERRRERFLRPPHLPRARQEQLRQVERETAQEILQEGARYVSGAELLQREGRA
                     EQEIVRCAQEWGATLIILCARSPRGEREPEHGPASVGHVARFVLDHAGCPVLLLRGAL
                     APRKEGLA"
     CDS             79663..80079
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00610"
                     /product="hypothetical protein"
                     /protein_id="BBH91862.1"
                     /transl_table=11
                     /translation="MSHKREEQLPEEKAGAKTILIVEDDDGIGAFLVQAISQETPHRV
                     LLVHDAFQALKAMRSIKPGLLILDYQLPGMNGLELFDQLQTMEDLASIPTILVSARLP
                     EQEIRQRQIVGLSKPLELDELLETIERLLGSGPAAR"
     CDS             complement(80109..81104)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257874.1"
                     /locus_tag="KTA_00620"
                     /product="formyl transferase"
                     /protein_id="BBH91863.1"
                     /transl_table=11
                     /translation="MLFFGMEGVFSALPLQALLRAGVTVCALVVPASWRQGPADQPKG
                     QRPPPLRPLLAPTSRHGARPLLPVLNRALAVSPVALALQAGLPVWEVSRLQAEEAIAT
                     LAAYQPDVLCVACFPYRLPVPLLTLPRLGAINLHPSLLPALRGPEPLFWVFREGLSET
                     GVTVHLLEERLDAGPIIDQERIGVPDGITYAELERRCALCGARLLVRAVQALAAGTAR
                     SYPQDEQRSSYRPAPSPADLLVPASDWPARRVYNFIRGVASWAGPLPVTSQQEMLFAS
                     DALAWWDPSAGRPLTSLPGALPATERLLPCGSGLVHLRLASGEAAHAVPASPEQS"
     CDS             81229..81546
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WEF9"
                     /locus_tag="KTA_00630"
                     /product="putative Fe(2+)-trafficking protein"
                     /protein_id="BBH91864.1"
                     /transl_table=11
                     /translation="MVNCVKLGRQLPGLEKPPLPGELGQRIYEHVSEQAWRMWETQRT
                     LLINHYGLNLADPEARKFLREQMEEFFFGSQEEKKPEGWIPEDVGVGVGPGRKGGGPA
                     RKK"
     CDS             81543..83090
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257877.1"
                     /locus_tag="KTA_00640"
                     /product="radical SAM protein"
                     /protein_id="BBH91865.1"
                     /transl_table=11
                     /translation="MKAPGAILLLSCYELGHQPLALATLQARLREAGYQPRAIDCAVE
                     PLAEEEIRAARLVAISVPMHTALRLGEALARRIRAIHPQVYLCFYGLYALLNADYLLR
                     DLADAVLGGEYEEPLLALVRALEREEQAREADGQRPDPGRLPRKLPEVPGVRTRERRV
                     GAWLQRPTFVVPQRHGLPELQRYARLEWNGRTHLAGYTETTRGCKHTCLHCPITPVYR
                     GRFFAVPQEVVLADIRAQVEQGATHITFGDPDFFNGPTHALRIARALHREFPAVTFDA
                     TIKIEHLLKHRHLLPELRELGCLFVVSAVESLNDEVLRRLRKGHSAADAVEAFALMEE
                     VGITLRPSLLPFSPWETLESYLALLDFFEARHLVEQVDPVHFSIRLLIPPGSALLESE
                     ERPAWLGELDETAYSYRWRHPDPRMDELQERVAALAEEGAQQGWDPVETFFQIKEEAL
                     AVAGRPFDRAAARKRYGEPRHPPRLTESWFCCAEPIRSHLNACCGETDQEQAVSCTSS
                     RCCGTGH"
     CDS             complement(83149..84489)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257876.1"
                     /locus_tag="KTA_00650"
                     /product="phosphoribosylglycinamide synthetase"
                     /protein_id="BBH91866.1"
                     /transl_table=11
                     /translation="MNSQSLQSLSLSQPQTEARKRVLLLMTPATYRGGAFASAARRLG
                     LEVVVGLDTPSGLVASWPAEVLALDFKAPEEAVERIVSFARERPLQAVLSVDDSAVEL
                     AALASEALGLPCNAPAAAEAARDKYLMRQRMAAGGVPCPVFRHFPLTADPEACARMVS
                     YPCVLKPRRLSGSRGVIRANTPAEFVSAFHRLKRILLTEGFDEQSTGFLVEDFIPGFE
                     VALEGLLTGGRLQVLALFDKPDPLDGPFFEETIYVTPSRLPGAVQEAIRSCVERAAAA
                     IGLREGPAHAELRVNEQGPWMLEIAGRSIGGLCSTILEFGAGMCLEELILRHALGLEL
                     PSLERRPEAAGVMMIPIPRAGILKGVYGVEEARQVPLITGVEITAPLNNPLVPLPEGA
                     SYLGFIFARGDSPAAVEQALRRAHGCLRFDIRRELPMLNAGLFPSTSPTGPGHP"
     CDS             84892..85581
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00660"
                     /product="hypothetical protein"
                     /protein_id="BBH91867.1"
                     /transl_table=11
                     /translation="MSHLVFWIDVDNTLLNNDHVKADLDRELRAVLGERLAERFWSLY
                     EAVRHESGVVDIPQALRRLREQTPPQQLPEGIYQQARALFEDYPFATALYPGALETLE
                     HLSRLGLTVIVSDGDHLFQAEKIASSHLAEAVGGRVLIYDHKERHLDETMRRYPGEHY
                     VAIDDRLDLLAACKAQLGERLTTVFVHQGRHAEQGWQQPGHYQPDRRVAAIAELQHLG
                     GDDFAPAKGRP"
     CDS             85732..86229
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00670"
                     /product="hypothetical protein"
                     /protein_id="BBH91868.1"
                     /transl_table=11
                     /translation="MVVLPREAQRALLSDAWNRRQIEACGLLTGQIDAQGNWHIVAVC
                     PLRNIAESPLYFEFAPEEVLQQELASPGQIIGVYHSHPRGPYGASQTDCETMRRVNQE
                     EQIPWIWLILCGPLTYGRHLEQARAGDLAAEAECRRWLWQRLLAYYHDPDQGLRRVAI
                     VLREE"
     CDS             86811..87782
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00680"
                     /product="hypothetical protein"
                     /protein_id="BBH91869.1"
                     /transl_table=11
                     /translation="MPAAGPGLGSYGQPGQPLQGGFPATPGGYQAPAGGPPYGTGVQQ
                     PYPGVGASYPGMPPYQPGQTGFAAPGTYPGGVVPGQTQVGGFPPSRPQPGGGPEQRNT
                     WIVVTAVGAVVVVFLLILLGAFVWMRGGSQTAAEPTATATAAPSPTPSPTPSPTPTPS
                     PTPSPTPTPSPAASPTPPPNPGFAWCDQCRNEGFTTQYPSNWSQSSTPDGTGIRFTSP
                     DSSEITASFKAPGPTNQTPDQLVANEIAQLPGATNVSPTTTTTIGGTTWRAASADYQQ
                     QSQDHIQVYATVYQGKAYLIEIQAPSGQFNQVNDQYFATMLATFQFV"
     CDS             88074..89360
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011462314.1"
                     /locus_tag="KTA_00690"
                     /product="adenylosuccinate synthetase"
                     /protein_id="BBH91870.1"
                     /transl_table=11
                     /translation="MAVVAVIGAQWGDEGKGKIVDELAARAHFVVRYQGGSNAGHRVV
                     HEKGEFVFRLIPSGILYPQTSCIIGNGVVVDPRGLLEEMEELERQGVDISRLYISERA
                     HVVMPYHFLLDRLEEEARGEEKIGSTQRGISPAYVDKHARSGIRMADLLDVDTFRSKL
                     ATILQQKNRMITQIYGQPPLSLEEIHGEYFQYGQRLRPYITDTQAMLHEALFERKTIL
                     LEGAQGALLDIDFGTYPFVTASSTLAANAASGAGLPPRSIDRVVGVYKAYITRVGSGP
                     MPTELFDEVGEEMRRRGHEYGTNTGRPRRCGWFDAVAGRFVAQLNGLDAMVITKLDVL
                     DTFPTIKICTAYRLYGKTIHSLPANLNDLAACEPVYEEVEGWQCSTSGISDYDDLPRA
                     AKHYLKRLEELLETPIAMISVSPQRGRTIQLQDVLA"
     CDS             89428..89928
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011228850.1"
                     /locus_tag="KTA_00700"
                     /product="prolyl-tRNA editing protein"
                     /protein_id="BBH91871.1"
                     /transl_table=11
                     /translation="MSSEQFAHLSPAARRVQEALAAGGFHCEVIELPTSTRTASEAAR
                     AVGCELGQIVKSLVFRGRESGRPILVETSGANRVDERRLGELVGEPIERADADFVKEW
                     TGFAIGGVPPVGHKKPLETFIDEDLLRYERIWAAAGTPSALFALTPAELQAMTRGRVV
                     AIKQPS"
     CDS             90025..90501
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011172509.1"
                     /locus_tag="KTA_00710"
                     /product="flavin reductase"
                     /protein_id="BBH91872.1"
                     /transl_table=11
                     /translation="MDLAAKKHVLRLFTYGLYAVSCADGGEVNAFTANWLTQVSFEPP
                     LVAVSVENDSRSLPMILRSRTFVIHVLPSGARELAGKLGKSALRDPRKLEGVAFHPGP
                     GGCPILEEALGWLACEVRHTVPAGDSTVLVAEVVEAGVQREGAPLTMAETGFRHAG"
     CDS             90752..91501
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00720"
                     /product="hypothetical protein"
                     /protein_id="BBH91873.1"
                     /transl_table=11
                     /translation="MSSHDEDHQLRAFPQRENADPLPSPAQAWGSLPAPANLPCVFCE
                     RSALTTVLQETPAFLVVADHAPVVEGHLLIIPKEHYACYGAVPAILDSELLALKRLVS
                     RFAARWYAPLLFWEHGVFGQTVFHAHLHCIPFGVVSYQQRLQPVASLARPVREQEDIR
                     RWYRERGHYFYLEDSRQALLFPPDPDCYRQVIYEVFWKSLSPEQQQRGWQRKEVRQRE
                     GISWLAATAGKWEQFCREEGTYAYPDRTRAG"
     CDS             91470..92390
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000787928.1"
                     /locus_tag="KTA_00730"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBH91874.1"
                     /transl_table=11
                     /translation="MPTLIEPVRDELVPAGRLRLHVVQWGRAGPPVVCLHGLTANAFC
                     FQAFADALADNHRVIAYDLRGRGRSERPERGYSVPIHAADLDQLLTALGLERTALLGH
                     SLGALIALYYAAWRPERVSKLILIDAGAPLPWKKPEEQPAWLRASIARLGTPVASFED
                     YRQRLQGLPFLGPWWNVYLDRYLEHDVEHLPDGSVRSRVYREGILEEGQRAGEARPAE
                     QWERVQAPTLILRAGAGLLAPDDQLLTEEAAKEMVAHIPQARLLEFPSLNHYTIIFGA
                     DPGPAQAVRAFLTLETRPLRLAKNEFRERS"
     CDS             92561..92707
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00740"
                     /product="hypothetical protein"
                     /protein_id="BBH91875.1"
                     /transl_table=11
                     /translation="MEDVQRAQERTSSQPACYVTLNVTTHPVRACHATGWVALNRSLG
                     CELR"
     CDS             complement(92735..94102)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258472.1"
                     /locus_tag="KTA_00750"
                     /product="cytochrome P450"
                     /protein_id="BBH91876.1"
                     /transl_table=11
                     /translation="MVQAPQAPVRRQPASPNLREILALLSRRNLPMTFLRLARKYGDV
                     VHVKGGPLEIFLLSHPEDIREVLVVQHANFHKGQGVQMTSRMLGQGLLTSEGDFHKRQ
                     RKLIQPAFHRQRIAAYATTMVEEASRLARSWQDGAVVDMAEEMMRLTLVIAGKTLFNV
                     DVEREASTVSQAMAVAMEAFIKIGLSPWAEQLERLPLPIRRRFYRARDEMDRVIYRII
                     EEHRRSGRDQGDLLSWLLQAHDEEGAMSDEQLRDEMTTLLLAGHETTANALAWTWYLL
                     AQHPEVAERLRQEVEQVLGDRLPTADDFSRLTYAEWVLAESMRLYPPAWSIDRTAIRD
                     CEIRGLAIPAGARIIMSQYVVHHDPRFYPEPERFLPERWTPEARAARPKFAYFPFGGG
                     PRLCIGEPFAWMEGVLVLATLIRSWEAELLPGQRIEPEAAVTLRPRYGIRMRLHQRQR
                     APVTV"
     CDS             complement(94155..94940)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010887993.1"
                     /locus_tag="KTA_00760"
                     /product="dihydrolipoamide acetyltransferase"
                     /protein_id="BBH91877.1"
                     /transl_table=11
                     /translation="MAAFQTRSQVITVDGTPVRYEYAGEGEPVVFVHGLSGSTKWWAR
                     NIPAIAQHYRVYLVDLPGFGAMRRFRRQFHLLQAPHWLDRFCQTLGLERFSLVGHSMG
                     GYVCMALAAQRPEQVKRLVLVASIGIPFERSVVQLLWPTALALARTTPAFWPTLLYDG
                     VRAGTLMILRAAHQIVALDARPLLPTLRTPTLLIWGAQDDLVPLAFGRQLHASIPQAR
                     LYVIARANHICMYDQPQVFNEALLAFLQGQEVGELASATAAAS"
     CDS             complement(95062..95655)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977395.1"
                     /locus_tag="KTA_00770"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BBH91878.1"
                     /transl_table=11
                     /translation="MLHKQKRKTRRERLIEVGLDLFSRHSYDEVAIDDIAAAANISKG
                     LLYYYFPTKHDFYLAVLRHSTNQLLELTEPDASLEPLERLRVGLLAYFTFAELHARTY
                     IALLRGGVGVDPQVAAILNHVRQTYVERVLQGLPESERHLPALRLAITGWVGFVEALS
                     LAWLAERQLSKEQLAELAIRTLLATINSLHELGSSPR"
     CDS             complement(95655..96473)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00780"
                     /product="hypothetical protein"
                     /protein_id="BBH91879.1"
                     /transl_table=11
                     /translation="MQSYQRGPLAGKRVLVTGAAGAIGSATCAELRRRGARVVGLDRR
                     GGEGIIQADVTSSEAVERAVAQAIEELGGLDILINLAGIGLPQDAGAPPGEDVALTLE
                     VNLLGPWTVTAYALPALLASRGRVINVASGLAFATVPFASAYAASKRALAAWSDALRM
                     EYGSQIGVTTVYPGYVRTPIHAAAEAAGLSLADLVREEPLEAVVRTLVRCCSGRVRRD
                     VATTRLGALEIGLARHLPALVDLVILLRLRRLARAHRYDRSPLAQRMIKRWGIT"
     CDS             complement(96559..98109)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00790"
                     /product="hypothetical protein"
                     /protein_id="BBH91880.1"
                     /transl_table=11
                     /translation="MSRAPSVQPPTAGEAEQSGTGNEPSQRARRQIRAGEGSLTLGPT
                     GPVKGLTGAVQQAVTTKGGTRMASRYCIIGAGYSGLGIARAFQEAGIAFDIFEQNDDV
                     GGNWLNGVYDATHIISSRNSTGYEEYPMPASYPDFPSRQQVLDYLRAYADHYGLRRYI
                     QFRRRVERIEPLDQRGLSGWRVTLDDGRSLEYRGVIVANGHHWDRRYPNYPGSFSGKT
                     LHSKDYKNADDFEGERVLVVGAGNSGCDIAVEAALCKRIKQVAISMRRGYYFLPKTIA
                     GIPVAEMEMPWMPLWLQKLIIKAALALIVGPNSRYGLPKPDHDLFDRHPIVNSQLLYF
                     IRHGLIAPKPDIARLDGKQVHFVDGSSQEFDTIVWATGFNVSFPFLDHGLFTWEHGYP
                     RLVAHLMAPDVANLYIFGLLQPRGGAGPLISRGARLLVELIQCQERLDVPIANLIARW
                     EPPSARYLVGVQETMRSIERLRRRLRRLAPRGSQPGGFSHDQSQPRPASEAAPGYAVP
                     AAGHASQS"
     CDS             98330..99190
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977233.1"
                     /locus_tag="KTA_00800"
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="BBH91881.1"
                     /transl_table=11
                     /translation="MTVATIRTVGVVGCGLMGSGIAQTCVQAGYTVVVREVTDELLQK
                     GLQRIFDAWEMLERKGKVSREQVEEYRGRLRGTVALEELAGCDLVIEAIVERMEEKLR
                     LFTALDRLLRPEALIVSNTSSLSVTQMAAVTQRPQRVCGLHFFNPAPVMKLVEIVRPI
                     TASDETIETVRQFAESLGKTPVLAKDTAGFIVNFLLIPYLLSAIRMLENGVASRDDID
                     TAMKLGCGYPMGPFTLLDYVGLDTTLWAAEAIYEEYKEPLYAPPPLLRRMVAAGMLGR
                     KSGRGFYEYS"
     CDS             complement(99279..100163)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00810"
                     /product="hypothetical protein"
                     /protein_id="BBH91882.1"
                     /transl_table=11
                     /translation="MAMSFTEDELQSFNTILERRLTAHRQEIERAFEQRLSTLSRDFD
                     QRLAQLQQELLRTLTHKLNDQQNELNIALSQKLGTQQTRLVQALGHEVEQRQQQQQQQ
                     IESALDRLLAAQLMGIEQLLNQLLNQRQAGPSETPTGSSPTTAEPTSSEPTSPPPPES
                     IEVQTELSWDDLMEAIGRALDERLERLYSSLRELSRNWEQHLAVQRAHANAVEPYHDN
                     QTTFQQVFQSIERLEQLVESLQVAMTANHALLSNRLYHHQHLPLERAHPSSQQLHRAS
                     PPPGPEPRISLSEEHEED"
     CDS             100371..101246
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225127.1"
                     /locus_tag="KTA_00820"
                     /product="4-hydroxyphenyl-beta-ketoacyl-CoA hydrolase"
                     /protein_id="BBH91883.1"
                     /transl_table=11
                     /translation="MPRAIDFHVHLPTTEFIEVTLGPYARAAERFFRTEVKLKDIEQM
                     AADYAELDMVGVLLAWDAETATGLPPLGNDYIAEIVRRYPRQFIGFASVDPHKGRAAI
                     KEVERAIKDLGLAGVKFHPGVQAFYPNDRAFYPLMEKIQELGVPALFHTGTNGLGAGM
                     PGGMGIKLDYTRPIYLDALAADFPGLTIIGAHPSWPWHDEMIAILQHKANVFNDLSGW
                     SPKYIPQSLLREAATRLQDRILFGSDYPFITPQRWLRDFEALDYFSPEVREKILWRNA
                     QKLLAHTPVAQMVFS"
     CDS             complement(101422..102450)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223063.1"
                     /locus_tag="KTA_00830"
                     /product="N-acetylglucosamine kinase"
                     /protein_id="BBH91884.1"
                     /transl_table=11
                     /translation="MRDCVLAVDGGNTKTLALVATLDGQIRGYGRAGCGDIYHAPPGA
                     EAREHEPAALQEIERAVETALKQAGSTPANLKAAIFNLAGADWPEDFALLEAAMRARG
                     YGEQLLIQNDALGVLHAACIGSPTNSGVAVICGTGAATGARGPDGRTWHSSHWQDSVQ
                     GASQLGHRVLTAVFHAELGITPPTTLRERVLTYFGASSVEEVLHRLTARLPQQTRPIG
                     GLAAALLDEAEAGDATARHLVTEHGSALGDFANVAARRVGLEGLPFPLVLAGGVLRHP
                     SPLLAEAIIARVHSRSPEAQPTRPRFEPVVGVLFSALELAGARVDEQLIARLQPTLPP
                     ASFFDTLG"
     CDS             complement(102521..103846)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005461090.1"
                     /locus_tag="KTA_00840"
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="BBH91885.1"
                     /transl_table=11
                     /translation="MARIKLAYIGGGSTRAAGTMASFIAQGEHFNGSEIVLIDLNEEH
                     LTIVQTIARKLARARGLDLTITTTTDRRAGLRDCDAVLTSYRPGGFEARHLDESIPLK
                     HGIIGQETQGPGGFFMALRSIAVMQDIIADMEAVCPRARLFNYTNPINIISEAVTHHS
                     AIPTISFCEGPIMDAARFARYAGLDPTRLSVRFRGLNHGSWGINPRYDGQDFLPLLEE
                     TYERLRRQHPKGEEESADPELRYTLRQLRLAITMQALPNHYLQYYYYKDELLAELQAK
                     PTTRAQDIMASVPDYWAHYREQAEQDVPALDPARSRGGLHELELAIDVMDAIYNDRGE
                     LWYVNVPNQGAIPGLPDDRVVELVGYADRHGVTPLVHEPLPAHLRGLINQLAEYQALT
                     AEAAWRGNRRDAIRALASHPLVLSLSKAEALYDEMAAAHRAYLPERLLR"
     CDS             complement(103972..104814)
                     /codon_start=1
                     /gene="cobB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WFY1"
                     /locus_tag="KTA_00850"
                     /product="NAD-dependent protein deacylase"
                     /protein_id="BBH91886.1"
                     /transl_table=11
                     /translation="MEQSIPQELRQALRQARKIAALTGAGISAESGIPTFRDAGGLWT
                     RFKPEELATREAFERNPRRVWEWYNERRQKAASAEPNAGHRALAEMEHFVEEVTIITQ
                     NVDGLHQRAGSSRVLELHGNLFRTKCLAQGHPAEPDLTSKDDVPPRCPRCGSYLRPDV
                     VWFGELLPEQTYYQALQAVLSCDVLLVVGTSGIVEPAASLPHTALRAGATVAVINPEI
                     TPLLEEETTYGLKPGRLYDLRGKAGEILPALVNATWKAPAQVDPPTPSSESNPGSPPS
                     RDRD"
     CDS             105168..106070
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011035563.1"
                     /locus_tag="KTA_00860"
                     /product="dehydrogenase"
                     /protein_id="BBH91887.1"
                     /transl_table=11
                     /translation="MRTVTEGPGVLGFAGLGRMGLPMARNLLRAGYRLRVYNRTPARA
                     EELVAEGAQRVERPRDLAEPGGIVFSMLADDAALEAVTLGDDGLLAGLAPGGVHVSLS
                     TVSPAIARRMQRLHAERGCAYVAAPVVGRPDAAAAGKLWICLAGEPVARQRVLPLLQV
                     LGQAIFPFGDEPALANVVKLAANFLVGSALEALAEALALAEKQGVERTALVEMLAQTI
                     FACSVYQNYGWMIAERRFVPGFSQRLALKDLGLVLDAADQAQVPMPLASLVHDRLLSG
                     VARGRGEEDWTALARAVDESAGLA"
     CDS             complement(106128..107372)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00870"
                     /product="hypothetical protein"
                     /protein_id="BBH91888.1"
                     /transl_table=11
                     /translation="MKKKNTLKKSNQNVIYIAICALMLLLGACGQASEGSASQQAATG
                     AAVSRPAATRPDWQGRDLESDRHLLARAQQILAGMTLDQKLGQLIIVEYLGHDYQDSG
                     LQEMIRDQYVGGFMYQESNHNFDPPYDSIGAVAAFSQQAMQDAKIPLLIATDQEGGLV
                     NRLYRFHGPLPSAEAMAATGKPSYAYQQGSQAAEWMRQLGINSDLAPVVDVHSVDPPV
                     LETRMFGSDPQTVATYAGAYLQGLQEHQVAGCLKHFPGLGAITSDPHNGLPVVNRDLA
                     TLNRIDLAPYRIMIPKYEPAMIMATDVLMPAIDPQLPAELSPKAIDGVLRQQLGYDGV
                     VITDGLYMRGISERWSLSEAAVMAIEAGDDLIEGPYTPSQVADVVNALKTAIEQGKLT
                     ETRIDQSVERILLLKLRYGIIH"
     CDS             108152..109729
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_052846891.1"
                     /locus_tag="KTA_00880"
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="BBH91889.1"
                     /transl_table=11
                     /translation="MREQSHHHDVIIIGAGHNGLVAAGYLARAGKRVLVLEQRDRVGG
                     ACTLEEPFPGFKVSPCAYVVSLLRPEIIRDLELTRYGFEAYIKDPQMFVPFPDGSYLF
                     IRASSERTAENIRRFSPRDAAAYPRFLHFFERASAILTPLLLEEPPTLAELAARFRGE
                     DEEIYSQLMFGNLYDLLAEYFESDQVRAAFAGQGVIGSFIGPKTPGSVYVMWHHMFGE
                     VNGQRGLWGYVRGGMGRISFALAASATAHGAIIRTGARVASILIHNGRAEGVRLESGE
                     ELRARAILSNADPKRTFLQLCADAGLDPAFLARIKRFKTESPVIKINLALKELPSFSC
                     LPGSEPGLQHAGSCEISPTPDWVQRAYEDALRGELSRHPYIEAYMQSATDPSLTPPGK
                     HLISLFCQYAPYHLQGRTWSEEVKEEMTERVIATMCAFAPNFADAIIARQVLSPADIE
                     ARYGMTEGHIFHGEITPGQLFGQRPTPECARYRTPVAGLYLCGSGTHPGGGVMGAPGH
                     NAAMALLRDWGESLPAS"
     CDS             complement(109913..110902)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00890"
                     /product="hypothetical protein"
                     /protein_id="BBH91890.1"
                     /transl_table=11
                     /translation="MEFDPGMILYQDHHMLAVNKPAGVVIHPTYKHSDDTLWNMLLSY
                     LEQQGPEQWEPPELPDEPGWERAPEAVRLMLRERRAARLRKQEGPLPKPVLLHRLDKD
                     TSGVVLLARTENARRYLGRQFNEHRVVKRYLAVAFAGAPAWTRPLQPLLVRRLTEDQP
                     RLSEPDVKAEDVPASAALAITGSEPEPLVLPVGSLWLLDGPIQRDPQDRRRCVVGPAG
                     LPAQTVLRVLAQHGRFLFLEARPITGRIHQIRAHLASLGYALVGDQTYAPAPLEGTPQ
                     AALQRQFLHAFSLTVRRYPDEVPVTFVAPLSEELRLWLEAYFPAALALIARDQ"
     CDS             111168..112163
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00900"
                     /product="hypothetical protein"
                     /protein_id="BBH91891.1"
                     /transl_table=11
                     /translation="MSLIQYYREHLQLRNPVLIAALAGWNDAADSATTAIKFLIDRWK
                     PVKIAEIDSEDFYVFTETRPIVRIVDGMQRSLIWPVNQFSAHGLPEQERDIILYLGVE
                     PQLKWRTFTECFLEICRHFHVSEVILLGAMLADIPHSLAVPITGSSSTPELQERLREL
                     DIHSSGYEGPTGMIGVLQDACRRASIPAASLWAAAPHYLAATPNIKVTAALLTYVNSL
                     LSLDLDLNEIQADAVRFEEQITALVARDPEASAYVRRLEEQIQALTDEEDEDEDEEEP
                     PETDTARGPSSNLDHPAGTGPLPSADVLIRSVEELLRREREQGPPDTDDDSKNEG"
     CDS             112164..113648
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00910"
                     /product="hypothetical protein"
                     /protein_id="BBH91892.1"
                     /transl_table=11
                     /translation="MSNRLYTLEEVLHPRSVAIIGASRAPQKWGHVAARQLLASFPGE
                     VYLITPSAPEILGQRTYPSLRAVPNPVDLAIITTAFQHVPAAVDDCIAHGVKGIVIVT
                     AGFSETGPVGRALEMELVARCHKHGIRILGSNCMGVYVRRARLNALGMAFPLPEGPIG
                     LVSQSGNLGMYLYAQAQLDGLGFTTFLSMGNGADVGFPEYLQYLANDPETKVIAGYVE
                     AIDEQTLRQVTEQLYRQGRYKPVVILLSGATEVGVRAALAHTGSLATVRPDHDTALLG
                     SGVVRVIRSDELYPVARALALQPPTPQGGRRIAIVGDGGGSVVASGDAALRCGLEVPI
                     LKEETQQRLRALLPARATATNPIDVAGAADEDPLAFARLSEICLADPDVDGVIITGLF
                     GGYRWLLSEAFGAREEEAARELGRLVRQYGKPVLVQTIYARYDKDIPALQLLRQEGLP
                     YYESIEITCRAMAALAEIGQFLTRMAAVARTADQDQESGMCTDG"
     CDS             complement(113742..114755)
                     /codon_start=1
                     /gene="ncd-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014206433.1"
                     /locus_tag="KTA_00920"
                     /product="nitronate monooxygenase"
                     /protein_id="BBH91893.1"
                     /transl_table=11
                     /translation="MTLLPERIQTRFTELVNIRYPIVQGGLSHLSFAELAAAVSNAGG
                     LGQIGCACFTTPEELRAEIQKAKRLTDKPFGVNFPIGHIPLEPFLDAALSEKPAVISI
                     TGGNPEPLLKRIQTSGVKVRTMVLVAGVRAARKAEALGADAVIAVGFEGGGHLGRDDI
                     GTLVLTPRVVEAVSIPVLASGGIADGRGLAAALALGAEGVELGTRFVAVRESNAHPHY
                     QQALLEAQETDTMIIERSIGRPARVLKGGVAERIRQVEEELEREGAGAEERLRRLLPL
                     ISGAVNKRAALEGVLDEGFVWAGQVVGLIHDIPTAQELIERMVREAWEICQRLPGLFT
                     SPR"
     CDS             115148..116767
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_00930"
                     /product="hypothetical protein"
                     /protein_id="BBH91894.1"
                     /transl_table=11
                     /translation="MSITFSLDKSTRTLLYQQLAEQIKSAIVRGELTEGMQLPPVRRL
                     AAELGVSTTTVAQAYDLLATEGVIGGHVGRGTYILSSPLTALARARAPFGGEAQATTS
                     QRLDWAAGWLGGLSPQASRAGQLQWLTQRALERWGDPATILNLSSGYPDVSLFPIERW
                     ERSMARAGRLLAEEARQASSLQVLQYGSTLGDEALRSYLCQYFTRFGFQPEPREILLT
                     SGNQQGLDLVARVLLSPGDPVFIEEPAYLAALDIFEQQRAACHPIPVDEEGLRLDLLE
                     QVLEAPAARPRLLCVVPTAHSPTGATMSCERRRRLVELACRYNLLIVEDDYCSELFYS
                     ETGCEPPPALRSFDREGRVIYLKSFNKLIFPTLRLGCIVAAAPILARLVEGKQAFARG
                     TSLPLARALLEHLSDPAFEEELCFYRQEYRRRRDALLNLLEEELAGLECRWTVPMAGF
                     NLLLLLPPQLQEYEVVEKAADRGLLLVPGQLFRVENGQPHCPSVRLTFADKSPEQLRE
                     GVKRLSSTLRALLHGGGSGQGRASPDLFTAV"
     CDS             complement(117412..118197)
                     /codon_start=1
                     /gene="crt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P52046"
                     /locus_tag="KTA_00940"
                     /product="short-chain-enoyl-CoA hydratase"
                     /protein_id="BBH91895.1"
                     /transl_table=11
                     /translation="MSYRYLQLERPQRQIAQVTIARPEQLNAIDRAVLDELSQLIDEL
                     EQERELLVVILTGAGEKAFVAGGDVAYMAAMSMAEARRFVYAGQEVLLRLERSSKVSI
                     AAINGYALGGGLELALACDLRLAAEGAQLGLPETSLGLLPGWGGTQRLARLLGPGLAK
                     ELIFTGRRVGAEEALRLGLVNRVVPRERLLSEAQELAQHIARNSPIAVQQAKRAINQG
                     LQTSLDQGLVIEAEAWLVLFATHDRQEGTRAFVEKRAPHFTGE"
     CDS             complement(118228..119397)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815523.1"
                     /locus_tag="KTA_00950"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBH91896.1"
                     /transl_table=11
                     /translation="MDFQTSEEHTLIRESIRQLASRYGLEYWREKDRQHAFPEELWQE
                     LARAGWLGTIIPERYGGAGMGLLEMAIVVEEMAASGAGATIAQLFMMTPVFGALTILR
                     HGSEEQRERYLPALARGEFDFSMALTEPDAGSDTLATKTLARRRGDEYIISGQKVWIS
                     GVDRAGGMLLVARTTPLEEAPRRTFGLSLFLVDPRSPGISHQPLEKVGTHCVTSSMVF
                     IDELVVPKTALIGEEGEGWRYLVDTLNSERIVTTAGCVGAGDLAIRLAVDYANTRVVF
                     GQKIGRHQAIQFPLARLKAEIEMARLMNYKAAWLLDHHLPCATEANMAKMVAAEAAFS
                     ACDQAMQTLGGYGFSTEYHIERLWRDVRLFRLAPISQEMVLNYIAQHVLGLPRSY"
     CDS             complement(119546..120883)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2VEM3"
                     /locus_tag="KTA_00960"
                     /product="dihydrolipoamide acetyltransferase component of
                     pyruvate dehydrogenase complex"
                     /protein_id="BBH91897.1"
                     /transl_table=11
                     /translation="MSEASEGAQIEVIMPRLGLTMQEGTVVQWVRHQGERVNAGEIIC
                     TIETEKITHEIEAPSSGYLQILQPEGATVAVGAVIARILARQEEVTGEAARPLSGRAA
                     GQAQEQQPGAVVTAPPQQETGSGDGRGRLEISPVALRMAQDLGVPLERVQGSGPRGRI
                     HKADILRAWQQLRSESSQPVATASPSAPVAPAGASTQDVARRSPGETEQARGPAYDRE
                     PLTPMRRRIAEHMLSSLQGTAQLTLMMEADVTEALRLREELQQEQQRLGGTAITITHL
                     LIKIAACALREHRRLNAALVGDEIRLYREINIGVATALEDGLLVPVIREADRKSLAEI
                     SAELQALAEQARRGRLLPDALTGATFTLTNLGAQGVDYFTPILPREQGAVLGVGRICE
                     QVRASADGFQRYSRLGLSLTFDHRLIDGEPAARFLARIKYLLEHPATLLLSAH"
     CDS             complement(120947..121924)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815527.1"
                     /locus_tag="KTA_00970"
                     /product="pyruvate dehydrogenase subunit beta"
                     /protein_id="BBH91898.1"
                     /transl_table=11
                     /translation="MAEKRYVRAVNEALREEMERDPAVCLLGVDVGAPGGPFGATRGL
                     QERFGPQRVRDTPISEAAIVGLAIGAATLGLRPVVEIMFMDFLALVMDQLVNQAAKMR
                     YMTGGQARLPLVVRTQTGYRDSAGPQHAQSLEAWLAHVPGLKVVMPSGPYEAKGLLKA
                     AIRDDNPVIVVENRTLYALAEEVPDEDYVLPLERAAVKREGRDVTIAAIGIMVREALA
                     AAEVLAERGISCEVIDLRSANPLDLQTVRTSLEKTNRLVIAHSATRCGGVGAELAAAL
                     GEEAFYLLDAPITRVGAAFAPIPFSPPLEQAIVPDRTAIMAAVEGVLAP"
     CDS             complement(121973..122959)
                     /codon_start=1
                     /gene="pdhA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002263117.1"
                     /locus_tag="KTA_00980"
                     /product="acetoin:2,6-dichlorophenolindophenol
                     oxidoreductase subunit alpha"
                     /protein_id="BBH91899.1"
                     /transl_table=11
                     /translation="MPTEQLDGGLARRLLTTMLTIRAFEEAVRDHFAARHIPGFIHLS
                     IGQEAVAAGLASALERDDYLYVTHRGHGHVIAKGADLKRVAAEIFGRATGYCRGRGGS
                     MHIAAFEVGVLGANGVVGAGLPHAAGAAWALQLQGRRQVAVAVFGDGAVNTGLFHETA
                     NIAALWRLPLLLLCENNGYAEFTPLSVHAAVESVAERAAAYRLPAWRVDGQDPLAVRA
                     VVCEALARVRAGEGPALVECLTWRVRGHYEGDPQRYRSPAELQEAAAHDPLRLFSERL
                     RREGLLSEAEEAALVAQARKEVAEAIAYAQESPFPDPASALDDVLSLPSEAG"
     CDS             complement(123082..124458)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015040685.1"
                     /locus_tag="KTA_00990"
                     /product="hypothetical protein"
                     /protein_id="BBH91900.1"
                     /transl_table=11
                     /translation="MEKTLSTELARFVAGLSYEALPAQVIDKAKTCLLHGLAVGLAGS
                     ELEYAHIARRLVALAEPGTGEVSAPVIGSALRASLAGAAFANGVILHGRVQEDTHGTA
                     HPGTMIIPALLAASELRPVDGRAFLTALVAGYEVLAAVSRDFTALTTPRGFRASAIYG
                     VFGAAAAAGKALALSVEQLAAALGFASAFAGGTTQSFASGTMEWHFENGVAARNGLLA
                     ALLAREGARASAIALEGPAGFYQAFAGTREGLERVVSHLGETWEILNVTFKPYPVCAF
                     NQSPITAALALVREQELSPEAVVRIELEMNPYEANYPGMAYTGPFTTVEQTQMSAPFC
                     VAWALAHRSFSFAALTRFDDEATHALIGKLEMRARQDLPPLSLRLAVHLVDGRTLEQE
                     LRVDASYYAWDFARELELIKELQPDLPLTPEATQRLIELIRSLEQCQDVHELTRLLAV
                     PAPSSVSS"
     CDS             complement(124934..126511)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228885.1"
                     /locus_tag="KTA_01000"
                     /product="fatty-acyl-CoA synthase"
                     /protein_id="BBH91901.1"
                     /transl_table=11
                     /translation="MTFNFSSVIEHYAERHPEREAIIYEGRRLSYGQLQERCEALACA
                     LKGHGLEAGDIVAILLKNCPEFLETIIAVNRLGAVALPVNWRLVGEELVYILNHSEAK
                     LLVSEREFAPVVEAVRGRCPGLRHIVGVGEDIPAGWLVYDELLAARRGQHLPAAEVGS
                     DDLHRLMYTSGTTAYPKGVMISYGNLYWKNIAQITLFGITAADRTLIVGPLYHVGGLD
                     LPATSVLYAGGSVVILRKFEPLALLEAVQRERVTNMWLPPSMINMLLQAEGIWNYDLS
                     SVRFIIDGGEKMPIPLIEKLLSLFPQAWFADAYGLTETVSGDTYLDKAKTIEKIGSVG
                     KPCLHLELRIVDENDQPLPPRQPGEIVLRGPKVFKGYWKDPEATAAALRNGWFHTGDI
                     GYLDEEGYLYIVDRKKDMIISGGENIASLEVERVLYEDPRVLEAAVVGMPHPRWGEVP
                     VAYVVVKPGQTVTAEELRAACQAKLARFKVPHHIFFIEALPRNPSGKVLKRELRLRVA
                     EDVAATAKGASSNQSAN"
     CDS             127163..127384
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01010"
                     /product="hypothetical protein"
                     /protein_id="BBH91902.1"
                     /transl_table=11
                     /translation="MSVYPRSSEPFLFVHKEPVQGQCPECGSHHLRRYPVLSEGGWWL
                     VTKCQDCLYSLERERWGRLGSIQLLSETL"
     CDS             127507..129537
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011393465.1"
                     /locus_tag="KTA_01020"
                     /product="5-oxoprolinase"
                     /protein_id="BBH91903.1"
                     /transl_table=11
                     /translation="MLAVDVGGTFTDVVALDDHAIKVTKVPTNALETERSVLEGARLL
                     DIASKPIFNHASTVGLNAIITRRLPKVAFLTTLGHRDILDMGRTWRPLDALTDPGWRR
                     PFGDAAAPLVPRYLRRGISERITADGSVLIPLDEAQAREQLAILRKCRVQGVAICLLN
                     AYVNPQHEIRLRELVREELGDIPCSISSEVSPLAKEYARASTTLIDVLMKIIFSQYSR
                     NLLSGLREAGFSGQVNFADCAAMLRPAEIAMEQPFRIVFAGPAAGAVSSAHFGRLIGE
                     ENLICCDIGGTSCDISVVTRGQPVVNATFELEHDLLVNALSIEIASIGAGGGSIVSIS
                     PSGEMRVGPESAGADPGPACYGKGGTAPTLTDTCLLIGLLDPERFLGGQMRLNVDLAR
                     AAFERLPTSLSLEKRIEYAYKIGLNNIAEGLLDITIKQGIDPRDYSLIAYGAAGPLFL
                     PAILEQIKAKRVIVPPYPGFFSALGLLSSDLVYSDSRSAYMVLTPEVAPTIAQIYRAM
                     EEKLLARIPGDKSQVRILRSFDGRLLGQTWETPFVEVPAGEITAETIATMIANFHRVY
                     EQRSGNRFEAIPVQSVTYRVQVVVPSQKVEYPFLGEGQPHEVAPERWTTLRYLGNGEL
                     RVAEYERDHLTSGALVRGPAIIREPTSTIHVVAGQVARVGSWGEIVIEPAAS"
     CDS             129686..131635
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010870477.1"
                     /locus_tag="KTA_01030"
                     /product="5-oxoprolinase"
                     /protein_id="BBH91904.1"
                     /transl_table=11
                     /translation="MVRVESPVLIKDLDEDAFRARYHCDRFTATVLSSRLRYIVQHMC
                     TGLLTNAFSVILRDWYDFASTIAGPPELDYPTPAVSNSLVLFLGTMTDAVRNAVEEFG
                     PQNLQPGDVLMCNDPYRIGTHVNDVCFIRPVFFEGRLVGFVNLQAHMLDMGGVVPAGF
                     SGTKRNVYENGLVIGPQLLYHGDRPVKSAWSLIFDNARFGNLMLPDIKTIYQNLRLGE
                     NLLLETIQRYGVESYLGAIRYACDLSAETMRQALARLPDGEFEGEDFIDCDGIDDSEE
                     YHVKVKVRIRGDRAEVDLSGSSRQARTSINGGWLDAKTAVAVALKYLLDPRSPFTSGT
                     LRNVDIVLPEGTFFSAMPPDGAIFLYWESTQPLLLAIFRALKDALGPNAVGGDYCSLN
                     IHNANGVRNGIPWVTMAQCGGEHGPWGATKDGDADSYMVFYLANNLDPATEAIESDFP
                     CVVLRKEYATDTAGAGQHRGGAAVVKDTLWLTEAEHYSMPLHTKAPSGFGVYGGKDGA
                     VGAVWVWEPEAYEQVQRAGLVGFDAAVYRQATPVAGVLNPETHALDRQGRYFHFARVP
                     VWRTRPRTMFRYLTNGGGGWGNPLERAPERVLRDVRDEYISIEAARELYGVVIRGDPY
                     HDPEGLQIDYEATQACRRAAADHNH"
     CDS             131907..132527
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003892139.1"
                     /locus_tag="KTA_01040"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BBH91905.1"
                     /transl_table=11
                     /translation="MARKRDIIEVAARLFARHGYHGTSVRDLSEALGLGKASLYHHIE
                     SKDELLFWVHEQFINPLLEETERRLSAEMDPRDALRTLSCILMRVIADYRPYVTVFLN
                     EWRALSPERAAAIREKRKRFEGYIRAALQRGIEQGLFRPLDVSVTCLGFLGMHNYAYQ
                     WLNPEGRLSPEEIAAIFSSIFLRGIAQGPGEVQNQAAETPASPQAG"
     CDS             132764..133516
                     /codon_start=1
                     /gene="y4mP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014206049.1"
                     /locus_tag="KTA_01050"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBH91906.1"
                     /transl_table=11
                     /translation="MAAAPVSDRINLSGQVAVVTGAARGIGQATARVLAREGASVAAL
                     DVLPCTETVQAVEALGQRALSLHCDVSDAQQVRQAIDEVVARLGPPHILVTCAGVVSR
                     TDLEAMTVEEWDRVLAIDLRGTFLCVQAVYPHMKARGYGKIVCVGSVAAKVGGVISGP
                     HYVAAKGGVHSFIKWVAKAGAPHAIYVNAVAPGPVWTDMTIGHPYRDDMSPLGRLGDP
                     RDIAEAILFLASPASNWITGLTLDVNGGMLMD"
     CDS             133838..134746
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01060"
                     /product="hypothetical protein"
                     /protein_id="BBH91907.1"
                     /transl_table=11
                     /translation="MNGSPEQSAQHKPAEAFSSRQHTYVIDPENPGELARLTMQERII
                     TEGMGGLFPEGQALPPTARVLDLACGPGGWVLDLAYAYPEAEVIGVDISPAVVEYAST
                     QAQTRRLANASFQVMNVMEPLAFPDASFDLVNGRLLAGFMLPAAWPRLIAEGYRLLKP
                     GGVLRLTEGELSLTTSPTLSALHELGTRALKLAGQSFSPDGRHVGITPVLPRLLRRAG
                     FQDVRLHASAIDWSIDTPAYYSLFKDCMMGLELIRPFLLRAGLIQQGELERQIQQALA
                     EMQQDDFCALWTLVTVWGQKPAASSA"
     CDS             complement(134809..135138)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01070"
                     /product="hypothetical protein"
                     /protein_id="BBH91908.1"
                     /transl_table=11
                     /translation="MLPLLIMILCILLLGGLVVLCYLYLRCGLGRPRLTDFSQWRGRW
                     PGTGDARRAAAMPEPAQPGGNDESLLLAVDVVTETSRQARLIAFLLLSGLLLSILLLL
                     LTLGAQP"
     CDS             135427..135978
                     /codon_start=1
                     /gene="msrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WBS2"
                     /locus_tag="KTA_01080"
                     /product="peptide methionine sulfoxide reductase MsrA"
                     /protein_id="BBH91909.1"
                     /transl_table=11
                     /translation="MSDHDQLELATLAGGCFWCTEAVFKRVKGVVSVTPGYAASRVPN
                     PSYEQVCSGQTGAAEAVQIRFDPRVISYEQLLEIFWHMHDPTTLNRQGNDVGTQYRSA
                     IFYHNDEQRRIALASKEALEQAHTYRDPIVTEIVPFSNFYPAEDYHRDYYDRHPNQPY
                     CMIVIAPKVQKLLKEYAPVVREG"
     CDS             complement(136196..137176)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012582559.1"
                     /locus_tag="KTA_01090"
                     /product="2-alkenal reductase"
                     /protein_id="BBH91910.1"
                     /transl_table=11
                     /translation="MMETEERDAQALDAYSRAVTTAAERVGPAVVRIDVERGGLRWPY
                     MSPAYGGPGFDATGLGSGFLFASDGQVLTNAHVVEGARRIRVTLADGRSFDAGLVGAD
                     PDADVALLRIGADHLPVAEFGRGKLRVGQLVIAVGNPYGLNWTVTAGVVSALGRTLEG
                     RGGRRLTNLIQTDTPINPGNSGGPLVDSSGRVVGMTTAMVALAQGLGFSIPLETLQGA
                     IARITRSNTARAGSVALGVGGMRILLDPALRRSAQLNQVSGMELLEVHRDSPAERAGL
                     RRLDIIVAADGEPVTEPRDLQRIVRRHLPGERLIVTFLRDGKLRRVTAVL"
     CDS             complement(137468..138457)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013230804.1"
                     /locus_tag="KTA_01100"
                     /product="LLM class F420-dependent oxidoreductase"
                     /protein_id="BBH91911.1"
                     /transl_table=11
                     /translation="MQQQSTALAHESGEAERPARERVGLALFGHAGAAHMLTRLQQAE
                     KAGVRQFWMTQLPTTVDTLTLFAAALVQTQSIRLGTAIVPTYPRHPLVMAQQASTLEE
                     LGPGRLRLGIGTSHRHAIEGVYGFSMVEPLEQLREYLTILRAALWEGRVDFQGRFYTA
                     HAAFAQPRRVPILISALRSRAFRLAGELADGAISWMCPHPYLLEKAKPALVEGAASRG
                     RPVPPLLAHVPVALGTDWGQVLAAARNSLGFYTRAPFYRNMFADAGYPLSDDGLLPEE
                     LIKNLVVWGDEASVAARLRELLARGLDELVVTLVPLVDDRRELEQLMALLGSL"
     CDS             complement(138629..139417)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226922.1"
                     /locus_tag="KTA_01110"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH91912.1"
                     /transl_table=11
                     /translation="MSESTTTEVIRTEGLVKRFGAVTALNGVSLYLRRGEVLGLVGDN
                     GAGKSTLIKILTGFLQPDEGRIFIDGVEVRLRSVSHARSLGIETVYQDLALINELSVY
                     HNMFLKRESLLKPFPLLNNRQMRRRAREYLESMGVNIPSVDTEVARLSGGQRQSIAIA
                     RAVYSQARILLLDEPLAAMGAKEGSLIMNLIRTLRNEGQVSMIMIAHNYAQVLEVCDR
                     VNLLQHGRIVLDKPAAQTSVDELTELVMREYRAGVNQRRQPAAG"
     CDS             complement(139414..140442)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226923.1"
                     /locus_tag="KTA_01120"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH91913.1"
                     /transl_table=11
                     /translation="MAEKVLSAPPLEAKPEPTPERPNRWLRLVRLFLRQREASIVVVA
                     VALVIYFQLSNRAFLSAQNVRTLSQFVAATAIISAGEVMLLICGEIDLSVGQVYALAP
                     FIMYFANQAGLPLVVGLILGLIVCALVGLFNGLITVVLKVPSFITTLGTLFLINGLTL
                     TISQGFPVLTPSEGLVNEVLGHASYSEIVWAIAITIVMQIVLSWTRWGLHTVATGGNL
                     LGASEVGVNVARIKIGNFMLCSVLGGFAGTLEAFRITSIDPLAGGTDIMFQAVAGAVI
                     GGTALTGGLGTIIGAFLGTLVLSILRDGFTLLGVSAFTFDIILGAAILVAMILNVRLR
                     LWREAGRE"
     CDS             complement(140873..141967)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226924.1"
                     /locus_tag="KTA_01130"
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="BBH91914.1"
                     /transl_table=11
                     /translation="MAGSSFSAYFERLPLRRRRLLQTALAGGAGATLASALAACGGQP
                     SSSSPTGVAGNFPSHPKWNFVFINHVTTNPFFVPTQYGIQDACALVGCTYQWTGSANS
                     VVKEMVDAFNAAIAAKADGIAVSIIDPTAFDDPVNRALDAGIPVVAYNADAPAGSKNR
                     RLAYIGQDLYQSGYRMGQRIVSLVGSGDVVGFIATPGSLNIQPRIDGAKQAILDSKAP
                     INFVEVATGAQVEEELSRIEAYYLGHPNIKGMFAVDAGSTQGVAQVMEKYNLAAKGVH
                     GGGYDLLTKTLQEIQAGNLDFTIDQQPYLQGFYPVIQLFLYLLSGGLMVPSDTDTGLL
                     FVTKENVGPYLRTQTRFEGSSSKEQLVPRS"
     CDS             complement(142292..143089)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532967.1"
                     /locus_tag="KTA_01140"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBH91915.1"
                     /transl_table=11
                     /translation="MARTFRSLRRQNLSAQVVREIGLSIMRKEFQPGDALLSEPELSQ
                     QFNVSRPVLREALKVLAEKGLIEARPRTGTRVRPRTDWNLLDPDVLTWQYEVGPDPAF
                     LEAVCEVRLMFEPMTARLAASRATAEEIETIERACDRLEELVEEAEPYIEADLAFHSA
                     ICAAAHNELLQRIVATLAAPLRASRLITVRLPGANRRAMPLHRRVAEAIRQRQGLAAE
                     EAMRDLIVLTTEDVHRAFGYIDTGPDLLLSTCLDESETPAAPAEGGE"
     CDS             143226..144440
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028331.1"
                     /locus_tag="KTA_01150"
                     /product="dehydratase"
                     /protein_id="BBH91916.1"
                     /transl_table=11
                     /translation="MKIVDVKTHVMGTAWRNLTFVRVITDEGLEGVGEVRMLNHTDAL
                     LGYLAEAVPNHVLGHDPRHIEDLVQRMYRNDYARAGEIAMSAIATIEIACWDIVGKAL
                     GRPIYELLGGPVRTRIKAYANGWYTVERTPEEFHRAARRVIERGYRALKLDPFGSGFY
                     ELEPSEKRKAVALVEAVRDAVGPDVELLIEMHGRFNPATAVEMARELAPFKPSWIEEP
                     VPPENLAALKKVAEQVTIPVATGERLHTRYDFRQLFELQAADIIQPDITHCGGLLEVR
                     KLAAWAECYYLLVAPHNVGGPVSTAAALHLAAVMPNFKIQEHFNDLNEEWVKQAAPGN
                     PEVVDGYFSLPQGPGLGVTLDQAFVAAHPRQRIFFNLFAENWHLRQAVQPPLQAQGPT
                     SSAAEQPPAPSA"
     CDS             complement(144507..145244)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01160"
                     /product="hypothetical protein"
                     /protein_id="BBH91917.1"
                     /transl_table=11
                     /translation="MGTLLLSIIAFCSTCAGGIVAMRQREQLQRVMAFAAGALVGLAT
                     FQWLPRLFSVLSLLPGERFAAFIALACGFFTFHLLERLALHWQESRRELAADGPAQPL
                     LGVVSVLLFSLHRLLEGATISLGFLVNPATGLLLAGAIVLHNLIEGLNAVVLLLANHS
                     SHRQALAWLLFFACTPLLGTLATIWLSLPTVLLPRYLGFFSGFLLYLGASHLLPVAQR
                     PGELWSLLWTLAGAGTALIMTVLLQPL"
     CDS             complement(145654..146064)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01170"
                     /product="hypothetical protein"
                     /protein_id="BBH91918.1"
                     /transl_table=11
                     /translation="MAQVGLLEDNPRIAKLCATFLDFAGHRVVHYRHPRECLEALRVE
                     KPAAAEADGQTPEALPIDILILDLYMPDMAGEDVLRQLRAHPHTRDLPLILCTAAPAS
                     EIEQAKSIAPRAIVVEKPFKLQTLTAAIEALMRS"
     CDS             146465..146929
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01180"
                     /product="hypothetical protein"
                     /protein_id="BBH91919.1"
                     /transl_table=11
                     /translation="MSESEQEQGRALPVSVVRFGLGKEIQLYPEELVVVKREEGEETR
                     VPLGQIQRLILMPGDPNPSRLILLADLDENETVMLAEGMSNVRDFRAMLPRLRELAPH
                     IQFDPPDMEEQLRQALNTRRAWTLTCYGAILLVCILLYLIYLLVAYIGSHHP"
     CDS             complement(147015..148250)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01190"
                     /product="hypothetical protein"
                     /protein_id="BBH91920.1"
                     /transl_table=11
                     /translation="MPRLLLTLALGWFLLLSAACAPSSGILAGGAWESTGLQHEHIRA
                     LAVSATDPAQLYAGDARNGIFASDDGGQHWQPRNQGLPLPLAVNALSFDATERRLYAA
                     TDHGVFVSSDGGGHWRTASAGLPTDSCTALAFDLERASVLYVGTAHHGVFVSSDGGEH
                     WQAANRGLPSGSPINDLAYVSDQGQLWAATVGGIYRSDNGGQSWRPLSRGLPANITVY
                     RVRPAALSGGEPRLVFAGTDQGIFLSHDDGASWQRNKEGLARLSVRAILIDFRTPTTL
                     YIGTNIGVLRSNDSGQVWSAIIGSGGLPKNRQVYALALGASDYGQLFAAVDDVYVFPG
                     SSGGWNTNAVVPLLLAIAFFVLLYWLTRSNRRHRRGLLRAAQPAAEHNEQPSAQQAGH
                     NQRLPSARQQNRDAPLDRS"
     CDS             complement(148252..148665)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01200"
                     /product="hypothetical protein"
                     /protein_id="BBH91921.1"
                     /transl_table=11
                     /translation="MVCPECHTSCGPEDQRCPACGAELVIPVSRSLVTRPRPALAPRR
                     LQWPALLRGPVQGVAAGVGALAVGVGLELLRRRLAALLSRSAGSTRHAAQALPLLSDL
                     KRLGPLAPEKAPKLPRGYEIQETVIYVERVIRRRS"
     CDS             complement(148783..149988)
                     /codon_start=1
                     /gene="kynU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I235"
                     /locus_tag="KTA_01210"
                     /product="kynureninase"
                     /protein_id="BBH91922.1"
                     /transl_table=11
                     /translation="MTTDASRVPYPAPPAVEHPELETYRREFPILQRKTYLNSCSLGA
                     LSQRGMARLTEFMERWNEWGAHAWYEIWLGELEQARRQFAAIIGAEPHEVAIAPNVSV
                     ALGAIASAFDYRQRNKVVLADMDFPTLAYQWLAKRRLGVECVFVESPDRIYTPPELFE
                     DKVDERTLLVATSRVFYTSGYIQDVRAVADIAHKQGAYLLIDDYQGTGQIPIDVEAMD
                     IDILVSGTLKWLMGGPGLAFIYIREGLLSQLEPTLAGWFGHREQFQFKTRELAFRPDA
                     ARMELGTPAIPAVYVANAGMEIVREIGVETICERTRYLTNDLIARAREHGWRVHAPRE
                     PERRSSIVMLEMEQPEQIVAELIKRNIIVDSRPGLVRISPYFYNTIEENAIVIAALEE
                     ILEERRRSG"
     CDS             complement(150520..151704)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004552205.1"
                     /locus_tag="KTA_01220"
                     /product="cysteine desulfurase"
                     /protein_id="BBH91923.1"
                     /transl_table=11
                     /translation="MSLRHPGLRGDLIYLDYNATTPVDPAVVDAMLPYLREHFGNPSS
                     AHSYGWVAHQAIERARSEVAALLGCAPTEIIFTGGGSESDNLAIRGVALARRAQGDHI
                     ITQVTEHPAVLNTCRALERLHGFRVTYLPVDEHGRVSPEQIERAIDRRTVLVSIMHAN
                     NETGTLQPLPEIAAVAHRYGALVHSDAAQSVGKIAISVADLGVDLLTVAGHKLYAPKG
                     IGALYIRRDLGLNLEPILYGGGQERGLRAGTENVAACVALGAACRLAAERLPSESARL
                     RRLRDLLWQRLRQHLGDRIQLNGHPDERLPNTLNVSINGVSGEEVLAATPEVAASTGS
                     ACHEGSADPSPVLLAMGLARERALGALRLTLGRWSSVDDVERAAVSLLRSIDVLTRNA
                     RP"
     CDS             complement(151777..153279)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258696.1"
                     /locus_tag="KTA_01230"
                     /product="aromatic-L-amino-acid decarboxylase"
                     /protein_id="BBH91924.1"
                     /transl_table=11
                     /translation="MEEREEQKRTTLDPAQQEQATGDMDPESFRLYAHQVVDWIADYL
                     EHVGDYPVLARTQPGDIRRALPAQPPQQPESMQAILADFEHILLPGITHWNAPGFMGF
                     FGITGSGPGILGELLTAALNVNAMLWRTSPAATELEQVALDWLRQMLGLPGPLFGVIN
                     DTASAGTLYALAAAREALGDLQIRQRGMSGRPEVPRLRYYASQEAHSAVDKAGIVLGV
                     GLEGLRKIPVDDDYRMDVAALEQAIKEDLAAGWRPFAVVATVGTTSTTSVDPVPAIAD
                     LCERYGLWLHIDASYAGSAALLPEYRHILAGCERADSFIVNPHKWLFTPLDCSVFFTR
                     KPDIVKATFSLVLEILRTDEEAPNLMDYGISLGRRFRALKLWMIMRYFGQEGLQARLR
                     EHIRLGQLLAQWVDEAPDFERLAPTPFSTVCFRAHPRGLDDEAQLTTLNERLLQRINS
                     AGHYFLSHTRLRGRYSLRAAIGNLRTTEATIRGLWQELQEGLQAELASLS"
     CDS             complement(153754..154029)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257693.1"
                     /locus_tag="KTA_01240"
                     /product="NrdH-redoxin"
                     /protein_id="BBH91925.1"
                     /transl_table=11
                     /translation="MERHATASTIAQQQIKVYATSWCGDCRRAKRWLDEHHIAYDYID
                     IEKDEQAAAYVMQVNGGLRSVPTIVFPDGTILVEPSNRELAQKFGLS"
     CDS             154407..155006
                     /codon_start=1
                     /gene="sigW_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q45585"
                     /locus_tag="KTA_01250"
                     /product="ECF RNA polymerase sigma factor SigW"
                     /protein_id="BBH91926.1"
                     /transl_table=11
                     /translation="MSHLDEQTLLHGLLTSPDSFFEQVVLYYEQRLFSFALRLSGNYE
                     EAQEITQDAFVRAYQALTSYSAEQVRSLALRPWLYQIVLNVARNRLRKRHRSPFCVSL
                     EQRGADPEEEPESAPAEGPEARVEARERQHLLQQALLTLPLIYREVVILRHIEGLSYP
                     ELARLLNQPVGTVKARVHRGLAQLRQVLAEHHAREVLYD"
     CDS             154999..155844
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01260"
                     /product="hypothetical protein"
                     /protein_id="BBH91927.1"
                     /transl_table=11
                     /translation="MTERQSCSLSQARRLVRELRTPQREALPPPGLRSHVLFSVGLAD
                     GYLRLSSPIGPVFVALNARGISAVDCAEDAAHFEARFRAAFGRCIFPLEPDEAPAWAR
                     QIEPALQRGQTLDLPFDLRGCSSFEQAVLYTTLTIPPGEVRPYAWVAREIGQPRAVRA
                     VGNALARNPIPLLIPCHRVVRSNYQLGNYSLGGSLNKRALLQIEGVDLVLLEQLATRG
                     VRYLGSTVTHIYCLPTCYHARRIAQEHRQPLSSPEEAARLGYRPCRHCRPALPVEQPA
                     DLASE"
     CDS             complement(155865..157103)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_048061129.1"
                     /locus_tag="KTA_01270"
                     /product="digeranylgeranylglycerophospholipid reductase"
                     /protein_id="BBH91928.1"
                     /transl_table=11
                     /translation="MQEFRDVVVVGGGPAGLAAAEAVARQGVGVLVLERQSEIGYPIH
                     TSGGSWIQDMQELGVPAQLYHPIPQVFFLSPRQEVALRYDPPVACVLDVRGLYQHLAA
                     RAIAAGAELRLRHVVDQVLLEEGRVCGVTVRDACGRRLTIRSRVTIDASGMARHIAVR
                     AGLAKAFRRYGYGAEYDLYAPHYPQEELYLLMGSRVAPSGYAWVFPRGQGRVRVGVGV
                     IHPDSDDDARSYLGYLLHEEPRLRDKFRGASPLEYHTGLFPAEGPAERFSWAGLLLAG
                     DAGGQGSTLVGEGIRFAIYAGRLAGEIAAEAIKEDDISASFLERFDQRWRARFGREME
                     LAYLINRHIAAYGDEQWDDALRLLRHLTPAQWAQAMRGEFTAGLLMSIVARSPRLIAS
                     GGRRLIGRLLERLGQGASAN"
     CDS             complement(157195..157902)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256262.1"
                     /locus_tag="KTA_01280"
                     /product="GlcNAc-PI de-N-acetylase"
                     /protein_id="BBH91929.1"
                     /transl_table=11
                     /translation="MVIVAHPDDAEFGCGGSVARWVREGWEVYYVICTDGGGGGPDEA
                     QDVSAEARQRMVETRKAEQRAACQILGVKEVIFLDYPDGQLQPTRELKRDLVRLLRTY
                     RPTRVVCQSPERSWTPALLLGRYHPDHLTAGRMALEAIYPASQNAWDFPELLAEGLQP
                     HRVREIYIVGAPVLNHAEDISETIELKLQALRAHASQVGEHFEQVEERIRRGAQECGA
                     RHQLAYAEEFHRTENAR"
     CDS             158295..161126
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01290"
                     /product="hypothetical protein"
                     /protein_id="BBH91930.1"
                     /transl_table=11
                     /translation="MQFTRQAQQQPQQLMTCPQCDNVVPIGAPFCNICGTRLYPPPNA
                     AQAPAASGPATTAPGAVAPAQPGATSAPTAAPETYDEEEEEEEDYEEYEEEEGGEEEE
                     EGESSKSAPTAAPPPAPGEIHSLLQRLEEQIGQIDIYFPANLPDKAQKINAWKKQLQR
                     ASACARLLERPQIQQIESQQALRLRHHIAEAARALDYTREYTVKLVGHAGAGKSTLLA
                     ALIGQDIFPRLAGGAVTGVRTRVRLCRDDEPEEMHVHFLTRAAFGHLLSQTQQAIKTA
                     PTQKMREALANELNILLKASEAFGDTYLKDDQPHVEVVPRERWKTESRRYIEEPARDS
                     EEPRLTRVIDYVEYRVHAGPRSVLPPNSVLVDLPGGAAGQIYHDLMLREELKQVDALL
                     LVIGNNRFGDDERIQRIFEEVRQAVLQNRAFDVASRMLFLVVTHWDEINSPASQEKAL
                     GSLRPFLRELPPGYASYHRHGPRHNYFFYPLRALDALLATLGLAGTSLDEERQQEGRE
                     YAGRLLGVYPELLKLAPALPPTTSAQEFEQVTREQHEAMLQYSGLPELTHDLQVFLTE
                     NRYEVQLRHAETQLAMALQLTEDLCWEQMSQLGVESHDLQELQQEMRSRQARRSAARF
                     EHLQRRTNAMLEAWNDALRQFDAAISSEKSVFQRVLQTAHERAAQRVKIRITQGHFDH
                     YIKVGNRRPDDSPAMEIGNRWTDIDGWGLIKALRQSLCMALERELNDPARTLAEAFLM
                     PIAYKEEVDGSLDINRVALGEFGGELDEIQKAYNKLKRSIREKARDICLYVTLGELLN
                     EEKYAPTRENPAVGALYRLTNAQGKAEEIIQQARRLMVPILDTICSGLARSTEQRIAR
                     LFRYELDKLQERQVYDSDRLEAQPVTQNGTFSDIVTRLYSHLTERVHTSEALRQQLDN
                     LQAQREAALDQWVDLIQEVEALKTIHRQD"
     CDS             161881..162753
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01300"
                     /product="hypothetical protein"
                     /protein_id="BBH91931.1"
                     /transl_table=11
                     /translation="MHGLIFTTWEKYLGERFGGGLLSAYREAIGESPSATPLVSRFYE
                     DSALLEGVAVASRLSGLSPDQLLREYGRYFILNSLTGHLCKYILSGVNSAYDLLLTMR
                     DVHSRLRKTAAGLTPPLFNYEFAPHERSVVLIYDSPRKLCSVLLGAIEGAAERYGEEV
                     AIYEQSCMKRGDSLCRIEATFARGSRSAEQLSEQARANAFEQQAHQNALKELGQRILT
                     ILPTEEAQALTLSEIRQALAQRYRLSPTYQRPAVLLQVLRHLQFAGYAAATNGQPGDN
                     LTTRRYWRVTTYWE"
     CDS             163096..163425
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01310"
                     /product="hypothetical protein"
                     /protein_id="BBH91932.1"
                     /transl_table=11
                     /translation="MTTWSASNIDKGLKVYSADEHHLGQVVAVYPESVRVRRGPLLFW
                     TDRFYPYTAIAGRQGRSLILKMSAAEARDEQWRKRPAYEQHPGDVLQTFYDRGHGVED
                     PLDPERD"
     CDS             163907..164899
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005816337.1"
                     /locus_tag="KTA_01320"
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="BBH91933.1"
                     /transl_table=11
                     /translation="MATGEDEAALPESEAAADLALDPLLESSDELELESAEADLTDEV
                     PERRSSNVRQALGSEDAFQSYLRDIRGLGLLTHEEELELARRAAEGDELARRKLIESN
                     LRLVIAIARRYTSTGVPLVDLIQEGNLGLMRAAEKFDYRRGCHFGTYATWWIRQAVSR
                     AAGEQSRLIHLPEHVATRLRKVRRVAAQLSQESGLDPEPEQIAAACNIDVNEVIDLLS
                     VIEQPVSLDAPVDDEARHSLADTLEDSTAPAPAETASRHLLGEELHRALSTLTPRERA
                     VITLRYGIGDGRSRTLLEVGKELGISRERVRQLEVVALMKLRNFSGNASLRECV"
     CDS             165865..166428
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01330"
                     /product="hypothetical protein"
                     /protein_id="BBH91934.1"
                     /transl_table=11
                     /translation="MTTAGPYPVPPAGNGPAGANPYATGAGSPAAYAAPTAQAPGQYG
                     AYPNAGSPAPNPANVVSPGAYPPQAPLVLRCPVCWAISPVGTSNCPGCRTSLAGVAPV
                     PATAVQQPPNQQGGPGGFLQSDGGKLAMGALGGAAAVIGGEMLLHGLERSLEGNDYGH
                     HHHHHHHGHEGGVLGDLGRLADDVGLI"
     CDS             166779..168056
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011460386.1"
                     /locus_tag="KTA_01340"
                     /product="peptidase M16"
                     /protein_id="BBH91935.1"
                     /transl_table=11
                     /translation="MQYERTTLPNGLRLLTMCVPGIRSASIAFFFAAGSRYEPDHLAG
                     ISHFIEHMLFKGSKNYPSARILSETIEGVGGVFNGSTGKELTSYTARVPCEHLDVVIE
                     VLADMIRHPLFDPQEIEKERQVIIEELSATRDDPQEWSGLLLDQIMWPGLPLGRDDAG
                     RDETVATISRQDMLTYLEQFYRPNALVVSVVGNFHHARVQELIEWLFRDWEPRPLRTW
                     TPCPPPRDVPPVAVVYKETEQTNLSLGTLGVAHSSPDYYALMLLNAILGEGMSSRLFQ
                     SIREERGLAYDIGSYTSSYYETGNLVVSAGVDPSQTEAALRAIVQELNRLCEVPVSAA
                     ELERFKAYVCGGLILGLESTQQVASWLASQECLLGRVVDVDEMIRHIQAVTPQDLQRV
                     ARTCFAPEWRRLALIGPEDPRQIDHFQKLLTAA"
     CDS             168081..171188
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01350"
                     /product="hypothetical protein"
                     /protein_id="BBH91936.1"
                     /transl_table=11
                     /translation="MLKTLSTLREYLQYTEDALSAGRIEEALEHCQYVLSHFPHALEA
                     HRLLGEIYLAQNRLTEAQQTFDWVLTNDPENVLAYCNRALTSERMGDVETALDCYQQA
                     YELSRGNSQIRQEFNKLSARSGQPGFMFSRAGLARLYMRGDLLFQAIQEWEAVLAATP
                     DRLDARTGLLEACWRDGDYERAEQIATALLEEIPGCLKALLLLAHMTFPHNPARAREL
                     LQRAEALDPEMTMARELFGDLMAASPDDPFLALVRKDAVLIPPPGRSAASSSSVALGA
                     SPRPGPALPEEQGQESEENEPIFGWTTPDPYPLALTTPPPASPTPAPPSLSSQQPEAP
                     KAASSGEVQRSSSPSWPLSSSDLSFGEQGLSWEEQPSWSSATAAASAPEEDLGLPADQ
                     APAHPAWLDALDTPFYRQPSGSLASPTPPPEPSPAPSPSAEAAMAQEAGDRTPIEEAP
                     DVAWSQPSTAPAEQPSEQHQEAEEEIFPFMQAGADPEEGWPEWLKSLGAETMEESASE
                     SSPSVSSPRGAVWGEPEGPKQEGERAGLADESRQESAAPPAFAEAESYTRSEQEGLAE
                     SSAHAPAEEDYAASGSAYSSPAMWDELAGGGFSTPMEKPAWLEQLQASHSAFESQEAS
                     AGPLWPPEEPAASSRASTTPAPPAASIWGEESAVSSPPPFQPSASPQGTAQAEAGIPW
                     LEQLAGWSTASEGTADSAAGSQPSSAFAVPASRSEPAPSPAVQSQGQSASSWLAELAA
                     SASQRSAEQSSAPPAAEQRLVTTLEDLEQQLYAQGFVPLQPGELANFAQQGTPSQSAA
                     PASEQPSRLTHEEQRQLTVPPSASELEETVRAPLGQPSRYEEPKQAPEPLWPATPGPS
                     SSPAQQGPSQGQSPSLPSYRPDALLEDELETTMKRPVFRLQPAQARPQAPGGRSAPAR
                     PAGREASGSGTPSAGTGTARSSQEGEVNYKEHLIRGYQYQLAGAYDEAMQEYRIVIRN
                     QPELLGEVISNTRALLKLAPKYAPGYRVLGDAYMRQGEYLQAMEAYNKALTMTRRAKG
                     QGTSS"
     CDS             171418..171771
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256591.1"
                     /locus_tag="KTA_01360"
                     /product="dynein regulation protein LC7"
                     /protein_id="BBH91937.1"
                     /transl_table=11
                     /translation="METILQRLTELDEVSGVILVGKDGLIVSGTLHSEDEEMIGALSA
                     TAFGSLSTYTKQINQGEIRHAIIETQQGTIQMAEVGDLILVVTTQQTRSPNLGRVRLE
                     MKKACRQILPLVTSQ"
     CDS             171873..172337
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010878270.1"
                     /locus_tag="KTA_01370"
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="BBH91938.1"
                     /transl_table=11
                     /translation="MERTLIIIKPEGVQRGLIGQILSRFEQRGLKLVGLKMLQMSPAL
                     AEEHYAVHKGKPFFAGLVKHITSGPVVVGVVEGRGAIKMVRTMMGATNAAEAAPGTIR
                     GDFALEIGYNIIHGSDGPETAAREISLFFKPEELLDYRLVTEPWLYEEQENQ"
     CDS             complement(172938..173216)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01380"
                     /product="hypothetical protein"
                     /protein_id="BBH91939.1"
                     /transl_table=11
                     /translation="MAGTLDSNPANSPNWRKHRNGCPFYRERWFPDSDIEAGEPLYQV
                     FCMKGTPPLTLEEQNRCLRSKTCCWRLAERAEKKEAVKGKGTRRSSPS"
     CDS             complement(173936..174166)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01390"
                     /product="hypothetical protein"
                     /protein_id="BBH91940.1"
                     /transl_table=11
                     /translation="MQYGPKRDAFPFSRWRRKEWGGLTVTITCGRSWLRGLWLGLAAQ
                     STTGEEKCNQEESSLYNQGRKECRQGPGQILF"
     CDS             174176..174646
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01400"
                     /product="hypothetical protein"
                     /protein_id="BBH91941.1"
                     /transl_table=11
                     /translation="MRRFRPLFLWLVIAFLALLYVVNSLYSALLEGLHLPLQTNDQVI
                     LESSRLAPLTTIVLLVLAVIVAPLCEEIFFRGFVFPGLRRGLATGWAIVVSALVFGLA
                     HADLGSLPVLIVIGLLLALLRWWSGSIYPGLLLHILNNGISAAVILLYMVGRLH"
     CDS             complement(174813..176165)
                     /codon_start=1
                     /gene="paaK-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q74CD7"
                     /locus_tag="KTA_01410"
                     /product="phenylacetate-coenzyme A ligase"
                     /protein_id="BBH91942.1"
                     /transl_table=11
                     /translation="MSDRKYFNEEIETLPRERLRALQLERLKAVVARAYKQNAFYRRL
                     YDEAGVKPEDIKSLEDIQKLPFLEKKTVRAAYPYGLAMVPPGGEQGALEVHATSGTTG
                     KSVPVFATRRDLQNWAELNARELWMVGLRPGDILLNCYGYGLPTGGFGFHYGALEMGV
                     MVIPMGSDARQYERIFEFITDFGVTAMCMTPSVGLYLGRKARELGIDFSRTRLRIGLF
                     GAEPWPWETRLKLEEYFHITAYDEFGMTEFLGPGMTCECEQRNGMHAWADAFLVECID
                     PETGEWVEEGQEGELVWTWLTGEGTAMIRYRSRDLSRLWWEERCACGRTHPKIGAIKG
                     RTDDAVSIRGLLVFPSQVEAALLRFPETGTNFRIIVDRRDGLDTFLLKVEVKERQLLE
                     QSERCQELARAMAEAVKSVTGNTPKVELVPPDSLPRATGGESKTASARVEDRRKLPSA
                     "
     CDS             176375..177046
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257887.1"
                     /locus_tag="KTA_01420"
                     /product="beta-phosphoglucomutase"
                     /protein_id="BBH91943.1"
                     /transl_table=11
                     /translation="MAEQGLQAVIWDLDGVIIDSAQAHFRAWQRLAHEEGWTLSEEDF
                     RATFGMRNDRIIPLLWGEMPPERVRALSERKEAYFREILRQNPTGLALPGALELLEAL
                     HEAGIAQALASSTPPENIALISELLGLQRYLQALISGETVERGKPAPDIFLKAAATLQ
                     VPPAACLVIEDAVAGIEAAHAAGMRCLAVATTREPEALREADLVVRSLTEVNVERLRA
                     LVPAS"
     tRNA            177233..177328
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="KTA_t00010"
                     /product="tRNA-SeC"
     CDS             177562..179733
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01430"
                     /product="hypothetical protein"
                     /protein_id="BBH91944.1"
                     /transl_table=11
                     /translation="MCYLRLSLRHLLPVSGGAKECGPRLRRWLIGIGQVALLLLVALA
                     MQWPAPVNGDELVAAWPGSDLVVSHWPMALELQRTVAQAHRLPLWNPYFGGGLPLGAD
                     PLAALFYPPTQLVHFFSLRNYFFVLMTLHFLWAGLGTLLLARRALGLPRWPALVAAVS
                     YMATPRLISHLGAGHVTIMQTVCWYPWLALAAWATVRQPLRWGPALAVCVAMTLLAGH
                     PQMAYYGLLMLGTVSLWLLVQQVWQSGWRPALLSAGCLLLACGLGVALAAIHLWPLWE
                     LMRYSTRAYALHTKDQISLTQFLHALVDEPPLGWLTWEGMIAPGLSVLCLAVFGIASR
                     VRKAWLLALGVILVASLAMGQASKVYHVVQHLLPDFDRFRGLARIWFLGLLGIALLAG
                     LGAAGLTQPLQRFSRLAGLATGMALLALVATNLVLLDQDYSQVGSVSLITTPSRVALV
                     AQQLAGTGRVYGVQENIPQLIAAQLELRLADGADPLLIGAYVQYMDRAGGYYGTGYQQ
                     RIPYDGPNVHPDPRLLGLLHVTVLVSKRPLHDSHLLLIGEIDGTFLYRNSLDAGPAYL
                     LRPGSDGQPPSLAHYQRLPATIQLLRLQDDEQSFRVTSATGGYLVVATTAYPGWIAVL
                     DGQRVPVQSFGGLMPAIRIGPGTHTLSYLYRPASVLRGAALSGLGLLALLLWLAGWQL
                     YRRGRLPHLLLRRSGGPGAAAAGSPARAELAEQLPSPVGRE"
     CDS             complement(179838..180692)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973653.1"
                     /locus_tag="KTA_01440"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBH91945.1"
                     /transl_table=11
                     /translation="MAYHYRGKTALITGASSGIGLAFAHALAARGMHLILVARSEERL
                     QQLARELRERNGIQAEVIAIDLSREGAATQLANAVQERGLSVDLLINNAGFGTYGPFA
                     EQSAAREHQEIMLNVTALVDLTHAFLPPMLARGEGAIINLASLAAFLPIPHMAVYAAT
                     KAFVLSFSQALWTEYRHQGLRVLAVCPGPVATNFFAVMGTSQEGMPGLVLSPERVVTA
                     SLRALEQGRSQVVPGLLNKLMAFSTRLVPRTLGARVAGNFLPRRSQPGKPAVGSSPLP
                     SRPGPEPR"
     CDS             181046..182404
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226604.1"
                     /locus_tag="KTA_01450"
                     /product="MFS transporter"
                     /protein_id="BBH91946.1"
                     /transl_table=11
                     /translation="MKVLINRNFALLWLGQAISNLGDVILGAALVLWIANDLGRGRSW
                     APVAVSGVFIAEYVPVAIIGPLAGVFVDRWSRRLTMLRTDGLRMALTGCLAWALFPTL
                     PFLGALEPPPGWQLGATYIVVLLDQSCGQFFNPARLALIGDIVGPEDLARATSLSQAT
                     MGLSVIVGPAIGSLLVFNFGIQWAVIADALSFAVSFLTIALIRVPVEKSLESDQPISF
                     GQDFRAGLHVLIGNRGLLAVLLASLLSMSAFGALNALAIFFVTDNLHAQPNLYGPLGT
                     VLGLGAIAGALIAGLIANRLGLPRLLWGATCALGLTTLLLARMTSIGPAFGLIFLVGA
                     TWIAVNVAVEPLVLRLTAREFVGRVTAVLTPAGSLASVLSAALAGALVSTVLHDFRGA
                     VFGLTFGPVDTFFSGIGSLVLLGSAIVRLLLHDIHFVDEQPGAEASSPASSRGQAEAR
                     DT"
     CDS             complement(182437..182991)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003975762.1"
                     /locus_tag="KTA_01460"
                     /product="acyl-CoA thioesterase"
                     /protein_id="BBH91947.1"
                     /transl_table=11
                     /translation="MELFDKAKERASSPPEIDRSQGHTIAYSRTTSSRLMGVLDANAN
                     GNVHGGVIMRMVDEAAAVVAIKHSHRNVVTARVERFDFLAPAYLGDVVSVHCELQYVG
                     RTSMEVGVRVTAEDPLTGEVRHVASSRVIYVALDEHGKPTPVPPLVPGNEEERAIIER
                     ARLRRQRMQKLEEELAKLEEGSPE"
     CDS             complement(183097..183732)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01470"
                     /product="hypothetical protein"
                     /protein_id="BBH91948.1"
                     /transl_table=11
                     /translation="MKYAIKFLFVGLSLSLLLATVLSACNLFGETASTPTPTPTATAR
                     PSAGAGTNPTSMLVSYRGDGYLIGYPRGWKVDTSKPGFVTFSDPAGIAYLSVHVQTNP
                     NGLISAQDQVTVGLQLFRSQVTHYQPVSVDPTTTVAGERWSQGAATGDLRVQGQPNPV
                     LVKIVVLADNHPANSPQTRGFTIAYATAQQVFDLAEEGEFQPMLQSFTFTS"
     CDS             184308..185141
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01480"
                     /product="hypothetical protein"
                     /protein_id="BBH91949.1"
                     /transl_table=11
                     /translation="MTEIDSSYSLSTVEALWLRLIELGRLTSERLRLALTAIATVDLA
                     LASALLQGDPRLTALGYSIEEEASQLLIAPDGHVVQSESRRRLVCSLPLLVATLLQLA
                     DEARELARLLLWFQACATPAVSIQVQRSSSALTPLPVAALFERITLLGQQANALTKAS
                     IEALACWDTQEARRLWRRQRYFRCHLARLQHDLLSGLAAAAGARQPEETASEQAGDNV
                     SQRWFMLLWGFVSSLRDISLHGTTLCERLVFLVEGLRDIRTLQRLERQLQVRCPAEQL
                     Q"
     CDS             complement(185233..185742)
                     /codon_start=1
                     /gene="bcp"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83CY8"
                     /locus_tag="KTA_01490"
                     /product="putative peroxiredoxin bcp"
                     /protein_id="BBH91950.1"
                     /transl_table=11
                     /translation="MSETIERVLLEEGQPAPDFTLPVVGGDETTGDQLHLADLRGRVV
                     VLYFYPRDNTPGCTTEACNFRDMHPEFRRRGIAVLGISADAVDSHRDFAEKYHLPFPL
                     LSDVGAAVARQYGAYGEKTLYGRKYLGVQRMTFLIDRDGIIRKVWRSVKPDGHAQEVL
                     QAIEQLQLA"
     CDS             complement(185925..186911)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000836423.1"
                     /locus_tag="KTA_01500"
                     /product="amidohydrolase"
                     /protein_id="BBH91951.1"
                     /transl_table=11
                     /translation="MKIIALEEHFQIAEINRAAAKWLPAQGGFRPVGYRQPERELEDL
                     GEGRLRAMDSMGIDLQVLSYTAVALPELPAAEAVPLMREINDRLAAAIQAHPDRFAGF
                     ATLPLTDPEAAARELERAVSRLGFKGAMINGRVQGLFLDDPRFRPVLEAAEALDVPIY
                     LHPAPPPEPVIEACYAGLPANVTSVFATAGWGWHLETGIHALHLILAGVFDRHPRLKM
                     ILGHWGEMIPFYLARIDQTLTPAATHLQRPVADYFLEHFYVTPSGMFTLPPLLLTLQI
                     MGADRILYAVDYPYIQDRQARAFLERAPLSPADREKIAHGNAERLLKLGGAA"
     CDS             complement(187052..187639)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01510"
                     /product="hypothetical protein"
                     /protein_id="BBH91952.1"
                     /transl_table=11
                     /translation="MTLLVLDIRLPDGLKAATFSAALLDLLPRFFIYTVTFALCSSYW
                     YGQHRLMDRMRVVDGGFSALCLLFLFFITLLPLVMSTFGRYPTEPLAVMLYALDLACC
                     GLSLVLLTWYAVFHRGLLEPDVGPQIWEHALYYGLPVSLLLLCPLLALPFSRQVFPVL
                     LCWSLIPGVIGLTRLIGRRRLLRLRKEPGKSDQRE"
     CDS             complement(188072..189256)
                     /codon_start=1
                     /gene="nadA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8G4K6"
                     /locus_tag="KTA_01520"
                     /product="quinolinate synthase A"
                     /protein_id="BBH91953.1"
                     /transl_table=11
                     /translation="MALRVACETSQESRILPLLHPAARDQYAHGGRADQIPRRYAEMD
                     GAELDRRISQAKAALGRRLLILGHHYQRDEIIKYADLRGDSFKLAQQAAARPEADYIV
                     FCGVHFMAESADILSAPHQIVILPNPTAGCSMADMANIAEVEECWETLNDVLGDEADL
                     VPVTYINSAASLKAFCGERGGIVCTSSNARKVMEWAFSRGRRLLFFPDEHLGRNTGLA
                     YGIPEEEMIVWNPKNPQETLDDEERLRRARLILWKGYCSTHMRFTVEQIAKARAEYPD
                     ITVIVHPECRREVVAAADLYGSTEYIIQQIERAPAGSKWAVGTEINLVHRLAQEHPDK
                     LIFCLDPIVCPCSTMYRIHPAYLAWVLEALVEGQVVNQVKVAPEIAHWARVALDRMLA
                     LK"
     CDS             complement(189338..190180)
                     /codon_start=1
                     /gene="nadC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973559.1"
                     /locus_tag="KTA_01530"
                     /product="nicotinate-nucleotide diphosphorylase"
                     /protein_id="BBH91954.1"
                     /transl_table=11
                     /translation="MSELPLDLIRQALLEDGAYRDLTTLCTVPAEAQAQAVLLARREG
                     VIAGLALALAAFRLLDERVQAEARIREGEAVTANQVLASLSGPARALLSAERVALNFL
                     AHLSGIATLTARCVHAVAGTGVRILDTRKTTPGLRALEKEAVRLGGGHNHRFGLSDGI
                     LIKDNHIKAAGGLAAAIEAVRRQVPHLLKIEVECETLEEVRAAVEAGADVILLDNMDL
                     EQLRHAVALVRSTAPGVLLEASGGIGPDPERLAAVAATGVDFISLGALTHSAPSLDVA
                     LEFL"
     CDS             complement(190173..191897)
                     /codon_start=1
                     /gene="nadB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7NMC0"
                     /locus_tag="KTA_01540"
                     /product="L-aspartate oxidase"
                     /protein_id="BBH91955.1"
                     /transl_table=11
                     /translation="MASCQRYDVAIVGAGIAGLTVALGLPSDWRVALLTKGRLGESNT
                     RYAQGGLAAALGPDDSPALHYADTLAAGAGLCDAAAVRLLVEEAPAAVRWLIELGVRF
                     DRAAPETSTEVTTADGLLLGQEAAHCRRRILHAGGDATGAEIERALLAALMERRHVTI
                     YPDTPVCALLLDETVAGCRGLLALDPQGLPIVVEARDIVLASGGAGNLWAYTSNPAGA
                     TADGLALAWRAGAALADLEFIQFHPTVLKVNGTTHLISEAVRGEGAYLRNHAGERFML
                     RYHPLAELAPRDVVARAILSEMLAEGTDCQYLDLTHLPDERMYARFPTIAALCRRHGL
                     DLAHDLLPVAPAAHYCMGGVLVDLQGCSTLPHLYAVGEVACTGVHGANRLASNSLLEG
                     LVFGRRLAAVLRGEAPAHSSGAGGRQQRELRLSLATAQAEDWPLPPDWVGPEELAQAL
                     QRELRDLMWRSVSLYRDEDGLREAWRQLQQLRARFAGAARPRAPREPLGRRWLETLNM
                     LDSAALVIHAALERRESRGSHWRRDYPQPDPSLNGVSLVLRPAPAGQRAAESTRDRTL
                     QPKGRPYV"
     CDS             complement(192129..192542)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010881317.1"
                     /locus_tag="KTA_01550"
                     /product="hypothetical protein"
                     /protein_id="BBH91956.1"
                     /transl_table=11
                     /translation="MKSHTAYLTFHTRKRKEIIPITDQVERIIRESGIQEGLALVSSM
                     HLTASVIIQDEESGLWRDIMEWAEQVAPERPDYHHHRTGEDNGDAHLKNLLMHLQVVI
                     PITRGRFDAGPWQRLFYVEFDGQRDKRVIVKVIGE"
     CDS             192768..194027
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01560"
                     /product="hypothetical protein"
                     /protein_id="BBH91957.1"
                     /transl_table=11
                     /translation="MQQRKRGVLTGFLLIALAIILTLLMGAVRARAPLSFLWTGSDVT
                     LQQQNQSTVQSLPLLNGKLASLGWIVGRDCQRGIQAYLQTADINPDAALVGSGWVNPL
                     TGQLMNGESNNCQAGTLSMENVVRLIHSKGGKAYLTVTMETDANGWTARQQSDYIKTA
                     TQQPAYIQAIVNVVKQGSYDGVIMDLEGADRTYPQIQQLFADYNRLVWKAMQAINKPY
                     GIALIHKVADRDDYYNLNGFEDWSLLGHCADFLVIMSLDQSYFTPGPTVSVPWLKQIL
                     AYALKTMPQMLPRIVWEFPLYGAGWHQAADGHWIFDGGINYADAVALVKSIPANQIDQ
                     QASNLNDPYAAHLVYTDSNGVRHAIWYHTAANLLRIIREFRAILQQTPQFSSAHAYLQ
                     IAVWYRATWEPGTLWRALLPVLPNGAA"
     CDS             complement(194043..196454)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01570"
                     /product="hypothetical protein"
                     /protein_id="BBH91958.1"
                     /transl_table=11
                     /translation="MSATSLPSYLSTDDHSYYQLDLRASATAEEAQWQPRLLARSPRG
                     ETLALGQFYLLRNGKPWLPVMGEFHPSRYPRRYWREALQKMRAGGLSVVSIYVFWIHV
                     EEEEGHFDWSDNRDLRAFVLLCADMGLEVLLRVGPFVHGECRNGGLPDWLYGRAIAVR
                     SNDERYLFYVRRYFAEVARQVRGLFFQDGGPILAVQLENEYMHAGAPWELTFRPGSEW
                     VPRGSDGPAHLERLRALAREVGLEAPLYTCTAWGGAAVPAEGFLPMHAAYPFTPWVPD
                     PAFEPVPSREFLFRSPQQPASDWWRAGAFRYPIERYPYAYCELGAGIQMTYLHRPLVP
                     PECTQALAVVALGSGCNWLGYYMYHGGSNPAGRHGFLNEFTVPRLSYDFQAPLGEYGQ
                     LHASYHHLRLIHLFLEQFGSQLAPLPVVLPPGASTLEPQETGVLRYAARAQQGQGFLF
                     VNAYQDHVERRDVEGIVLEVLLPRGRLRLPREGSLRLRQGVSAILPVGLELSGGLHLR
                     YATAQPLTVLQQADGRTTAVFFAPEGLEPEFALTRESCRALTVQGGRRAEEEETLYAW
                     PQPGLGTRLEATGASGETVELLVLSQEEALHCWKVKLAGHEYLLLTEGEGAAWVDADP
                     AEARLTVCWQGEAQLDLLSYPRLPVSLVASGLLEDRGAAGLFWRYRLRRSPWKARWSL
                     EQPEPQVVRLRLAAEALEGVRDLFLRVDCVADVGQAFVDGHLVADYFGSDLPWVIGLK
                     RFAQPGRELELILRFTPLRADAPVLRYFARERLPLPASDGTLPVTVRGVQLMPEYGIE
                     LPWRA"
     CDS             complement(196734..197873)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012584091.1"
                     /locus_tag="KTA_01580"
                     /product="LacI family transcriptional regulator"
                     /protein_id="BBH91959.1"
                     /transl_table=11
                     /translation="MKESRFQQQPAQPAAVRKGHMVTIYDIAKAAGVAKSTVANVLSG
                     KGKVSEATRERVLYYARELGYRPNLLARNLSQHRTFTIALILPTIANPFYPEIMEAIE
                     SILRQRDYQTLFCNTHGDFALGRQQMERLMSRWVDGYIIMGSSMDIADITHYFHQGVP
                     IVLCDWQENESPVGIPQVTVDFYRAGQLAAEHLLALGHRRIAVIVDEPQQHLRLEGFR
                     TTLQQAGLELPPARIALGDSSLESGYAAARQLLSPDQELALPTAIFATNDWMALGAME
                     LVLDRGLRVPEDISIIGLDDIVVSAHLRPPLTTIAIPKTRLAQEATELLLTQIETGGE
                     GQRPESSAAREGADGAAQHEEETAPLRLVPPYLVVRQSTAAPASS"
     CDS             198466..199788
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225936.1"
                     /locus_tag="KTA_01590"
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="BBH91960.1"
                     /transl_table=11
                     /translation="MNRGLLFCRARGMAKAGLLLLLALSISSYLVACGGTPASSGPVT
                     LTFWSWVPNLQQAIDLFEKSHPNIKIKWQNVGSGGTEYTKLTTALKAGSGAPDIVQIE
                     YAYLPQYILSGKLVDLSQYGANDVKDQFVPWTWAQVSSGGKVYAIPQDTGPMGLLYRE
                     DIFKKYNLPVPTTWDQYAQEAIQLHKANPKIYITDFSPSDGPWFFSLLWQAGSQPFEV
                     NGTTIKIHLDDAAALKVANYWGNLVKSGAVSTAADWNNDWYAALQNGTLATWITAAWA
                     PSDLEGFAPKSAGLWRVAPLPQWNPGEHASANWGGSTDAVTTQCQHPAEAAEFVKWLN
                     TNPESVKILTQKLYLFPAQKSALEDPSFDTANTFYGGQQVNRIFVESAQQVNTSFQWS
                     PFQDYVFSQLQNQLAAAVSGKISFEQAMHNTQNAVVAYARSQGFTVIA"
     CDS             200047..200973
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011068330.1"
                     /locus_tag="KTA_01600"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH91961.1"
                     /transl_table=11
                     /translation="MQELVPASRAHGALRLWRRWRRRVITPYLFLLPFLLLFSFFLLV
                     PLLYALWTSFFVERLIGGTTFVGLVNYQEVVHDSNFWEGVRNVLLLLFTQVPLMLGLA
                     LLLALLLDSQIVRLKTIFRLGYFLPYAIPSVIGALLWGYLYSSHIGPFAQLAELLHWP
                     PPPFLTAAGLLPSIANILTWQWTGYNMVILYAALQAIPPELYDAARVDGASGWQIARR
                     IKIPLIAPAIVLTVVFSIIGTLQLFNEPQIMAAIVPNLIQDHYTPNLYAYNLAFTNQQ
                     YNYAAAVSFVLGAVVFVFSYIFMLVTYRRGQR"
     CDS             200973..201899
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011031642.1"
                     /locus_tag="KTA_01610"
                     /product="ABC transporter permease"
                     /protein_id="BBH91962.1"
                     /transl_table=11
                     /translation="MAHIGSLPAGRLATREQPATRAGARRQGWTLRGLVLLFLVLMLI
                     YFVIPLFWLVVSATKTNDELFSTFGLWFAPDFHLLENLHDVFTYDNGIFLTWLTNSAY
                     YAVVSALGASLIATLAGYAFAKLSFPGRELVFAIILGTIMVPNTALAIPTYLLLSKVG
                     LVNTPLAIILPSLVTPFGVYLMRVYAEQALPDDLLDAARVDGASEWRIFWSIALRLLA
                     PGFVTVLLLSFVGTWNNFFLPLVVTNNPAYYPLTVGLANWNQLSQAFSGSRILYTLVI
                     TGSLISVIPLIIGFLFLQRYWQGGLTFGSLRS"
     CDS             202060..203286
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01620"
                     /product="hypothetical protein"
                     /protein_id="BBH91963.1"
                     /transl_table=11
                     /translation="MHPEKQTPLSEEGRAELRARPVPRLSLSRRRFLGQLAAATALGS
                     GLGLSQGLPAALAAPLPTPRQTSGSRPRVLGHDLSTLQQLEDIGKRFSDQGRVLPAEQ
                     IVARHGATFIRERLWVQPPIPYNDLPHILTMARRIKAAGLHFLLDFHYSDFWADPSHQ
                     TTPQSWQGQDLTTLAQTVYDYTRSVLGALARQGTLPEIVQTGNEVTAGMLWPQGQIYV
                     NGTERWPQFATLLKAAIAAVRDTSRAIEVMVHIDRGGDNAGSRYFFDHVLAQGVDFDV
                     IGLSYYPWWHGPLSALQANLNDLAPRYGKDLVVVETAYPWTLTDGDSEPNIVNAQTTL
                     LPGYPPTPAGQLAYIRAVRAIVDQVPQGRGRGLVYWESAWIPGVGWEPGAGDAWDNLT
                     LFDRQGRALPSIRCYE"
     CDS             complement(203595..203990)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01630"
                     /product="hypothetical protein"
                     /protein_id="BBH91964.1"
                     /transl_table=11
                     /translation="MTTADLGGQPRRAAEELPGQGVALTAEVAELYARFFKVLSDPTR
                     LRLLALLLEAPAQGRTVSELVAALGAPQGRVSTHLGCLRWCGLVQAIREGKYVYYRLC
                     DERIRLLLTTAGALLQEHAANIASCGVIR"
     CDS             204197..204385
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01640"
                     /product="hypothetical protein"
                     /protein_id="BBH91965.1"
                     /transl_table=11
                     /translation="MDADLPSDREAGPGQSIRGESEGERKAKRENGLMEHVLYYNYAD
                     RTGDATSRSVTDETYLFF"
     CDS             204615..205034
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01650"
                     /product="hypothetical protein"
                     /protein_id="BBH91966.1"
                     /transl_table=11
                     /translation="MARLCQLAARLILVLGLVTAAAEIYLLWNTYHYILQSGYSLSDG
                     ISIPQGFSYVRMGGVSWLDLVGPVAFLFGTIATTIFYSLLLSLIGHVLSAIAGSRPAG
                     TSSERISASEEELTDGLIFQPLDEVETSERGRDRQRR"
     CDS             complement(205125..205931)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01660"
                     /product="hypothetical protein"
                     /protein_id="BBH91967.1"
                     /transl_table=11
                     /translation="MLVEQKLNAFARLRPEFETSFLFVQQVQGQERFARFPVEMTVRY
                     FHALWICECKDRLLSVPRTIERYEGERCLRLLRAWQEEGETAEVVAFLQRRLDAMPFA
                     DLTRQIQVMGRQAHGEQEVLLRRLRHGRAVLLNRVMNLLQALDAIFALDEEALQEQVR
                     EACRRYGHEPEQIEAQLAELRSPLYAYVPHRLLARENILLMNRLGASTCADQERRRWG
                     EARPAEEGGPRALALIDGYQDLTSTRNPLRMSRTLSQLVGSGLLLPTGAG"
     CDS             206446..207426
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01670"
                     /product="hypothetical protein"
                     /protein_id="BBH91968.1"
                     /transl_table=11
                     /translation="MDEPRTWRELLGTIIADSHERQRLAEELGVTSTTLNRWASGASD
                     PRPQNLRLLLKALPQYREQLQELIQAEFEDFVAAPSDDSSLEIPAAFYARIFRARATT
                     TEAMRYWSLSNLILQQALGQLDPDHLGMAVRVVRCMPPKEGKIRSLREWLGLGTPPWG
                     GELEHKAMFLSAESLSGYVVSSCRPNAIQNIDEEHSLIPAHRDPHERSAAAHPILYAG
                     RVAGCFLVSSTQPYYFLSQARLTLIQHYADLLALAFDPQEFYDPKDIELRVMPDQSIQ
                     RKYFMKFRRRVSEVMMEATRSGRSLNNLQAEQLVWQELEDELLELSLRLN"
     CDS             207453..208277
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258540.1"
                     /locus_tag="KTA_01680"
                     /product="hypothetical protein"
                     /protein_id="BBH91969.1"
                     /transl_table=11
                     /translation="MFDDFVARGRESGELDPRWRRTCLGGGRLSVEQSRLRLELEASR
                     EGEYSDAQIDDYGELPRRAFPWRPPLRMEVRACLSHAAATLASTVETPGLLRGTAGFG
                     FWNYPFSLRGDVLMLPEAVWFFYASPPSNMALVPGVPGWGWKAQVVHALRPGFLAAAL
                     PTALAALWGRLSGELRPAARWLQRLTGAQERLLEEVELTAWHSYALEWLPSQARFFVD
                     GSLLFTAPAPPTHPLGFVAWVDNQYALATPRGTLRFGTIATGRQWLDLDYVRIEPL"
     CDS             complement(208274..208900)
                     /codon_start=1
                     /gene="clpP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:D1BA83"
                     /locus_tag="KTA_01690"
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="BBH91970.1"
                     /transl_table=11
                     /translation="MSATLYVPTVIEATGRGERAYDLYSRLLKERIILINGPIEEQMA
                     GLVIAQLLFLAAESSEREINLYISSPGGVITAGLGIYDTMRMLPCPIATTCVGYAASF
                     GTILLMAGDRGRRRALPHARIHLHQPWTASGVSGQASDIEIHAREMLHTRDMLNEIIQ
                     LHTGQPLERIKRDTDRDFFLSAAEAVEYGIIDEVLEPPTKDFKTSPLP"
     CDS             complement(208995..209300)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01700"
                     /product="hypothetical protein"
                     /protein_id="BBH91971.1"
                     /transl_table=11
                     /translation="MLPRSSCQFLSYTQEHILSTLHIPIVYEEQQPDPPRWEYRLISL
                     QPPKEPLLSEERLARLGQEGWLLQAIIDERASGSGSQVHYYFVRRLLSPGRELMEGE"
     CDS             209545..209982
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01710"
                     /product="hypothetical protein"
                     /protein_id="BBH91972.1"
                     /transl_table=11
                     /translation="MADLQETLGKVIRRERQQRRLTMRELGERAGLSEIYVGEIERGQ
                     KYPSARVLESVAAALDLEVAELLELVAAELRGVSEAAHSGHSQTGFGTPAPVHSAAGR
                     REQRPGQGEPLAAQQVLTVAGFSSLLLAGQLGEASWQRSRLRR"
     CDS             complement(210163..210492)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01720"
                     /product="hypothetical protein"
                     /protein_id="BBH91973.1"
                     /transl_table=11
                     /translation="MTISLEQLIIWVIIAAIVGVVGEFIARRHAPGGIIGAILLGLLA
                     IFLVDGVLHWHISGEPYLNGVPLVTSVLAAAVLVFIWSAFAYRRLSPYYYRRGSYVQR
                     PRRWWRG"
     CDS             210406..210651
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01730"
                     /product="hypothetical protein"
                     /protein_id="BBH91974.1"
                     /transl_table=11
                     /translation="MTARDEFPNHSYDGRDDDPDDELLQADGHDDSHLLAEAGLVRLS
                     LDARFYSIWENHALTALLVSGPALVSERGRRGAFSPP"
     CDS             complement(210670..211056)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011392516.1"
                     /locus_tag="KTA_01740"
                     /product="amino acid-binding protein"
                     /protein_id="BBH91975.1"
                     /transl_table=11
                     /translation="MQLLIAARRLAICQLAPDDPLPAWLSAAERTASSLLALIWTPDE
                     LSVVCPQEWVPEGVRCAPDWAALKVVGPLDFALTGILAALLNPLAAAAIPVFALSTYD
                     TDYLLVREPQLDAARAVLLAQGHEFL"
     CDS             211325..211774
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010889330.1"
                     /locus_tag="KTA_01750"
                     /product="transcriptional regulator"
                     /protein_id="BBH91976.1"
                     /transl_table=11
                     /translation="MTARPRACAANRRAEEADLCQVRAIHPEQVEAVRQSLLPFESAM
                     RTAALFAVLNDPTRLQVLFALLHAPAGELCVCDLAAGLGRDDTTISHQLRVLRTHGIV
                     GLRKAGRVVYYRLIDDHVRQLLELGLAHASEPAGGPAAVSHGVEVSA"
     CDS             211777..212814
                     /codon_start=1
                     /gene="czcD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000510049.1"
                     /locus_tag="KTA_01760"
                     /product="cation transporter"
                     /protein_id="BBH91977.1"
                     /transl_table=11
                     /translation="MYAGHCEESAMKEKMPAHSASGQGDQEHHSHQGHHAHAHAHDLP
                     RRSLRLAFLLTTLILLSQLVGGLLANSLALFSEAGHVVTDLFALGLAWFAAVQAERPA
                     NARRTFGYHRVGILAALINAVTLIAIAVAILIEAIGRLRHPAEVQPLAMFVTPLIAIA
                     INLFISVVLQRQSQHNLNTRAALLHVLGDVGASLAVIAGGLVLLLTGWSAVDPLLSVG
                     IALLLAFGAWRVVQEATDILLEAAPRGLSVAQLAHDMLQVEGVREVHDLHVWTIASGM
                     PALACHATIEDGTPSRSASIRQALTQMLTEKYHIDHATIQFESEKDRQSCCHGQSLYC
                     CLDPSRRARQA"
     CDS             212885..213121
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01770"
                     /product="hypothetical protein"
                     /protein_id="BBH91978.1"
                     /transl_table=11
                     /translation="MLRAEREEARARKWVEHLPAYLIPPFFYATFASLSGPGTLLQLS
                     TVLSWRDPGEIESAYGRSAALQALDFWSKRRGGV"
     CDS             complement(213068..214354)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001006741.1"
                     /locus_tag="KTA_01780"
                     /product="Bcr/CflA family drug resistance efflux
                     transporter"
                     /protein_id="BBH91979.1"
                     /transl_table=11
                     /translation="MSRSSVEDTEPSTQRTEPARGWRYILLIVILGSLSAFGPLSIDM
                     YLPALPLLSQDLGASASEAQLTLSACLVGLALGQILAGPLSDSFGRRRPLLIGLLAYI
                     LASLCCAVAPSITLLIGLRLIQGMAGAAGIVIARATVRDKYSGILMARFFSMLMLVSG
                     IAPIAAPLIGGLLLRLTTWRGIFLFLTLLVVLIWLAALLGLPESLPPERRQSGKLETT
                     LGTFRRLLTDRSFLGYALSCGLSAAAMFAYISGSPFVTQDIYGLSPQAFSLVFGTNAL
                     GIAIMGQINGRLVGRIAPRKLLAGALTAVAVGSGGLFLAVISGVGLIGILPALFVVVA
                     SQGMVFPNAATLALTDHPREAGSAAALVGLLQFVLGAIASPLVGIAGSQTALPMASVI
                     GVLGFSALLTFWLLGRRQPLNAASSLAPEIERLEGR"
     CDS             complement(214757..215356)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01790"
                     /product="hypothetical protein"
                     /protein_id="BBH91980.1"
                     /transl_table=11
                     /translation="MKESLLACARSWVKEHAGSQVPHLLRAEEWLRQINPAASEAMLL
                     AALTHDMERAFPGPDSPKQDPSRGPDDPLYLQAHSERSARIVGGFLREQQAPADLIEA
                     VTALIRVHEVGGWPEADWVQAADSLSFLEVNVRPFLSMMSNSRAGWTPEAVRAKFSWM
                     YTRIRLPEARRWAEPLYQRALEQLQRQEARLKQAEKPGS"
     CDS             215763..217409
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01800"
                     /product="hypothetical protein"
                     /protein_id="BBH91981.1"
                     /transl_table=11
                     /translation="MAALGLILVGVSLRLMLLKQHWPWTDSDEGIFGLMARHIAYQGE
                     RPTFMYGSFYMGPLQAYLGAVFFHLFGSSLLALRLGLVMLFALFLVALYFLTRTLYTA
                     GLGLLTLTLLSLGSPYMLTYQLRSYGGYLEILLCGTLAFLIATWLALSADPGLSRRRF
                     LLRCGVYLAWGIVVGLGLWSDMLILPLMSLSFLLIVIFCWRELVLLLPVVCMLGGLAL
                     GMWPLLAYNLHAPPGLDTLSAVIAQQQGPVPLHYTPALVWQQIKATIQLSLPTISGNP
                     FCPVSEVPVLRDPTSAPTLACRLIHLGWGTGFLLLFLVALGLASWDLWHLGRHSWLEG
                     KANRQADLVRASARLLLLMAAAITLVLFIHSLAPLKWPSLHGRYLIIFWIALPAVLWP
                     LWQGARATWSFLPRLRQPGRALCLALLLLLLLFYGIGTAQAFSETSTAQMYYQQDMAF
                     VQRLEELGVTHFYSDYWTCYKVAFLSQERMTCGVVNQQLQPGYIRYWPYYWATHADRH
                     AAYVLPRGEYESALHALMSQQNRRYRLTLYGDYFIVQPVV"
     CDS             217524..218405
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011392599.1"
                     /locus_tag="KTA_01810"
                     /product="PHP-like protein"
                     /protein_id="BBH91982.1"
                     /transl_table=11
                     /translation="MQRRLSEEASIDLHLHTTWSDGRWTAADLLAHVRERGFTLIAVT
                     DHDRVDTIAHLQHLAKEQGVTVLNGVEISAAWQGQMADVLGYGFDPEQPDLRRLVEQV
                     REGQRANAEEVYAELLRRGYSFPERERLLAAQGNRLRVAGDCGFLLVQHGYVSNWREA
                     LAVIRDAGYREIKADLAAAVDALHRSGGLALIAHPGRGLREPAEFTFYSPELLDRVRA
                     EVAFDGLEVYYPTHEPELEAIYEAYARRHGLVMSAGSDSHGPPGRLPVGYPAWRCRAL
                     LERLGIVVESETTAAGS"
     CDS             218742..220262
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_041272219.1"
                     /locus_tag="KTA_01820"
                     /product="carboxylesterase"
                     /protein_id="BBH91983.1"
                     /transl_table=11
                     /translation="MSQCIVETRYGKVQGYQQGSICVWKGIPFARPPVGTRRFRAPEP
                     PEPWAGVRPTIAFSPMAPQVPEMGASMVGAMGAERVVDPRPISEDCLYLNIWSPAADQ
                     GKRPVMVYIHGGAFTIGSASDPWYDGTSFAERHNIVVVSLNYRLGILGFVYLKELAGA
                     GSSYSGNCGLLDQIAALRWVRENIEAFGGDPENVTVMGESAGAMSIAALLGMPAAHGL
                     FQRAILQSGAAGDLPTGAEATRVAQALLAKLGLEPSQVEALAEVPLEALLKVQPELGR
                     EFGGVRAFSPVIDGETLPRHPLAMLAQGLARDVAVLVGTNRDEWRLFALMGGGTQIDE
                     ALLKRLFGDSAQQVLALYTAAREDRSPELAWIDLMGDLVFRIPAIRLAEAQVRQGAPV
                     WMYRFDWKSPAFGGALGAAHAMDIPFVFNTLDVGLSRLFTGTAPSRQALADLMHAAWA
                     AFIREGNPMIPGLPDWPRYDLERRATLIWDEVPSLAEDPQGELRTLWEGVRLVSEA"
     CDS             220832..221737
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004199877.1"
                     /locus_tag="KTA_01830"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH91984.1"
                     /transl_table=11
                     /translation="MQHSQRKISPTSPPVPRPPSQVANALSSGARDAQGTPPAIELRQ
                     VTKRFLTPSGQTYTALRDLSLSVAPGEFCALIGPTGCGKSTTLSLIAGLDTPSAGSVL
                     VMGEEVHGNDPRIGYVFQTDAVFPWKDVLHNVAAGPLFRGVPKREAMERARAWIARVG
                     LAGFEDRYPHQLSGGMRKRVALAQTFINEPQILLMDEPFSALDVQTRTLMENELLQLW
                     SALSASVVFVTHDLEEAIALADRVCVLTAGPATVKGIYPIDLPRPRNVAEIRFDPRFV
                     QLYHDIWEDLRDEVMISYERAKQSS"
     CDS             221712..222602
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532454.1"
                     /locus_tag="KTA_01840"
                     /product="ABC transporter permease"
                     /protein_id="BBH91985.1"
                     /transl_table=11
                     /translation="MNELSNLLEQRQGAADLEAGTDSAILATLTRRRRRRRWLIQALR
                     LLLLVGLIGGWELGARLGLIDPFFWGRPSGIWQQLVTWVLHGTAQGPLWVQIAVTLEE
                     ALIGFLIGVVLGISFGVLLGRNAFLAELLGPYIKAANSIPRVTLAPLFAIGLGLGSQS
                     KIALAVVLVFFIVFFNAFQGVREVDRNLLANARILGANRWQLFREVILPSALTWIIAS
                     LHTSFSFALVGAVVGEFVGSIEGIGLMIQNAGATFNANGVFAAMLILAAVALLSEVII
                     TALERRLLRWRPTSLSEVTL"
     CDS             222793..223833
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532456.1"
                     /locus_tag="KTA_01850"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBH91986.1"
                     /transl_table=11
                     /translation="MSVTRQWLRLPITVLMLLLAMLVSACGSSSGPTVSNGKIQLKIM
                     VGGLSKQIYLPNMLTQRLGYFAQEGLAVTLIDEASGQSAEDEVLAGQVDAGSGSYNHT
                     IELQAAGKQMECVVQLDIAPGEAEIVATREAGQIRSVSDLKGKNLGVTELGSGTQTLT
                     TVLLHKVGIAPSQVHFVPVGAGDTFIAALQQGKIDAGMTTEPTISRILASGIGKVLVD
                     LRTPQTTQAALGGPYPFICVFMRNDYVNAHKDVVQKLVNAYVKTLKWIHSHTAEQIAD
                     MMPADYYAGNKQLYVTALRNQLAIFSPDGLMPAGGPEFVLSTEQQSNASVQGKQIDLS
                     ATYTNEFASKAS"
     CDS             224152..226935
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01860"
                     /product="hypothetical protein"
                     /protein_id="BBH91987.1"
                     /transl_table=11
                     /translation="MRPVVRRSLLTRLLTVYLLFVLVVLLGGARINMLVEQRLRSDVQ
                     AADQALAEEIARETSLQLLGAEQAIQSLGRLVLASPSAAPATLERLFQAWHGARSDVD
                     HVYWLDPFGAVLVAWPADHVVAGAEFSPPTVVEQALKSDQPAFEVGIVGLASSRLASP
                     GVIIAQAVRSQGHLRGLVAASFSLAELSLPLANVVQAQQRQSKHLMITVIDSNGVVVA
                     ASERRRLLETVLSELPGAVQALQGQSLSRSGPGPDGQDWLFSAVPVPKIGWAVVVERP
                     ASEALAVVDQFHLWLLLVASLFTLGGLLFWLLLHLRVIRPLQTLASQHQALPASAEAI
                     PTATLQLARQRDEIGDLARSLIRLERDGLRKLSELHTLLETSNAVVRSLDPRAVIEEI
                     MHEVQRLVDVQAVAVLLPDEQGVLRVLQSSGHSERYDRQLSLSPERVSSAAVLALHSG
                     QPVQKLLDGSQPSFAYEDGFRAVLALPIISHHVGSVVLVVHRREPRLFEEHEIQLLST
                     FANYATLAWEHAVLYERSDERLRAVAQENERLYRRATEEKQRLAAIMESMQDGLLLLG
                     IEGQILYANQAACSIAGLPRTALEGRSIAAFYEALKATGAEAAACARALNQTEPAMFL
                     IENREGTQARALQLRLFAVQSESGETIGRGLLVRDVTRERELDEFKTTLLAAVGHELR
                     TPLAAIKGYASTLLQPDVTWPPEEQQHFLQTIMQEADRLTQLVRNLLDLSRQEAGLLQ
                     LRCTAVDPRELVLTVCERTPPGSATVKVAIPAELPPLLVDRGRIEVVLHNLINNAVLY
                     GASQVEIKAWRPADEEALILAVIDDGPGIAPEELPHIFERFYRAPRGRRQHTAGTGLG
                     LAICKAFVEAHGGRIWAQSGPQGTALCFSLPLAPQSALTALHEEGAAEKESETHDGDS
                     NNREGQAHSARRG"
     CDS             226880..227617
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257870.1"
                     /locus_tag="KTA_01870"
                     /product="DNA-binding response regulator"
                     /protein_id="BBH91988.1"
                     /transl_table=11
                     /translation="MMATATIGKARRILLAEDEQALRDFVSRNLRVRGFEVLEAATGL
                     EALALFEREQPHLLILDLMMPRMDGLEVCRRVRERSTVPIIVLTALDAERDKVAALDL
                     GADDYLTKPFGVEELLARVRAVLRRVQWESRAPAEPAQGVQRFGEVEVDLARRLVRRS
                     GEEVRLSPTEFAILEQLITQAGKVLTHRWLLQRVWGPEYGGEVEYLRVYLNRLRQKLE
                     PDPAHPRYFLTEPGVGYRFVNPDLESR"
     CDS             complement(227636..229390)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9W9R7"
                     /locus_tag="KTA_01880"
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="BBH91989.1"
                     /transl_table=11
                     /translation="MKEKRIRGVAASPGIAIGPVYRYEPVPIHVEAETCQDVSAELAR
                     LEAALVEARQELRLLAEQASKSVGSKEAAIFSAHELFLQDPELLQQVQQRIRQRQSAA
                     FAWQEGFQYYIQQLGAIQDEYLQARVLDLEDVAQRVLRHLTGQSEQSLQPSAPAIIVA
                     RELTPSALMRCPREAILALCTAQGGPTSHVAILARALGVPAVVGLGEEDLAALRSGQV
                     VIVDGEQGLIVVEPKEHELLIYQQRRRLLQEQALQAEQSRLLPACTSDGRCYPVRANI
                     QAPEEVTEARACGAEGIGLLRTEFLFLDRSQAPSEEEQLAVYRAIIEATQPAPVVFRT
                     FDIGGDKPAPYLSLPREPNPFLGVRGVRLGLKQPELLRTQLRALLRAGAGRELRILFP
                     MVSSFEEIEALHQLTQAVREELRQQGQPLAERLELGVMIEVPAAALLTEAFAEIVDFF
                     SLGTNDLTQYTLAADRTNEGTASLADPFHPAVLRLLQLTIEAAHRRQRRVEICGELAA
                     EPLAIPLLLGLGIDELSMVPRAIPRCKQVIRRWTQSEARQVALQALQMRTAAEVRSYV
                     RACSTDELAARADDGREA"
     CDS             complement(229398..229697)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01890"
                     /product="hypothetical protein"
                     /protein_id="BBH91990.1"
                     /transl_table=11
                     /translation="MAASTEVVVAYRDGLHARPATLLAKTAAAFSSTITIENLTQGSK
                     PVNAKSPLTILSIGIQRNDRLRIAAAGEDEQEAVEAIARLIASNFGEAEGDERQE"
     CDS             complement(229740..230141)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003421030.1"
                     /locus_tag="KTA_01900"
                     /product="PTS mannose transporter subunit IIAB"
                     /protein_id="BBH91991.1"
                     /transl_table=11
                     /translation="MIGVVLVSHGSLAAGLKDAVEMIAGPQERFVAIGMPAGSSLEHL
                     KRQIESAVREVMSDGGVLILIDILGGNPASASLQLAQQGTQVICGVNLPMLLEILVQR
                     EYMSLRDLTPIAIQAAKEGVINLTQRLTDRG"
     CDS             complement(230224..231141)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011860920.1"
                     /locus_tag="KTA_01910"
                     /product="MerR family transcriptional regulator"
                     /protein_id="BBH91992.1"
                     /transl_table=11
                     /translation="MLKISDFARLGQVSVRTLRYYDEIGLLKPVQVDPLTGYRYYAVE
                     QLTRLHRILDLKEMGFELSQIVHLLDEQVTPEQLRAVLQQRLAEVQQTIVIEQERQAR
                     IEARLQQLMLDDQQAHYDVVLKRIKPQLVATSRTTAPTRAQQLHFARQMLQFLKECGV
                     KPDEQWLLLTPDATGEGERSIVEVAIPVEGASLGNIVERSGGHITIRELPAVTAATLL
                     YRGSPYSLSGVYQSLGTWIEAHGYAIAGPYRHLLLRQADEPEGCLIEVQLPVERREGG
                     TGRLFLQNSRRIPEIESLALVTRAASSGS"
     CDS             231760..232239
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01920"
                     /product="hypothetical protein"
                     /protein_id="BBH91993.1"
                     /transl_table=11
                     /translation="MTSSDEPFQLKELLTPATIRLHVVASDPVEVIREAGQLLLTQGA
                     IEERYIEAMQQALQTYGPYMVIVPGVALLHARPSDGVKRPCMSLLTLEPPVFFGNEDN
                     DPVSIAIAFGAVDRQKHLQALTMLTQLLANEQALSAIQASTSAEEVMDIIAAASPAQ"
     CDS             232275..232547
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003723637.1"
                     /locus_tag="KTA_01930"
                     /product="PTS ascorbate transporter subunit IIB"
                     /protein_id="BBH91994.1"
                     /transl_table=11
                     /translation="MKILAVCGMGFGSSLVLRMTIEDVLRAAGLKAQVVVSDIGTARS
                     EQADIIVTSAEFARLLADRGIPIVVIKNYVDRKEMKEKLLPLLKGS"
     CDS             232677..234104
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001681684.1"
                     /locus_tag="KTA_01940"
                     /product="PTS ascorbate transporter subunit IIC"
                     /protein_id="BBH91995.1"
                     /transl_table=11
                     /translation="MNIVLAVVQFIVSEILSKPPLLVGLIALLGLLVLRRPPSEVIAG
                     TLKTIVGFLILTGGANILIGALTPLGTMVQAGFHLQGVVPTNEAIVSLAQKAFGAPTA
                     LIMAFGFLVNLILARLTPVKFVFLTGHHLFYMATVLAVVLGSAGITGVHQVVLGALML
                     GTIGTVMPALVHPFTRKVTRDAGFALGHFNTFGYITSGLVGKLVRRLGAPRASAEDLT
                     VPEGLAFLRDSLVMTTLTMVIIYVVLAIIAGPAALTQAAGGGNYIMYALTQALTFGAG
                     VAIILVGVRMILAEIVPAFRGIAEKVVPNALPALDCPTTFPFAPNAVLLGFIMSLLGG
                     IVGLFLMGPLGLALIIPGMVPHFFDGGTSGVYGNSTGGWLGAVIGSFINGLLITLLPA
                     LLLAFMGSFGLANTTFGDTDFCLAGIITGLGAKAGFFGSYAVVVVLALVLLALASFVT
                     LRITPRSGPQEEAAEEAQAAADTTV"
     CDS             complement(234324..235796)
                     /codon_start=1
                     /gene="lpdA-3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010944034.1"
                     /locus_tag="KTA_01950"
                     /product="mercury(II) reductase"
                     /protein_id="BBH91996.1"
                     /transl_table=11
                     /translation="MPAPAAEPDLLILGGGSTAFAAALHAADLGKSALVIEGRLIGGT
                     CANRGCLPSKHLIEAARLHYESAWPRFTALTPLQQPVNWAALLEQKDALVYTYRQQHY
                     ERLLEEVPGLSLLAGQARFLSPHEIAVARPNGDHQRLRASRILIATGSRPYLPPIPGL
                     QDVPYLTSDWLSTPDDPWQTSLRQQPRSLLIIGGGAIALELGQLLLRLGTHVTLLVRR
                     PTVLADSSWEPELRQALTEQLQAEGLQLLTQVQVLRVGAGPAGVEVTIQDGAQQRTLE
                     AERLLIATGRRPNSEHLALERAGVAVDAQGAIRVDATLRTTVPHIWAAGDVIGTAWGN
                     QFATPVGAADGRLAAHNALSGEPARPVDHRVIPRCLFTDPPFASVGLTEAQAQAAGLA
                     CACRVLPVSLVPRAGAIEDRRGLIKMVIERSSRRVLGVSLLARNAEEVIHEAAMALRF
                     GATLEDFTELIHVYPTMAEALKLVALSFTRDVHLLSCCAS"
     CDS             complement(235763..235927)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_01960"
                     /product="hypothetical protein"
                     /protein_id="BBH91997.1"
                     /transl_table=11
                     /translation="MAVLTEVVVGRDAREGAKRTLKVSHYVAGQLYYLLPPKGEASRR
                     CPRLPPNPIY"
     CDS             complement(236284..237144)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228550.1"
                     /locus_tag="KTA_01970"
                     /product="oxidoreductase"
                     /protein_id="BBH91998.1"
                     /transl_table=11
                     /translation="MQMHQMHADIPWVTLNNGVHMPQLGLGVFLTPKEQTIDSVLAAF
                     ENGYRLIDTAAAYHNEEEVGEAIRRSGLPREELFITSKLWNSDHGYDQALKGLETSLK
                     KLGLDYLDLYLIHWPLPMKGLTVQTWKALERAYKDGKVRAIGVSNFKPAHLERLLQES
                     EIVPAVLQIELHPTFTQEETRNYARAHGIQVESWFPLGGQRSKDTLLNMPLLTQLAAK
                     YGKTPAQIVLRWHMQLGLVAIPKSVRPERIRENREIFDFELSQEDMAAISALDTGVRL
                     GPDPDTFDAE"
     CDS             complement(237644..238693)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003977450.1"
                     /locus_tag="KTA_01980"
                     /product="LacI family transcriptional regulator"
                     /protein_id="BBH91999.1"
                     /transl_table=11
                     /translation="MPLEPKRPKRLTMVEIARRAGVSTTTVSKVLNHRPGVGEKTRAR
                     IQRLIEQSDYVQNHAARHLRQGRSGLIDLVLMRLEGGYDLGIMQGVQEVLEQSGYRLV
                     VFATNEDEATERLWLRRLLDQSSDGVLLLLPYERVGIAETLLEQGIPFVAIGDRNEPT
                     TAFPTIGSTIWLGGYTATEYLLSLGHRRIGIITGPLHLTTSRARLAGYREALEQAGIP
                     VDPALICEGSYLLGDGLRQTEALLDLPDPPTAIFAGNDAQAAGVYQALYRRRIRIPEE
                     MSVIGFDDVTYAAHMAPPLTTIRQPLEEMGRMAAEMLLRLIAGQPLETHHVELATSLV
                     IRESCGPPRRGPLAR"
     CDS             239295..240665
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228682.1"
                     /locus_tag="KTA_01990"
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="BBH92000.1"
                     /transl_table=11
                     /translation="MGTQGTGSQLNRRRFLRRTFELSAGVVGLELLAACGGGSSSTTT
                     VTATVNTLPPSTNPGAVYVFNQVVKDFEQAHPHEHIVGKNDPYDPTTYFAKLAAGQLE
                     DGIQSYFTEPPLLIARHAVADITNLARSWPSFKDYIPSIASIVTRGDRVYGIPVNGYV
                     LGIFYNRKLFQGAGLDPDKPPTTWEEFRGYAKQLTSSKVAGFAETSTANQGGWHFTNW
                     MYTAGGDLESADGTKAVFNSPQGVSVLNFLKAMRFTDRSMTQQQLLTQADTLQLLATG
                     KVAMVVMAPDQLNALQAQYQANLKDFGIGPMPQNGGNAALTGGNLWVFNPKSAPEVIK
                     AAFDYVIYSNFNLEVVERSLAQQAAAGQAVGAPTAVLFQGSFQEQLSALYRKYATVPL
                     ENYTSFMNAELQLRPEPRNQTQKMYATLDPVMQAILTDPKADPETLLNQAAHQFQQIL
                     DQSASS"
     CDS             240728..240907
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02000"
                     /product="hypothetical protein"
                     /protein_id="BBH92001.1"
                     /transl_table=11
                     /translation="MRPQPQAPSARTRPCEGVQHVAFFFIFVIAALVGSCLGPGLCAL
                     RVSHSDPACEARGSQ"
     CDS             240966..241799
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228683.1"
                     /locus_tag="KTA_02010"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92002.1"
                     /transl_table=11
                     /translation="MLPALVIFALFVWYPVVLGFLMSFQSVDMINPASWVGWANYRRV
                     LADPLFALAWRNTLAFTGYALLFGYLVPLVLALAINEMRHGKSYFRLAFYLPVMLPPI
                     VTVFLWRWMYDPDSGLLNALLSLVHLPGRLWLEDPQTALPCLVVVATWSAAGSTMLIY
                     LAALQGVPASLYEAAEIDGAGFWRRLWHVTLPCIRPIMLLMLVLQIIATMQVFIEPFT
                     ITGGGPQHATLSVLLLIYTYAFQNADFGEASALSVLLFLVLAAFALVYMRMTSRLLQG
                     D"
     CDS             241802..242812
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003972133.1"
                     /locus_tag="KTA_02020"
                     /product="ABC transporter permease"
                     /protein_id="BBH92003.1"
                     /transl_table=11
                     /translation="MEMERIDALHGLDEQEPLAVGGRRWLAWRRRFGGRRSSADTLVS
                     SERTLISPLMLRRPLVRVLYWGIFSLLLVATLTTLGPLYWMVSGALKSNVEIFQTPPT
                     FWPAHPQWSNYSNAWRILQLPLYLGNSLILAAGAVVLQLLVSATAAYALSKLRLWGKQ
                     AIQFAFFATLMVPSVVYLIPQFVNISDLPLIHVSLINTWAGVWLPEAANAFNILVLKS
                     FFDTIPSELIDAARLDGASSWQVFTRIVLPLSRPALAVITIFTVIASWKDFLWPLLVL
                     SNSNLQPLLVALYHESSLNANLPFSYLMAGLVFASIPPIVLFLLFQRQIIRGVNLTGL
                     KG"
     CDS             242942..246391
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02030"
                     /product="hypothetical protein"
                     /protein_id="BBH92004.1"
                     /transl_table=11
                     /translation="MQDVQRRASALLRCGRSRRLALLLTTLALVLGSLGLVLTLPHLT
                     GTARASSAAVTGGAGATLPYVEMEAHQATTNGSILGPDFTLGSLASDAVDRQAVLLTS
                     GQYVQFTLTQPANALNLRYSIPDSASGGGISATLSIYINGVKQPQELQLTSKYSWLYG
                     QPNFSNCNANDWNDTPGGTAHHQFDEVHVLLPQMSAGTTVKLQVDPENTAPWYAIDVA
                     DFEQVPAPLTQPAGSLSVTAPPYNADPTGKVDATSAIQQAVSDASAQGKTVWLPRGTY
                     LVTSHILVDNVTMTGAGPWYTVLTGAPVGSNGTGVGVYGYDAYDGRTSSNVTLSNFAI
                     EGQITNRVDCLQDNGIGGTLNNSTISNIWIEHTKVGMWFDGPLSGLKITGCRIDSVLA
                     DGINFHRNVTNSSVTQTIVRGTGDDGLAMWSATDNVPATGDSNNTFDHNTVQSPYLAN
                     GIAIYGGNGNSVTNNLVTGSQYRGGGIMIDYEDFGNATAPFAGTTTVSNDTIRQTAGI
                     GDQGIQQFGALMFWADSGAMNATFTVSNVEIDNSQYMAISFDGGNPISTVNMNGVNIN
                     GAEFAFSNKVSQITGSASNVTASGLTVASIQSCESASSWNITLGSGNSGWSPSSQVCG
                     FPTGTPTPAPSPTAPLPTPTPSPTPSPQPAPTGTLVLAINAGGSAAGNFVADTDYDQG
                     NQYSDSSTAINTSRVAETIPQAVWQSCRWNSSFTYTIGGLRAGSSYTVALDWAELTWT
                     AAGQRLFNVAINGTTVLSRFDVYATAGYKTALQKQFTVTATSSGQIVIAFTQGGADNP
                     FISGIEIWQSAGGTATPTPTVTVTPTSTPTPTPAPSGTLVLAINAGGGAAGNFVADTD
                     YNQGNQYSDTSTAINTSGVSNPAPQAVWQSCRWNSSFTYTIPGLTAGTIYVVKLDWAE
                     LSFQAPGQRVFNVTINGSPALINFDVYATAGYKTALQRQFNVAANSSGQIVIAFTQGT
                     AKADNPFISGIEIWKPASSPTPPPVGTLITAINAGGTTTGNFMADTGYNQGNQYSDTS
                     TAINTSGVSNPAPQAVWQSCRWNSSFTYTLTGLFAGARYTVKLDWAELTFQAPGQRVF
                     NVAINGTTVLSNFDVYATAGYKTALQKQFTVTATSSGQIVIAFTQGSADNPFVNGIEV
                     YQA"
     CDS             246640..249201
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011140201.1"
                     /locus_tag="KTA_02040"
                     /product="alpha-glucosidase"
                     /protein_id="BBH92005.1"
                     /transl_table=11
                     /translation="MERAQPVATNAHLSAAWPDGYQALGQAQICQRDATSLCLRSGPA
                     TVEVTALAPDLFRVGLFLHGRPRCYESPAVVEQEWQLDQVTISGPEAGRVSMATTLAT
                     AHLSLDPLRISFSDRHGRVFAADDPEFGMGWFEQPVEDAPLALANVVGTLGLPLRVYK
                     QHLPEEHYFGCGERFGGLDKTGSYQLFWNTDPPPGRSVFQNNLYVSIPFTLVLANGLA
                     WGLFVDNPGRVAFDLAHEHPGRSWFGTSTGDLIYYVFCGPTPQAVLERYTALTGRTPL
                     PPLWSLGNGQSRFSYASAEELRQVAATFRARDIPCDTLYLDIDALDGYRVFTWDRERF
                     PDPSGLFSELRSQGFHVVSIVDAGIKVDENYTVYMDGKRRDVYCKTPDYQDYKNAVWP
                     GLCVFPDVTNPEVRAWWGEQHRPLLEAGVAGIWTDMNEPAVFIPVHGTLPPETIHPGG
                     GVPRLHLEIHNAYGSLLVQATREGLQRLRPGERPFVISRAGYAGIQRHALIWTGDNAS
                     TWEDLAQSVPQLLNLGLSGVSWCGSDIGGFYGDCSGELLARWTEFGIFQAFCRNHSEK
                     QTRRQEPWVFGEPYESVCRAMLKLRQRLLPYLYTLFEECHRTGAPVLRPLFWIAPTDP
                     AAWAYDDEALCGDALLIAPVTRPAVSHRHVYLPAGTWFHFWSGQRFSGPAHVVAYAPL
                     GQPAIYVRANTAVPLWPEMNFVGELPPDPLTLLLYPAEGRGTSNLYEDAGDGYGYQQG
                     EYARRSISCEVEGDEIRLFIGPREGHFVPQRQRIVLELRALERTPRSVEWSSDNGAPA
                     SPVEWSYDQEESRLLVTLREQAEAQEISIRLAAKATETALNPRREHRAEGPADRF"
     CDS             249570..250592
                     /codon_start=1
                     /gene="cas1_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WFZ6"
                     /locus_tag="KTA_02050"
                     /product="CRISPR-associated endonuclease Cas1"
                     /protein_id="BBH92006.1"
                     /transl_table=11
                     /translation="MNLIVEGKGIFISKHQGRIRLVRGSQVVEEVPLIHLNQILVIDT
                     GIGISSDVVKLYSEEGIPLHFLEKNGMVSASLYAAGLTGTVLTRRAQLLAFSTAKGCE
                     LARAFTRGKLANQINLLRYFIRSRKDEQPELCQKLHQSAQAIHDLLGEIDGLLIEKQG
                     IAELRPSLLSLEGRAAQHYWTGLRHVLPEQLHWPGRQTRGATDLFNSLLNYGYGVLYA
                     QIEQAILLAGLDPYAGFLHADRPGKPSLVLDLIEEFRQCTVDRTLVGLLNRRVPLEQD
                     GEGLLTAETRRKVAEKVLERLNGGSELYEGKRQALRFILQQQARHLASFLRGERETYT
                     PFVASW"
     CDS             250624..250926
                     /codon_start=1
                     /gene="cas2-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WFZ7"
                     /locus_tag="KTA_02060"
                     /product="CRISPR-associated endoribonuclease Cas2 2"
                     /protein_id="BBH92007.1"
                     /transl_table=11
                     /translation="MRTLVIYDIPHDGTRTKIADACLDYGLERLQQSAFIGELSLSQQ
                     RELFLKMRQRLGRHGANIQLFSLDERAWAGRRVIIRAEPVSLDKDHSKEDEGDDGQ"
     CDS             251211..251846
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258805.1"
                     /locus_tag="KTA_02070"
                     /product="CRISPR-associated protein Cas4"
                     /protein_id="BBH92008.1"
                     /transl_table=11
                     /translation="MEEKSVDHEEEQEICWLDVTDLKQYTCCPRLIYYRYTLPTIRPL
                     TFAMQAGKESHRAEALHHEVRRSLHRYGLSEGERIFHQPLISRRLGLKGRVDLLIVSP
                     SLTASVREATIVEYKDSERQTQAHFTLQLAAYALMVEEELGLTVKRAFLYSIPLRQAR
                     PVPLTSALRRRVEATVDAIRQSLQTESLPAPTAQQRRCPLCEFRRFCNDVV"
     CDS             252052..253131
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012255981.1"
                     /locus_tag="KTA_02080"
                     /product="DNA-binding transcriptional regulator"
                     /protein_id="BBH92009.1"
                     /transl_table=11
                     /translation="MNIETMKRVHRLQAIIHLFESQAQRRWRTREIAERLGINEDTAN
                     KYLNELQVTGLLPITKEGLYWFLPEGAVIPRLQLSLSYPEAVGLYLAGRLLAQTRDER
                     NWHLTMALHKLLEALPAPVREQQGTIAALLLTEDTEREDFSAIFLALACGWVQHRRVQ
                     LTYEPPRKSRFETLFDPYLLEPSAIGRTIYVLGYSHAVQALRTLKLERIRHAKLTSES
                     FDPDPSFKAEELLQRAWGVMYGDEEPVRVRLHFSSQVVKRVRETRWHPSQEIRLTRDG
                     CEWTALIGDLVEIEPWVRGWGADCVVLEPEELRARVISHVQRACQQYGLQPAPASAHE
                     PGRLNPDLFRRPARPDEASDQNRKE"
     CDS             253144..255726
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012255980.1"
                     /locus_tag="KTA_02090"
                     /product="CRISPR-associated helicase/endonuclease Cas3"
                     /protein_id="BBH92010.1"
                     /transl_table=11
                     /translation="MKTLYPYQERVLQVLAQGRNVILVIPTGGGKTLAALLPFLQSCA
                     FNDGTLPSKALYVTPMRVLAAQFMGTCRQLLEEELNPLLIEPLRQRYAQFDRPLLSLQ
                     TGESPDDPQFESLITACTIDQLLASALGVPYSVDGARANINVGLLASAYLILDEPHLY
                     PLNRQGQSCFGALTTTIELLRQLKDLTRFIFMSATLSRPLVEQLAHMVEAEVIEASDA
                     ELETLARGRQRVFRRVAEPLSAEQVLEHHQRCSLVVCNRVERAQELYLQLDELIQARG
                     QPIRLQLLHSRFSDEDRRRQGEELQRLLGPAAWDEKSGRYRGENVIVVATQVVEVGLD
                     ISVETLHSELSPANSLIQRAGRCARFPYQQGQVFIYPLPVDDQGQPQTLPYEPAPCQR
                     TWEALAEYDGQVVRFQEERRLLDTVHCESDLQLLARYEEQRQELLDKMVASLRRPDPS
                     VRSTLIRDDLQVAMLVHDAPEEEIVTAPWQWQLFTLRPSLLQGKHWQALQERAAALGL
                     DWVCKQAVLMDTGGGTVAQGEDDSRREPLYTWEPVTNPAQISTALVLAFPQALVTYDR
                     DLGLVFRDGRLPLPARWQQRLEGTRYQSRPLERRRSGGAGQTVSRQRYEEHIGGLANA
                     YHYGLYHELAYGLRRLEERMGLAAGTIDQAIQLALALHDLGKLAEGWQRWARAWERLY
                     HEKKGLPYQEPAADYLFAKTTYDVRAREERQWEQELPLRRPNHACESVALARRFIGDC
                     LGATTPTSPYAPVVRATCYAIAHHHTTGAHEYGATRLAPGALEAVRQALELVQREAAP
                     RRANLQLIAPACEQGDLFPEHATSGKFSQPALDLHKPQYETWLAFVMTRALRLADQRA
                     DAYR"
     CDS             255899..257803
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012255978.1"
                     /locus_tag="KTA_02100"
                     /product="hypothetical protein"
                     /protein_id="BBH92011.1"
                     /transl_table=11
                     /translation="MTTLYINKASGTFADTLLALGMADLMRLCLARLGRLEQPPEIYD
                     AGQSFLIQLPAVAESDLTSSDRLALLRPLSTAKQQERQAKKGRSFSEVEIFDYEAEQE
                     KQRQLQAQLAKLPPEKRSPKARLNPTPELQEILSNGPSPELEHYKAINVMKVADTFNE
                     LALRWVSLSAEQQWFAVRLLFRLFSAPLNDVEQAQHTWEKWAKEQGLSSKAQATAVQL
                     LNPTSGKGANAPKSNRLAVGGLENFWLLELVKFRGFMLGAAPYTLSGSKDRKTFVVLP
                     ERVELETLRAIMQKFREICWSSTAIKQDILAALRLAQVLVNHRRNELASNQNLDPDEL
                     PPLVSITHGLDVAFYKDMGSAHAVMNVSTINLPSWLPPRPRSVAEAMQIDDLLDEHIA
                     IINRIEGSQGKEGSEELELLRIYRDFLSSHDLRLFWYFAASYGPYLFRQREREKNEKR
                     WLRQFSSQGLDKLVLLESAAMETKKGTQDLKLSPILQNKGFQRIASAIREATVNAQRR
                     RFQDSNYPYEVRYGLGQELLRKIHRRDEFMQALSEFLLQYNAETAREEEKLAQKLGHA
                     LRPEDYRHHHLRYPVTTSDIDEFTTLFDQYPCELVASMLLSYGYARWGKAEESGQSEE
                     DTETAAAQAQ"
     CDS             257875..258867
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012255977.1"
                     /locus_tag="KTA_02110"
                     /product="CRISPR-associated protein DevR"
                     /protein_id="BBH92012.1"
                     /transl_table=11
                     /translation="MTNMPISLSIAARMTLNMHSLNNEGGEGNQIQTRMVDIVGDDGL
                     LHTVNAISGDMLKHVLMEHFYRRAREEGLSLCAGCQQFDANRINADSDFIKGAGNTGA
                     ALIDALLQRCAMDDVGGILVTEGGRSVPRKSVCEFGWVVALPERVRTDSYFHVKYALE
                     RGPGAARKEEGDEHRGANLGQSIFHRPASSGVYAVVCHVELNRVGYNDITQSYAISAE
                     ERQRRSRVLLESLLYSFLELNGAMRSTQLPHLLALEGFISTSETATPAPLVSPLLGGS
                     DEPQAYREQAAAIVRALNGDGPQHVRLQTFDTLAEFSQQMRALIDSITPEAASA"
     CDS             258908..259645
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012255976.1"
                     /locus_tag="KTA_02120"
                     /product="hypothetical protein"
                     /protein_id="BBH92013.1"
                     /transl_table=11
                     /translation="MWIVAQYLPVSFFSLRPASATSSGGQTLLVPTPFAIKMALLSTL
                     IRTRGLAEGERLFPSLRDLPIALEPPEQAVVIKGFSKIRRELKDKSNPEKAARARLEK
                     EYPFQPTIAYREYVSYYGSLRLACEVAEESPLAAVLPELLIGLNYLGKRGGFVQIVEP
                     PQPRAELPAGTFLLLTASRQEAFPIEGTLQVLDDCGPKLTFAQANIYTDERIVLNRDR
                     VLRHVVLPYQRWRSSHAYSWYRRLPLS"
     CDS             259668..260858
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258802.1"
                     /locus_tag="KTA_02130"
                     /product="hypothetical protein"
                     /protein_id="BBH92014.1"
                     /transl_table=11
                     /translation="MGQLWSSAVLCPGQGRAEAPLMDVPFLTWKGEPMLTTYHLLWTM
                     RVETPLELDASPGTALRGALFSAIWRRFCMNKQARTCLECQLLQVCPVSALLAPADDL
                     RAPTLQRLNGQPWGRDIPRPYVLEPPLEVGRRYEPGEQLVFGMTLIGRRVELLPYVML
                     SSQELERQGLGRPLPENGSPPRRGEFRIEQIEAYHPFSGERQQLYRAGERQVTTPTLA
                     VRAEDVRQRALALSEQRVTLAFLTPLRLVRHGTLCKEPDFATLVQRLLERLEQLGQAY
                     GDAEEARALAAQRGRLLALAATVRCEKHTTRWQDMPSYSRRLRRATPIGGLVGQATFV
                     GELAGLRELLVWGELVHVGKDVVKGDGWYRVSSSVKGDSLPTACFPWLQSHAHASFSW
                     GYDG"
     CDS             261638..261952
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02140"
                     /product="hypothetical protein"
                     /protein_id="BBH92015.1"
                     /transl_table=11
                     /translation="MQWRNRLLQVAIILFVLLLVNLILQYSAAQGTLKGAVGVLSWVL
                     PILLLALGLAALWLAYTRRQLPQARLQRGGLSGNTGLFLLGLIVVILALVFLLQNIAS
                     FL"
     CDS             261987..262760
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011143410.1"
                     /locus_tag="KTA_02150"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH92016.1"
                     /transl_table=11
                     /translation="MKDQESPALVLEKVSRSYGSLRALDAVSFVLYPGELVALLGENG
                     AGKTTTLRLIAGLLSPDAGLIQGMGGRIAWGSKEMKQFMGYLPEDPFLYETLSGFEFL
                     ELVGALHRLPRSLCQQRAEQLLTRLNLREVAQRRIQSYSQGMRRRLALCSVLLHSPRL
                     LLLDEPLNGLDLASVREVKLLLSELCAEGSAVLVSTHLLDVAERLCSRAIILSHGRVI
                     ADGALEELRRQASQGAEASLEAVFFALTASDHGVVHSES"
     CDS             262894..264549
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02160"
                     /product="hypothetical protein"
                     /protein_id="BBH92017.1"
                     /transl_table=11
                     /translation="MYSKMGWHRQREHGFHRLTVSFLALALLAFCWWLGHKLALPPTL
                     AGRVLPSFLPGGLTGLWLLCLSWQVVQAPAALWDWPDLEWWLTAPVPLAFVLMRASLR
                     LFATLRGIGMILLALGVLALAALHLSPLLFLSLGLLLLYEALCSTLFALLLTLWLASY
                     FGKRRLRQLIIGVAVGSCCLPLGLFLVTLFPTGGEHLRALLLSTGMVWPGTILTDLIL
                     TLAGSAAASSPAPLPPLASLALLTAMIGSLLLLGGACLLVGKRGYRAGWEGTLIASGQ
                     GTLRGSALRSRLRGGSLWELAWNLRLGSPAVAALVGFCWQDTLYDWRRLSSIVISAFL
                     LLAACWRTTLSGPLALPLALALILSLDALVARMVGLPALQRLLQARSLLQMTPTTAVT
                     LLWSCTLAVGLPLLLVNGCLFVLTLALMPLTLTLACLFGLCLVGSGLGFSVLAVTTGC
                     ATMRTVSLGGSQRASALLFLLGGLGLALSTLLPLGTATLMGLDPVSRQLVLALLESMF
                     HLALPPWLQRLLFWGLPSATVVFLAVLTARSARTVHELLSPTP"
     CDS             264595..265155
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02170"
                     /product="hypothetical protein"
                     /protein_id="BBH92018.1"
                     /transl_table=11
                     /translation="MPVIVFIAMRFGLAALFLYAGLQKIRIQEHFYATIVAFQLVPEY
                     LARLLARLLPAVEVGCALALLLGIATRWMAFALLSLLLVFSGALATAWWRHLSLACHC
                     FGEAGPGEVSSFPRSLLRNAGLGSVALGIGLAPAPALRLLFPALLVDRSYQLGLLGAL
                     MALTLLVTTLALWTVGASFRKQQVLE"
     CDS             complement(265278..266096)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000566240.1"
                     /locus_tag="KTA_02180"
                     /product="beta-ketoacyl-ACP reductase"
                     /protein_id="BBH92019.1"
                     /transl_table=11
                     /translation="MAIPDVSNKSLAELISLRGRNAVVTGGARGIGLAIAERLAEAGA
                     GVLLGDVRADEGQAAAEHIAARYQVQALFAPVDVTDSDSVRGLAQRALQELGSLDIWV
                     NNAGIYPSSPALEMPDEQWDRVLAINLRGTFLGAREAARCMIQAQRGGVIINLASTAG
                     YQGGAGLAHYVASKHAVRGLTKSLAIEFGPYNIRVLALAPTLIRTPGIAELRQEMAAV
                     GAPDVLGDSFGESLPLGRAGVPDDVARVALFCASDLSLLMTGSTLLVDAGALAG"
     CDS             complement(266642..267682)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007053640.1"
                     /locus_tag="KTA_02190"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBH92020.1"
                     /transl_table=11
                     /translation="MKAAIFRGAGKVVVEERPDPVIQEPTDAIVRIVRACVCGSDLWY
                     YRGIASHPEGSIGHEFIGFVEEVGPEVKTIKRGDFVIAPFAISDGTCPHCRAGFHTAC
                     MRGGFFGQGIEGVAGQAERTRVPLADGTLMAVPGAPFSDEVLASLLTLSDVMGTGYHA
                     AVSAEVKPGQTVAVVGDGAVGLCAVLSARLLGAERIIVLSRHPKRQELAREFGATDIV
                     AERGDAAVQAVLSLTDNVGADAVLECVGTNEANQTAFAIARPGAIVGRVGVPHEVEIP
                     AETTFYRNIGMRGGPAPVRAYLPLLVEAVLSGQINPGRVFDFTTDLDHIAEAYAAMDQ
                     RRAIKSLLIVSQ"
     CDS             complement(268038..272045)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256730.1"
                     /locus_tag="KTA_02200"
                     /product="hypothetical protein"
                     /protein_id="BBH92021.1"
                     /transl_table=11
                     /translation="MQQRQEMVSSTIESEGALLPQDLLARIAQQDESLGGLSAADYHR
                     QGEQLNEVISDAWARIRLAWLRFHEARARAPQGDDARLTRERWLLPLFRELGYGQLVE
                     APPQMIGAKSYPIAYFWQQVPIHLVGYRTDLDQTQRLPSGSRSSPFSLVQEWLNRSSG
                     HLWGIVSNGMRLRLLRRNVSLTRQAYLEFDLETMLSGEAYADFVLFWLLCHQSRFEGK
                     NPADCWLERWSRQAHEEGVRALEHLREGVTTAIKELGHGFLVHPANHALRERLRSGEL
                     SAMGYYQQLLHLVYRLIVLFVAEDRDVLLRPDAAAEARSRYVNYYSTARLRRLARWRM
                     GTRHGDLYRALRLVMERLGSEQGCPELGLPALNGFLFSREALPDLADCELTNYALLVA
                     VRALATVQDEQKVYRVVNYKDLGSEELGSVYESLLEMHPFINLEETSFELKVVTGSER
                     KTTGSYYTPGDLIECLLDSALEPVLERAAKQPDAERAILNLKVCDPACGSGHFLIAAA
                     HRIARRLAAVRTGSEEPGPEARRRALRDVVGHCLYGVDVNPMAVELCKVNLWLEAMEP
                     GKPFSFLDAHIQCGNSLIGATPALLRQGIPDSAFEKVEGDDPAMCREYKKLNRAQRAG
                     QLDLFTLDAQLWEDQHVIEESLTRMEAIGDDDVEQLHRKQEGYRQLLSSREYQRACWL
                     ADAWCAAFVWQKRRTAELPYPVTEGIRRKFEEAPAQVPRWMKAEIERLREQYRFFHWH
                     LAFPGVFHLPAPGEEPENAETGWSGGFDVVLSNPPWEHAELKEQEWFATRDSSIAEAV
                     GAERKRKIKALKESNSILYQQFLEAKRQEDSLRHFIRDSGRYPLCSSGRINTYAVFAE
                     TMRHLIAPHGRLGCIVPSGIATDHTTKEFFQAIISSRSLLSLYDFENATGIFPAVHRS
                     YKFCLLTLTGSAEPVSQGATFAFFLHKVAELQAPERCFSLSAADIALINPNTRTCPVF
                     RSRRNMQLTKAIYERVPVLVKEGPPEENPWGVRFRQGIFNMTSDSHLFRTREQLEREG
                     WRLEGNIFRRGKEAYLPLYEGKMINHFDHRFASSFDAVEKEKFRETTVDEHRDPCYLS
                     LSRYWVSLYEVEKRLKDWEKYWILLYRRIARSSDARTYIAAIAPVAAAADTSPVLLIP
                     ERLIRLVPSLLANLNTYPYDFVVRQKCGGIHLDFYLVKQLPVLPPERYSQPCPWDSHL
                     TLGDWIKPRALELTYTAWDLADFARDCGYDGPPFCWDEARRFLLRCELDAAYFHLYGI
                     ARDDVDYIMETFPIVKRKDEQQYGEYRTKRVILEIYDELQRASETGQPYRTRLTPPPA
                     DPAVVHPPRSPLAQS"
     CDS             complement(272167..275070)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010883982.1"
                     /locus_tag="KTA_02210"
                     /product="ATP-dependent helicase HepA"
                     /protein_id="BBH92022.1"
                     /transl_table=11
                     /translation="MNYAVGSLVKVRGREWVVLPESTPDLLVLRPLGGTDEEVTGVYL
                     PLEPVEPAQFALPDPRHWGDHRSCSLLRDAVRFGFRASTGPFRSFAHLAFEPRPYQLV
                     PLLMALRLDPVRLLIADDVGIGKTIEAGLIARELLDRREVRRLAVLCPPHLAEQWQAE
                     LREKFHIEAELVLSSTVAQLERKLPERDLSLFEHYPFVIVSLDFIKADRRRDEFLRTC
                     PELVIVDEAHTCAFPGHEHSARHQRYQLVAGLAADPRRHLILATATPHSGKEESFRSL
                     LGFLKDEFKDLPQNLSGRENERHRLRLAEHFVQRRRADIRSYLHSETPFPERDEELKA
                     YKLSDRYRRLMQQALSYAGEVVRDTSGGQTRRRVRWWSALALLRSLASSPAAAAATLR
                     SRAQVAGAESVEEADQIGRHTVLDLLDSDATESLDVVPGSDFEEEDAHEADASEERKV
                     RRRLLAMAREAEAITFAQDTKLQVAHQLIADLLQQGYRPIVFCRFIPTADYVAKELRQ
                     HLPKGVEVAAITGLLPPAERELRVMQLAQHERRVLVCTDCLSEGINLQEYFNAVLHYD
                     LSWNPTRHEQREGRVDRFGQASPRVKVVTLFGEDNQIDGVVLRVLIQKHREIRSKLGI
                     SVPVPLDTEQVIEAIFEGLLLHESLTSAQAGQLLLPGFEDLLKGEQKNLYREWEAASD
                     RERRSRTLFAQHGIRVDEVERELQEVRAAIGLSEDVERFTTQVLQAYGAFLKRPAGEP
                     DVLEVDLRETPTALRDAIDLLRYAGPNGQQLRISFRRMGLPRTLYLSRTHPLIEGLAA
                     YVLDTALDPVDDAQNPRLARRCGVFRTSRVQTRTTLLLVRLRFQLRMATRGKEEALLA
                     EECQLYAFRGAPAQAAWIEDAAEVEALAQEPAEANLAPEQITDFLQRVIDGYTQYLLP
                     YLEERARERAEALRESHRRVRQVASLSLRHLAVEPLLPPDVLGIYVYLPLPAR"
     CDS             complement(275067..280385)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010883981.1"
                     /locus_tag="KTA_02220"
                     /product="RNA helicase"
                     /protein_id="BBH92023.1"
                     /transl_table=11
                     /translation="MNIFELREHLISDYASYVQSFLQIRDPGIRSHVTQEFERGLLWP
                     EPLIQLNPRFKPGATIDELVAEGLLHPACARIFRRGKTSREPEGQPLQLYRHQDEAIR
                     LAVQGHSYILTTGTGSGKSLAYIIPIVNYVLRHRNQPGIKAIVVYPMNALANSQKGEL
                     EKYLGLGTANHNVRFRRYTGQETAAERSEIINHPPDILLTNYVMLELIMTRPHERPLL
                     EAARLRFLVLDELHTYRGRQGADVALLVRRVRDRLTPPGETLQCIGTSATLISAEQHQ
                     DQRLAIAEMASLIFGTPILPEHIIGETLERVTEEVDTSSAVFRKRLSACVCDPKRRPP
                     ERYEDFVRDPLAIWLEETFGIARRPDGYVRAQPLRIAGEGESAAALLARLTGASPETC
                     AAKIKAWLLAGYEQVRDPETGNPPFAFRLHQFISKGDTVYASLGLPQERYVTLQPQQY
                     VPGSRDQLLFPLVFCRQCGQEYYCVRWLDDQRLIARDVQDQYEQESEVENNAEDGGGR
                     KARKGKRAGQIGFLYLSQERAWPIAQDKIEERLPDDLKEVINGKERVIQSARSAVPLP
                     LYLRPDGTLVRHEGEGFLCHFIPSPFRFCLCCGVTYSVYQRNDFFKLASLSSEGRSTA
                     TTLLSLSTILHLRESDHQAGDQSEGQLMPAKLLSFTDNRQDASLQAGHFNDFVETVLL
                     RAALYKAVKRAGEAGLSHDDLTLRVFEALELQWTQYAANSEAAYTPYSIRLKTDEALR
                     NVLGYRLYRDLQRGWRITSPNLEECGLLIIDYPDLPYICADPALWQESHPALQAASPD
                     VRRKLCRTLLDELRRGLAIKVNYLDPRFQEKIKQQSSQFLVPPWGLDEDEELLYASRV
                     FAHPRSRTHERESVSNRYLSGLSRFGRYVRQELMTALGANLQLTADDRQQIIRQLLAG
                     LCKAGLVEAVTEDERGMGPGYQLSAAAMSWRPGDGSIPYHDPLRILELPKDQPMPVNS
                     FFVNFYRRCAENIHALQRIQAQEHTAQVPAARRQEREEAFREAKLPILYCSPTMELGI
                     DIADLNVVNLRNIPPTPANYAQRSGRAGRSGQPALILAYCSTGSSHDQYFFRHPEEMV
                     KGAVTPPRIDLTNEDLIRAHVHAIWLAETGLPLGQSLKDLLDLSGEPPALSILPRVRQ
                     HLEDQQARERARARAARVLKTLHKDLTEARWYSENWLDEELGHIAQRFDQACERWRGL
                     YRAALSQRNTQDRIITDPSRSHSDKERAQRLRAEAESQLLLLTSGDQGDDVDVEQSDF
                     YSYRYFASEGFLPGYNFPRLPLSAYIPARRSKQRDEYLSRPRFLAIAEFAPRAIIYHE
                     GSRYVIHRSLLPRQADGSGLITSSAYLCSHCGYLHPLTEECSREVCDACRNPLGRRLD
                     QLFRLQNVSTRRRDKITSDEEERLRQGYEIYTALRFAESRGRPLRLIARIERGGQTLG
                     YLTYGQSATLWRMNFGRLRRRNEAMRGFVLNKETGEWGKEDAIASDPTDALAAGTIRV
                     IPYVEDTRNCLLLKPERELDAAQMASLQSALKSAIQICYQLEDNELAAEPLPHADQRQ
                     LLLFYEAAEGGAGVLRQLIDVPEALARVAREALRLCHYDPETLEDQRRAERAREDCEA
                     ACYYCLMTYANQRDHRLLDRALIRDLLAELKECRVVLVEETDPTLAAAAAGDSLARLL
                     NEARKEVEREWLRWLQEQGYRLPTRAHWQPPHCSATPDFLYDGGPGAAAIYVDGEGPA
                     GAERATRDLESSEELLDQGYLVLRFGPRAQWGALCRRYPSIFGREP"
     CDS             280577..282022
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02230"
                     /product="hypothetical protein"
                     /protein_id="BBH92024.1"
                     /transl_table=11
                     /translation="MSKYFLLSLSRASSSLQAIIDGQARLTIQQVAPPTLQVGDHCLV
                     MQREPSPIVLPLVLSVVSVNSPAQTATLAVIERYNHPANLNALNGDIYQTSSESKLLR
                     EQAIAEEVQSYNYSPISLFPLTKSRWEAITGSMGGSRLEEQALLKHIHSYVSARGYYF
                     DEETLYNYHICLKTRPFVILAGLSGTGKSKLSQFYAEALGVPRERYLRLAVRPNWNDD
                     RYLLGYFNTLSGSYISEPALDFLLEASAKEQELYFFCLDEMNLAHVEYYFSQFLSAFE
                     EERPTDRRITLMSQRLYEELKQQRQGLTIPPELPLTPNLLFTGTVNIDETTQPISDKV
                     LDRANTIEFFSIDLDKIPQPRVPPDPVPISALTWQSYKAQQPDSRYRELLRAINTILN
                     RVEIGIGYRVVREIELYLANSAGLLEPQAALDLQIKQRILPRVRGTEVIEGVLNELLA
                     LTRDQQLPRSHQRLEEMKSRLKRDGYTSFWR"
     CDS             281997..283706
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02240"
                     /product="hypothetical protein"
                     /protein_id="BBH92025.1"
                     /transl_table=11
                     /translation="MATPASGADAPWLTMNGQPLSFAPDDDNAALNLREYQSYIIKVT
                     PAAPHPLSLQIDEVPLHTEHYGLWQWRPEHYAGLYSLTASAPGVEPRSAWLRVFPQKL
                     SQRLYEQMRSELAALSLDLWFRLLSPAVERAAFARRLDETSPLHDYKQVRTLIEKLRP
                     VMLHIRRRPHCSLQPVQRRCSWQELAHVGGGTQPLPGPSLELPAEQRPFGYVRHLPQQ
                     WQVEESQLSYDVYENRLLKHFLQRQLPARLSLIEERASAEAQRRAAIYQRYHNEEDRA
                     LLERLQRVIAECQQMRQRCLFWSSEPFLKTVQPAVLPGKATQVLLKHPAYSRLFQLYL
                     QFQQRLMVVNTERYVNELGQRRVSELYEMWSVFTITHLAVELLEARGYRLVSNTTFYE
                     VEKRYFEFEVRKNVASIVLAKDDLEVVFKYEPYYPHASTVGTAPALVSTLSSGGPLTP
                     DMAIEVYRQGEPLRVLVFDAKYRWQRSPSGHYYAREDDINKMISYRINIRYQYLRRTS
                     GDAQLQCKRIVSSASILYPGTELQEEDDGHIRAFPLVPGLAQGRLQAIRRQLSELLTA
                     AQL"
     CDS             284236..284949
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02250"
                     /product="hypothetical protein"
                     /protein_id="BBH92026.1"
                     /transl_table=11
                     /translation="MQSLWTTFPPQLVLAGSTLYVSQGSIYGLDTRTGKVRRQYAVSG
                     SAALAFARGTLYLNVNRHPDSSVQAVRAHDSWALWSYQVAGPLAHAPTLARDGVYVST
                     TEGVLYALQARNGRLLWQQAVGGTSAAQWPTVAALIGRVLCVGAKSGPDSILSAYQPA
                     DGALLWSSHLSGTWFSLPIGAAGRVYISDNNGEVSAFRLRDGQLLWQTAVAAEVQSTA
                     YLSMRPSSIVLLPASSPEP"
     CDS             complement(285071..285925)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010967912.1"
                     /locus_tag="KTA_02260"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBH92027.1"
                     /transl_table=11
                     /translation="MGSAWTEGDIEANAIHLHYSRTGDQQRPSILLLHGITDSGRCWS
                     RVATDLATSYDVIMPDARGHGQSSLSPDVVSIALLATDAVAVIRALSLERPILIGHSM
                     GAVTAAMVAASYPDLVRAIVLEDPPLLDSPDIPAPPSTWQWLFDLRTLSPEERLIKAR
                     ALQPTWAEEEIGPWAASKAEVQIAVLDAAHAAIGAFPWRDVFPRIQCPMLLITGDPSL
                     GAIVTAPVARQAVALTRQGQLVEIAGAGHNIHRDRYDQMMRAVKAFLSRVEYPGPPPE
                     AAMPVPSP"
     CDS             287092..288408
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02270"
                     /product="hypothetical protein"
                     /protein_id="BBH92028.1"
                     /transl_table=11
                     /translation="MTTHPLPAELEEQLQAHRRWLDSRGSAGHRLSLPQADLHELDLS
                     NYMLSFASLRDCNLSEANLCESWLAATDLTGSQLQGALLSYAHAEGVCFDQAILDEAN
                     LAKADCFRARLRQARLRHLRGVRVNLRNADLQAADLSYADLQRAILSSACLEAANLRG
                     ANLRWATLSGANLRGANLQQALLTGALLTCADLTGARLGSASLLGARDLDTVQADWID
                     ISEDDGPPQLLYGEQARRWLLSATILRPSVTAGALLQQAGFSQEEISSLLQADWHTGL
                     APLFLLLNRLKAALQYGTDWLGLSPQQLYQLHAQIRAASSYTNPSAPRLQTLVRLKGL
                     LAQALLGSLVAFCQPVTHPHYGPAILDLVLPKALIMVSLDRTIPTEELAIYHHQASSS
                     QRVILYAPHFPARLVHYLSLDYVADYFAVVQSPEDLFHYLHVHHLS"
     CDS             288426..288959
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02280"
                     /product="hypothetical protein"
                     /protein_id="BBH92029.1"
                     /transl_table=11
                     /translation="MSSVVALLSSASIPDPELEAFLLQAGAQPLNSLFTYLLTRETAF
                     VRIHLHALPPLAELEPPALQQALGQPIRTRLLLVFPSTPESEQLCLQFCCQFAARWPC
                     LLDDCSHSSHSFYTPEDLRALAQEGRGFGHPDAFQPLLAHLETSLEAAYYSSAYQALF
                     KQQAHSSKEASEQQQPA"
     CDS             289002..289661
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02290"
                     /product="hypothetical protein"
                     /protein_id="BBH92030.1"
                     /transl_table=11
                     /translation="MIFYSLPSPDLQAQILAHERWLQSQGRAGRRLVLRQADLHELDL
                     SGSGLTDAQLQACNLSRSLLEEAWLEGADLTGSRLEEADLLRAHAAGACFVQASLDEA
                     RLSGADCSRACLRQASLRRLEGISTDFWASDLREANLSGATLDQANLRQARLEAANLT
                     GARLKEADLTGARLWRARLQGAQGLETVRVEWIDIGEDGQPQLLHGEQARRWLLAAAS
                     S"
     CDS             290068..290529
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258480.1"
                     /locus_tag="KTA_02300"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BBH92031.1"
                     /transl_table=11
                     /translation="MDDYQDYRLFQELSLLLDHADRLVLRQFRLNTLQYNALLLLDPD
                     EGWRLTDLSERLLCERSTVTRLVDYLESEGLIARSPDPTDRRSQRVTLTAAGIARRRE
                     AQAAIEEAIRRRFSVLSREEERQLIAMLKRLRAVVSAEIEATSHEANNTAP"
     CDS             290562..292499
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256397.1"
                     /locus_tag="KTA_02310"
                     /product="alpha-amylase"
                     /protein_id="BBH92032.1"
                     /transl_table=11
                     /translation="MPEIFESATDEAPSQPDAEQMAAVPGDLPLREILIRWTAQRTQF
                     RHDNTTLPAAPLPGEPVEVWATSGEEVPIERAVLFYTVDGSRPDRSSTALPMERVRVT
                     WDPHAGYLTHWLARIPGQPAGTRVRYRIAGWLAHPGSPASDEPEIWAQDGQGFAFHFA
                     GERAFTTFAYLVEEEAQRRPPAWTSEAVIYQIFLDRFRSDASDGSFPPESEPQALHGG
                     TLNGVRAALPYLAELGVTCLWLSPLHLAESYHRYDALDYFSVDPRLGSSADLKALIEE
                     AHACGMRVLLDFVPAHVSWHHPAFVAAQLDRQAPSHDWFYFERWPDRYGTFLDAVPGL
                     PSLRSESEGARRHILASALHWLGEFGFDGFRLDHAIGHSMDFWCEFRLATRALRPDVF
                     LLGEVTDTPDALRRYRGRLDAVLDFPLAAALRSTFGVRTWDLRRFESFLSAYEEYMAT
                     GPARASFLDNHDMNRFLFISGNRAELLKLAALCQFTLAPVPIIYYGTEIGMSQRADVS
                     SKAFGGDAEARADMPWRPEHWNQELLAFYRSLIRLRRALPVLTHGARRVVHLDAHQAT
                     YAYLRTHAADQHLQPGDALVLFNLNEQPQTVVLPEAVLPSAATRLLATGSVSVVRRSQ
                     HQVAITCQPLSGAIFAWQEGG"
     CDS             292662..293951
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259002.1"
                     /locus_tag="KTA_02320"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBH92033.1"
                     /transl_table=11
                     /translation="MMMQKKLFTVHASGSRPLLALSTLIAMLLLLLSACGGTSSSSSN
                     SGSSIDYSGTIVIWHGWQGAYLQAKQAIFNEYMRLHPKVKIVLVHQDNIASKAATAVK
                     AGNGPDIIAFTDDNLGSLALGHVVVPLDQYISQDYLNRTYSPAAASALVFNGHVYGVP
                     EAVEAITLMYNKNLVSADQLPKTTDDLLAFAKRYQQTHPGQYGVVWPTEDAYFNAPWF
                     YGFGAQYVTPDGKAHLDTPQALQAMEYIASFRPYLPKQPTYDVVSSLFAEGKAAIIIN
                     GPWSYADYASGGKINVGFATLPIVSATGTPAKPFVGVKSLWMAKTAKNPALVADLMKF
                     YTNKANQIAMSRADGEIPANSAAADDPAIQALPAVAGYAAQVKLGVALPNTPYMSALW
                     TPVQNALTAVWNGTQTPAKALSDAQAAATKGIAQISS"
     CDS             294105..295046
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02330"
                     /product="hypothetical protein"
                     /protein_id="BBH92034.1"
                     /transl_table=11
                     /translation="MLRVKRRTIVAFLLPMLAMMAVINLWPILYTLYLSTTNYSEFNS
                     DNYRFIGLENYRQLLLSFDSDFFPVLWQTLLYVVVCVACFLIVGMLTALALNNPRVKG
                     LPFWRVVLLLPWAAPSGITALIWKFLFQYDFGPLNQIGRLFFGRQFGIPWLLNPTLAF
                     ISVVIVNVWLSYPFFTVVILGALQSIPSELREAARIDGAGPWQYFRHVTLPLVTPALV
                     PATILSAITTFQMFNTVFLITQGGPIVSALKPGATEFVMIYMYNRILGATVANPHYGF
                     IAAFSITLFVLLAILTYIGSGLGTRSPQMSGIREARA"
     CDS             295043..295993
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010972816.1"
                     /locus_tag="KTA_02340"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92035.1"
                     /transl_table=11
                     /translation="MSQKLSMAEAPKEQLASSALSGEQRRAPRQRQRRALARLGARLG
                     LVGIYAFLVAMAVFALFPLYYVVQASFAGAQNLYTTDLHLFPAHFTFANYVTAFTQEP
                     LLNWIGNTLLVCGLTALCGLACSTTGAYALARFRFAGRQLTLRALLTLQAFPGLLALT
                     AYYLLLNALHLLNNLLGLVLIYSAGAIVFCCWNTKTYLDALPVELEQAALLDGATPFQ
                     AFWHIVLPLATPALAVAALFTFMTGWNEFALANLVLNANDNGSNLTFILGLYSLQSDF
                     RTPWGIFAAASVIVSLPLMLIFFFAQRYFRSGLAQGGLAN"
     CDS             296179..298374
                     /codon_start=1
                     /gene="amyA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_269428.1"
                     /locus_tag="KTA_02350"
                     /product="putative cyclomaltodextrin glucanotransferase"
                     /protein_id="BBH92036.1"
                     /transl_table=11
                     /translation="MKSVSRQHARCSYLLLVLALIFSLAVSGGLFPRLIPTIVHAQST
                     PNVAANTADFKPAVIYQVVLDRFFDGNPSNNDPSGDTGLYDSTKTNWKLYWGGDLAGL
                     TQKIPYLAGMGITAIWISPPVENVHLPVYETGSSAPEAGYHGYWARDFYRLDPHLGTW
                     SDFDTLVTTAHNYGIKVIVDFAPNHSNPNDTGEYGSLYQNGTFEAAYNNDPNGWFHHN
                     GGIADYNNLYQDEYDNLADLADLAQENSSVDSYLKGAMAQFLAHGVDGVRVDAVKHMP
                     APDGGWLRTLSDSVEAQGPHYMVGEWYLSSISDPTYQYALKFANRSGISLLNFPLTTA
                     LRDVYASGNAASEVDSVLSQEESGFLWLNDQAIFVDNHDMPRFLTLNSSYDRLHEALA
                     AVLTLPGIPVIYYGTEQYLHNDTNGGGDPYNRPMMSSFSTTTTAYSEIKALATLRQSN
                     PALAYGTYQQRWINSDVFIYERQFFNNVVLVAINKGSASYSISGLYTALPNGSYSDYL
                     GTLLHGGTTITVSNGAVSSFTLGANQVSVWQYTAPESSTPEIGSVGPNLSRPGDQVMI
                     DGQGFGSTVGSVKFGTTTATVKSWGPHSITVITPNVAGGLYGVQVCTSTGCSNVYQTR
                     VSSTAQVAVTFTVNNAPSTNYGDNVYLTGQFDELGNWGTSPTTAIGPLNDPNYPNWFV
                     MVSVPACWNIQFKFIIIRANGSVQWENGNNHSYTAPCSGTGAVTVNWQY"
     CDS             299260..300870
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004528841.1"
                     /locus_tag="KTA_02360"
                     /product="kumamolisin"
                     /protein_id="BBH92037.1"
                     /transl_table=11
                     /translation="MPELPQGFTRLAGSERHLPAQARRVRSADPNERIEVSVYLRDPA
                     AIEEAGALERHARLPGPQMSREEYLARHSASPEDVARVEAFAQAHQLQVLAVDRAARK
                     LVLGGTVAQFCAAFATELHHYEYEGQTFRGRSGYLHVPRELAQVIIGIFGLDDRPQAQ
                     PHLRFTSAPGRGTLVSTATVSYTPLQVAQLYDFPSGLTGSGQCIALIELGGGYSSEDL
                     AAYFQQLGLNVPEVVSVSVDGGENSPTGDPNSADGEVALDIEIAGAIAPGARIAVYFA
                     PNTDRGFLDAITQAIHDTANAPSVISISWGAPEASWTRQAMTAMNQAFQDAAALGITV
                     CVASGDNGASDGLNDQKAHVDFPASSPYVLGCGGTRLEAQAGQVTREVVWNEAAEGGG
                     ATGGGVSDVFPLPAWQERVAVPPSINDQHRGRGVPDVAGNADPQTGYLILVDGQRTSV
                     GGTSAVAPLWAGLIALLNQRRGQPVGYLNPFLYQRYSQLLQQKALRDVTSGDNGGYAA
                     GPGWDACTGLGTPDGALLLQALLTPSAA"
     CDS             complement(300957..301517)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02370"
                     /product="hypothetical protein"
                     /protein_id="BBH92038.1"
                     /transl_table=11
                     /translation="MQESLQGGWQNFYVIIGSASAALIGLMFVVMTLLAARGMRQTGE
                     EAIGAFGTPTVVHLCTGLLVALILTAPWPALWQVALLLACGGLAGVLYMLIVIQRARR
                     QRHYQPVLEDWVWYVIFPLLAYASLVGAGMALLSYARPALFVIGAAATLMLLIGIHNA
                     WDTITYLTFNQDSLDKEKNKGQGRET"
     CDS             complement(301612..302580)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02380"
                     /product="hypothetical protein"
                     /protein_id="BBH92039.1"
                     /transl_table=11
                     /translation="MLTLMRPLATWLASLSRRGRPSLCAHQPPPMALLIDGENIGAEW
                     AAAIVAKASLFGVVTIRRIYGDWASAQMASWRTIAECYGFQQVQVPRAVPGKNAVDLA
                     LAVDAMDLFFGGLRCFCLASSDSDYAPLVRRLRAAGCFVLGIGRPPISQMLQAACQVF
                     LTTDQLHPLLLQREAPATGLIHPAGAKEVKECPAPVKEALAPPMVSQSMTTGSAQPKQ
                     GTIPAGLLCLAYQEASKVSKRQDGWVSESQLGQHLHKLDTLFKVKTYGFRRLRELLER
                     ARAEGLLEIQHSDGKQWYVRLLAAASSQTLASASSPSELEEPALES"
     CDS             complement(302979..303860)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02390"
                     /product="hypothetical protein"
                     /protein_id="BBH92040.1"
                     /transl_table=11
                     /translation="MDMAEADNSYVIDAENAGELARLMQQDRLLTKAMGDLLPEFATE
                     LLPPDGGRVLDLACGPGGWALELAFAFPRIEVIGVDISQQVITYARAQAWSRGLENVH
                     FQVGNVMEPLSFSDRSFDLINGRLLSGFMLPDAWPRLLGECWRLLKPGGVMRLTEGEM
                     PLSTSPASERFNALFTEALKRAGRSFSPDGRHIGITPMLARLLRQAGFEEVRLRATVI
                     EWSIGTEAYYPVFKDALFGIELLQPFLVKVGVATKEELERLAQLAIAEMQQEDFCAIW
                     NLVTAWGRKPASAAAVG"
     CDS             complement(304764..305897)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003974908.1"
                     /locus_tag="KTA_02400"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBH92041.1"
                     /transl_table=11
                     /translation="MKAVVYKEPFKVAVEQVPDPKIQHPNDVIVRITSTCICGSDLHM
                     YEGRTAAPPGLIFGHENLGIVEEVGSAVTTLKKGDRVVMPFNVACGFCKNCERGFTGF
                     CLTVNPGFAGGAYGYVAMGPYPGGQAEYLRVPYADFNALKLPPGTEHEDDFVLLADIF
                     PTGYHGAELAQVSPGESVVVFGAGPVGAMAAYSCLLRGAAEVYVVDRVPERLKKIEEI
                     GAIPIDFSKGDPVEQIRQMRGGDGVDKGIDAVGYQAIQPGQDKEAPSAVLEALIQIVN
                     PTGILGIPGLYVPADPGGVDPHAKEGRLLISFGKLFEKGLRLATGQCNVKRYNRYLRD
                     LIIAGRAKPSFIVSHHVPLDDAPMAYEKFDKRIEGYTKVVLKP"
     CDS             complement(307340..308176)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011731602.1"
                     /locus_tag="KTA_02410"
                     /product="creatinine amidohydrolase"
                     /protein_id="BBH92042.1"
                     /transl_table=11
                     /translation="MLAVQATHWHHLAEMTWTELDRLNRERTVILMSAGPLEQHGPHL
                     PVGTDVFAAEEVTRRLLDHLSKTTDWTLLLAPTVLYGSAVLSRPYPGTVSVRRSIQTE
                     YCTDILASFVENGFRWIIVTSQHMDPPYILAWEEACQRVNARGGRALHGYERLIFDDL
                     FEAGLLSAILGCDIEGESHAGVFETSQLLATRPELVRQEELAALPRVRLDFLGELRRA
                     RSWRELANGLGYTGYPAEATAERGELIYRRYVARYAALVEQHLAGADVWSALTLTRWF
                     PS"
     CDS             complement(308247..309095)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011392823.1"
                     /locus_tag="KTA_02420"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBH92043.1"
                     /transl_table=11
                     /translation="MGLFQPVQDEKRSLEGRIVSYIRDLVERGVLTPGERLPPERELA
                     AQLRVSRTALREALHTLAALGLVEARHGRGIFVVGGALQATAQRLSLALGAREGEEEG
                     VARIRQLFEIRRVLEGAAAEWAAQRAQPEQIAELQALLARDRALRTAEKVDRSLISEV
                     DGQLHALIAASTANRLLVLLMATLLDELATARSRSLVLPERIQRSLEQHVAIVEAIAA
                     RDPLAARTSMIAHLDDVEQAIIRNWEAETAAGKRRMVQDEEQPDLTESGGDSSQEETR
                     GWLPPR"
     CDS             complement(309100..310182)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_041272527.1"
                     /locus_tag="KTA_02430"
                     /product="lactate dehydrogenase"
                     /protein_id="BBH92044.1"
                     /transl_table=11
                     /translation="MTEMDSVGLSLVEAAELERFAASVMEAVGLPWADARTVAWALVT
                     ANLEGIDTHGVSRLALYARRVRAGLAAARPRLRWSHPAPAVALLDADNALGPVAAVAA
                     IDEAVRLAHGQGVGMVAVAHTNHAAALSAYVERATEADCLALMVCNTPPAMPPWGGRR
                     AFLGTNPLAFAAPGAGPGEPPVVVDMATTVVARGNIIMAAREGRAIPEGWAVDAEGRP
                     TTDAQAALAGAVLPMAGPKGYALALMIEILSAIVSGSSWGPRLRSPYQDWTGPTDAGL
                     WCLALSLPALMPLEVYRQRLGALLEALRQEPAAPGEEIRIPGARRAAMRARRLSEGIP
                     LDPATRAELEALGAELGVRPLVWKAP"
     CDS             complement(310277..311221)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02440"
                     /product="hypothetical protein"
                     /protein_id="BBH92045.1"
                     /transl_table=11
                     /translation="MLIVVSEWLASPGPELLAASGHSICLDPTLWNDPARLRECLAEA
                     AALIVRNQTRVTASLLEAAPHLRLVGRLGVGLDNIDVEALRSRGIELVTARNANAIAV
                     AEYVMAAMLHVARNLTAADASVRAGKWERTQLGGMELWGRTLGLVGVGEIGRRVARRA
                     LAFGMKVIGYDPFIGPYDYAPAELGIRLLPLAEVLEQADVVSVHVPLSAETYHLLDAS
                     RLARMRPEAILINTARGGIVDEGALIEALNAGRLRYAVLDVTEEEPLPAESPLRSCPS
                     VLLTPHIAGLTAEAQERTSRLVITEILQRLAGGQSQGG"
     CDS             complement(311259..312707)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005816116.1"
                     /locus_tag="KTA_02450"
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="BBH92046.1"
                     /transl_table=11
                     /translation="MADYTLSTLASLYIRGEWHRPDAGNVREIRNPADGSLVATIGYG
                     SQSEALAAAEAAREAFPSWAGLPARARADLLLQASRLLQERSERIGYLLALESGKRLP
                     EAVAEVRFAVEYLRWFAEQVRRPAGELLRPETAQRRQLTLRQPCGVALCLTPWNFPVS
                     IQARKLAAALAAGCTIVSRPSEKAPLAVMELFRCLHEAGLPPGVANLVHGPAAEITQT
                     LLRHPAVRVVSFTGSTEVGRQIMHQAAERVVRPLLELGGNAPFIVFADADLDRAVEGA
                     MLAKFRNNGQSCIAANRFFVEAPIFAEFVERFAARINAMRVGNPVQEPIPDLGPVIDE
                     QRQQALTRLVAEAKAAGAQPVTRPVALPSRGTFVAPMLLVDLPADNALAQEEIFGPVA
                     LVFPFETEEEVIARANASEMGLAAYFYTRQLERAWRVAEALEAGIIGLNAPLPSVAYA
                     PMGGLKQSGLGREGSHEGLDEFQEVKYLCCEW"
     CDS             complement(312789..313946)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012582864.1"
                     /locus_tag="KTA_02460"
                     /product="galactarate dehydratase"
                     /protein_id="BBH92047.1"
                     /transl_table=11
                     /translation="MAEQHLSGYRRPDGRVGIRNHVVILPVDDLSNAVCEAVARTVPG
                     TLALPHAYGRLQYGPDLELTFRTLTGTGANPNVAAAVVIGIEPNWTQRIVDGIAASGK
                     PVEGFSIERFGDLRTLERAARVAQLMLQDASELRREPLEREEIIISIKCGESDTTTGL
                     ASCPTVAQVVDRHVLAGGTVIFGETSELTGGEHLIAQRCIDETVRARFLAMYEDYIRE
                     IEASGANLLGSQPTQGNIRGGLSTIEEKALGNIAKTGTVPVVDALEPAQAPTRRGLNF
                     MDSSSAAAEFITLMGAAGAVVHLFPTGQGNIVGHPIVPVIKITANPLTAETMAEHIDL
                     DVSGLLRREYGLREAGDRLLALIDRTINGRLTCAEALGHREFVLTKLYRSA"
     CDS             complement(313928..314266)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_052846820.1"
                     /locus_tag="KTA_02470"
                     /product="dehydratase"
                     /protein_id="BBH92048.1"
                     /transl_table=11
                     /translation="MSHSDSQAQQVQQSRATAPDFLIHNEGDHVAVAVQDIQPGRHTA
                     VYMDSEREVTITVLEAIPLGHKVALSDLKEGEAVIEYGLPIGLARQPIQAGQHVHIHN
                     IRSARWQNSI"
     CDS             314615..315817
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003972914.1"
                     /locus_tag="KTA_02480"
                     /product="transcriptional regulator"
                     /protein_id="BBH92049.1"
                     /transl_table=11
                     /translation="MSISLTRHGLREVNREQALRTIVREGPLARIDLAQRIGLTAAAI
                     SHITRELIEDGLLREVGTQRGKRVGASAILLDLPEEAPIIGAIHQGVSAIRIALCTLR
                     GRVLARRQVSTPRPISPEETVTLIEQQLQELLAETGYTQASLIGIGAGVVGLVDSERG
                     LVKRAPSLGWEKVPLAELLAKRLGSPVAIENNVRAMALGEALLGQGRFWPDFAFVYVG
                     TGIGSGLIVNGQPYRGAHGSAGEIGHITVDPAGERCACGNRGCLETVAAEPAIVRLAS
                     AQGLGSLAEASSPKEAVRRLALLAREGDQAACAVVRTCGESLGIALSTLTDIFNPSRI
                     VLHGAIAAAGDLFFSAVSTCLHQRAFLTKDESVELVAPTFGEDAGIIGAASVALEALV
                     LRAAGRER"
     CDS             315928..317298
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011459729.1"
                     /locus_tag="KTA_02490"
                     /product="fucose isomerase"
                     /protein_id="BBH92050.1"
                     /transl_table=11
                     /translation="MMNIENRRERPLPVLALACIARPTFAVDYAGDMARQALAALQQE
                     SWPVYGDATLLMDAQSARQYALGLKERAPDVLVLLCATFSDASMAVELASHIDAPVCL
                     WALREPGSPGERLWLNSLCGAHLAAYALHKAGRVVRYIYGDPGEAGLFAPLRALARAA
                     ATRKRLRTSRLGLVGEAPTGFYSCQFDELELARVIGTTVSRIDLAQVFKAASQAPASA
                     VAEVIASTQRRSPSLQALRSEEVQRFGAAYVALRALLEEQHLDGLAVRCWPEFPQDFG
                     LMPCATLGRLADDGFVCACEADLHGAVTLLMLQWLSGAAPLLADVVALNEQRGALWLW
                     HCGNAPACLARPGEEIPLTLHCNRRIGVAGDFAIRPGPATLARLGVGAGGYRLLYVEG
                     ELLDEPVNRFAGNTAVFRPTCHARQVLDTLIAGGWEHHVAFVAGHQAEALEALAELLA
                     IERVAL"
     CDS             317468..317914
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02500"
                     /product="hypothetical protein"
                     /protein_id="BBH92051.1"
                     /transl_table=11
                     /translation="MAVNEDALQLQLSRSEKGPAHGLAPRLEVEPSQVSPPTLSRRRL
                     LSQGIKASVGVTALGTWLAACGGAPASTSGPVTIQFAALVDTTGEQTAEIKRFNDLHA
                     GKIHINDPRLRPGACPQPRRPGLRGWLTAAHCPAGQYSDPECCVRH"
     CDS             complement(317802..319007)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011028668.1"
                     /locus_tag="KTA_02510"
                     /product="transposase"
                     /protein_id="BBH92052.1"
                     /transl_table=11
                     /translation="MQVQRTIPLLLPADEDLRRTLAVFQAVQQQLSAPCFNEGRPLSA
                     VALQRACYHEVKGQLNAQMTCTAIRLVAAAYQSASSHRRPPQRPFQFRRRRALFLIGQ
                     RGRDARLCPDGTLSIWTVAGRKRLPYRVPEAFQQRLAQAKTIDSLTVLERDGQLIGRL
                     TITLEGPDPQPLPGADEAARSSQIVGIDLNETNALVAVDGQERVLFVSGKAVKVRNRR
                     TAKTRARLQRKLAARKAQHRDTRSVRRVLKRLGRQQRHRTQTFAQTVAKRLAEWVPAG
                     AVLVFERLQVPPPEHGQIRGKALRRRLALWQRGLIRRWVEQQAQERGLHVVDVNPAYT
                     SQICSRCGQRGNRRRHAFTCPHCGFQEHADINAARNIRDRCTVLRGSGLLSTSPEARA
                     DEAAGKPLA"
     CDS             complement(319653..320093)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02520"
                     /product="hypothetical protein"
                     /protein_id="BBH92053.1"
                     /transl_table=11
                     /translation="MTLPWSEYDPVPSPITLSNLLTSLLSLLTKEECVRLYGRLSLTL
                     SIKAWPMTPESVTREACLKQAVPILLAYGFEQGWGTALAAVDELRRHHPVTKSMLLEQ
                     DRQALIRSWDHRIERVLQALEHEEAAQPVHQQDPVQPPEGATDQ"
     CDS             complement(320068..321009)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02530"
                     /product="hypothetical protein"
                     /protein_id="BBH92054.1"
                     /transl_table=11
                     /translation="MLPSANPRPVRAGRAASSPHIAPRRGTVVPSDPLHPVHLYLEDL
                     GAFPRPDPDSPLPVADPGRAPGTALVERNLRLVVSVARTYAPLLRAGRLSLDLADLIQ
                     AGNLGLLEAARRYDPGRGYRFSTYAVWWIRLAICQAIWEADTIRLPSTMRTRLPTRSA
                     EGTDEARGAVPGAQAVPRAVSLEALTREERRQILVLPDPTRSDPAAIVCRQHEAQERR
                     RWLEEAMQRVLSPRERAVLRALLEPGDRWHPVTLGEVARTLGLHRESVRQLRDRALSR
                     LRAAWLADSQRETNPERNQCCSPEQGGSSHDPALVRV"
     CDS             complement(320993..321259)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02540"
                     /product="hypothetical protein"
                     /protein_id="BBH92055.1"
                     /transl_table=11
                     /translation="MQWIRALVHRTVTHPERSLRRLERQIAAYQARQAHLEAAIQQLC
                     AQHLAVQLQLRRQQRQHSRPQAPRTEAPGPIPLLSPGGSHAPIS"
     CDS             complement(321404..321658)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02550"
                     /product="hypothetical protein"
                     /protein_id="BBH92056.1"
                     /transl_table=11
                     /translation="MSLARAGRFPAGTWLLYERPGGLKVAVIVQPAGPWHDEPMRAVL
                     ILDGLTGSEIEALIRLLGLAPFAEWAPASPADTQAFFGVE"
     CDS             complement(321655..322200)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02560"
                     /product="hypothetical protein"
                     /protein_id="BBH92057.1"
                     /transl_table=11
                     /translation="MPETAGSLAPAGRLPELPAPAAPWPCWVVWLSQAIQQVGAYEVP
                     LSAGQLRQLVDGLAALAARLETEATCALDQQRRTRAGMQAKAFLHRQYLRLSAASQQC
                     DEARLLVGTLAQRVSREQLARLPHRHRPGVSGPDRLRQQVRQQLVSLRAALERLGSSS
                     RPGGVVSHLAGSASLEGGEHR"
     CDS             complement(322193..322390)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02570"
                     /product="hypothetical protein"
                     /protein_id="BBH92058.1"
                     /transl_table=11
                     /translation="MVTLQVLSAASQPPVIQVQVEGVPFVLTCHLTAAASPHLAVTRL
                     TLVQPGEDQWPAPAERRGTHA"
     CDS             322526..322867
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02580"
                     /product="hypothetical protein"
                     /protein_id="BBH92059.1"
                     /transl_table=11
                     /translation="MPVLPQQVMDLAVLNHVKLADTGRPVGVLRLLLLPPGTQCRAKP
                     PKPAQSQQHPSPETEGSPQPPAQHGRTDGRTDGCSQERSQQPPAVPPGTVAPPAQRGT
                     SRAAGDWLRAE"
     CDS             complement(322991..323503)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02590"
                     /product="hypothetical protein"
                     /protein_id="BBH92060.1"
                     /transl_table=11
                     /translation="MERYAAHGSASDPVGEARDTPASPDSLDVLLTKVEALLRRPGRL
                     YWIGASPALPPLWFFWPPWFTTARRGRFLETRRAYLQALRAVLARVTRWRQAPDPRLR
                     AEASRLEERLRDELQERLLWYQIRPGPTWPPWDEQTRSSPPRRWAPASTSSPTVSRPV
                     SPARSVPRGR"
     CDS             complement(323657..324205)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02600"
                     /product="hypothetical protein"
                     /protein_id="BBH92061.1"
                     /transl_table=11
                     /translation="MPLRKALTVLFRFVLKEGDPFPFFQPQHTADDWHLAGRLFYDFG
                     GFPWTDALLFAQRRVAELLPLSSFEPQCELRTLRTAFLAGFVARFLEVWRVPPRYCPL
                     EFPAGVFLQEVPLVPGTPSPQSSTLSEAADRAAVALPTRQGWLLCLSRQSPQRYVVCS
                     PPPAPEAVRVDLAVLDRPYPWW"
     CDS             324104..324376
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02610"
                     /product="hypothetical protein"
                     /protein_id="BBH92062.1"
                     /transl_table=11
                     /translation="MPIICRVLWLEEREGITLLQDEAEQDSKGLAQGHKRLFWGRRCG
                     MEEHLRWLLEDSRISATEPQGFLQFTGLPDASTPPEPPGLLSGWLG"
     CDS             324392..324889
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02620"
                     /product="hypothetical protein"
                     /protein_id="BBH92063.1"
                     /transl_table=11
                     /translation="MIGYHRVPPWEQETETRQTTARKQRRETERRHEATSVAISLAET
                     TQGSRSGGKYPEGLQSKDHTEMALVVIVEADPDAAIGGNRGNDPPPLAERWGSIRVKA
                     NREGDKHRVPTQPTSLQNLACIGLPGRDRRLRPSSAAGRGVVSRQRHHNKTPPRRERR
                     TNTIR"
     CDS             325367..326176
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02630"
                     /product="hypothetical protein"
                     /protein_id="BBH92064.1"
                     /transl_table=11
                     /translation="MKINYKKNYYTAKEAMERLGINKNRFNYLVRTGRIRKFIPPGGE
                     QGYYLKTEIDRLARELLAFMTYDEDTGIQVRHARTEEDLLQEHELATLLFGSAVHSLE
                     TRRAWLARNPDLDLIVLDHGRVVGFLNLLPCQETAIKDFLQGRIRGWDIKPEDVLPFK
                     PGEELSCIIMGMGTTPDVPPSRRAMYGARLISGLMNFLEDLAKQSVVIRKFYATSATP
                     TGIAILRHAGFREINRIGNRIAFELDITTAESPLATEYRHILSTAVPHDSP"
     CDS             326306..327058
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02640"
                     /product="hypothetical protein"
                     /protein_id="BBH92065.1"
                     /transl_table=11
                     /translation="MAERILSGESSRGVSYGYLLAGKKIEAIVDEWLEFLWGAGGSIG
                     EPGKLQVNGPLQVDALQYMHDLIYKFRLAPTGTSTYAPNDILALFSQGKAPFMRNWVF
                     AYAIANTPSRSQVAGRVGVAPTLATAGHSGHGCTGGWVLAINAFSRYKDAAWTFIDYM
                     LSKETQTSMAINAGLIPSRPDVVSDASVQAKMPFFKQISSILNSGLNRPTLKNYNQFT
                     TPLQAAINSVLSNQANPSDALNSVQTQVTALT"
     CDS             327250..328188
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003403357.1"
                     /locus_tag="KTA_02650"
                     /product="ABC transporter permease"
                     /protein_id="BBH92066.1"
                     /transl_table=11
                     /translation="MATIGAPLLKAQESSSRGPLERREERLAWLMLLPVLLALLALGV
                     YPVLSTLWFSFQQGGSFGLGTTGAGLANYLRLLHDGQFWSALRFSLLYSIVTVSGQMV
                     CGTALALFANRHFPGRWLARAAILFPWAIPTATNSVIWAYMFNDQYGLINSLLEHLGL
                     LNPAHPIVWLGSAQLATWLIYVLAVWKANSLVALLVLAGLQGISAEVYEAARVDGASR
                     WQLLWRITLPLLRPVLLVTLIVRTIESLQAFDLISAFTNGGPGNATQNLGLYIYLQIQ
                     QFGDFGYGSTIAVVLTAITLVFIALYMRMFMSASTR"
     CDS             328215..329114
                     /codon_start=1
                     /gene="malG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006314872.1"
                     /locus_tag="KTA_02660"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92067.1"
                     /transl_table=11
                     /translation="MALASTSRTMATEVSSGRPRRGRSLLGLVVRRTALYLVLAVILV
                     VQFLPLIWALLTSLMTPQETTSIPATLWPAHPTLSSYLEALQGDIGRYYLNSIVASLV
                     STLVTMVLATLAAYAFARLRFRWKRLVLLFVVSLSLFPPFSQVIPLYMMLQGMHLIGT
                     LFALIIPYSVFGLPLAILILMSFLHEVPFEYEEAAALDGMSRLGAFVRIVLPMIIPGL
                     FTTAVIVFVGDWNEYLFALNYTTTATYTLPVGIVILSQTEFTTNFGVLSAAMIMSVVP
                     LVVLILLLERRIVAGLTAGGLKG"
     CDS             329136..329873
                     /codon_start=1
                     /gene="tal"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:D1B643"
                     /locus_tag="KTA_02670"
                     /product="putative transaldolase"
                     /protein_id="BBH92068.1"
                     /transl_table=11
                     /translation="MEFYLDTAQLDEVRAAVAWGVLRGVTTNPSHIARAGVRDMRAHI
                     QELCWIADVPISVEVVALDADGMVAQGIDFATWSPHVVVKLPTTVEGLKAMARLSRSE
                     VTATCEGCSHVADCPIRTRFAQQQRLTRRPEINATLIFTVNQALLALAAGATYVSPFV
                     GRLDAVGEDGVALVSELAQVLRVQQQPGKIIAAALRHPVHVTAVARAGAHIATMAYAI
                     LTQLIEHPLTAAGLEAFLQDYRRSQGQ"
     CDS             329879..332386
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02680"
                     /product="hypothetical protein"
                     /protein_id="BBH92069.1"
                     /transl_table=11
                     /translation="MDLVEGRAGVLTQGRYLRRLVRATAWPGGLRAEVALIPFRLLGS
                     SLRPVVVSAEPLAQQMTTTGVPNRPAETGGLAEREGHVGGALAAVEAQVMLELQVLSP
                     RIVRLRLGQPAALQRTRAYGMLVPGALEEVLSATYGPHVPLPSLEETTTGVRLTLEGI
                     SIMLERDPFSLQITSAAAPEVSWRTALDDRNVHGLLCTPPPGLDGAPQEPPAAFWSWA
                     IAPEEHFYGLGERFARLDHRGTVVTLFNIDAWGTTTEAAYKNVPFLLSSRGYGLFVHT
                     PAPVAFALGTPSARAALVRCGEAELDLFVFFGREAREILEAYTRLTGRATLPPRWAFG
                     VWLSRCRYQTRAEVEEVAARARAEGVPCDVLHIDPAWLAQPNLSCDFTVNEEAFPDLP
                     GLIQELGERGFKVSLWELPYVSEQAPRYQEAARAGYFLRDERGEPIGADFGGPPPDGR
                     KRAIVDFTNPAARAWWQDLHRPLLRAGVAVFKTDFGEGVPLEARAANGMTGYELRNLY
                     ALLYNAAVHEVIAQETGRPGFVWGRSGWAGTQRYPAQWGGDPKTDVAAMACTLRGGLN
                     LALSAPGLWAHDIGGFYGPPPSPELYIRWAQFGLFSPLARAHGTTPREPWAFGEEALT
                     IFRRYARLRLRLNPYLYSLAWEAHAYGLPMLRPLLLEFPDDPIAASIDDAYLLGSALL
                     VAPVFSEAREPVARRLYLPAGEWVDFWSDERLEGGRYVTRLAPLELLPVYVRAGTVLP
                     LGPERTFLSEQPPDELTLEVYPGAPGAGRVVWDASGAATELHLLPLGADGWQLQITGE
                     RQAHWSVRWHTSQGIKEQVIGFTARATLSLSDGLLQG"
     CDS             complement(332680..333402)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02690"
                     /product="hypothetical protein"
                     /protein_id="BBH92070.1"
                     /transl_table=11
                     /translation="MSADEPTILPLEATEATQFTPGGALSAETAQAGPYPYDATWELP
                     PLPPPPPPAPKHSRKRIVTLLLLTCLVIISAGAGALAATLYWRSQPDALIALSSRSTP
                     SLGPSPTSDVGYTANDILTDFIAAGAHPFYIQRNVTISQWSDGVFSVSVPATSSVTFA
                     DASDCSGPCDPHTMGLWVYKDDATATQAYNEVNQENSQASLHPPQVLAPVPTTIFIHA
                     RCLLLGADIHSLYVQVIKQFCR"
     CDS             334043..334207
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02700"
                     /product="hypothetical protein"
                     /protein_id="BBH92071.1"
                     /transl_table=11
                     /translation="MPRAFTNLTDFLEVNKLQIAAHVESTSSREGLWAIPEGREEAEE
                     AALYEEEGDL"
     CDS             complement(334511..335305)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011762836.1"
                     /locus_tag="KTA_02710"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBH92072.1"
                     /transl_table=11
                     /translation="MDLGLQGRVAIVLAASRGLGKACAAALAAEGARLTISARHAQTL
                     AQTAQEIERASGSQVLAVPGDVTRLADLEAVVAATLERFGRIDILVNNAGGPPPGLFD
                     QIDDAQWQAAFEQNLLSVVHAVRLVLPSMRRAGGGRIINIVSTSVKEPIDGLVLSNAI
                     RTGVVGLAKTLAVELAPDQITVNNVCPGRILTDRLRQLYLTPERLAGGASEAEILEEV
                     ARAIPLRRIGMPEEVGALVAFLASRQAAYITGTTIQVDGGLVRSLL"
     CDS             complement(335650..336441)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02720"
                     /product="hypothetical protein"
                     /protein_id="BBH92073.1"
                     /transl_table=11
                     /translation="MNCLQCGQQIPEQLPYCPICGSAVPGTAASEERRRENRDLGPEE
                     PGAAQAEMNSTEALSSRSEEGPSRPTPVREEAQREALLPVTVPARSPTWRERLQPLTG
                     RIGGGIAILGNILMAIAFFLPWFLVVIVMSVSLDSCGTATVTMMGEVGPSRPIPAEGT
                     SLIGLPDWRTLFYLLLVIVSLLLSIIILLRPRARRRIWAAVAHLAVSFLQCGNFVALS
                     SPPSNAMKFVITQILGGFWVGLTGLIIALIGSLQMLFESLLEPRQ"
     CDS             complement(337704..338192)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013533666.1"
                     /locus_tag="KTA_02730"
                     /product="cupin"
                     /protein_id="BBH92074.1"
                     /transl_table=11
                     /translation="MTSSHEPYFLAREEGQAVWFLGTLMLFKATGQDNAQTFSLIEQT
                     LPPGFAPPLHVHHAEDEAFYILEGELTFVCGEQRWRAGPGAFIFLPRHIPHGFLVEGS
                     QPARLLQFTVPAGLEKFHAEMGEPAQSLTLPSPTPPDLAKMQALTAKYHFEIVGPPLG
                     QE"
     CDS             338376..338831
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530634.1"
                     /locus_tag="KTA_02740"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BBH92075.1"
                     /transl_table=11
                     /translation="MQPLPRMIGALLRIPFQQTVARVYQRLIEAGYTDLRPTHFVLLQ
                     QLRPEGMRVTELARLAQVTKQSMGALVDYLEERGYIERVPDPKDGRARLVRLTARGRA
                     VEQIARAAIGELEAEWAQYLGNERFAALRSALQDLVSLIESQDEIGRLP"
     CDS             339694..341493
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011058229.1"
                     /locus_tag="KTA_02750"
                     /product="ABC transporter permease"
                     /protein_id="BBH92076.1"
                     /transl_table=11
                     /translation="MARMLHPLLQPRQSRHALPAPGNHRWLWLRDLILGGSFLLLLCA
                     LLVLAASRWAGPLTPQVAISLSPLALPLYAGYSLLRMLLAYGLALLFTLLYGHVAATN
                     RRAERVLIPLLDLLQSIPILSFLPAVVLALVAAFPHSNIGLELASILLIFTSQAWNMT
                     FSFYHSVLTLPRDLIDVCRLLRLRPWQRFLKLELATSVIGLVWNSMMSWAGGWFFLMA
                     SEQFSLGERSFRLPGLGSYLQLAADQGDAQALALGLLTLIGLIVLLDVCLWRPLVAWA
                     ERFKMEEQAETAPPRSLVLDLLRGSPTARWLWRRLGLPLGEGLAWLLNRLQPLPEERS
                     AHLSSVEQSRGDQLFLWLRRGVGMVFLGLLALLALWIGWQGGLLLAQVPLATWGRLVL
                     AAGATWLRTLAALAIGTLWTVPVGVAIGLSPRWSRRLQPLVQIVASIPATALFPALLA
                     LLVALPGSLSLAAILLMLLGTQWYVLFNVIAGAMAIPRDLLEAAALFGVTGWRRWRTL
                     ILPALFPFLVTGLLTASGGAWNASIVSELVQFHGQTLHTFGLGAEIAAAAGAGNYPVL
                     LAGTLLMAVVVVLLNRLLWRRLYHLAERRYRLA"
     CDS             341582..342991
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011056736.1"
                     /locus_tag="KTA_02760"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH92077.1"
                     /transl_table=11
                     /translation="MAQRQTIETDGTVILEAQQITHLYQGRGEQRRGGHAPVVLDTVS
                     LQIRAGELVALLGPSGSGKSTLLRILAGLIRPTRGAVYVHGQPLQGPTPSCAMVFQSF
                     ALFPWLTVLQNVELGLEALGLPRLQRLKRALAIIDKIGLDGFEEAYPKELSGGMRQRV
                     GFARALVVEPELLLLDEPFSALDVLTAANLRRELLQLWYQASIPTRAMLLVTHNIDEA
                     VSMADRLLILGADPGHIRAEIRGLPRGQREPHSPSYRQLVDLIYRLMTSPDEDGAALL
                     AAEEPALMQRGRPRPTRPYQTLPHVAPADIIGLLELVQARGGRADLAELGRELQMELD
                     ELLPLVDAADLLQLARPQAGDLVLTEIGRQLAEADVQEEKRLFRQQALARVALLRRIA
                     EDLAATPEQRVDAKRYLERLREHFSEGEAEAQLQTIIEWGRYAEVFTYQEEAGIFGLE
                     ADTEREDLAAEAAGGPQEQ"
     CDS             343092..343394
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02770"
                     /product="hypothetical protein"
                     /protein_id="BBH92078.1"
                     /transl_table=11
                     /translation="MGLAELLTEQARQADLLIELAQWLLRQPGRRDEGQQLCRRAEQC
                     IALLADGPDKALLFIWLGEGLGQAELLEEAECCWHWPYVSSPRCQAGSMSSLAVIP"
     CDS             complement(343465..344085)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02780"
                     /product="hypothetical protein"
                     /protein_id="BBH92079.1"
                     /transl_table=11
                     /translation="MNEELRKIIERVEQLDPVLQDALVKEFQGIVERLSSMSPWVLMP
                     WDEQQFEGFTMHAHMALHLAKEEARRLSAHAVGPEHLLLGLVREGEGVAARVLKQLGA
                     GVDNLDQLVAWVFKPDPMRGLGRVATTGDPPVEGELPWTSRAKRIFGLAKEEAQRLKE
                     EHIGTEHLLLGLLQDEDNLGAGMLAMLGIDLAEARRQTLRAIGKGE"
     CDS             complement(345610..346353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02790"
                     /product="hypothetical protein"
                     /protein_id="BBH92080.1"
                     /transl_table=11
                     /translation="MILFALRAQSKLEFLRFLRNGRALFFTLLVPIGYYLIFSYGFGN
                     THALQLHFGIAMAGFGTSGVSLGTLGSRLAQERQLGWLRLRQTTPLSPLAYFAAKVLA
                     TFSMAGMTIICVLTVALLEGLRVDNYWALVASALILWCGSLPFIALAFVIGSWTDAET
                     GYIVSIGVYLVLGYLGGLLQPLQLMPGVLQDVARFLPSAHYLLLALRPLQAASSGSAL
                     EDVLLLLGYTVLFTALAIWSYRRSATAGR"
     CDS             complement(346350..347288)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000411157.1"
                     /locus_tag="KTA_02800"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH92081.1"
                     /transl_table=11
                     /translation="MKVSADEAAGARSQQPVIFLDQVTKSYGTVQALRGVSLRIEAGE
                     SVALLGPNGAGKTTAISLMLGLLRPSTGRVLLNGGDPTVPAVRRAACLGAMLQNARVV
                     DLVRVRELLDVFCCYYAQSLPTDELLEIAQLREKQRSYTQHLSGGELQRLLFALALAG
                     NPRLLFLDEPTAGMDVASRRRFLQRLRELHRDGRTIILTTHNLADVEGLSQRVIVLNE
                     GRIVADGSSEEIRAMASGQVVSFLAEEPNDQLLGAIPGVLRLERQGPRVVLFTRGSDA
                     LLTELRRRGMATPHLEIRGASLEEAFLALTRKEDKA"
     repeat_region   347870..348644
                     /inference="COORDINATES:alignment:CRT:1.2"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_seq="gtcagaagacgcgaagcctcccgtctgggat"
     CDS             complement(348725..349006)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02810"
                     /product="hypothetical protein"
                     /protein_id="BBH92082.1"
                     /transl_table=11
                     /translation="MAVPFTWVAFVAWLLVMGGWFLEIGRTLNRLPAEGQRRSHDQKG
                     TQEPVPGRSDDWRSAREEDPQVRIERGNGGLFTSWCLGSLSDVHALVLY"
     CDS             complement(349044..349406)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02820"
                     /product="hypothetical protein"
                     /protein_id="BBH92083.1"
                     /transl_table=11
                     /translation="MPCSCPTQAIFYGTYEEWLAAGRGAQGAKPVNRFYFGRQRVRTR
                     NCVVLTEEDEALDLLALLDEVSLGLGQETPAATASRNAADWVDARMAGIPEWEAPAQP
                     WTPREPVPAPVSVSQASH"
     CDS             complement(349830..351839)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02830"
                     /note="possible pseudo due to frameshift"
                     /product="hypothetical protein"
                     /protein_id="BBH92084.1"
                     /transl_table=11
                     /translation="MAGHLGRQLGRYRLIRLLGEGGFAEVYLGKHVILGTQAAVKLLK
                     NRLDPNDLAAFRREAQLMARLSEGHPQILRVLDYDDERGQPFLVLEYAPGGTLRQRHP
                     PGTRVPLETVVGYVQQVAAALQHAHEQEPPVLHRDIKPENMLVGRQGEILLGDFGIAT
                     LVTQYAHPRAVGGTAAYMAPEAFRGEVHRASDQYALGVVIYEWLCGQRPFPGPDLVAY
                     GYQHVHQRPPSLREQVPELPAGVEEVVQRALAKDWRERYGSVKELAEALEQAWHAATS
                     ARPAREEEERPLGKASHPEEATAAVEQTAVLEAPQAVPSAGPSLSLPAEGPRPTRHRL
                     SRRRVLLLVSGAGVMVLGGGMTWLALAQRRLVSSLLDRLYYGRTTYYGHTEAVLAVAW
                     SPDGRRIASAGWDATVQVWDAADGGHVFTYRGHTEAVLAVAWSPDGRRIASAGWDATV
                     QVWDAADGGHVFTYRGHTEAVLAVAWSPDGRRIASASDDKTVQVWDAADGGRVFTYHG
                     HTAIVWEVAWSPDGRRIASASDDKTVQVWDAADGGHVFTYHGHTNAVNAVAWSPDGRR
                     IASASDDKTVQVWDAADGGRVFTYHGHTAIVWEVAWSPDGRRIASASDDKTVQVWDAA
                     DGGHVFTYHGHTNAVSAVAWSPDGRRIASASDDETVQVWQVGEGS"
     CDS             352313..352657
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02840"
                     /product="hypothetical protein"
                     /protein_id="BBH92085.1"
                     /transl_table=11
                     /translation="MTSRLCRRAPASAIEWSLGPEMHYPVIKDALIGLELIQPFLVKM
                     QVATREGGAGAALSAGARRDATSSCVEQQLSKGEEKEHNMTASSEQDSESDQDLLFSH
                     QARDGCKKERFG"
     CDS             complement(353105..353344)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02850"
                     /product="hypothetical protein"
                     /protein_id="BBH92086.1"
                     /transl_table=11
                     /translation="MRGLALRPKTVALDVSASVLGTASQILSPLPRFGEPGYKAGLNT
                     NPSGQHVTEEDLYRATMATRSIVSGYWFNIPAGGR"
     CDS             complement(353341..354609)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02860"
                     /product="hypothetical protein"
                     /protein_id="BBH92087.1"
                     /transl_table=11
                     /translation="MPEIRTILKQALAPIRSRDFTVLWLGQTISACGDQCYDIALIWL
                     VTGLTGSSLLVGTLLAINYLPTILMLLIGGVWADRSPRSILLWSDLLRGLLVFLLALA
                     VTLGWVSLPLVICASFIFGLVMAFAGPSLLVLWNMLVAPEDYYAVTSLRQLSQQLALL
                     FGPALGGFLIARWSVPVALLFDAATFVIAVCSTLLLRAQRKPQPSRGGAVSSSPRTFF
                     AELTTGLRFLWREKGILIVVLLIALTNALNNVTGVLVPLLVRYVLHASAAQYGLMAAC
                     AGIGTAVGTVAMSLVGKHLRSIATVICGWLVIMGGAITLMGTATTVWLLYIAQMLLGL
                     AFIVVEIVATAHCLQMIPEDQRGKVFSTIVAIAMGLNPLGSLLGGGLGNLVGLRAGLW
                     ASGGTIVLLSVLAFLFPPVRALNRPRDAGY"
     CDS             355112..355522
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02870"
                     /product="hypothetical protein"
                     /protein_id="BBH92088.1"
                     /transl_table=11
                     /translation="MGSVALKLIRQASLSVLMLRSHGEMLAGPQPGYERPRGTVVPLD
                     GPVHAKAALESTAALVHALATMHLLAVVEVDEEAEDESARGKRERRLARARRYPAHAV
                     EEIHAGLAALQAAGLQLELTWSVHTGSDGAQNHS"
     CDS             355519..355749
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02880"
                     /product="hypothetical protein"
                     /protein_id="BBH92089.1"
                     /transl_table=11
                     /translation="MMWLSTTRTLVETPLPGGCDLPVMSTHSREDLNRWLLGSMTERV
                     LERTRLPLLVVRPQGIEATPRPPWGTLQDDLD"
     CDS             complement(355788..356342)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02890"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBH92090.1"
                     /transl_table=11
                     /translation="MTIRPIRPEDEPLVVRFHKRLSERTVYLRWLHVLGLSQRIAHER
                     LVDRCFIDYDRVLALMAISREEAEFALLIGDQVQGQGLGTKLLRRLMEIARQEGLQRL
                     QGRMVPEKQAMLRICRTLGFQLAYHPEEQLMQVNLPVVGRERADQGTPVREGWERQGA
                     TSTLASLCLGEPACRSERTCSYGW"
     CDS             complement(356364..357170)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02900"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBH92091.1"
                     /transl_table=11
                     /translation="MVDNPKESAGRCAQVAGWLTAACQAGHTLLSEPEAKAVLQAYGI
                     PIVETRIALTEDEAVQQAEQLGSPVVLKLLSPTITHKSRMGGVRLVLRTAEEVRQAYR
                     AVAEAAERQAGAGQMQGVTVQPMVTLEGYKLIVGSFCDPQFGPVLLFGSGGRLVEVRR
                     DTALALPPLTTTLARRLLERTRIFTALQHGAAGLPAVDLAALERLLVRFSLLIVEQPL
                     IRECDINPVLAAGDHLLALDARIVLHSIDVPEIALPRLAIRPYPSHYLEN"
     CDS             complement(357265..357765)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02910"
                     /product="hypothetical protein"
                     /protein_id="BBH92092.1"
                     /transl_table=11
                     /translation="MQRARAVRLTEEMKRVVDEQRLAFVATVCPDGTPNLSPKGTIAV
                     WDDSHLIFADICSPGTIANLKERPVLEINVVDPVARKGYRFKGTATVHGEGPLFEQML
                     AFYRQRGTRSPIQHIVLITVEQASPLLSPAYDQGETEQQIASRWLARWKRLYRERYGP
                     VVPLER"
     CDS             358673..359281
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02920"
                     /product="hypothetical protein"
                     /protein_id="BBH92093.1"
                     /transl_table=11
                     /translation="MSEQPSSSASDQLSPAEWLQVWLQLVPAPETTGATDLALLTALQ
                     HELATELQREGFVLPAPAPTGQKGADLVTEAWLLVRQVAGAVWQHHAAIAEGLADLSA
                     LVTLFEKLLPVLKRLRERHARLVGPQASQEQPLSWTIELGEARLTLEAPDLDQVQAAL
                     QLARRIQNALAGSRSGSGTPAKLPNKVRVRGTVPPRRKRKRR"
     CDS             359324..359548
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02930"
                     /product="hypothetical protein"
                     /protein_id="BBH92094.1"
                     /transl_table=11
                     /translation="MDERQHLRETASFWRDSDLGDLEVLHASYLTHAFAPHRHASFVL
                     SIIDQGAGALWYRGAIHLAPAGSQGLAEPG"
     CDS             359493..359909
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02940"
                     /note="possible pseudo due to frameshift"
                     /product="hypothetical protein"
                     /protein_id="BBH92095.1"
                     /transl_table=11
                     /translation="MVPSILRPPAVKVWLNPDEIHPGQVAGTQGWVYRAIYPSTELVA
                     ELAATVAGCSWHAYFSPTPILSDQTLADLLSRLQTALAENRPLLERESWPLHTYAYLL
                     TRHAERPLVAGSLRPELRAVRVAREYLEAHFAQIYR"
     CDS             359906..360172
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02950"
                     /note="possible pseudo due to frameshift"
                     /product="hypothetical protein"
                     /protein_id="BBH92096.1"
                     /transl_table=11
                     /translation="MTQLARVTGLSPFHLAHTFHQVMGLPPHAYLNQLRLEQAKQLLL
                     AGHPIATVAYAVGCADQSHLTRQFKRIYGVTPGQVLYHCKNRQD"
     CDS             complement(360516..360752)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02960"
                     /product="hypothetical protein"
                     /protein_id="BBH92097.1"
                     /transl_table=11
                     /translation="MFDEQGTSSIACSCQEYQPCSQQLLPIVPHIQTQQQDDASHACE
                     QPDQAQLPNPFTPIDAESAQDDQERFSGDQQACQ"
     CDS             complement(361472..366181)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02970"
                     /product="hypothetical protein"
                     /protein_id="BBH92098.1"
                     /transl_table=11
                     /translation="MTTGAPPKGKTDRGRRLALVIGVNGPPAPGRAPLAFAEADACGM
                     AEVLQQDGCGFCLVVPPVLGAQATTEQVRKAVLALALELQEEDFGLVFFSGHAEVLPR
                     EAGLDEVYLVTADFEPAHLKIDSTAHLSFRWLRQILFEHERAAQLLLILDCCYGGKFA
                     ESAPDPSLDELQRRLAYYFGEPGERSPAPAGSVRLALTATGLEPAKEEDGHGRFTGQL
                     LKILRGGVPQAADEQGTICFGQLFTCLKQAVPEQSPRFYGAGDDLVLARYPQLAQARQ
                     RSRAEDKERQRLRALVRRRDGFYEDRRRSCVGRREEQAAVWRLVEELLPSGGYVLITG
                     EAGQGKSCLIARLIEDQARAQGSEERVLFHFIPQVPPPDYQVALLQELLARLVLKYEL
                     PTWWLVGENRAALSAAFAQLLQELARHGKQEVIFIDGLDQLQPDPQSGWRDLSFLPQG
                     PGHPPPGIVFVLGTRPDDTLQPLELAKPRRVYPLPRLSAGDFAELLRQRQVHLSAELE
                     RRSYEVLDGHALFLDLLAKELAVRRRLAPGEVEALVERLSSDPEQVFTLALERLRRER
                     GQWRRVLKPLLGILLVAQEPLPVPALRQLVGLAGQGEIDLEEVQEGLRRLGGLVMRDQ
                     QGGYTLFHLKLRDYLRGGSGEPDGPQREPAGLFDEEEERRWHGLLAHWCEQGGLARLW
                     QAGAKEEAERRRRQYGQRHYVRHLYEAGEWERLFAVLDEGSYGRAKVQADPSMRDYAQ
                     DLDLGRQAAAAVGETLEEQLEQLPRLWGYTLLRSSLGSRADAYPDEAFLLLCQLGQEA
                     KALGLVELLTERERQADLLMELAQWLLRQPGRREEGWQLCQRAEQRIALLADGPDKAH
                     CFIDLGEVLAEAALPQEAERCWRQAEQVIAGLSEDAFTKAALLVRLGQALAAAKRPLQ
                     AEQCWQQAEQLSTSLSNAKQKVKILIRLGKALAMWSLRQQQAEDCWQEAAHLIASFPD
                     HDWNRVDALIELGAALASAKCWPRAEECWQQAEKLSSQLPEDGLRKTLALTSLAKAFI
                     NAQRWPEAERVISFLPEQHWSKTAALTALGKALADARHWPEAERCWLQVRQLITMLSD
                     DSDKVEALAGLAKALAEVQCWQEAEQCWLQAEQLIATYLDQYGKAALIGLGDALVSAQ
                     CWQEAERCWLQVGRDIASYTCDDWSKAKVYIQLARTLMKAQRWRDAERYWVQAERLIS
                     SLPEEQERFSALSHLGEALANAQRWPEAERVISFLPEQDWRKAGSLIALGKALAEAQR
                     WPEAEQCWQQAEQLITALPDEQDGWRKTPTLTSLAEALISAQRWPEAERVISFLPEQD
                     WRKAGSLIALGKALAEAQRWPEAEQRWQQAEELATLLAEDSDKVEVLTRLATAFAEMQ
                     RWPEAEQRWQQVEQLIAALPDEQDGWRKAQALSNLAASLAIAERWQDAQGIISSLPEN
                     SAHKALALTKLAQALANARHRQDAERWLPEVVQVLIGLLPSSKETEALISLTRVLIGY
                     GREAEAICLIQHAWLRDMGRHEAFWYFPAVFPLVTRYPALGSALYEATCWADAFLQGT
                     PRPASLSFRLERSHDPA"
     CDS             366546..366899
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02980"
                     /product="hypothetical protein"
                     /protein_id="BBH92099.1"
                     /transl_table=11
                     /translation="MAAAENRTSEQPLDPVRGPQPAFAAQEPRAQAERQATEEQRLRS
                     LAVDAFSRAMLRDRLKSFVGRNGELQELRRQISELLATGGYLAITGAAAQGKSSVMAK
                     LVDLSRSGHRERPKD"
     CDS             complement(367078..367458)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_02990"
                     /product="hypothetical protein"
                     /protein_id="BBH92100.1"
                     /transl_table=11
                     /translation="MLKDLIWRTLPLLSQRFGGQPEQEGMAFQPLVDPPDEGGFEEHG
                     GPCAIRPATLQHLLKILQAESRKSIFPERLLQLEGVQRVGPCAQDKDDPRRWSPSGEQ
                     AQVAHAPGLLWQLIQPIDKDHLLA"
     CDS             367372..367662
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03000"
                     /product="hypothetical protein"
                     /protein_id="BBH92101.1"
                     /transl_table=11
                     /translation="MEGHALLLGLAAEALAQQRESPPDEIFQHLSVNPQSLLSLALDR
                     AGRSSPALATLWQRVTKPVLAVLLTACEPVERTHLQEIVSLQAPARGGCPHR"
     CDS             367706..368638
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03010"
                     /product="hypothetical protein"
                     /protein_id="BBH92102.1"
                     /transl_table=11
                     /translation="MGDLQGEGAPYSLGHGHLRDYLRRDQTRPDKEYLFDEEDEQEWQ
                     SILAAWCEEGGLDRIWQDATHDPGEQRRRLYARQHYITHLYQAGLRQWRRLFALLDEG
                     SYGRQKVQVEDSFRLYDRDLQLGQRAAASSCWSQDEAVRLLPTLCRYTLLRAYLSENT
                     LWYPWWYTDEAFQLMLLLGKERKALALAERQDTLSSSHLLLLIARHLAAMPGRERQAQ
                     QLWLRVQGRVLAVQDDPSQESALEQVVEALVEAQLLEEAERLIHFIEDRFRQGRAWYR
                     LAQALTQAQRFDEAERVIRSIEMIPPGKQRPGAS"
     CDS             368813..369052
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03020"
                     /product="hypothetical protein"
                     /protein_id="BBH92103.1"
                     /transl_table=11
                     /translation="MPYLLPRDLLEDQRLNYQYHALYRTLSNHYLAPLTAENTRTILD
                     VGTGIWAFELHALFLREQPGDEPPASAGKKQEDHP"
     CDS             369186..369383
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03030"
                     /product="hypothetical protein"
                     /protein_id="BBH92104.1"
                     /transl_table=11
                     /translation="MVSSHGRQVVVGGVMSTTETIVAQCPHGAPRLEWLVKRMENNGL
                     TEGAGDGTRTRDSLLGRQVVP"
     CDS             complement(369899..370198)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03040"
                     /product="hypothetical protein"
                     /protein_id="BBH92105.1"
                     /transl_table=11
                     /translation="MSPVRSGDRDRYRATQQEAEPTLSPARRKRLLKTYGPAPSGYTT
                     EDLERFLDLLYGLYSHISSPKALREIIVSDPFDRREQPRQLRLVELAAWLEAIIS"
     CDS             complement(370345..370929)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03050"
                     /product="hypothetical protein"
                     /protein_id="BBH92106.1"
                     /transl_table=11
                     /translation="MQLFWFRSAADLAGPGGQHPDLALIELAATDTFEAIIAGLPTAA
                     PALLVRFPATGPLVEEQELLLRRCQASAERLAVLLPPEQLCQWGASAYRAGVPFACRW
                     ERALALLGIDALAFPRDEAGQEQEGSVPARAQPVSIEHQPQTEGFRPRLLWAGCFASR
                     WLCLLNLLWSGGCLLGLVLLLIQPVLSLPVPGKP"
     CDS             complement(371163..371402)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03060"
                     /product="hypothetical protein"
                     /protein_id="BBH92107.1"
                     /transl_table=11
                     /translation="MLCNTYWGRGFTFLAGASISVYLPDLGTGAEASYLSTTSQVYSN
                     MVYAFIPTVTIEVIVGPTQVIATTIPGVHSLSTAA"
     CDS             complement(371503..371715)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03070"
                     /product="hypothetical protein"
                     /protein_id="BBH92108.1"
                     /transl_table=11
                     /translation="MSLCPAALASLSVVGQEGTQAVLAAGPGPASAVGDELVTLASFP
                     QSGQNKVVRDLLDRPAQGQTKVLHRN"
     CDS             complement(371845..375747)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03080"
                     /product="hypothetical protein"
                     /protein_id="BBH92109.1"
                     /transl_table=11
                     /translation="MPYSPEELNLEAAPADRLPSSAGRPGSALQRRKTLAVLVAGLLL
                     VLLVLLLWGQPSVGTDPAGRSPALVGRLIALVNFPVMLPVLAGLGVLCLLGVLGLVTL
                     AAVVVRTLTRPRRQAAVSTLTPALVGWPAEAISFPVTVGSCSYRVPGYYCPQPGARSL
                     IIVSPGYRRPVEDVLLICRALWQAGHHVLAFEYLGHGRPLPAGAAVPLTLGYREVQDF
                     LAAVLYAQERAPGCRIGALGFSMGGAVSLLGAACCPEVAAVVADSAFATQWQAVEQVV
                     RQHLRLPPRWWDWLLPPLHWVSNQFLRWRAGYCFEQVQPVQAIAQIAPRPVLLIHGQQ
                     DRLIPPVAARQLYAAARRPKALWLVPGVEHVGACLHVPDRYVARLTAFFQRALWQDLP
                     ARHRQAGSSVVAAAQGEEPSPPQASPLHSPEPAQPPPAGWRLGLVWGRWLVRWRWVVG
                     GAWLLVLLVSLPLAQTIGALLQPGGTTIPGSEAAQVQTVLRDRLHLPATQLFAVLSVS
                     RQQARTRAFAAQQQAVVARASSLPHVLTVRSQVSPDGQTALVILGLDEDSDAVAALVP
                     ALQTRLGAIPGPAHLQLTGEAAVATALQQATQEDTARAEALALPLTLAALLLVFDGLL
                     ASLLPVGLAGLTLITTLAGLSLLARLFPLQSLTESLVGIIGLGLAIDYSLLLIRRFRE
                     ELARTRAVPEAVAETMATAGEAIACSACMVTLGFGALLLIPIPLVRSLGVGGCLVTGV
                     AALAALTLLPALLSLLGPRINALALSALLPWRWRRWRGLGPVRRQHPASGAEPHAAVG
                     PVSWWERWAWTVMRHPLPLLGGALGILLLWSWPALALRPGLPGAAVLPADAPARQGWE
                     HLTQAFPTVDPAPILVVVQPADPRSTRAATDHAALLRLVGWIEHLPHVSGVERAPDQA
                     SQPFPSEPALLLVHTRSAPDSPEEARLLDQLHAVPASLREGFRLQIGGPRAQTLEFDR
                     TLYRASGLALLFLLAGTVLLLLVTFRSLLLPLKAILMNLLALGSAFGALVWVFQDGHG
                     ATWLGFTPTGSLDRFVPIVLGCTLFGLSMDYEVFLLSRVRECWRRGRNNEQAVAEGLA
                     RTGGMITSAACLFLLVAGAFLATRLVVTKELGLGICVAIGLDAFLIRPLVVPATMRLL
                     GQWNWWLPGQRSWERLRRGAGVIRKDGRHHCRRLARGRPWHPLPFKANEHQAQRAWEA
                     LLIRLVAQTLPVSPAHLTAQSHFFTCGGDSRALEHLLLRINQQLGVTLTMEEALTCPR
                     PAELAALVQQRLLQQDEQRTAPPVQPLSRHEPASTRQE"
     CDS             complement(375813..376172)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03090"
                     /product="hypothetical protein"
                     /protein_id="BBH92110.1"
                     /transl_table=11
                     /translation="MNPAFYDAVVGEQLIQAVVNAEPELVALQVRGGQRFAWVTVRFW
                     LWQMRRDPATGQLQQGLQADPTTGQPVRHQMSVLLLRVPPAVQGPSAPMGGTGWLVSN
                     YGLDVPAGAPLPLLTPP"
     repeat_region   377808..378665
                     /inference="COORDINATES:alignment:CRT:1.2"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_seq="gtcggaagacgcgaagtagcccgtctgggattgaaac"
     CDS             complement(378755..379099)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03100"
                     /product="hypothetical protein"
                     /protein_id="BBH92111.1"
                     /transl_table=11
                     /translation="MMTAPRQLGCSRLIRLLGEGGFSSLSLGEHVILGPQAAVKRPKR
                     RLNPDDLAAFRREAQLLARLSSPYLHILHALDDDEAGQPLLGGETCVRRGLLSLPGAF
                     SVSRARSPWPCC"
     CDS             complement(379313..379615)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03110"
                     /product="hypothetical protein"
                     /protein_id="BBH92112.1"
                     /transl_table=11
                     /translation="MLRLPILPSHPSVQDASREAVSSRFDSGCKLERGDLPGDWGASR
                     FPTALCVQTRGFLLIVREHRGQVGQAAPACGIALGVGRWLCAGHLLPLSRQEAGEG"
     CDS             379871..380500
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03120"
                     /product="hypothetical protein"
                     /protein_id="BBH92113.1"
                     /transl_table=11
                     /translation="MLTALMLDWTGASWQEACDALAQLTDALGTPIDPGIFETVVLLN
                     LLGFPTVQSCEGHLDHGTPSPWVTVVDRALHRRYLQQWQQVCQLQEQAHQSGDPAALD
                     GYYRALAELQLAQAQWNQEETLRARLMELLDAFYDQQPCRCPATRLLVQRHHPGLYRI
                     RPVYAVDPPPEALRASYLERGQEEMRAWTRALRQCWERQRAAQEGRDCS"
     CDS             380623..381420
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03130"
                     /product="hypothetical protein"
                     /protein_id="BBH92114.1"
                     /transl_table=11
                     /translation="MGSGIGAVEMHALFPHALVVGGDVSLASLPQPVPPTCVFVRANV
                     LEGLPFPDGQFTSTHQRLLVAAIPAHAWPGVVQELVRVTRPGGWIELVKASDVIQPAG
                     PATRRLLDWFVGISRQLGFEMVVLRRLGALLQQAGCVDVTSQDIPVPLGRWAGTTGQL
                     LRTDLWHAFDSKKLCVHEPRPRPRSSRPSCRSLLLPLPDDTALDGRQHCCPTAGAGTG
                     CLHAIVIGHGDQSEALGAHAFQESGGRPASVTPEVVCRWRPRQSWAT"
     CDS             complement(381485..383092)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011086318.1"
                     /locus_tag="KTA_03140"
                     /product="4-chlorobenzoate--CoA ligase"
                     /protein_id="BBH92115.1"
                     /transl_table=11
                     /translation="MSDIPLPLSGTPMTLPTLVELAVSRTPDQLALVEQEQHYTYAQL
                     YSQVCAQGNALSEAGVAPGERVITVLPTSASHALLLLAIFQIGAVAVPINPRLKPDEV
                     AYCIEHAQARAVCFESRTAPVVLEAVRKLAASWRPRLLAVGGEISAPEVTPLDVLARQ
                     ARRERPAVTIDPTDLSLILYTSGTTGRPKGVTITHAASVARVMGLALNHGLTALAGLR
                     VLGLMPLFHTVGLHGVFLTALALNGTYYPLAEFQPARALQLIQDAQIDYLFGSPTHFH
                     ALLSHPASQEVDLSSLKHLLYAGAPMPTPLLLQCSQRLCSNLTHIYGNTETYNSLFYR
                     HAAEAPQALVPGVYHRVRVVSIGGAPEDEVPAEVEGELIVDTHSPESFSGYWRNPEAT
                     ARCVRDGWYYTGDVCLRDRAGRFFIVGRVDDMIISGAENIHPAEVEEALLSHPGVGDA
                     GVVGVPDPHWGQRVVAFIERRDPALTAEELDQHCRQHPTLATFKRPRQYVFVEKLPRN
                     PSGKLLRFLLREQAAQSGAVSERELLP"
     CDS             complement(383178..383837)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012804114.1"
                     /locus_tag="KTA_03150"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BBH92116.1"
                     /transl_table=11
                     /translation="MSAETPRTKSNWLQQVRELIAVKVGDDALVEQRYHELIETATSL
                     FLERGFHGTSVPEIARAMGMSVGGLYRYIAQKEDILLLILASILWQFHQEIEPKLQQN
                     SDPAEKLRHSIAAYYHNIARNTGGALLAYRESYVLQGKARDLLKQLELRTNSIFEEIV
                     REGIARGVFKPYPPDLVAYNIIMLAHAWALKRWYWSGRETIEQYIEMQTEFILSALQQ
                     R"
     CDS             complement(383871..384698)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011731602.1"
                     /locus_tag="KTA_03160"
                     /product="creatinine amidohydrolase"
                     /protein_id="BBH92117.1"
                     /transl_table=11
                     /translation="MQATRWRYLAEMSWTELDRLDRERTVILMSAGPLEQHGPHLPVG
                     TDVFAAEEVTRRLLEYLREATDWTLLLAPTVLYGSAVLSRPYPGTVSVRRRVQTDYCT
                     DILASFVENGFRWIIVTSQHMDPPYILAWEEACQRVNARGGRALHGYERLVFDDLFES
                     GSLSAVLGCDAEGESHAGVFETSQLLATRPELVHQEELAALPRVRLDFLGELRRARSW
                     RELANGLGYTGYPAEATAERGESIYRRYVARYAALVEQHLAGADVWSALTLTRWFPS"
     CDS             complement(384785..385117)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03170"
                     /product="hypothetical protein"
                     /protein_id="BBH92118.1"
                     /transl_table=11
                     /translation="MLSDPAASEMSLDPISAAESEQLLRARRQEVARRLQAIRNEIAG
                     LIAEAPSPALEMLLWHVLEHVFVAQEYADPETVTELTPYDHRLALDPADVPGEGQGRP
                     FRTPAPLS"
     CDS             complement(385122..386486)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2RG74"
                     /locus_tag="KTA_03180"
                     /product="phenylacetate-coenzyme A ligase"
                     /protein_id="BBH92119.1"
                     /transl_table=11
                     /translation="MLSSHNRQSRYWDAYWQQMPRAELDAFHFRRLQRLIAFAYERVP
                     YYRRLYQEAGFRPEHIKTWDDFYRLVPVTDKPMITEDQYGQGSLFGFQALPAEYHRWF
                     HRTSGTTGQPLNEAFSGYDRLIAAYDSWCWGWWDVGLRPGDSIYFAFGYGTFIGFWTA
                     TFSAERMGLTIIPGGGLSTEQRLLQILELHPTCVCATPTYLLHMSRVAREKGLPLHEA
                     GVRVLTMAGESGGNVPSMRAALRAGWGDVRICDIYGISELIFLATECREASEGKALGV
                     HVAERHCHSFVADPATFKPLFEDGAVGEHIVTTFRPTQPLIKYRTHDLVRLWRAHDHG
                     CGWTWTFLEGGVLGRTDFMVTIRGTNVYPTAVENLLGQVDGLTPYYEIHIERRQDQDC
                     MSVVVEAEPALAREVYPALQERAMQLLHHAIGVRIEVQVVEPQSLPRYELKSRKVIDH
                     RRKG"
     CDS             complement(386639..387448)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_052846972.1"
                     /locus_tag="KTA_03190"
                     /product="crotonase"
                     /protein_id="BBH92120.1"
                     /transl_table=11
                     /translation="MATPLTFRDLQLEFIATEQQGPIAYIKLNRPPVNAHHMPMLLDL
                     ERAILAVRFDPSVKVAIVTSQLPRYFSAGADIRVIRDEDPEQVGLLSQTSKEILQRMR
                     TTAKIFIAGIDGHCMGGGLEIALACDYRIASNGPWQFGLPEVQLGVLPGEGGTQLLGR
                     LIGPHLTLRLSVSGESFGVQKAHELGIVDEVYEPEAYASSLQAFAERIAQGPTRAIGF
                     IKMVINEGLDLPLQGGFALERELQNQLLRTEDVREGVTAFLERRPPRFRGR"
     CDS             complement(387803..388456)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03200"
                     /product="hypothetical protein"
                     /protein_id="BBH92121.1"
                     /transl_table=11
                     /translation="MSAVSDEELNPAIVKLVATLVAAKRRLARHYLEWCVRGPVLEAS
                     TAVSAMAQEEYGQARVLAGLLDGEGLQTSLSLPALVLQPAPCWISLICLAALFDTAVT
                     EALAVTARYSPSLARRVAKILQEESFHQLFAQQWLQLLGQEAALRPRLLQQVEQLRAQ
                     LLPWLEQLDQLLSEAVPAREQSAQAAVAWQQRMADWLRQLAPRGDAPGPHILPEGGS"
     CDS             complement(388453..388692)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03210"
                     /product="hypothetical protein"
                     /protein_id="BBH92122.1"
                     /transl_table=11
                     /translation="MSSLAHSEIYQVLARRKPDDELQVIGSVHAPTRELAMLYAAWTY
                     DEETWAELQVVRRGSLRPVAFAVGSQAAVEKGAAS"
     CDS             complement(388766..389086)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03220"
                     /product="hypothetical protein"
                     /protein_id="BBH92123.1"
                     /transl_table=11
                     /translation="MMTSTERLMQALAEVQDPELSISIVDMGLVQRLQEQEGQVTVEL
                     TLTSTGCPCADWIREDIEQRLLAEPGVREVKVVFSWERPWTPQRLTLRGRHALRQLGY
                     ALES"
     CDS             complement(389083..390027)
                     /codon_start=1
                     /gene="paaA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011228339.1"
                     /locus_tag="KTA_03230"
                     /product="phenylacetate-CoA oxygenase subunit PaaA"
                     /protein_id="BBH92124.1"
                     /transl_table=11
                     /translation="MTENAVLLARVQAGQLIEADEVSEEYRQLLIETLTITADTELLG
                     ALMHYDNLYHERVPEPFVGTLLAITQDEFGHAHIAYRLLEDLGVDIDYLLWERPAQRF
                     KHPYAMDMLYTTFAESALIGFLQDRAGFHLLGDVYRTTSYAPWKRALAKVDREEVFHM
                     RFGERAVTMLARSPEGRQQLQQALDWMFPITVEWFGQPDHLKRRDRQLEFRLKSKTND
                     QLRQDWLAEVVPFLTRLGLRVPAHYDESQGAYVLDYPFPCRFLPEEKRWDFSAPVSWE
                     EVRARWRQRGPYNEYLVQTLRTGRTLLTALQAAGEVSQ"
     CDS             390294..391490
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225693.1"
                     /locus_tag="KTA_03240"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBH92125.1"
                     /transl_table=11
                     /translation="MHNTYLLTEEQQKLQRWAYELAQAEFQASAERWEREGIFPWEHV
                     ATLAEQGLLGFTLPRAFGGLERSRLEAVLVLEQLARVCLTTAEIAHICMNGPSYAISR
                     LGSQALQARYLPEVVAGKRLIGIAITEDEAGSSLGEISTRAHVRATSVVIDGRKCFTT
                     IGDVGGTFEVVVRFGGEGTRGLGAVLVDADTPGFAVERVYEKIGGNGIHEAALRFEHC
                     EVPREQVLIEGDPATSNGFKLVMRAYNALRLGIAANSLGVAQAALDQLVPYLLQRRQF
                     GAPLAAAQGLRWRVARLALALEQARLLTYRAALLSDDYGFPPAYETALAKLAATEVAL
                     QAADEAIQVLGWRGITKDYAAERRYREIRGWTIAGGTSEMLLESLAKQVLRHYEQSSG
                     HALQAE"
     CDS             complement(391604..392326)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011228340.1"
                     /locus_tag="KTA_03250"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BBH92126.1"
                     /transl_table=11
                     /translation="MTQIQRRPDSVRSQQTAREHVISLAERLLHPQSSHEQRLLEIVK
                     TAAAVFRERGYEAGTLEDISQQLGMTRPALYHYVRSKQDILFLTINYLLDIALAELNE
                     LERQQDTRERLRSLIIHLITLIGRERSFFTVFFRDKAGLEEPYLSLIREKERAYVAAF
                     RRAVREAMTAGMLPTIPEGIATQAILGCCNWTYQWLDPAGPVPLEQAAELIASFLVDP
                     HPMHLSGKEDASAAAPSDGQGQ"
     CDS             complement(392687..393133)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03260"
                     /product="hypothetical protein"
                     /protein_id="BBH92127.1"
                     /transl_table=11
                     /translation="MTPLTPLPVVRLKVDRLKIAWMAVAITDPNPIHLEDAVAHQAGF
                     PSVIAHGTFAIGLMGLLLTRWAGQQQVRRVEARLLEPVFPGEELLCQGEVTGIEEDEV
                     QLRLQVLAGERQVAVGSATVARPAAAGPPLEREVKAPLASEPGPAL"
     CDS             complement(393150..394754)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03270"
                     /product="hypothetical protein"
                     /protein_id="BBH92128.1"
                     /transl_table=11
                     /translation="MTLSSSLPHILHEDWFQARGQPTLKGSRCPSCDARYFPPRRSCP
                     GCGANELLPYEPPRTGRVLACTVIHVAPAPWQAPYAVAAVELDDGLVVYAHLSEGRVQ
                     PGTPVTLDALTVRRADGEIVTYAFRPLPASAGLPAAAASARQPTPQSLPPGARPLAAP
                     VFVAGVGMVPFGKHPDVPPEILALRAGLAAVDDAGLDQRSVQALFVGTAFGGTAMGQK
                     ILRHAPWGQRPVINVENACASGSTALLEAATWVASGRCDVALAIGVDAPASQGGGLIP
                     LPPDDPLAAVGIPLPALYALTADHYLHHSGASVRELASLVVISRRHAAANPYAFFRAP
                     VTVEEVLQSRPVAEPLTLFQCCPNADGAAAAVVVSAARARQLGAKVRLRAGQLRSGRV
                     QSRFGPQSVVALTAREVYEAAGIGPEAIAVAEVHDAYSSALPPALEKLGLAPPYEAAA
                     RLARGDYDYQGAGPVVNPSGGLLSRGHPPGATGLAQVFEVVTQLRGQAGARQVAGAHV
                     GLIQNQGGTVLDLETNAVAILLLTDS"
     CDS             complement(394751..395170)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03280"
                     /product="hypothetical protein"
                     /protein_id="BBH92129.1"
                     /transl_table=11
                     /translation="MDLSTIELPDVTFTVEQVKAAEFASALDTQLATEADGAVLVPIG
                     MVFFVLCRDSATIFERLGVRWDRALFGGVRLEYARQIRAGEQLVARSRFLSYRERSSA
                     EGQLGILELETCYSASDGQLVLREVSTLIARGGLELS"
     CDS             complement(395151..395702)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011173050.1"
                     /locus_tag="KTA_03290"
                     /product="phenylacetate-CoA oxygenase subunit PaaJ"
                     /protein_id="BBH92130.1"
                     /transl_table=11
                     /translation="MNEQHECMSDVALTEETVLQALESVLDPEVPVSIRQLGLIQGVH
                     LDENEISVALVPTMLACPGREVIAEEIRQRLSQLAGERRVVVTWETRVIWTPRRITTS
                     GRQQLQSWGVVAREPTPHGVRCPYCGSYQTRLNNAFGAAVCKAQFSCSTCGSAFDVLR
                     GALRPVPAEATSQRGDGDGSLHD"
     CDS             complement(395699..396385)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03300"
                     /product="hypothetical protein"
                     /protein_id="BBH92131.1"
                     /transl_table=11
                     /translation="MDHVAEFELRAWADDEFIVGHILGSRIIEYTHLEECLAIGSFAQ
                     DEMAHARALYEYTGLHDRALDRYVFFRAAEEFVVTPLATYQPADFPELVVKQYLYEVL
                     DRLRLQAISERSGRQLQEILLVMRYEEHVHSEHWRRWLQVLATSPARPRLEQALQVVG
                     RYCGLLPWQPSAQVQSWYGHWRPQAEQELAEQGLTLGAAASVDWQQPFAALIEHMQSV
                     FRERPEVRLG"
     CDS             complement(396430..396771)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03310"
                     /product="hypothetical protein"
                     /protein_id="BBH92132.1"
                     /transl_table=11
                     /translation="MSNQVFEVFVILKRGDPATHVGSVVAPDPVLALHEAKETYVRRT
                     ECVSLWVVPRSAITAFAPEDEILFQAARTRDYRQAGYFTRHERQPVRPAPEPDGQSGE
                     TLAVSHGGAVS"
     CDS             complement(396752..397729)
                     /codon_start=1
                     /gene="paaA_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011031683.1"
                     /locus_tag="KTA_03320"
                     /product="phenylacetate-CoA oxygenase subunit PaaA"
                     /protein_id="BBH92133.1"
                     /transl_table=11
                     /translation="MATAPVIAAGVRPLAPEAVEDLDAFIAWLQAGGLVQAGDPMPES
                     YRQHALRIASFQALAELVGVLLFSDWLERVPAFIRKQMITAKVQDEVGHGHVMARVAE
                     DLGGNRLTILEDYLEGRSKLLNVFHYEFQTWPEIAVGAILQNSAAIVQFQSLVKGSYL
                     PYVRALRKILPEESFHFHQARNLIQTLLEQRDPVVRRQLEEGLALWFPRVLAYFGPPE
                     GERFWSNKMVQFRLKMASNEALRQAWLTKIVPVLEQLGLQIPDPRLRRREDGTWEYTE
                     PDWEEVRRVIAGQGPASARRREQVRSIYERNRWLTEMMGIGEQHVKPGF"
     CDS             398051..399754
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088817.1"
                     /locus_tag="KTA_03330"
                     /product="acetyl-CoA synthetase"
                     /protein_id="BBH92134.1"
                     /transl_table=11
                     /translation="MEQRPFANVPEQFLPPPEHRAEFLFAVPWLYYIRRAQIFNAADE
                     LLDRTVRRGLGPRTAIIDADREEIWTYHRLQAAVNRCANALRALGVRPGERVVMRLND
                     VPAAAIVQLAVWKIGALIVPTATAERARELSFIFSDVEPTVVVSDRDYLDDVDQARAA
                     APQLRAVVAWPEASGRDYESFERLLATQSEEATTYPTQPLDASGIYYTGGTTGQPKGC
                     LHTHAAEVALADLNNLSRAVTADDVLFTHAPIGHAFGNGEKINFPLRAGASAIYAVRP
                     SGERLWQLVARYGATVMAGAATIYRIMLQVCPTPRERYPQLRLRQAISSGEILDQATY
                     ERWQQALGFPVRNTVGMTPIRHLFIDSNLLGEKVAPQLSVGRPLPGYEARLVDPVSGE
                     TLLDPEQPGRLAIRGPSGITYWVHRHSGILERARQDVRGGWSLLDDAYIWDQEGWLWF
                     HARLDDMIVTGGRQVAPREVEDVLTRHPAVAEAAVIGLPDPIRGQAVTAVVVLRPGQV
                     PSEDLAHALQDFCKAQMAFYKYPRRIEFVPELPKDNVGKLQRRILRERLQPLAGKEHL
                     P"
     CDS             399751..400179
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010938185.1"
                     /locus_tag="KTA_03340"
                     /product="thioesterase"
                     /protein_id="BBH92135.1"
                     /transl_table=11
                     /translation="MKPDTIWQPPPRALSLQVLVSMADVDSYQIHYHSYYRWIELAHH
                     QLLRRAGMTVRELLAQGAATPAVHSECDYFIPVQVDETLTLLAWIDRPGKTSYAARCL
                     FMNAAEQVVAQGQVIHVYIEHGRPVPLPAWLLRLASDKEA"
     CDS             400183..401844
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088817.1"
                     /locus_tag="KTA_03350"
                     /product="acetyl-CoA synthetase"
                     /protein_id="BBH92136.1"
                     /transl_table=11
                     /translation="MKEHYPARATVPQDWLVPPELQPDFLWEQDEQTRSERNVGREAI
                     DLWCDRGNGERPAVIRMTTGEVVTFQELKEKSDRLAGALIELGVVVGDRLALRYSSQP
                     AAIIAAVAAWKAGAAVVPIPAQARRSEIEFYLNDSAARWAIVLNEGDLYSELAAALPQ
                     TSVRRVVIGRKAPHQDGESLEALMNEGRADLAARVCTQADDLAAVWHTGGTTGRPKAT
                     YHTHRRWLAAGRRLARTWGIQPGQVWLYGIPISNVAGLLGRFICTLQAGATLVEPENF
                     SGVSVLQAIVAQRVTHLLAIPVTLSQLAQEVAGDRHALASVQQVYAPFLTTGAGDLYA
                     RWKELGYHLSNPLGSSIMCQWFIGPRADTTFPPFALGKPVEGYEICIVPIEGTSAEPL
                     PAGEVGRIAARGPTGLTYWNRPELQRAEVKAGWTITDDLGRMDENGVFWFMGRLNNLV
                     VTAGYKVVPGEVEEILQQHPQVQEVAVVGLPDPLREQVVAAFVVPKDSKGGEALAQQL
                     QQWCKERLAPYKYPRKIFFRDQLPRDPVGKVQIQVLIQQAVDRPV"
     CDS             401882..403324
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257259.1"
                     /locus_tag="KTA_03360"
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="BBH92137.1"
                     /transl_table=11
                     /translation="MIGIDAASLEKLWIDGQACDSQSQETYPLINPFTGQTLAQMARG
                     GQAEALSAIAAAARAFPLWSRLPGNERANRLYKAYHLLRRYRAELEALLIEDLGKTSR
                     EAAKEVRSTGAFLRYCAEEARRIFGDFVPSPDPKKRVVVVPQPVGIVTAITASNAPGI
                     LFGRKVAPALAAGCTLIVKPAEEAARVTLLLAQLLEGAGLPHGAVNVVMGDAPAIVET
                     LLGDPRVAMVTFTGSVQVGREVMRLAAAGPKRVVLELGGVAPFIVFADADLQAAVEGL
                     VSAKFRHAGQICASPQRIFVEESVAEAFKSLLVERLARVKVGDPRDATTEYGPLQHQR
                     NLQKIQRLLEDALARGARVVTGGHSPGGLLFAPTLLEGVTDEMAIAREEAFGPLIALA
                     TFRDEAEVIERSNNTAYGLGAYVYTRDLARAWRLAEALEVGIVGLNDPFPATIEGPFG
                     GVKQSGFGLEGGRYGVEEFLLKKQISFSLA"
     CDS             complement(403607..404431)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257237.1"
                     /locus_tag="KTA_03370"
                     /product="2,6-dioxo-6-phenylhexa-3-enoate hydrolase"
                     /protein_id="BBH92138.1"
                     /transl_table=11
                     /translation="MQKTEEIGQSIVAGGVVTNYHEAGQGFPVILIHGSGPGVSAWAN
                     WSRVIGYLAERLHVFAYDQVGFGYTSLPADGVFGLERWVAHLLAFLDAVQVERAHLVG
                     NSMGAAVALAAAVLHPERVERLVLMGPTGVRFPLTAGLDAVWGYTPDLEQMRHLLRLF
                     VYHQELANDDLVALRYRASIRPGIQEAFASMFPPPRQQGIDDLAAYEDRLTEIQAPTL
                     LIHGRDDQIIPLSTSLKLLHAIPRAQLHVFGQCGHWTQIEHTRDFNRLVRDFLTEA"
     CDS             complement(404651..405649)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257232.1"
                     /locus_tag="KTA_03380"
                     /product="catechol 2,3-dioxygenase"
                     /protein_id="BBH92139.1"
                     /transl_table=11
                     /translation="MAENGQEPMFEVAQLAHVELLTPKPDETLWFFKDLLGMEETCRE
                     GQSVYLRAYEDFYHHTLKITEAQHPGLGHVAWRTTSPQALERRVRAIEALGLGRGWLD
                     GDLGHGRAYQFLTPDGHRMELLWEVDYYQAPEPLRTELLNRPQKRPLRGVPVRRLDHV
                     NLLAQQVTPNRDFLMQQLGFRLREHIILNDGTEAGAWLSVSALVHEIALMGDRSGARG
                     RLHHICYWYGYPQHLSDIADVLMENNIQIEAGPGKHGISQAYFMYVFEPGGNRVELFG
                     DAGYLIFDPAWKPITWHEKDLAKGIIWYGSPLPAEFFLYGTPSPDVAASLAGAASQ"
     CDS             complement(405863..406657)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011393278.1"
                     /locus_tag="KTA_03390"
                     /product="2-keto-4-pentenoate hydratase"
                     /protein_id="BBH92140.1"
                     /transl_table=11
                     /translation="MSSGNLSPSTAEELALRLDQAEQTRTPIAPLSESYPGLTVADAY
                     TIQQHWLQKKLLRGARLVGHKVGLTSLAMQRQMGVDQPDYGFLLDSMVHSSGTLLPLQ
                     QLIQPRVEPEIAFWLQADLSGSHVTPAEVLAATRSVSAALEIVDSRISDWRIKLTDTI
                     ADNASSARVVVGRQIALRDLDLEAEQVELRRNGEVVGVGNGAAVLGHPAAAIAWLVRK
                     LAEFNTGLRAGELVLPGAMCAAVAAQPGDQFEARFSHLGEVKVFFG"
     CDS             complement(406701..408158)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257240.1"
                     /locus_tag="KTA_03400"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BBH92141.1"
                     /transl_table=11
                     /translation="MHPYWFDVQHYIHGQFVEGEKHFEILFPATNEVIGRAPEGGEAE
                     VDAAVRAAKAAFAYWSQMPPSQRRRHLRAFAEGIRAHEEELALIESLDVGRPIRENKA
                     GYIARIAANIDFFADFAVMHGSEAYPMENGYINYVLRQPVGVAALITPWNVPMLLETW
                     KIGPALAFGNTVVLKPAELTPIGAWKLAQIAQEAGLPPGVFNVVHGFGPDSAGALLTQ
                     HPEVSLISFTGETVTGKAIMSAAARTLKRISFELGGKGATLVFADCDLDLAVETSVRA
                     AFFNQGEFCLAGPRLLVQRPLYEPFLERFLARASTLQPGNPLDPETTLGALISREHVQ
                     RVRSYIDQAVAEGATLLLGGGPPHLPPPYHEGNFLSPTVITHVQPHDRICQEEVFGPV
                     VTVAPFDTEEEALAVANGVSYGLSSVVLTRDVGRAVRVAEALKVGTVWINDFFVRDLR
                     VPFGGMKQSGIGREGGQYSLEFYTEAKTVCLSNRS"
     CDS             complement(408178..408915)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011229068.1"
                     /locus_tag="KTA_03410"
                     /product="4-oxalocrotonate decarboxylase"
                     /protein_id="BBH92142.1"
                     /transl_table=11
                     /translation="MMSRPITPEEVALLEAVRSARAARYTVAGNRFHLAARQAYRIQE
                     HLGAHRTVRGYKLGLVSPAKQAQMGITTPIYGRIYNDMLLKQPVVPLSRFIQPRFEPE
                     IVILLGQDLPPTAAIQQAQQIIAVAYLGIDLLDSIWAGYRFTLAEVIADNASGGGFSR
                     GEQALVWPVKGTLRLFIDECAVAEGSLEALGPVEDHLLWLAHEVGGLKAGQLIYLGSP
                     ISARPAIPGDVRVEGPQGSWLVATFVG"
     CDS             complement(409113..410138)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9W9U3"
                     /locus_tag="KTA_03420"
                     /product="4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="BBH92143.1"
                     /transl_table=11
                     /translation="MRALRLTDTTLRDGSHAMRHQFTRQQVRSIAQALDRAGVPVIEV
                     THGDGLGGASLQYGFSHTPELELIAEARSVCERAKIAALLLPGIGTRKELKAAAERGV
                     QVIRIATQCTEADISEQHFGLTKELGLEAVGFLMMAHMRPPEVLAEQARLMESYGADC
                     VYIVDSAGALLPDGAYARVKALKEALTIQVGFHAHNNLGLAIGNTLAALEAGADQIDG
                     SLRGLGAGAGNAATEVIAAVLDKMGQNPGLDVFALMDAAEYIVAPIAPYQPLPDRDAL
                     TIGYAGVYSTFLLHARRAGELYHLDPRSILVELGRRQAVAGQEDWILDVALELASRSQ
                     DKQVSQT"
     CDS             complement(410135..411064)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9W9U2"
                     /locus_tag="KTA_03430"
                     /product="acetaldehyde dehydrogenase"
                     /protein_id="BBH92144.1"
                     /transl_table=11
                     /translation="MQHSASNGRAKVAILGSGNIGTDLMYKLLKEPGSMELALVAGID
                     PQSEGLERARSLGIPTSTESIHAVLADPEIRIVFDATSAKAHVRHARLLREAGKIAID
                     LTPAARGPYVVPPVNLGAHLDQMNVNLITCGGQATIPLVYAVSRVTPVRYAEMVSTVA
                     SASAGPGTRQNIDEFTYTTARGLEALGGAREGKAIIILNPASPPIMMRNTVYVVPEGD
                     FDFQQVAASVEQMVADVQRYVPGYLLKNPPIVEMRETPWGRSAVIVMLLEVRGAGDYL
                     PTYAGNLDIMTAAARRVGEVFAAHLLSSKEAVA"
     CDS             complement(411071..411850)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257233.1"
                     /locus_tag="KTA_03440"
                     /product="IclR family transcriptional regulator"
                     /protein_id="BBH92145.1"
                     /transl_table=11
                     /translation="MVQSVYKAFQILNLFSHEQPEWGVCEIARKLGFPKSTASALAAS
                     LTEGGLLRRTPTGRYRLGWRIVALSQLLLETTEFRSEARKVMESLVARFGETVHLATL
                     ESDQIIYVEKLQGTRAVRVAVTGVGVRLPGHCSGVGKCILAHLPWERVQAILEKQGLP
                     ALTPNTITDPQVLRAELEQVRRQGYAYDREEAVLELCCVAAPIRDHSGEVIAAMSLSI
                     PAYRFYANEEQYRLAIVRAAQQVSENLGYIPRIACSGKRRN"
     CDS             412399..412707
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03450"
                     /product="hypothetical protein"
                     /protein_id="BBH92146.1"
                     /transl_table=11
                     /translation="MRLYACSRRDGFPVGLILALLRTSCPFPGTGNPASTIPMPATIL
                     SREEQRPREWAPSHLAAQHTRAGSRAAGLQMDAAAAPAQPAPALARSEHPTREALAAE
                     "
     CDS             complement(412750..413469)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003532444.1"
                     /locus_tag="KTA_03460"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBH92147.1"
                     /transl_table=11
                     /translation="MRQSQEHPQSANSRSRKRDRAYQFLKQLLLEGELQPGVALDVNA
                     IASELAMSRTPVLEAISLLEREGFLSVVPQVGVFVRITPSEETYQRMLARAALEGVLA
                     ARAAQRIDERTLAELQSLLEQMDEQSSDSLTYGALNRDFHRLIHQAAGLPVIRDLIDQ
                     LWDTLEYTGYSKQLFTSRQASQREHKAIFAALCAHDPHRARALMEQHVLRVAELFAPT
                     ESQTYPKPTSLQLTRQTRRPE"
     CDS             complement(413816..414697)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011229072.1"
                     /locus_tag="KTA_03470"
                     /product="2,6-dioxo-6-phenylhexa-3-enoate hydrolase"
                     /protein_id="BBH92148.1"
                     /transl_table=11
                     /translation="MPVQEQWVQTGTITTHYWIGGDPANPALVLLHGAGPGASAAANW
                     ERVLPDLARDFYVIAPDLVGFGETSLPRRPWPRGWTAWIGLRVEQVLGLLDALQVHSA
                     HLIGNSMGGYLALQLLIEAPERFGPSLLMGPAGGAFTPGPEMALMRSFATDLRPARLK
                     QVFRAFLYSDEAIPDLDQLVERRYALAAQPETLEAYEAMMIDGPIPLPPTLLSRIRHP
                     ILILHGRFDRIVPLESSIWLLQHLHAAELKVYDRCGHWIQLERWEAMQADIRAFLQYH
                     MTAARRPAVERTEASPA"
     CDS             complement(414812..415798)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228946.1"
                     /locus_tag="KTA_03480"
                     /product="metapyrocatechase"
                     /protein_id="BBH92149.1"
                     /transl_table=11
                     /translation="MSYAHRQGIAKLGHIHLVTPDLDKSLWFWSEIVGLEEIARSENE
                     VYLRAYGEWEHHSLVLSKGEQARVDHVAWRTERPEDVDGYQRLLEEQGINCQAVRPGD
                     ELGQGRALRFQVPHAGHTYELYFDIEKPQAPPETRSTMKNMPHKAWRKGISPVRIDHV
                     NLQTTHQTVSQGIQFHLDTLGFRLREHIRLQGPGTIYAWMSVTPLVHDVALGVVFEPP
                     ADPAPARLHHVAYWLDSWQDVLRANDILAEHNIKIDLGPGRHGISRAFFTYVRDPGSG
                     HRLEIFSGSYLIFDPDWQSIEWTEEDYVDGLIWWGEQRPINQMGSMALTTPA"
     CDS             complement(415966..416748)
                     /codon_start=1
                     /gene="hcaB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7N6C8"
                     /locus_tag="KTA_03490"
                     /product="3-phenylpropionate-dihydrodiol/cinnamic
                     acid-dihydrodiol dehydrogenase"
                     /protein_id="BBH92150.1"
                     /transl_table=11
                     /translation="MTGGGSGIGRAVVDAFVREGARVVVLDVVAERITELEQLHGDQV
                     AGVVGDATTWSANQGAVALALERYGRLDCLVCCVGIWDYFASLKTLEPDQLAAAFQEI
                     MDVNVKSYILATKAAWDALVESTGSVIYTLSNSAFYPNGGGPLYIASKWATRGLVVEM
                     AFELAPRVRVNGVAPGGTLTNLRGLRSLGQEGLRLRETPGIEDLMRQGNPLQLVLNPE
                     DHAGAYLYLASPELSRGVTGAVINSDGGLGVRGIARLAGLLT"
     CDS             complement(416765..417094)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03500"
                     /product="hypothetical protein"
                     /protein_id="BBH92151.1"
                     /transl_table=11
                     /translation="MAEHRPTAVTPLPSWADRDMLAADPPTEIGNEFASVLVRRIYTR
                     NGVRLQIISPRLGFEIRLDPLELESLTWQTPETFARLLEHPYGPPGAPRATGHAGNGL
                     EDTHGPS"
     CDS             complement(417104..417613)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_001705092.1"
                     /locus_tag="KTA_03510"
                     /product="hypothetical biphenyl dioxygenase beta subunit"
                     /protein_id="BBH92152.1"
                     /transl_table=11
                     /translation="MSAVSETILREIEAFLYREAELLDERQYNEWLALLSEDVQYELP
                     QRVTRERSQGEGILDGTGHFLENQWTLRKRIERLATEYAWAEDPPSRTRHFVTNIRVA
                     PGEQQDEYLVRSNVLVYRTRGDDPTYDVLSAERSDVLRRVDGSLRLARRRVLLDHSIV
                     LTRNLAIFL"
     CDS             complement(417675..418994)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_001705095.1"
                     /locus_tag="KTA_03520"
                     /product="putative large terminal subunit of
                     phenylpropionate dioxygenase"
                     /protein_id="BBH92153.1"
                     /transl_table=11
                     /translation="MTVTAQRVHGPEEYLATAQEKFLQRAYLLPGLFSDPEIFRLEKE
                     RIFARAWHFVAHESEIPRPGDYVVRYVADDPLIIVRTESGEIRALYNMCRHRGMQVCR
                     AEAGNAAFFRCPYHGWTYKNTGELIGVPFHREVYGAEGLQRGEWPLISVRLESYEGLL
                     FANLDPEAIPLREYLGEATFYLDFYLKKSTAGLEVRGAPDRWIFPANWKLGADNFIGD
                     AYHTAFTHRSTVEVGILPVPDANFHKDGPQAIVGPWAGGYVPNLPYAALYPHLVGTMR
                     ANLTPAHHAIMDHDLWQSHSTLFPNVSFLNAPGIMPGTAPVAYFTLRVWRPLGPDRME
                     IWSWYLVERDAPEEWKEASYRAYVLQFGTSGTLEQDDTENWSSITKVAKGQLARTIPL
                     NYRMGLDHLQPLTDWPGPGQAYPVDYTEYAQRHFWTTYFEWMCSNSR"
     CDS             419266..419529
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03530"
                     /note="possible pseudo due to frameshift"
                     /product="hypothetical protein"
                     /protein_id="BBH92154.1"
                     /transl_table=11
                     /translation="MIDDEGIYPTTAEGLAKLCPVLEQGTVTPGTQTHPADGNCGMVL
                     TSRARARELSRDQAVEVQCLAFGQARARKDFMPQATFWPPGRR"
     CDS             419451..419795
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03540"
                     /note="possible pseudo due to frameshift"
                     /product="hypothetical protein"
                     /protein_id="BBH92155.1"
                     /transl_table=11
                     /translation="MPGLWPSPGEKGLYATGNLLAARQALTAAGVSLRELRAVKTHNP
                     FAVNDIYFARELGLALESFNHYGSPLVFSHPQGPTGLRQIIELIEELIMPGGGCTAGD
                     TGTAIVVHVDLH"
     CDS             420569..421465
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03550"
                     /product="hypothetical protein"
                     /protein_id="BBH92156.1"
                     /transl_table=11
                     /translation="MTTPDNTYPIDPEHAGELARLMQQDRLLTEAMGGLLPEEGISLP
                     ETGRVLDLACGPGGWALELAFRFPKAEVLGVDISPQVIEYARAQAWSRGLSNVSFQVM
                     DVMEPLAFPDGSFDLINGRLLCGFMLPSAWPRLVQDCFRLLRPGGVLRLTETEGPLTS
                     SPATERYLHLIWRALQQAGQSFSPDGRHIGITPVLPRLVRQAGFREVRLRVTAIEWSM
                     GTEMHYPVFKDHLIAMELLQPFLVKMQLASKEELERLYQQALAEMQQEDFCALWNLLT
                     VWGRKPAPTTETCSGASSAAGE"
     CDS             422535..424583
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03560"
                     /product="hypothetical protein"
                     /protein_id="BBH92157.1"
                     /transl_table=11
                     /translation="MHEEAEAERAWPWDWQELGIGNLLAVRDCSSEALIRASVEAYGY
                     GGREPWPGRGWPARIGKWLTAAQVSQQLPSACWVRIGQVGAWAVALYSSELGGGLGQS
                     WLRQLSSGRELVSLEAGGFWQADQRLLEDDWLYYVDGELVTAFGLQRAYERWGRAPDR
                     FLVAMRQVGLPVDGSIPPQEPGERLTSEGGNVAASRLRRAALALLDQALGLRLPRAVV
                     AGPLLTIPLSEWHWVSALLGAINLALWCVREQTPEQLLSALGLDPATARLEQPSVIDE
                     ETVRAGRVGAWAFALDFSLKAGWDPLWGWDQTAQALSRGTEVALFQTNPKVTSLAYFA
                     EGTKVCEFEPYSSCWRFGSEPDRFVEQMRQIGLAVDPPNQPDESAALAAALALLRRGL
                     DIPLPQPLLESPLLTAPLSAWQRREDEEALLMLLLVRGADPKHLLHRWVTWSGADPAS
                     AQVLAREEAWAQLPAPSATWLRAGWAGEWAVLVVSQQPPADWQQQPQWLQGLAAETEL
                     IELSRHVTHGLCTNGLAYYGNGELVTAFNPVHPEVRYGQDPDRLVGAMRHVGLRIEAP
                     LEEEAERDQYAPTPELAALEVLTRALGIRLPAAVVEGPLLTARVLPAQGSASGIGVAT
                     RPGVWCLKSCPSLKVPKEPARTEIGGVADSPAGDGIYQVSAPEGKEPACCLAQREQAH
                     "
     CDS             complement(424818..425135)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03570"
                     /product="hypothetical protein"
                     /protein_id="BBH92158.1"
                     /transl_table=11
                     /translation="MRQGLLHALMQVLLENSLRHPIQTRTDGSDLSQHLLVISSFFTE
                     ALEALSVNSEARQTIGGTLTREELLCFHRAASSVAGQAGAWLLLFKIDACSRVLALTL
                     RVK"
     CDS             425034..425336
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03580"
                     /product="hypothetical protein"
                     /protein_id="BBH92159.1"
                     /transl_table=11
                     /translation="MLTQIAAVRSGLNRVAQAILEQYLHERMQKALAQRDASLAMHVL
                     REALDRLLFSRQGPRRSSRLALPVHILAGQQSAREMTPRGESMVRVTLISSLHLQQ"
     CDS             425564..425779
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03590"
                     /product="hypothetical protein"
                     /protein_id="BBH92160.1"
                     /transl_table=11
                     /translation="MIDDSSLFLLLHERHLAGKCGGDCSLPSLSSAFLAPVPARPGSP
                     LAHDQEQGDDQEREYEGKQQDEGTSWG"
     CDS             complement(425907..426722)
                     /codon_start=1
                     /gene="mgtC_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011816623.1"
                     /locus_tag="KTA_03600"
                     /product="magnesium transporter"
                     /protein_id="BBH92161.1"
                     /transl_table=11
                     /translation="MMALLFTFVIRVMAALLCGVLIGWERQYRQRTAGLRTNALVALG
                     SALFVLATALTNTDTRIAAQVVSGVGFLCAGVILRDGFNVRGLNTAGTLWCASATGVL
                     AGMGQPGLAGLSAFIIVAVNLMLRPLASRINRQSQRRERRKLLLHYQVQLTCTSEHEI
                     PIRSLLLQQIQGGPLVLQSLESEDASDPGRLTVRAELQSEGEQTQALEQLVARLSLEP
                     SVSAIRWSIRAAHPADEESDEQMTYALAEPLTALIGQPVRSPSLDDLTDGRER"
     CDS             complement(426874..427128)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03610"
                     /product="hypothetical protein"
                     /protein_id="BBH92162.1"
                     /transl_table=11
                     /translation="MQQITQLLLTSATVQPTPSYEGGKEEAQGTLWQTTQPSGWSRLK
                     RLAALLIIMHPRLLPLMSDHDTRRLIQLLTSRDRGAVLLD"
     CDS             429009..430652
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_001703449.1"
                     /locus_tag="KTA_03620"
                     /product="putative manganese transport transmembrane
                     protein"
                     /protein_id="BBH92163.1"
                     /transl_table=11
                     /translation="MQQMTEQHLTTATAQLDAAHVGDIQGAWGTLSQTTQPPRRGWLK
                     RLIALLIIMGPGLVTMIGDNDAGGIATYTQAGQNYGTSLLWTLLILIPVLIVNQEMVA
                     RLGAVTRVGHARLIFERFGKFWGAFSFFDLFLVNYLTLVTEFIGFAMALNYFGVSPLI
                     SIPVGILGLIAIVLTGSFRRWERVMWINCLVSLLMIPIALLPHPAWGPILHDTFVPGV
                     AGGLNGNALLTIIAIVGTTVAPWQLFFQQSNVVDKRITSRWLSYERLDTIIGSILTNI
                     EAAGLIIAAAFALAGTRYFGNFIDAGTTARAYAALGHPLMGALLMIILLNASILGACA
                     VTLSTAYAVGDVFSVAHSLHRRFHEARLFYSVYILLIVLAGGLVLIPNAPLGLLTFAV
                     QALAGILLPSATVFLVLLCNDRAVLGPWVNRFWLNAVAAVIVGLLVALSFILAMTTLF
                     PAVDAMLLTRVVFALLLAALVVLGLLAAVRRLRRGSDPELAALLQMKKEDWQMPPLQE
                     IPRPAWSLTRWVGMVTLRAYLIVAIVLLVVKVVELALGH"
     CDS             431002..432354
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03630"
                     /product="hypothetical protein"
                     /protein_id="BBH92164.1"
                     /transl_table=11
                     /translation="MAHTMLSSSQELPPVTSEDLKRARDRLRVVQARRHRWGKLSLLW
                     LLIGPGLLVMLGENDAPSMLSYAATGATYGLGFFLPFILLTFIMAFIVQEMTVRLAAV
                     THRGHAELIFERFGPFWGTFAMLDLAVGNLLTLVTEFIGIRAGLGFFGVPPVLAVLLA
                     LAVIVLVVLTRRYWTWERLSLALALFNLVFIPVAVLAHPDPSRLMEAFLTGRPFPSWD
                     KTTLLLVLADIGATVTPWMLFFQQSAAVDKGVTGQDIAHGRLDTALGALLAAVAGIAT
                     AIATSPLFVHHINASSFAGADFARALLPYVGRLGASLFALGIIEAGLLAAMTIASSSA
                     YAFGEVTRQPHSLNRSLREGWPFYSVLLLAAGLAATLVLIPHAPLEFIVLIVNVYAVL
                     SMPPALVFLTVLVNDRDIMGEQANGPLANLLSVTVTLFICLAGLAYGIATVFPGLLPS
                     "
     CDS             432403..432618
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03640"
                     /product="hypothetical protein"
                     /protein_id="BBH92165.1"
                     /transl_table=11
                     /translation="MDELQPQPVNTKQDLSWVREVLEPDQLVESKVPLGRRRLGPGLL
                     VLLWVLRIYVLVMTVLIVYQVWQALHP"
     CDS             432969..435710
                     /codon_start=1
                     /gene="mgtB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002210890.1"
                     /locus_tag="KTA_03650"
                     /product="magnesium-translocating P-type ATPase"
                     /protein_id="BBH92166.1"
                     /transl_table=11
                     /translation="MLKHVARRWNRAAHVSAFLDDPQLQQVLHCDLAQTLRLLGASLL
                     GLTDAEAARRLRQSGPHYLPDLRARPWWRHLLLAFWNPFLLMLAGLGLASFLCDLFLT
                     SPADRSWIKELLLASMLVCSGSVRFWQERRAEQTLRPLASTMAEAVQVIRRADEQAAP
                     TLRRIPLEEVVPGDLLLLEEGRVVPADVRLVSAQALLLDQSLFTGEAMPVEKNDSEHG
                     EQPAPRLRSRADRSLLALLDASHLCLMGCSVVRGRALAVVVATGSATVFCRTARQFLK
                     RPFLSALQQELNQVSKVLLVSLLLMVACLLLMRGIARGDWSEALLFALAVGVGFTPEM
                     LPLVVTVALARGAVLLAHLGLVVKHLPMVQTLGALEILCLDKTGTLTSAPMQLVTAMD
                     ATGQEQTSVLRLAALSALAQQRGTFQSKDPFAQAILTAARQRGIQLQAGVTFDEVLPF
                     DPIRKRASAIVRAADESTFATRVQTSALLLCQGSFEPVLAITSAVETAEGLQPLSETA
                     RLQLRRLARWLQEQGMRVLAVAYKPVDPRRADALAAEEQELIFAGLLGLGQTLRDGVR
                     EGIEALRAGGISLKLVTGDDERLAAGLGEEVGCDSRRVLLGWELEGLDENDLPTLVGQ
                     TEIFASMTPLQKALIVRVFQQRGAVVGYLGDGLNDLPALRRADIGLAVNGATESAQAA
                     ATVLMQTSTLKQLAAGIRVGRKVSRTIGKYLAITISSNFGNALSILLASLFLPFLPML
                     PVQLLVQNTLYDLTQLALAWDQLDDELLQQPHRWHVAPVLRLMLIMGPISSLFDVLTF
                     LILWWFFDARTTATAPLFQSGWFLEGLFSQILAVHLLRTHRVPFLRSRAALPLLLASG
                     GAFGVGLLLPLTRLGALLGLVPLPPVYFCWLLLVLGGYCLLTELAKRWYFHRWGPWL"
     CDS             complement(435905..436066)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03660"
                     /product="hypothetical protein"
                     /protein_id="BBH92167.1"
                     /transl_table=11
                     /translation="MLIQIAAVRSGLDQVARAILEQYLHERIQEAVARGDATLATQDL
                     HEALDRLLL"
     CDS             436025..436291
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03670"
                     /product="hypothetical protein"
                     /protein_id="BBH92168.1"
                     /transl_table=11
                     /translation="MIEARTNGSDLNQHLLVISFFFPEALETLSMTSKARQPMGDVLT
                     RGELLRFHREASSFARQAGTWLLLFKIDSRYSILALTRWVKRQL"
     CDS             436784..437545
                     /codon_start=1
                     /gene="mgtC_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226786.1"
                     /locus_tag="KTA_03680"
                     /product="membrane protein"
                     /protein_id="BBH92169.1"
                     /transl_table=11
                     /translation="MGMGLFLARLLSALLCGLVIGLERQYRRRAAGLRTSALVATGSA
                     LFVLASTQLPGGNRLAAQVVSGVGFLCAGVILRDGLAVRGLNTAGTLWCVAATGVLAA
                     TGQLSLAMLSALMIVATHVTLRPVALMIDRWTRHALEQPGTCYLLQVLAAEDAASHAR
                     ALLWQALQSEPVLLQDFRCQPGPEPGLLRLQVKLCLAERNDRLLERVSLRLSLETAII
                     GVTWALATGEDRTGPEPEKPGEGQQSAKGVVSSSP"
     repeat_region   438170..439920
                     /inference="COORDINATES:alignment:CRT:1.2"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_seq="gtcggaagacgcgaagtagcccgtctgggat"
     CDS             complement(440175..441311)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015063658.1"
                     /locus_tag="KTA_03690"
                     /product="C4-dicarboxylate transporter"
                     /protein_id="BBH92170.1"
                     /transl_table=11
                     /translation="MKQGSMSVYQASWWNWVRQLYPGYFACVMATGIVSIALLLNQAI
                     LVSVILGWLGGGLFLLLLALYLLRLIRYPRAVLQDATDPSKLFGYFTAVAAPGVLATR
                     AALSHWVGLPVLLTALAAGIWCFLTYWAFAVLLFHNARPLQQTVNGSWLISIVGTESL
                     AINGTLLASIWPEQAAVLQLVAYAFWTLGVLLYLIFITFIVYRFFFGKILPADLTPPY
                     WINMGAMAITTVAGIRLLQAPHPAPLLVGVRSYLTGFTLMMWAWGTWWLPLLVLIGIW
                     KYGIMRQPLRYEPALWSIVFPLGMYATALHLLGQLPGIAFFEAVAVPFTWVAFVAWLL
                     VMGGWFLEIGRTLRRLRACAQTRETHPLAVSEREGPASRLPAEG"
     CDS             complement(441524..441880)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03700"
                     /product="hypothetical protein"
                     /protein_id="BBH92171.1"
                     /transl_table=11
                     /translation="MNRTANDGPGPARPPGRARGPARANPDDPPVQPPPRGRSGPLPG
                     PRYLGIPGRAAIVQAQVLLVALIVIVQLWLVTDALYELLSGRTSLLPWLALVSLLGFG
                     LALVITFWPRRQLAEE"
     CDS             complement(441877..442431)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03710"
                     /product="hypothetical protein"
                     /protein_id="BBH92172.1"
                     /transl_table=11
                     /translation="MESAAHRFQVRRQDQPGSAPRPPEPAAEWRQEFPYVWSEDEVVT
                     RRDTLFFLLAGSGALCLATGTLALIGKLSEGSSTKIVPVARVGELAENHWKVFAYPDE
                     YAQGILIHVPGKGLVAYSDVCTHLSCAVTYQPESQWLYCPCHEGLFDAATGNVLAGPP
                     TRPLPVIELEEHQGIIYAVRMVLR"
     CDS             complement(442456..443217)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03720"
                     /product="hypothetical protein"
                     /protein_id="BBH92173.1"
                     /transl_table=11
                     /translation="MPETVTIKQLFLDPSRCIGCRSCVAACRECDTHRGESMIYIDYI
                     ERANTVASSPTVCMHCEDPLAPCAQVCPAQAILVSPDGVVHQADETRCIYCRNCGYAC
                     PFGVPKFDIRGHFMRKCNLCYDRTSQGKGPMCATVCPTQAIFYGTYEEWLAAGRGAQG
                     AKPVNRFYFGRQRVRTRNYVVLTEEDEALDLLALLDEASLGLGQEVPAATASRNATDW
                     VDARMAGIPEWEAPAQPWTPREPVPAPVSVSQASH"
     CDS             complement(443237..445549)
                     /codon_start=1
                     /gene="nasA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223026.1"
                     /locus_tag="KTA_03730"
                     /product="molybdopterin oxidoreductase"
                     /protein_id="BBH92174.1"
                     /transl_table=11
                     /translation="MSVDKSVFRRQQRQQETFDFHSATQVPTAWETSVEVERYVPTHC
                     CFCGVQCGMYLKVANGQVVGVEPREDFPLNHGMLCPKGTNAYQLVHHPDRLTQPLMRK
                     RGKDSPLEPVSWDEAFDTIVQRFREVQRAYGKDAVAVFSGSTMTNEKCYLMGKFARVA
                     LGTRHIDYNGRLCMSSATGANERALGIDRAANPISDMLHADCIFVIGANVGECFPIIT
                     SYLWQARDRGCKLIVADPRQTPIARTADLFLPLRPGTDLALLNGMLHVLIKEGLINEA
                     FIRERTVSWEEVRALAEQYPPERVARVCGLRPEAIVEAARLYGQARAALIYTARGLEH
                     QSKGVANGLAAINLALATGNFGRPGAGYSTLTGQGNGQGGREVGQKATQLPGCREIED
                     PEDRAYICSVWGIREEELPHAGYPATLMIPAMLRGEIRACLLICSNPLVSLPDLHTAE
                     RAWRSLDFFVVIDPFLSETAELADVVLPGNLWAEEEGTTTSLEGRVIKYNQAVEPPAG
                     RQDWQMICELARRLGKGQYFAYRSPRDIFDELRLCTRGAKSDYWGITYEKIEEQGGVF
                     WPCPSEEHPGTPRLYEERFGFPDGRARFHAVPYIPPAEEPDETYPFVLTTGRVIYHYL
                     SGNQTRRIPFLREMAPYPWVELHEQVAQRLGIADGDWVTVRTRRGELTAPALVVRTIR
                     PDTLFIPYHYGRSQAANQLTNPVLEPMMKIPEYKVCAAALERAPEPPEWARSIDQEQL
                     VQARQRRRELPAAGRRPVPQPRSLIASEQA"
     CDS             complement(445615..446757)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03740"
                     /product="hypothetical protein"
                     /protein_id="BBH92175.1"
                     /transl_table=11
                     /translation="MSQAATQQQHLPEPAHPQTTVTRPRFRLGLRTRCILYGVLAAAV
                     LTGLIALGSRGFHWFDAALIGYVVATIFAVAAVTYKYSFWLARPPTGRYWRRSWRLFF
                     SYENFRRYTSLIPLAILDLFSQQFIRRRGLYRWIMHQCIFWGVLLSCCITFPLTFGWI
                     RMTLTPAGEHLLWFFGFPLFAFRPESILGFLIYHALDITALLLLVGLVLAFHRRFHDL
                     ALISIQRFGFDIVPLALLLAIVVSGLALTADSTWLGGAYYWYLSLAHEVFVVLWLISL
                     PFGKFFHLIERPATVGIELYWKTGEGTAMQRCARCGEEFAPARFIADLKKTLLEVGED
                     YTLRQDSSTTRPEQAMWWQDLCPACKRVARGQATLTALDPEGNRFL"
     CDS             447190..448215
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258386.1"
                     /locus_tag="KTA_03750"
                     /product="universal stress protein UspA"
                     /protein_id="BBH92176.1"
                     /transl_table=11
                     /translation="MFQRILVPLDGSQRAERALPLAARLARASRGSLILARIVQPGTA
                     LLWAPSALDPATMRAWLESATEAAEAYLQRVAALPVLRDVPTEKIVRSGLPADQLLRL
                     VPEVSADLLVLCSHGYRGLQRWALGSVALKLIRHASIPVLVLRSHGEMLAGPQPGYER
                     PFRAVVPLDGSVHAKAALEPAAVLVHALATSTPAALHLLAVVEVDEEAEDEAARRDRE
                     RRQARARRYLAHTVEQLRAGLVAPKVAGLQLELTWSVHVGSDVAQTILDVVEHGQDRA
                     GEHLPGGCDLLAMSTHGREGLNRWLLGSVTERVLERTRLPLLVVRPQGIEETPRTPWG
                     TLQDDLD"
     CDS             complement(448379..451153)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011141077.1"
                     /locus_tag="KTA_03760"
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="BBH92177.1"
                     /transl_table=11
                     /translation="MPQPQPAPGGSAAQKGQPTTLFDLPFSHPLRVFFAPRSIAVIGA
                     TERPGSVGRAVLTNLTTAAFGGSVFPVNLHRSSVLGIRAYPRVTDLPEPVELAVIATP
                     AETVPAVIADCVAAGVKGAIILSAGFRERGPAGQALERQVLEEARRGGLRLLGPNCLG
                     LMNPRIGLNATFASGMALPGRMAFLSQSGALCSAILDWSLQERIGFSAFVSVGSMLDL
                     GWGELLDYLGDDPHTGCILLYLETVGDARTFLSAARAVARRKPVILLKGGQTPEALQA
                     AVSHTEALAVRQEVFEAACSRCGLLLVESIDELFAMAEVLARQPRPQGPHFTIVTNAG
                     GAGVLAADALAKAGGTLTPLSPETRAALDALLPPYWSRQNPVDILGDAGPERYAQAIA
                     ILSREPASDGLLVILTPQAMSDPTRTAEQVVEAVAGSTRPVLASWMGGSSVAAGHEIL
                     TRAGIPTFASPDTAARAFCAMWRVSKHLQSLYETPSVVDDPEESANRRAQVAGWLTAA
                     RRAGHTLLSEPEAKAVLQAYGIPTVEARIALTEDEAVQQAEQLGYPVVLKLLSPTITH
                     KSRIGGVRLALRTAEEVRQAYRAIAEAAERQAGAGQMQGVTVQPMIAWEGYELIVGSF
                     CDPQFGPVLLFGSGGRLVEVQRDTALALPPLTTTLARRLLERTRIFPALQRGAAGLPA
                     TDLAALERLLVRFSLLIVEQPLIRECDINPVLAAGDHLLALDARIVLHEVDVPETALP
                     RPAIRPYPSHYIGSWQLPDGTPVMIRPIRPEDEPLMVRFHERLSERSVYLRWLHVLGL
                     SQRIAHERLVDRCFIDYDRELALVAVAREEPSGARAETLLGIGRLIKLPGREEAEFAL
                     LIADQVQGQGLGTELLRRLIEIARQEGLQRLQGRILPENQAMLRICRKLGFQLTYSPE
                     EQLMQATYLL"
     CDS             451483..451755
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03770"
                     /product="hypothetical protein"
                     /protein_id="BBH92178.1"
                     /transl_table=11
                     /translation="MMWGFGCGGMLWMWLGAILWLIVLAALAWALFHLARGKGRLSEG
                     QSYSHPSGPNRTPLQILQERYARGEIDAVTFDDMLARLRASEESRQ"
     CDS             complement(451907..454510)
                     /codon_start=1
                     /gene="mgt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010948085.1"
                     /locus_tag="KTA_03780"
                     /product="magnesium-translocating P-type ATPase"
                     /protein_id="BBH92179.1"
                     /transl_table=11
                     /translation="MPGLPPPSPGELTTTTTAAVSPRYSQSLSQLLTEVRSSEQGLTE
                     EEARRRLRQFGPNEVAAERTSSGVVQLVRLFLNPLVAVLLLASLVSALLGELTNALII
                     AIIVLLSLVLNFLQSYRSQRAVERLRSSVAPVAHVLRDGRWQDLPRRLLVPGDVIRLA
                     AGDLVPADARLIEALDLHVQQAALTGESLPVAKRAEETATTLAHPAEASNWVFLGTSV
                     VSGSALALVIATGPRTAFGDVAIRLAQHPPETEFERGLRHFSFLILETVFFLTLFVFL
                     TGVLLHHPLFESVLFALALAVGLTPEFLPMIVTITLGQGAVRMARHKVIVKHLEAIQN
                     FGSIDILCTDKTGTLTRGEMTLQEACDLRGQASERTHFFAYLNSALQTGFNSPLDQAI
                     QRSGAFSLATYRKCGEIPFDFERRRLSVIVEQTTTGKRLLIVKGAPEHILPLCTSCEL
                     DGVAQPLTAALQGEAEALHQRFSQEGLRVLAVAYRELPQQERYSQTDEQGLTLLGLLT
                     FVDPPQAGVAEAIAALARDGVQVKIVTGDNELVARHICRQVGLEPARVLVGSQLERMS
                     DAALLGAVEHVTLFARVSPAQKSRILLALKRRGHVVGFLGDGINDAPSLHAADVGISV
                     AGAVDIAREAASILLLEQSLQVLHAGILEGRKAFGNVMKYLLMGTSSNFGNVFSMAGA
                     FLLLPFLPMLPAQILLNNFLYDLAQVTIPTDRVDASLMLKPQRWNIGLIRSFMLLVGP
                     ISSLYDFLTFFVMLAVFHASEALFHTGWFIESLATQTLVIFVIRTAGHPLRSRPSLPL
                     TLTTLAVVGCGLLLPWTPLAAPLGFVPLPAGYFLFLAVATLTYLALVELVKGRLLPTG
                     QPTGQPGQAQP"
     CDS             454887..456881
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03790"
                     /product="hypothetical protein"
                     /protein_id="BBH92180.1"
                     /transl_table=11
                     /translation="MTSVPPIPARSAAVPPPPRFSFQALGELSRHYPLPSAALLLLLV
                     ALLCWLSKRADLARWVLLVITVMGGIPLSWQTLRQLSRRELSVDLIAILAIIGALLAG
                     EYLAGAFVVLMLSGGEALEAYALRQARRSLSALAERAPRISHIWRGQELVDLPAEDIE
                     VGMVVVVKPGELVPVDGEVVAGSSYVSEADLTGEPLPQPKAVGAAVLSGSLNLDSPLE
                     VRATRRSLESKYAQIVRLVAAAQEQKAPLHRLADRYSVLFTAVSLSLAALTWLLTGSG
                     ITALAVLVVATPCPLILATPIAIMSGIDRAARAGLIVKSGATVEALGEVQVAVFDKTG
                     TLTLGVPSVSRLWRAPASEVPAEAPLLDDATLLRLAASVEQLSSHILARAVVESARAQ
                     GLVPGLTEQFQEVFGKGVAGRVRLTVAPEEPAYEVIVGNRTFLRQRGIPLPPVLLQAR
                     EEWTAAGQIASFLVVNGYCLALIVLEDRPRADLAQLMADLKQAGIEETVLLTGDGEEV
                     AQRIRALAGMDRAVARCLPEEKVQVIRDYLNKGRKVLMVGDGVNDAPALATATVGIAM
                     GQQGLTAAASVADAVLLSEDVRRIATAVQLGRGVMSIARQGIWVGMGLSATAMLLAAF
                     GWIPPAVGAILQEGIDVLVIFNALRVSRIPLETGQGRRVL"
     CDS             457183..458967
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010942078.1"
                     /locus_tag="KTA_03800"
                     /product="kinase"
                     /protein_id="BBH92181.1"
                     /transl_table=11
                     /translation="MPAPSVMRAAEAMITTILAGKVPAPAAGTQPQSTSAASAPQLVQ
                     THASVVVLLPDLVYKLKKPVNLGFLDYSTPMLRRQWCREEVLVNAPLAPGVYLGVAPI
                     VCTQREEMHIGPIFSPESVPEPASSLEDGTVVDYAVVMRHLPETATLAGWLQSGRLSA
                     AMLEAVARRLAAFHAEAHADGEVRHYGQPELLAFNWQETLTQLQPYLGRTLDQSTYEQ
                     IQRYVEQFLAQRRALLLARIAQGRIRDGHGDLRLQHIYWLESPLKDSQQEPQLLFLDR
                     IEFNTRFRYADVAAEVAFLAMELEYSARVDLADAFVDAYVRATGDENLREVLPFYLCY
                     RACVRGKVASLLLDEPEVPLEERNQAQQQASALFALAAHYASRPAGATLVMIGGLMGT
                     GKSTLARALQQTTGAALFSSDVIRKRLAGLAPGETRAEAFGEGIYAPAWGTRTYQALH
                     ALASLALQEGRSVILDASFLRREDRQIMAQAAATQGIPTFFIECFCPREEALARLRYR
                     WSQRQRVATPGSSSSSEASLQSSTVEASDGRPDLYDAQCAQWQPCLPATEKIMGVPLR
                     TDRPLPVLLAQLLDILGQPRLACRLVQP"
     CDS             complement(459094..459435)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03810"
                     /product="hypothetical protein"
                     /protein_id="BBH92182.1"
                     /transl_table=11
                     /translation="MAQAGKELERLWRRSAGTVRSLALTWSVTVDPDTVHAIGQAAHL
                     DKLFPEQDGTGIPDLLLLSAWGSNEAHQRQLGSVAERLIQLARLPILFIPILALRQIL
                     HGAAQPPTIGQ"
     CDS             459709..460197
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03820"
                     /product="hypothetical protein"
                     /protein_id="BBH92183.1"
                     /transl_table=11
                     /translation="MAQQLGGDTTHRPGMGAMTGPHQQVGLSCLNLTQAGRSRFPGPG
                     PCLHRQVCKGRGVGLLLKVRLRLRDGGKRGSLQHLVTAEKHRPALGLQIDGLEQQNAS
                     AGRRSQVRCDVDGLLNAPRAIERNENTLKHDLFLPILAVIFPRSGGSRRSFDLSSLSF
                     IA"
     CDS             460469..460954
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012546540.1"
                     /locus_tag="KTA_03830"
                     /product="peroxiredoxin"
                     /protein_id="BBH92184.1"
                     /transl_table=11
                     /translation="MAERMTAQVRLVEGLSFEAEAGSGHHLRLDTGPEHGGHDAGFRP
                     MELLLIGLAGCSGMDVLSILRKQRQQVISYEIIVEGIRSATHPKVFREIRVEHLLTGR
                     QLQAEAVARALDLSIQRYCGAEAMLNKVARITHTFRLLDVDTGREVAAEAAADKNTTA
                     Q"
     CDS             461035..461451
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_052846667.1"
                     /locus_tag="KTA_03840"
                     /product="peroxiredoxin"
                     /protein_id="BBH92185.1"
                     /transl_table=11
                     /translation="MANRMSLIVFSGTADKLMAVATLTSGAVAMGLEVELFLTTWGLQ
                     AFRKGAAEANVSVSKDAGDLGPVLLEQMHKKQVPGWLETLQQARELGQVHVYACAMTL
                     ELLDMKLEDLEPIVEEVVGVASFIERASESRITLFI"
     CDS             461559..461810
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256473.1"
                     /locus_tag="KTA_03850"
                     /product="preprotein translocase subunit TatB"
                     /protein_id="BBH92186.1"
                     /transl_table=11
                     /translation="MPEKPEGIQVDKEIDARGSFCPGPLMELIRGIRAIPVEGTLALL
                     SSDPGSARDVPAWVQKAGHELLGAFPEQGYTRFVVRRKR"
     CDS             461841..463034
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012256474.1"
                     /locus_tag="KTA_03860"
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="BBH92187.1"
                     /transl_table=11
                     /translation="MPRQIIIIGGGVGGTITANMLARQLRPHEAEITLIDSTGRHVYM
                     PFWLYMPFSDSDPQSHLLVRDERTLLHQRVHLLIGQVQQIDVANHQVHVYQSSALEPA
                     RGKRESILVYDDLVLATGARLALADLPGLEEGQGVWHHFYDTEGALRLRQALSTFPGG
                     RIVIAVAGIPYRCPPAPLEFTFLLDDWLRQHCLREHTVIEYLYPLPRVFTIERVAEMV
                     APLLEEREIATRVFFTPEAVDQQRRVIRSLEGEEVPFDLLILVPPHRGAQVIEASGLG
                     DSQGWIPTDRHTLQVKGQEHVYALGDATDLPVPKSGSAAHFEARVLARRLVAAIRGEA
                     LEGDEGLYDGEVMCFLETGNRRATQLVFNYEHPPEPPRPSLFYHLEKQLLNHAYWHLI
                     PQGLI"
     CDS             complement(463149..464219)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258386.1"
                     /locus_tag="KTA_03870"
                     /product="universal stress protein UspA"
                     /protein_id="BBH92188.1"
                     /transl_table=11
                     /translation="MFRRMLVPLDGTAAAERALLIAAHLARAAQGSVTVLRVIEWPPP
                     GVLADSSTLFDPSSSLAEHEITRATRYLNETVQNYAQALEHLPVEQEVAFGPPASTVF
                     SAARLEQADLIVLCTHAASRLKRWLVGSMAQQAVRRSPVPLLVFHEQGPLLPFPRPGR
                     PLRLLLPLDGSLTAEAVLKPALQLLALLAPPELSLVQLVSVIDVPGYGTLGGLRIPDP
                     GLREQLQEEAKSYLEGVMQRVRQEQLADPAVTITSTVITGSNVPGVILKHAAAEDAQD
                     PAQHFDLIALATHGRSGLARLLLGSVTEQLLTSSKLPLFIVRPGMLRESDGAQEESAG
                     QAGEHKPPAADESGVAGWTGLL"
     CDS             464649..465812
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011404253.1"
                     /locus_tag="KTA_03880"
                     /product="hypothetical protein"
                     /protein_id="BBH92189.1"
                     /transl_table=11
                     /translation="MQQNRYYQEIKAVLASEEAPCLSLYLPTPSKGQGYYLGPRLLKR
                     LLHEARERLAQSRLSLATQRSLLAPIEALPAEVSLWNTVAPGLAVFRSATLYRIYHLS
                     YAPRPQVVVGAHFFIKPLLPLLSHNKHFYLLVLSRKHVRLLVCHPFGQQEVPLPESIT
                     SPPGSWRERWSRAHALQYHSGSPLTHHGRRGAVLYHGQGAGEQEQQADELRYIRQIDH
                     AVHALLRSQQAPLVLAAVSSLQALYRRVNTYPFLLKEGLEGNFDEMSAALLRQRAWPL
                     VFSSLQQAQQEALARLREREGSGQTSADLDEIARAACSGRVQLLFIAEEATLWGRLDP
                     VAQTIDVHAEAQPGDEDLVDRLAAQTILHDGLVSVVAPVHMPTPGPLAAIFRY"
     CDS             complement(466018..466806)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03890"
                     /product="hypothetical protein"
                     /protein_id="BBH92190.1"
                     /transl_table=11
                     /translation="MCKRETEDSRSLRELQDKLVRLGILTGERLTRALKAVELFDPAL
                     AQTVLPADPTIANLQATIEDEVRVFLLEAEEMGDSTLRFLVSLPVLGSELLLLSEEAQ
                     ELARLVVWLGSSAAQAGQANGEARQWPPTLAGLGEQLMSFGRQISASAMAVALALAEQ
                     DTQGAQRLWRQQRRLQHELTRLQRSLLLTMPAGTLPSAGTRAPAQPWVAYLSALALLL
                     KRVSFHAATLCERLIFMVEGVRSMRMLQHLEARLLVDRCHEPAQ"
     CDS             467328..468380
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_048065256.1"
                     /locus_tag="KTA_03900"
                     /product="NAD(P)-dependent alcohol dehydrogenase"
                     /protein_id="BBH92191.1"
                     /transl_table=11
                     /translation="MKAFVMKTIGQVGFMEKPVPEPGPNDAVVRTTRALICTSDSHTV
                     RGAIGPRTNLTLGHEAVGIVHTVGSQVRQFRPGDRVVVGAITPDWGDLASQAGHPSQS
                     GGPLGGWKFSNTKDGVFAEYFHVNEADANMALIPPDVSDEMAVYCADMLSTGFMGAEQ
                     GRIPLGGTVAVFGQGPVGLMATAGARLLGAGLIIAVEAVPRRQELARLYGADVIVDFS
                     REDVVKRILELTAGQGVDTAIEALGSDVTFQNAVKVTKAGGTISNIGYHGHGEFVHIP
                     RLDWGVGMAEKTITTGLCPGGRLRLERLLRLLQQKRVDPTPLTTHTFPFEEMERAFEM
                     MDQKLDGIIKPLIVFA"
     CDS             468904..469083
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03910"
                     /product="hypothetical protein"
                     /protein_id="BBH92192.1"
                     /transl_table=11
                     /translation="MMPLKSNQPIRSSVLIGREQESALLGARIERVKQGHGQMPLLSG
                     EARIGKSRLLAEGKR"
     CDS             complement(469221..469844)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03920"
                     /product="hypothetical protein"
                     /protein_id="BBH92193.1"
                     /transl_table=11
                     /translation="MSEHPDPASPQEASPSPAPAGPSTARSDEAALPLQDQPQLQPST
                     SAAPVAQPGPDMAPEPAPAQTPESDWFSWEDDPADDGSFFLPFQRSGPLAAPTILDAA
                     PDPTRDGQMSPSQAANTARCQAGAGLALVLATSPGPAGADLVVSLIIGGMVLPLLLQY
                     TARRQPGNLIGPVRAARIGNVRRMPPLLSVSLQEARERRHCSWQMRA"
     CDS             complement(470869..471201)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03930"
                     /product="hypothetical protein"
                     /protein_id="BBH92194.1"
                     /transl_table=11
                     /translation="MRVMRIKRPSYDAIIAGRKTLEVRVGYDHIKRYQVGETIRLETS
                     GDAAIIRIKAIRRYKNFEDMLAAEDWQKIDPDSSDVNTALHCIREIYPPEKEALGVYV
                     FEVEPVTD"
     CDS             complement(471226..471666)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03940"
                     /product="hypothetical protein"
                     /protein_id="BBH92195.1"
                     /transl_table=11
                     /translation="MGNEGASFCWPAIQAQDLWLSRHRSVLFPADKWWAVTADAVPQA
                     KGGMHKQATREATLYYNEDRFAFFFLGRHADPCTRKPGLSTSATTTGSEPTPLLPILV
                     VLTAETAKDPDPALVQTVGHETTTILCLCQEDLTLRLGDGGQEK"
     CDS             472020..472229
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03950"
                     /product="hypothetical protein"
                     /protein_id="BBH92196.1"
                     /transl_table=11
                     /translation="MQVQRDLLAAPFTPPDADVLTEQAMSRLMGMSALSTKANSQFVY
                     KSTASAYAISSSRISDSVSDGHRHG"
     CDS             472222..472728
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03960"
                     /product="hypothetical protein"
                     /protein_id="BBH92197.1"
                     /transl_table=11
                     /translation="MDERQARLLFGQHLRALRQQRLLTQEQLAERIEKTPEYISLLER
                     GERAPSFDALLLLAQALELPLPALLAFTGQPLSSSLPSPAASLETSLPLPEPAAGSPA
                     KAPAHRQRDLTRFLRAYEQIQDLQELAREYGINDVFQDNGGKVLQMLIILGLRILSGR
                     EGNDAIDA"
     CDS             472744..473082
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03970"
                     /product="hypothetical protein"
                     /protein_id="BBH92198.1"
                     /transl_table=11
                     /translation="MKTVNLALHRNRGVTTHHHLTEEIIDKYQSVYAWYIGLYKDIEL
                     QSVWKVPPHLLEPLFLEWRKRIRQQGGRPLNNPKIPLRYVFQGTCVYRQVTDDRQPLF
                     SGLEPPDGWT"
     CDS             complement(473079..474080)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q64YN8"
                     /locus_tag="KTA_03980"
                     /product="methyltransferase"
                     /protein_id="BBH92199.1"
                     /transl_table=11
                     /translation="MIRKAPRYITRYGAAYLGDALALLDELETDSVDLVVTSPPFALQ
                     REKAYGNVDQHAYVDWLLAFCRKVFRVLAPHGSFVLDLGGAYQRRRPVRSLYPYEVLL
                     RLCRELEFRLAEEFFWYNPAKLPSPIEWVNKQKIRVKDAVNHIWWLAKDDFPKADVRR
                     VLVPYSSRMRKLQADPEKFYTPALRPSGHEIGERFATDNGGAIPSNLLHIPNTESSSL
                     YLQRCKALGISPHPARFPVKLPLFFIQFLTEPGDVVLDIFAGSNTTGFAAECLRRRWI
                     AFELEPQYLAASALRFLPRDVPEDEVATLYQRLLHTEQGSTIVLPHPEVEQAPLFDV"
     CDS             complement(474974..475246)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_03990"
                     /product="hypothetical protein"
                     /protein_id="BBH92200.1"
                     /transl_table=11
                     /translation="MGATLPTAGILLPKRHWPSFLPRVLCLRFSGSHLPGGRCQRLQE
                     AWELWRRWQPRLEWDRFEADEQGQRLWAETAGGWLIAQAASWEETE"
     repeat_region   475539..476313
                     /inference="COORDINATES:alignment:CRT:1.2"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_seq="gtcagaagacgcgaagccgcccgtctgggattgaaac"
     CDS             477284..477541
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04000"
                     /product="hypothetical protein"
                     /protein_id="BBH92201.1"
                     /transl_table=11
                     /translation="MLHCWQPLGGPTGQVWIVVLEEELAHQGQVLLQAAGFGERVQVI
                     ATDGWQGHAPAAPMSTSSLPPVPPGCPVDGMTSSPLEDGGR"
     CDS             477538..477846
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04010"
                     /product="hypothetical protein"
                     /protein_id="BBH92202.1"
                     /transl_table=11
                     /translation="MNWQGPLQLHQSGLLVLEKLVRPDRGGMEAVGMFWQPPLSFMPL
                     QAPILAVLPTSKPSSRLPAGSLRTGTRVWRLPGSHPLPRLLEEPACAWFLQGHCPGIQ
                     "
     CDS             478052..478177
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04020"
                     /product="hypothetical protein"
                     /protein_id="BBH92203.1"
                     /transl_table=11
                     /translation="MGRPSQQAYRVKDTAAGTALRLQTADTAVTILPDLFAKAPS"
     CDS             complement(478956..479150)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04030"
                     /product="hypothetical protein"
                     /protein_id="BBH92204.1"
                     /transl_table=11
                     /translation="MPFRLPKELDERNGLGGLHAVRHLTLGRLSFVSINEQLRQGGQV
                     RCASLAAHRALARWKERKSS"
     CDS             479915..480640
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04040"
                     /product="hypothetical protein"
                     /protein_id="BBH92205.1"
                     /transl_table=11
                     /translation="MQCCQCGREIPDPLPMCPICGVIIADKGPPTEAEPREGEAGAAT
                     VERLPAMSATMRAGESGTPMADVGPAQQLAASPGVALTQPATQQPSLDPMRGRIGSGI
                     ALLGSILAFISLLLPWIAVTSTSPDGTVTTTTDVGPLNLDAMGLLTGWAVLYILLVMA
                     LLLLNLAVFIQRARRMLAGAGIAQLAVSLTGLLLCGPVAIALQAVQPEEDLGGGWVGL
                     VGFITSLIGSIWILVDCLRAPKE"
     CDS             480730..481038
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04050"
                     /product="hypothetical protein"
                     /protein_id="BBH92206.1"
                     /transl_table=11
                     /translation="MERGWPGAAESGNPACRIAARLRCSRENQERLPLFPGQSGQTIL
                     DTHHSQLTTAAGRGCTMMPSDAFHPEAPESIYPIDPEQVAELDAMQQDRLLTASIGAW
                     "
     CDS             481079..481651
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04060"
                     /product="hypothetical protein"
                     /protein_id="BBH92207.1"
                     /transl_table=11
                     /translation="MPRLGLWPWRLGAGIGLCLSQVQIPGVDLSPQMIAQTREQTCSR
                     GLEMENAHFQVTDVLLPLAPADGSFELLSSRLLCSFLLPAAWPLRLSECRYLLKSGGV
                     IRLTEGEKPLATSGTLERISALGTQALRRAGQHFSPNGGHVGIPQCYPGWSPGGLSAG
                     LSVSGQVRVHGRWRPKAMTLPSRSTLSCWS"
     repeat_region   482455..482937
                     /inference="COORDINATES:alignment:CRT:1.2"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_seq="gtcagaagaggcgaagccgcccatctgggatggaaac"
     CDS             complement(483138..483455)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04070"
                     /product="hypothetical protein"
                     /protein_id="BBH92208.1"
                     /transl_table=11
                     /translation="MMTTHRQGERSRHIRLLGEDGFTSVSLSEHVPLGPRAAVKRLKH
                     RLNPDDLAAFRREAQLLTRLSSPHLHILHALDNDEAGQPLLGGETRGRSGGVSCLCQA
                     HPR"
     CDS             484771..485184
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04080"
                     /product="hypothetical protein"
                     /protein_id="BBH92209.1"
                     /transl_table=11
                     /translation="MMSTLTVSIVGPQSAAAGAHGVDSSRLIARVTLHVQRKQVELLL
                     YDQRYREELIECFTPGCMFTAGVVTPEGYALDALKVIYPWESAFIDVLQERLLLLGLR
                     CVPEHKLPLLSWLSRWRRQDGLGDRVRLTEQDLGG"
     CDS             complement(485193..487229)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04090"
                     /product="hypothetical protein"
                     /protein_id="BBH92210.1"
                     /transl_table=11
                     /translation="MRDQLGKQVGRYRLIRLVGEGGFAVVYLGEHVVLGTQAAVKLLK
                     SRLEPDDLATFRREAQLMARLSSNHPHILPVLDYDDEGGQPFLVMEYASGGTLRQRHP
                     SGIRVPLETVVAYVRQVASALQYAHEQVPPVVHRDVKPQNMLVGRQGEILLSDFGIAL
                     IVTQYVHPRAVVGTAAYMAPEQFRGEVHRASDQYALGVVVYEWLTGKRPFPGPDFVAY
                     GYQHVHQPPPPLREQVPELPVAVEEVVMRALAKDWRQRYGSVREFAQALEQAAELSPA
                     RATWAPTLTNTQPALSRRSAEPKTGTLLHVLRGHAGEVKAVVWSPDGRRLATADEHGT
                     VRLWDGASGQELAVLPGRKPRWSPDGRRLATAGDKDGTAHLWDGATGQELAILADQMG
                     AVQEVAWSADGTRLVTSSEGLLVRLWNGASGQQLALIHGSSPRWSPAGRRLAIRGYQP
                     GTVLLVDGTYGRELAVLQGHRGMVTAIVWSPDGTRLVTVGFERTARLWDGSSGQELAI
                     LQGQGQDFSSLSLEDICWSPDGTRLVSWGEFGPVRLWDGSSGQELAILLRPDIPLREV
                     VWSPNGERLITNDETGRVALWDGSSGRELAILLQPGALQQVAWSPDGKLLATGDAGGT
                     VRLWDGSSGQELAILRNHSGAVWAIAWSPDGRCLASAGEDRLVCLWRVKPGQRS"
     CDS             complement(487325..487642)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04100"
                     /product="hypothetical protein"
                     /protein_id="BBH92211.1"
                     /transl_table=11
                     /translation="MASGGPQLAPCDWGEPIPGPAEALPLPAGARSFHQFNPATRAGH
                     AHPFPDDDREGQALRDANADEDAGGRERDEPVISGQTETGSQPAASAQLPLAETSRLT
                     TTA"
     CDS             488028..488240
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04110"
                     /product="hypothetical protein"
                     /protein_id="BBH92212.1"
                     /transl_table=11
                     /translation="MGKRISCPNCQGTGFTADVMCPRCQGTGHVELLDDWGQRRTVTC
                     FRCLGTGLVKEGDTCKMGGSSGEVEG"
     CDS             488242..488880
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04120"
                     /product="hypothetical protein"
                     /protein_id="BBH92213.1"
                     /transl_table=11
                     /translation="MSVLLTLDWAGASWQEACAAFAQQTDALGTPIDPGIFETVVLLN
                     LLGFPTVQSCEGHLDHGTPYPWVTVVDRALHRRYLQQWQQVCQLQEQAHQSGDPAALD
                     GYYRALAELQLAQAQWNLEETLRARLMELLDAFYDQQPCRCPATRLLVQRHHPGLYRI
                     RPVYAVDPPPEALRASYLERGQEEMRAWTRALRQRWERQRAERAASAQRAVP"
     CDS             488995..489621
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04130"
                     /product="hypothetical protein"
                     /protein_id="BBH92214.1"
                     /transl_table=11
                     /translation="MGSGIGAVEMHALFPHALVVGGDVSLASLPQPVPPTCVFVRANV
                     LEGLPFPDGQFTSTHQRLLVAAIPAHAWPGVVQELVRVTRPGGWIELVEASDVFQPAG
                     PATRRLLDWFAGISRLREAVPVTTRLLASASASSSASHLVDGEAPSDRMAGRAWATAC
                     QRIEAPGAAVFQRGRASQSAASGSSAPGIFLFLCGPILQTRFSFPSTL"
     CDS             489828..490445
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_001702830.1"
                     /locus_tag="KTA_04140"
                     /product="metal-dependent phosphohydrolase, HD subdomain
                     protein"
                     /protein_id="BBH92215.1"
                     /transl_table=11
                     /translation="MAESLSLSEKDALALPNQALLASFARLAEALLSPLGARWLHVQG
                     VARVALRISSLLAPDDAWHLIAAAYLHDVGYAPALWHTGFHPVDGALFLRQQGYERLA
                     CLVAHHSEARFEARLRGLEDLLLRFPRERSVVADALTFCDLTTSPLGTRVSLQERARE
                     VTLRYGPDHIVTQALRQALPTKALAIARTRRWLRCHGLDPDRFTD"
     CDS             complement(490694..490906)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04150"
                     /product="hypothetical protein"
                     /protein_id="BBH92216.1"
                     /transl_table=11
                     /translation="MPIDYYDDPAALKANTILPATWAIIEDEEGQIFLQQRQEDGLGS
                     LSGGVRELEESMTQALVQADKGGNGS"
     CDS             complement(490950..491135)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04160"
                     /product="hypothetical protein"
                     /protein_id="BBH92217.1"
                     /transl_table=11
                     /translation="MTLLHQAQGKPRLCMAASLMEEGAIAPAVRSANVFALTLQEFIA
                     DLFSQALVSGLLVEAIQ"
     CDS             491644..492855
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04170"
                     /product="hypothetical protein"
                     /protein_id="BBH92218.1"
                     /transl_table=11
                     /translation="MFRNDASAARERLLTPEPRLGFWGWWLDLVAPPRKPETTANPHL
                     REKLRKAELAGYFLFILTFFSFFDLLLALLNRRLLSIVEIFVFLGFLALVGRLNRDGH
                     SELAAGLVIGAMMLSIAYVIIFALADKGASDLLPTYDFFIYPIMIGSIFMPRKLIIPF
                     TLVEILFIWYNLLLGPHPREIIQVRGTPVMWLWLARPTLMLCITAIVSWLGSRSVEQA
                     ILRADHAEELIAAERLLSAQSRMLLQQQEQLKAEISQILIVHREAAAGNYSVRAPLNS
                     QGMIWQIAHSLNNLLARCQELARDHDELKRAREDVEKVSYYIEQLRQGKHLPLPICHS
                     ILGKRLVYALTTHTPPPRPSQPLSPERHSSGPIPRPNLRPSRVSFEALRDNKETPPSG
                     QKRPGTGPTQA"
     CDS             492970..494220
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010920174.1"
                     /locus_tag="KTA_04180"
                     /product="MFS transporter"
                     /protein_id="BBH92219.1"
                     /transl_table=11
                     /translation="MQRRQVTEQRPVSWLFGLTYLLANLTGNSVLLPVIIFLIPYQVN
                     LLDPTAHVTSLALVQSIGAIFALLSTPLAGAISDRTRAHFGKRRLWLFVHMLCACTAL
                     LLLRFAPTILLIVIGWSLLQFFGGALLTVLQAIIPDRVPLNQRGLISALVGLAIPLAA
                     VLGGLVIAVIFRKDYPAAYYPLIGGLAISIMLFLLVYRKEANVDQSPPPFHLKAFLAR
                     FWVDPRRHPDFSWAFITRLLLFLGYFAVATYIQYYIKDGIHYEQIFPGKKVLDGTLAV
                     QSIETLFILICSFGAGWLSDRLGRRKPIVIAAALLVMSALLTPAVLPTWNGVQLFAAL
                     LGAGYGAYLAVDTALITQVLPSAADYGRDLGLINLALSIPLILSPLLGGLLINSLGYS
                     SLFIAGAGMALLSAIMVLPIKSVR"
     CDS             494280..495092
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027099.1"
                     /locus_tag="KTA_04190"
                     /product="hypothetical protein"
                     /protein_id="BBH92220.1"
                     /transl_table=11
                     /translation="MPSSIDLSQPEQLLRAFVKTRASLIEEEVVCWWSGRVYSLVPGE
                     PSRFLFAIEGYNICRCRSIPGGYEQLSREMMVYQDPKQRSILERWVNPFTGEEVEVVP
                     VWNDPVNQRYLLEGPQGPFTLQVTPLEGGRLCLALDVLLAYPSPLPRALYPRYSQSDL
                     YQGAELFQFFVSQDDLENATLSSVPCEIAWTRIGPWLPWMAMADRPGWLLYQCRGCKL
                     QGGYAALPAALRSYVERHQPHYQHAPLEWSGPNESSWSYFKKKLLASQVSHL"
     CDS             complement(495762..496739)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010975228.1"
                     /locus_tag="KTA_04200"
                     /product="D-ribose ABC transporter substrate-binding
                     protein"
                     /protein_id="BBH92221.1"
                     /transl_table=11
                     /translation="MLRRMLSVLTVLLLVSLGLAACGSAGQSSSTSSSGSGGKKLIFI
                     ITPAYDNIFFKAEADAAKARAQALGYETVAVTHDDDVNKQNQLIDTAIARHAAAIILD
                     NAGADATVAAVRKAKNAGVPVFLIDREINATGIAVAQIVSNNYQGATLGAQEFVKLMG
                     EEGNYVELLGKQSDTNAAIRSRGYHDVIDQYPRMKMVAQQSANWDQTEAFQKMQTILQ
                     AHPDIKGVIAGNDTMALGAWAALQAAHKTNVIVVGFDGSPDVIASIKQGGIKATVLQP
                     AVRIAQLAVDEADKYIKTGSTGQPEKQSIDCILVTAQNADQFGVFGPKQ"
     CDS             complement(497164..498234)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013533059.1"
                     /locus_tag="KTA_04210"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92222.1"
                     /transl_table=11
                     /translation="MRNPSSVASREPAARRSFALQRRQIQTILFQLRAFVALIILVII
                     FSILSPDFLTLNDLTIVAEHVSINALLAIGQSFVILTAGIDLSVGSIVGLTAMVAGYL
                     ISQGLPLPMFGVVVYFNVWIVILVGLLVGIVLGLINGLVITRLSVAPFIATLGMLYAA
                     RGLALLTSNGATFPDLGGDPALGNTGFPFLGTGSLLGIPMPIWLMVIFGAVASFVASR
                     TPFGRQVYAIGGNERAAQLSGIRVNRVKLLVYVISGFCAAMTGLVIASQLQAAQPATG
                     ESYELNAIAAVVLGGTSLFGGRGTILGSIIGAFVIGVLSDGLVLIGVSEFWQMVIKGA
                     VIVLAVVIDQLQQRWQKRAIAA"
     CDS             complement(498256..499929)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013533058.1"
                     /locus_tag="KTA_04220"
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="BBH92223.1"
                     /transl_table=11
                     /translation="MKGADQEQEQTPDIVLRAEGMTKIYGGTVALDNVDFNVYRGKVN
                     VLIGENGAGKSTLMKIIAGAETATRGRLLLEGQPVHFKSPREAARAGIGIIYQELNLF
                     PNLSVAENILLDHEATTWHGLLVDRRRQQERARQLLQRLEQPIDPQAIVGTLRLGQQQ
                     VVEIAKALARDVRILIMDEPTSALTTAEVEVLFRVIRELKAQGVSIIYISHKLEELLR
                     IGDYVTVLRDSHRIAEAPVSAIDVNWIVEQMIGRSVGETYLHQEHQLGPELLRVEGLS
                     LPRPGGGLVLDNVSFQVRAGEIVALYGLLGAGRTELLECLMGLHPEATGSLWIAGRPV
                     RGRTVGERIAEGLVLVPEDRQREGLVPTLSVAQNMVLASLRRYLRGPALSRQKELRAV
                     RRLMHDLGIKAPSPQTLIEALSGGNQQKVVVARGLLTEPRVLLLDEPTRGIDIGAKAD
                     LFRLMNQLAREGLGILFVSSELREVMRVADRILVLARGRLTGEFRRGEVSEEALVAAA
                     SVGQGPGTTSEEEAGEAWAAGGALALGATDTSRATPASEERREQPRPRI"
     CDS             complement(499926..500570)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015888267.1"
                     /locus_tag="KTA_04230"
                     /product="hypothetical protein"
                     /protein_id="BBH92224.1"
                     /transl_table=11
                     /translation="MSGLAVIICLLLSACSLYTVRPLNATSGNAPGGGSSAQNFDPER
                     YVQQIWDSRVVPTVVQQAHDASEVLAALKANPQAAQQRYGHQEGDGPYTFMVKGIGRV
                     VSINTASRNGTLGLDLPPYDGKADLLLQIGPVILGTAIRDGVGFLHFSQFVNQIQYAQ
                     VADALNARAVQVAQSIHPTQLKGKLIQFYGVFALTDPQFILVAPVKLQVEGSSA"
     CDS             complement(500706..500987)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04240"
                     /product="hypothetical protein"
                     /protein_id="BBH92225.1"
                     /transl_table=11
                     /translation="MKGKGFLTSVSELVASQRKYISSKSLCQALMRLIPLDKGTRVSL
                     FFKGGCENLFISIYLFLAISWENLSPKASSSLGASQLSYSRSVSEEKEV"
     CDS             501027..502094
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012584055.1"
                     /locus_tag="KTA_04250"
                     /product="LacI family transcriptional regulator"
                     /protein_id="BBH92226.1"
                     /transl_table=11
                     /translation="MGDESKGRGNRMATIEDVAKRAGVSISTVSRVFNGTRFVNPTIA
                     ERVRAAAQELNYQPSRAARVLRGNRSKILGLLITNIQNPFFTALVRGVEDVAHERGYS
                     VILCNSDEDPHKERQYIEVLCAERVAGAILVPTREHQPAISLFHRHRIPVVAVDRRVK
                     DEEVDAVLVDNIRGAREAVLHLISNGYRRIGIITGPLSTTTGRERLEGYRRALEEAGL
                     PYEARLVRSGPFKESTGQVQTRELLALDKPPEALFLGNNLITMGALDVLQECGLRIPD
                     DIALVSFDDTPWAHLKTVSLTTVAQPVYELGSTAALRLFQHLQISPAGFLTRQEIILA
                     PYLCIRGSSQPRLTDASIVRK"
     CDS             complement(503260..504294)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010974941.1"
                     /locus_tag="KTA_04260"
                     /product="dehydrogenase"
                     /protein_id="BBH92227.1"
                     /transl_table=11
                     /translation="MVRIGLLGSGFVATFYMQGLVEVPGQQVVSVYGRTAQRVQEFAA
                     RWGIPHATTSMEEVAANPEVDVLFIALPNKLHLEAAQLAARHKKHVVCTKPLARNAQE
                     ARQMLEAVRQAGVLHGYAETEVFCPAVMRARALIEEGAIGRVLTVRSREAHAGPHAPH
                     FWNAEEAGGGALLDMGCHTIEAARYFIGKEVRPVEVLAWGATLYHTDKTTGEDNAVLL
                     LRFENGALAQSEISWTARGSLDLRNEIYGTEGSIFTDVTRSTPISAFVRSTSSYLLEK
                     AESNSGWIFPLPDEARVYGYHEEMKHFVECIARGEMPRETFEDGVIVNTIIDAAYRSI
                     REHRWISLEW"
     CDS             complement(504433..505188)
                     /codon_start=1
                     /gene="yvoA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:O34817"
                     /locus_tag="KTA_04270"
                     /product="HTH-type transcriptional repressor YvoA"
                     /protein_id="BBH92228.1"
                     /transl_table=11
                     /translation="MQEAAEEPLYRRITRILREEIERSRKPGDPIETEQELEKRFNVS
                     RITVRRAVEELVREGLLTRRRGSGTFVAQRRVVEELGTLKSWTEQMRELGLEPHTVDC
                     QILKVVPPSWVARALGLSEEQPELVLRVQRLRYASGEPLALMIDYLPVRYVPDLAEKG
                     LEGESLYETLEKRYGLRLAHVEDTVTAREATHLEANLLGIDPKAPVLYVKRVTYLENG
                     DPVDAANVISRADRYEYRMSGRLPGRRFSPSTY"
     CDS             505375..506340
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011140504.1"
                     /locus_tag="KTA_04280"
                     /product="sugar kinase"
                     /protein_id="BBH92229.1"
                     /transl_table=11
                     /translation="MREQEVAGKILCFGNLQLDVLCRTVTELPPPGQLRAIESIDLVL
                     SGNAGNVAMVLGRLGFSVELAGYSGADVVGEQLRAVLAENGVGTGKLLRHPCIGTGTS
                     VITLTPRGERSVIFVNGANACFDLSAVPDHWLDDLRVLYVGSIFVLPQFSGEAVGALC
                     ARARARGITTVLNICWDAEGRGLSFLEPALRETDYFILNYDEGQLLTSEKQPERIIER
                     LEACTAGSVVVTLGEQGCCLRQAGRWHHIPARPVQATDCTGAGDSFTAGFIAGLILGW
                     SPVACAHLGCYLASLAVTGPGVYTRIPSFEQIRGALQGVLDKSDH"
     CDS             506383..507654
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04290"
                     /product="hypothetical protein"
                     /protein_id="BBH92230.1"
                     /transl_table=11
                     /translation="MTEEQSYRYGGLQHVFNPGISVAEAAQRLRRFAYIEERMMRLFA
                     SRVVTIRERDIKVLLARLQYEEAMHADAWRERLAELRVNKHKLEQVPDEALAVLFDEA
                     EYLPGSYPFLLAVQQVLKSALVESYRTYLATTNGLADYPSVRILQHVLAEEEEHLRLL
                     ALTLDSLQPSEEEERLAASWQTTLRRYLEAAGGMDGSAPRSKPIARLHSANQTYHLPH
                     ELMRDETLPRVWDYVVPSPQETQAYLNYMMGLRLSEINVAEGLAIVLFETSGMPWSFY
                     RDISRHCWDEMRHSLFGEAAIESTYGRRDALPMRDYEGIFVMEASPLEQYAVLGLEVE
                     GGNMKYPPGKRYEWEFARDEARHPLMTTFQDFDWADEVLHVNIARRQLDTWFEGGLKA
                     IRPFAKRGREHRTQVKQRHEPVALPQPEPVS"
     CDS             507769..508899
                     /codon_start=1
                     /gene="rbsB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973784.1"
                     /locus_tag="KTA_04300"
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="BBH92231.1"
                     /transl_table=11
                     /translation="MLLSDWRDPARGTYHFVKLYFFLLLTLALCLMFTAACGGSGNIQ
                     SSGGNGAHHKPFTIGVSNGFVDSEWRTQMLQDMQTVNAEYKREGLTKDLVIESADVDV
                     QGQIQQIRNLINRGVDAIIIDPNSPTALNPVIEQAIQAGIVVVSVDQEVSAKGAVNVT
                     IDQREWARISMRWLAQKLNGKGNIVVINGIAGTPADTARYNGVKDVLSQYPGIKVLNV
                     VNANWDEATGQQKMAALLASQPNIDGVWSQDGMAQGALQAVIAANPPKWPIMVGEARA
                     GYLQLWAQVKRTHPTFSSIGVINPPGVGASGLRVAIDLLLGKHIRPGVLAGQAGNTIY
                     VPIPGEVTDANFASEYARVKDLPQAYTLDGYISQQQADSYFS"
     CDS             508926..510440
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973785.1"
                     /locus_tag="KTA_04310"
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="BBH92232.1"
                     /transl_table=11
                     /translation="MAITLSAKHVVKRYGGVVALRDGNLEVRSGEVMALVGANGSGKS
                     TLNKIITGVVAPDEGQLLLNGQMVRFPTPQAARRRGIVAVYQELSLVDNMTVEENIWL
                     AHEPLWPGGLVQRRAIRKRTQELLSLFQGTVSQRLQPETPVAALSPDEKQIVEILKAL
                     SLQPALMLLDEASASLDARQVGRLFELMTHWKQEGMALIFISHRMEEILRVADRITVL
                     RNGESVLEAYAGELSTDELVQAMVGQTVAERYIQRREQQALSKPCLVVEGLRTNGLHG
                     ISFTLHEGEILGLGGLRGQGQSEILLALFGAIPFEGRIFLAGKPVHFTHPHQAVKAGL
                     AFVPGERSTQGLLLIRSVLENLHLPSWARYGMLLRLGQARRDAARMADRLKLLMPSLD
                     AAVSSLSGGNAQKVVLGKWLLRQPRVLLLDDPTKGVDVGARAEFYQILAELREAGTAI
                     LLYSSEDDELLGLCDRVLVLHSGEVQAELAQASLTHAELVAASMGTTVREEASS"
     CDS             510437..511435
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006315532.1"
                     /locus_tag="KTA_04320"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92233.1"
                     /transl_table=11
                     /translation="MSVQAQQRSQTSLLRQWRRVILRQSYLFALLLLLMAVLVNALLQ
                     PNFFRPTVLNGNLQSFLPLILLASGQAVVIIGGGVDLSIGSIVSLVSVVTVHALGTNP
                     GAGQIALAFALGLAVGLLAGALNGFCVASLRFQPVVTTFATSSIFAGLALWIMPSAGG
                     SVPPDVMNLYLASPLGLPLTLWIVVLVLIAWNLLCSTRYGRYLYAVGGNALSAYVSGV
                     PVAVVQLSTYVIAGLMAALSAFTLVLSTGTGDPLIGGPMMLESIVAVVIGGTRLGGGQ
                     GGLTGAVFGVVILGLFLNIIAFANVPAWWQTLVNAAIMVLALAGSNLIPLLRRRAI"
     CDS             511432..512391
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011969744.1"
                     /locus_tag="KTA_04330"
                     /product="monosaccharide-transporting ATPase"
                     /protein_id="BBH92234.1"
                     /transl_table=11
                     /translation="MRAWLSTLRQRSELIAFALAVLLFIAGGLAHPGFASYGLAINIL
                     RLAAFLGIVAAGQTLVIIAGGEGIDLSVGSVVTLGAILVYHLSAGKDELAAPALLIAL
                     GAGALIGAVNGVGITLARIPPLVMTLGMSGVVQGMILAVTQGRLSGGTPPVVEVLVNA
                     PFWAGIPGVLLIWAVVGIAMWLLLTRTPYGKYLFAVGANRVAARLSGVRVPVLLVLTY
                     ALSGLLAALAGVVLLGYIQRVFLDLGSDYTLPSVAAVVVGGTVLSGGQGGYLGTMAGA
                     LLLTILSSLLTTLMLPESVREIVFGLLLLLLLSAYGRQHRLRR"
     CDS             complement(513023..513163)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04340"
                     /product="hypothetical protein"
                     /protein_id="BBH92235.1"
                     /transl_table=11
                     /translation="MGQRVLEVGTGTEYNAALLAWLTGEPQRMVTMEVVPDLAAQARQ
                     AL"
     CDS             complement(513646..515190)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010970040.1"
                     /locus_tag="KTA_04350"
                     /product="sugar kinase"
                     /protein_id="BBH92236.1"
                     /transl_table=11
                     /translation="MGDGRRKLEGKALLGIDLGTSAVKALVLEATSGRRLGEGRAAYP
                     LLTRQPGWAEGEPEEWWRQTVAAVRMALRRLEPDQVAAIGVTGQMHGIVPVDAAGNPV
                     RAALLWPDQRAVGQLARFEQLPVQLRERLANPFAPGMAGPLLCWLADEEPETFARMRW
                     ALQPKDWLRLRLTGTVFTEASDASATLLYDVPGDRWATEVMDSLGLRRELFAPLLPAG
                     AAAGYLQASAAKELGLKPGLPVATGAADVAASLLGAGLLAPGPLLLSLGSGAQFVLLC
                     QEPRPDPQWRTHLYRAADGRHWYRMAAVQNAGLALDWVRRTLQASWLELYASSESEVT
                     AVEPLFFLPCLTPERPYHPRPRAAGWLHLRLDHERDHLLRAALEGVAFGMRLALEALA
                     EGAEVKEQLLVVGGGGLHPGWRQMLADILGSELWAVAEKDTAVRGAALLAGLAAGCWE
                     DVTILETWRPPVLTVTAPGARRAAYQERYQRYRELLLSPAAAILEESKAFSARLHEDG
                     GRADQS"
     CDS             complement(515199..516074)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529342.1"
                     /locus_tag="KTA_04360"
                     /product="epimerase"
                     /protein_id="BBH92237.1"
                     /transl_table=11
                     /translation="MMRQKIGIHAFVWVGGWSQEECRQALESSRASGYDLIEIPLLEP
                     ATIDVALTRSLLAKTGLEATCTLALTPETDISSTDEEVVARGERLLCDALAVARDLGA
                     TYLGGVIFGALTRYREPLTPAGRLNSIRVLARLAEQAAASGIQLGLEVVNRYESNFLN
                     TAEQALALIEEIGAPNIVVHLDTYHMNIEEDNFVKPVMACGKRLGYVHVGESHRGYLG
                     TGTVDFPAFFRALKRAGYQGPVTFESFSRAQQIANLSGSLAIWRHTWTDRFDLARRAR
                     AFIAAGLEAADTHGD"
     CDS             complement(516098..516943)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530505.1"
                     /locus_tag="KTA_04370"
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="BBH92238.1"
                     /transl_table=11
                     /translation="MSPTEFEGVFSAPQIPERDAATATPSRPTVPDPAEVLLLVERVS
                     KHFGAIVALHEVTLWARRGEITAIVGDNGAGKSTLIKCISGLHPPSSGRLFFEGREVH
                     FASPQEARQAGIETVYQNLAVIEDLTVWQNIFLNRERVKRWGPLAVLDRRAMRREALQ
                     MLRQFEVHLPSIHARLRQLSGGQRQAIAIARAASWGSRLLIMDEPTAALGVRETRRVE
                     ELILRLREQGLAILLISHNFEQVLRLSQQVWVMRSGQVVGGRRTSETTSDELVAMITG
                     VKGNE"
     CDS             complement(516940..517932)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530506.1"
                     /locus_tag="KTA_04380"
                     /product="ABC transporter permease"
                     /protein_id="BBH92239.1"
                     /transl_table=11
                     /translation="MEQSNAPATAFSAQAERLSWRERFSDPEFWINWTAVIALAGLVI
                     IFGIAAPAFLSLGNIRAVLIAAALLVILTVGQTFVILTGGIDLSLASTMTWAGVVLGQ
                     VVVHGGPIGLACLLAITAGLLVGLINGLLIAWGRIPDFIATLGTLSAASGAALILSNG
                     EPVTIVSTFLLQLATGSLGPLPYFVLIALLVVLLGHFLLFYTRFGTHLLATGGDAEAA
                     RAMGIRTAGIKLAAYILAGGLAGLAAILFTARIGAAEPAVDTSYLLNSVAAVVLGGVS
                     LFGGRGTIAGPAAGALLLTVLVNGLTLLGLSQFYQPVVVGLAVVLAALLVRYWR"
     CDS             complement(518056..519081)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530507.1"
                     /locus_tag="KTA_04390"
                     /product="LacI family transcriptional regulator"
                     /protein_id="BBH92240.1"
                     /transl_table=11
                     /translation="MCRQSLMTKMSLILLAVLGVIITACGGASSGTGSSGSAQVAAVI
                     KGLDNPFFQAMQRGIQDEARTVGVSVTVQAAASITDTTGQADKLQALAGQNYGCYIVN
                     PISGTNLVQALAPVSQAGKPIINIDNPISAQAAQAAGIKISTYIGTDNISAGRQAASE
                     MAKLLPTGGKVALIGGIAGDVTSQQRLQGFSQGIPATIQIVQTVAADWDRQKALTAAG
                     DILRAHPDLKGFFVANDDMALGVVRAIADAGKQGQVKVVSVDGIQDALKSIQAGQLSA
                     TVSQYPYTIGAMGVEACKAALAGKTLPAKVTAPILVVTSDNVAQALASFPKPFSSYSD
                     PFQDLLK"
     CDS             519404..520696
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011031696.1"
                     /locus_tag="KTA_04400"
                     /product="sugar kinase"
                     /protein_id="BBH92241.1"
                     /transl_table=11
                     /translation="MKSPLEGNGASGSGAVLALFRTGQARTRADVIRLTGLARSTVTQ
                     RLERLLAAGLLVPDGASVSTGGRPPTQFKFNAARGVFLTADVGASHLRCALTDLAGTI
                     LAEEASELDVAVGPHPVLEQVTRTFLALLQRLRVPPQKVHGIGISVPGPVEFATGRVV
                     SPPIMTGWDGFDIPGYFLERFACPTLVDNDVNVMAFGEYKACWPEHPHMLMVKVGTGV
                     GCGIISNGQILRGAQGAAGDLGHIPYSGDLANRTTPPLCRCGNLGCVEAYAGGWALLR
                     DLRALGHQVHSTYEVVRLIRAGQQDAVHLARQAARVLGQAISDAVSLLNPSLVVLGGR
                     LAHADEPLLAGIREVVYRRSLPLATRDLQITTSRLDIHAGITGLALLLGEYLYAPELV
                     DLALDAEASPPPAGRYGPLSGKALHYTLRLLSQGAATP"
     CDS             520964..522904
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04410"
                     /product="hypothetical protein"
                     /protein_id="BBH92242.1"
                     /transl_table=11
                     /translation="MESTSCALETGPLFRVWLCGPLCLERRQAATYEPLPLSAWGGSA
                     YPRQLLKALLCCPRRQAHRERLLAWLWPDAAPDQAASALHTATTKLRKVLQPPGASSL
                     LESLSEGHGYRLPGQALLWVDAEEALQLLQQAEACQRTGDPLAVERLLEEAVRYWQRG
                     TFLEGEEGDWVLARRATHERACYRARWWLSEIYEQQGRWPEAEAVLTELWEEDPTDGE
                     VVARLVTVLLRQGRRQEARRCYRDWRHLLARTGDSLDEQSAQAIERVLHAAGLTESQP
                     SPSPRPASPLPGFLSGPNQGILDMKTLHWSTATDRQRRQLLQTTLEGLGLLALPGIGS
                     TSLFEEHVHSLSEELFQVLDSMLQKVWSLFYYHMASTNLQPIVQGLLQAGQLLLHQAH
                     SDLLRQRASAFLSGVCLLTGRIALDQTGASLAVHAYQEALSYARDAVSSPLESLVIAR
                     IGGDLHEQHPQMALSLLSEARHLYSSKSAQLDQKLQAWIALHEAEAYARLQQKQRCLT
                     ALDQAENLDLHEASDPFWTAVNPALLWGFKGACLLTLGEPALAAEALERAKQLAAPSR
                     RQQAIFSADLALARAYQGEIDMACAAGEEALLLLLEVRSSCVLTRLQRLLPVLSHWSG
                     EACVQRWWSTWREGAALLGHVG"
     CDS             522933..523727
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011035669.1"
                     /locus_tag="KTA_04420"
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="BBH92243.1"
                     /transl_table=11
                     /translation="MDLGLTGKGVLITGGSRGIGRACALTFAQEGAHVACCARGEPDL
                     RRTLEELRSYPIRAFGQVADVTRLDEVERFVQASVAALGRLDCVICNVGGSGGKGLLH
                     SRDEEWLATLDVNLLHAVRVIRAAIPALQQQSESAIVIISSISGRKPSPSVQYGTAKA
                     AEVFLSQALALELAPLRIRVNTICPGSILFAGGGWERFQARHPEAFARFAQEEFPFGR
                     LGTPEEVARVVVFVASPAASWINGAVIAVDGGQQQPSVFQRGPVWR"
     CDS             523742..524311
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04430"
                     /product="hypothetical protein"
                     /protein_id="BBH92244.1"
                     /transl_table=11
                     /translation="MDAQQRGVLYIISCASGAAEHVADLVRAAQAEGWTVCVIVTPQA
                     VKFVHRPLLEQLTGYPVRSEYKHPDEPDVLPRADAIVVFPATFNTINKWALGISDTLA
                     LGILCEYTGLHIPIVAVPCVRTHSGLDTHPAFPQSLERLRSYGVAVLYEPETYPPKNE
                     VPPSVILQRLDHLLAARNASSPSASSTQQ"
     CDS             525020..525394
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04440"
                     /product="hypothetical protein"
                     /protein_id="BBH92245.1"
                     /transl_table=11
                     /translation="MALLRRLFARRRPGVQAASAACAASQAAAGTAPEPGRPSVRQRH
                     YLEDVPYLLPKDPLEDQRLNYQHHALYRTLSNHYLAPLSPESTRTMLDVGTGTGIGAF
                     DRGAPGSASLPSCLSCTVTVYS"
     CDS             525480..527465
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04450"
                     /product="hypothetical protein"
                     /protein_id="BBH92246.1"
                     /transl_table=11
                     /translation="MESTSCALETGPLFRVWLCGPLCLERRQAATYEPLPLSAWGGSA
                     YPRQLLKALLCCPRRQAHRERLLAWLWPDAAPDQAASALHTATTKLRKVLQPPGASSL
                     LESLSEGHGYRLPGQALLWVDAEEALQLLQQAEACQRTGDPLAVERLLEEAVRYWQRG
                     TFLEGEEGDWVLARRATHERACYRARWWLSEIYEQQGRWPEAEAVLTELWEEDPTDGE
                     VVARLVTVLLRQGRRQEARRCYRDWRHLLARTGDSLDEQSVQAIERVLHAAGLTESQP
                     SPSPRPASPLPGFLSGPNQGILDMKTLHWSTATDRQRRQLLQTTLEGLGLLALPEFSP
                     AFASEVLERLAFVLQKPSCLDGRTLQYLTQRLDSYWLVMRCFGLPTRDLLHLTLSDLQ
                     IITELLSGPLLPTNRQRLCALAGSAAMLAGHLYHDQGLQDHARSYCLLAVSAAHEAHD
                     PVLEAVAWARHSFAWTYDGQPLAASQSIERARQLVRQQKGLLTTWLALIEAEIAARLQ
                     QDQRSLQALSEAEDAVLADQPSFERESLWTGLDASLAAGFRGACFLELARGTDQAMLQ
                     RARQALEAGLGLPLQENPRVRVTLLIDLARAYVQAHELEAAHPYVLQAIESLQQKPSR
                     IKLQRLLQLRQDWALWQKAPLVTELEEAIQLVAERGG"
     CDS             527468..528037
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04460"
                     /product="hypothetical protein"
                     /protein_id="BBH92247.1"
                     /transl_table=11
                     /translation="MDAQQRGVLYIISCASGAAEHVADLVRAAQAEGWTVCVIVTPQA
                     VKFVHRPLLEQLTGYPVRSEYKHPDEPDVLPRADAIVVFPATFNTINKWALGISDTLA
                     LGILCEYTGLHIPIVAVPCVRTHSGLDTHPAFPQSLERLRSYGVAVLYEPETYPPKNE
                     VPPSVILQRLDHLLAARNASSPSASSTQQ"
     CDS             528746..529681
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04470"
                     /product="hypothetical protein"
                     /protein_id="BBH92248.1"
                     /transl_table=11
                     /translation="MALLRRLFARRRPGVQAASAACAASQAAAGTAPEPGRPSVRQRH
                     YLEDVPYLLPKDPLEDQRLNYQHHALYRTLSNHYLAPLTAESTRTILDVGTGTGIWAF
                     EMHALFPHALIVGVDVSLQSLPQPVPPTCLFVRANVLEGLPFPDGQFTYTHQRLLVAA
                     IPARSWPGVVQELVRVTRPGGWIELLELSDVIQPAGPATRRLLDWFVGISRQLGFEME
                     VLRRLGELLQQAGCVDVTSQDIPVPLGRWAGAAGQLLLTDVLHGLDALKDAYCARTST
                     PPEVVETMLREAAQEWERLQARYVFHAAYGRRPQP"
     CDS             529678..530094
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04480"
                     /product="hypothetical protein"
                     /protein_id="BBH92249.1"
                     /transl_table=11
                     /translation="MSHPDPDGDPAAPRLHFGKATSASDGPADPGRTLLILSRDQLAA
                     LRAVLAGYRQEAFQHLLPTPERNERLRQIQALLGRLYALEPPPGGQGWLSLSPEEWSC
                     LLQVLQAVRTQPALQERWRQQLQRLAPAFGWDPRTL"
     CDS             530286..530531
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04490"
                     /product="hypothetical protein"
                     /protein_id="BBH92250.1"
                     /transl_table=11
                     /translation="MRGPALLVQGAPAALADLPDLEEAAISCEQIQEAWQAIEQALLH
                     LNHLPAERAWQVLLAPFGLQVVAPPPPAEPAPAGGAP"
     CDS             530528..530686
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04500"
                     /product="hypothetical protein"
                     /protein_id="BBH92251.1"
                     /transl_table=11
                     /translation="MTGSTRSSPPPAPLGLVTGGLVCRSTPQGLQPDPPALGRVQVAP
                     RTGARRPR"
     CDS             530683..531156
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04510"
                     /product="hypothetical protein"
                     /protein_id="BBH92252.1"
                     /transl_table=11
                     /translation="MKPLDPPPSERAPWRVWSQWVSDLVQVLGTYELPLTREQLRQAT
                     SGLAQLEERLQWEQRRATVSPVEGRRLLAGEAARMHWTHLLRTARCRLDECRLLLGTL
                     VQRTRAAGTAPGAAQAGVAYPDRLRQRVRRALEQFQEQLEQVASLEDEAGGTSPC"
     CDS             531460..532467
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04520"
                     /product="hypothetical protein"
                     /protein_id="BBH92253.1"
                     /transl_table=11
                     /translation="MRSVEGPSDPIRPPQHRRSTYILDAEHAGELARLMQQDRLLTEA
                     LGGLLPEEGISLPETARVLDLACGPGGWLLELAFCFPHATLIGVDLSPSVVEYATTQA
                     RSRGLSNVSFQVMDVMEPLAFPDNSFDLINGRLLWSFMLPAAWPRLLAECRRLLRPGG
                     IVRLTEMEEPLTTSPAFERLMALGCQALWQAGQSCSPDGHHIGITPVLPRLVRQAGFV
                     DVRLRPTVIEWSADSPRHYPVFKDFLVGLELVLPFVERLGLATRAELTTLYQQAVAEM
                     QADDFCALWPLLTVWGRVPGSSDAEPPSRSPAQAAAQTPADRLSSPPAGEAREEGPHA
                     C"
     CDS             532457..533827
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04530"
                     /product="hypothetical protein"
                     /protein_id="BBH92254.1"
                     /transl_table=11
                     /translation="MPAELILHPAAWGQLEAVLQRLAGEAPSAGVIELCGLAGSGKTT
                     LLRQVEHRARALGLPVVWRSLPLPATAAAGEDPGAGAAILAALRPEVEACLRQQGRAV
                     LLLDDVDPADAFQLEQLMALLPPQGRPAPLLVVLTAGRPLSWSWEWVLLSQSRQVLTL
                     PPLEAAGSAALLEAVAPRLAPEARALALAWADGYPLALVVLAEALRDGTLDPRQPADR
                     VRLLEQLTERVLRQGVLGALPPAERPAAETLLRLLAVPHRFTALLLHELVEQFAPELA
                     PAQPLHSLWWLQRLKAATQAFRWVQEGVRVGYRMEPPLRHLLQALWQDEAPDRWQEIQ
                     RWLVEFWSRRARQGQPQERVGALLEWSLARLQLAAPAARVQESQALLAELAAWPWRDS
                     AARQQAVAALGQDQELLTTLGAAAATWQAGLASLEAAPRTPPPPPGEASPPPEPAPRE
                     EETDTP"
     CDS             533824..536646
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04540"
                     /product="hypothetical protein"
                     /protein_id="BBH92255.1"
                     /transl_table=11
                     /translation="MTDSPVVPSVQPAASRALQARLQAWLAQTQADSPWIVWLHDAPA
                     APPPAAGGAPAWGGFGKSTLLRQVLATVRQRFPRLPIVSLDGLDAAAQERFRWVRQVV
                     AHLEAASAWRAERFHTVWAQLQAEGRLPPVAPGVQRQVLDLDSRTRLWTALASDLAAL
                     RPHLPAQGPTLLVVVDHLDLLQPSPQTLVLAPGERFPERFGLPRVKTVLVSRQSPDWQ
                     QPLWCGRQHEIWPLAVPPWTPQDVQQALRRALDPAGLRAPSTLVQQASALLHQLTGGQ
                     PTLVQLACTQLAQGCLPLEELQRLPPQAVASRLLSPLDTLEGPLAWWLLVLAHWQPGP
                     ALPGIPLTRLAALLARLSAGERQAPPIALRTLVAALRQVPGVRLSGLRVPPQAAQDEA
                     ACVALQAELRRLLVQAGWEPQDPDRRFRRALSRVILAAASAEDQPAPPRSETEAAWQA
                     SLLEQLAQRLELDREAGLHWFERPFSRACLSGRRGLARALLETVREVEPLLTPPQRWQ
                     LRLWEVRLLRLEERPAQAQALLEHLRQEADPAWQDEQQEALLYEQARCALQQGRVREA
                     IQVSEQCLALAQRRGNEERASTLQGQLGYLSRRLGHWEQALHSYAASLAYHQQRGSLA
                     WSANLLNSIGHVYRLQGHLEAAWRYCWLGLRVREELWRQGQLDERAVGLSHGTLVPIL
                     LESGDLLQAEQHLRLAWECYAQVDDRKGLAATALRQGQLALLKGQCEEADAWFSQAEA
                     LVTGRAGEILDEEVWIASQCSRGRAAAAHARWPEAVARLQRACEHARHVQDRAQLALS
                     LCELMRALAHLGRQAEAEAAWQEARALAEEEGDRWLLGYGEEILGDLAYAAGRWEEAM
                     RHYVASCAWLAHHHRVASHQAQRRVLERLLACPLETVPALVQAVREDWRQRGLAEAAP
                     ELDQACEEILRLLPTPDRWPGPRPSP"
     CDS             537177..537506
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04550"
                     /product="hypothetical protein"
                     /protein_id="BBH92256.1"
                     /transl_table=11
                     /translation="MPVDPLQTYRTTVEQLAHTGTATEHSYRAALARLLETLAPGTTV
                     INEPRRIACGAPDLAETAVMGVTRLTVGYVETKDLGLDLESLQRDAMQARPRTENGRQ
                     LQRYLRS"
     CDS             537549..538358
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04560"
                     /product="hypothetical protein"
                     /protein_id="BBH92257.1"
                     /transl_table=11
                     /translation="MEGTLRLQAQLATIDRQRRLTTTPQAQQEVRALLEGFLSHRAAP
                     ISRPAELAQRMARLAHLIRAIVVEAFQRQQASPLLRDLYHSFREVLLPDLTEAAFADM
                     FAQTLTYGLFAARFHHRGAQPFRRTDAAREIPRTNPFLRRLFGAITGVELDDEPFVGF
                     VDELAELLALTPCTRSREIKLLTSLVSSLAFSVNWFQRWLREMQKGHGSLGKSPTTRY
                     TIPSVICSSSPAQNRQGRGNSISLWRRRPLSQGSREQMPGSRSGLIQASNL"
     CDS             538623..539777
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04570"
                     /product="hypothetical protein"
                     /protein_id="BBH92258.1"
                     /transl_table=11
                     /translation="MPYQDKTTTLEPCLRLRHCYSLTLLRVLAGIGTLLSLRVISAPL
                     VLWAATLGIIFCSWALLALLIALVWKQQDRRLRPLALTIDLALCVAVNLLFAPWPSSI
                     AAAAFLLPAYGWAIAYGVRGVLIVLLTFCWSELIIALARLSTNQPPANWLATLLWLLL
                     ISLTAALHLLLSRRQSLLVPIFNTQSDAQLQPGSSEFPLSESQKADAAGNSRERAAPP
                     IISPMTLYCDSNATSLAERALHRDALPGIQASLVLTALEVAFAPYGIKLDQHRQQLES
                     ALEALMYPQMADPSQFVCCLQRLLQEAEHHWQQRAALSAREWELLHLLAEGLSYRQIG
                     QRLYLSPSTVKTHMRHLQQKLGVSGREELLRLAQVRGWISDPACQQRAEE"
     CDS             complement(539798..540541)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010889268.1"
                     /locus_tag="KTA_04580"
                     /product="ABC transporter"
                     /protein_id="BBH92259.1"
                     /transl_table=11
                     /translation="MTLFALRAQSKLEFLRFLRNGRALFFTLLVPIGYYLIFSYGFGN
                     THALQLHFGIAMAGFGTIGVSLGTLGSRLAQERQLGWLRLLQTTPLSPLAYFAAKVLA
                     TFSMAGMTIICVLTVALLEGLRVDNYWALVASALILWCGSLPFIALAFVIGSWTDAET
                     GYIVSIGVYLVLGYLGGLLQPLQLMPGVLQDVARFLPSAHYLLLALRPLQAASSGSAL
                     EDVLILLGYTVLFTALAIWSYRRSGTTGR"
     CDS             complement(540538..541506)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000411157.1"
                     /locus_tag="KTA_04590"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH92260.1"
                     /transl_table=11
                     /translation="MAETLERRGMSMKVRAAAALTQSPQPVICLDQVTKSYGTVQALR
                     GVSLRIEAGESVALLGPNGAGKTTAISLMLGLLRPSTGRVLLNGGDPTISAVRRAARL
                     GAMLQNARVIDLVRVRELLDVFRSYYAQSLPTDELLEIAQLREKQRSYTQHLSGGELQ
                     RLLFALALAGNPRLLFLDEPTAGMDVASRRRFLQRLRELHRDGRTIILTTHNLADVEG
                     LSQRVIVLNEGRIVADGSCEAIRAMASGQVVSFLAEEPNDQLLGAIPGVLRLERQGPR
                     VVLFTRDSDALLTELRRRGMATPHLEIRGASLEEAFLALTRKEDKA"
     CDS             complement(541569..542270)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04600"
                     /product="hypothetical protein"
                     /protein_id="BBH92261.1"
                     /transl_table=11
                     /translation="MLLQYGLCRRLLMAAARRLAEQLPLSLHYPTRDLALTLAVAGAG
                     LTALGIAWAVSWANGQNLPGLFTEHLLLLQLPIGVLLGLGEASVSMLLSSLALALFRL
                     WRQRQIGPGIVNELRAIGRAGWVRAYRQTLQIWPAPVGWAIITLALLGEELLFRGLAA
                     RLLAPEGFPLALVTSTLLFVAVQEQGMPSWFSALPAMCGALVIGPINAWLLMTVPNIL
                     PLVLAHLTFFTVMIL"
     CDS             complement(543151..543387)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04610"
                     /product="hypothetical protein"
                     /protein_id="BBH92262.1"
                     /transl_table=11
                     /translation="MLETDRSCSKIGRETEPLIHRIHAGLIGKHVEQTGHWLCPVPQG
                     PVERRLRFATPGRHDQQRRLPCPLRAGSQATQLY"
     CDS             543392..543898
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04620"
                     /note="possible pseudo due to frameshift"
                     /product="hypothetical protein"
                     /protein_id="BBH92263.1"
                     /transl_table=11
                     /translation="MPSQALYQQLLLTEMGPATAREAARWSLNLNRLHTYPLKLLSPY
                     QLLKVLYRIKSFEGMLADYTQAAFIFDEIHASDAEQLALIVALLQYLQQRYGARFLIT
                     SAMLPSLVYQRLIEALEVSEPIVAEAELVQRWRRHQLQLLGWGPARRWLEACCCSGGA
                     RKRGLGLL"
     CDS             543885..544343
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04630"
                     /note="possible pseudo due to frameshift"
                     /product="hypothetical protein"
                     /protein_id="BBH92264.1"
                     /transl_table=11
                     /translation="MACCNTVERAQRLYQRLRQVLAAEQVLLLHSRFTARDRQVREAQ
                     ILERAEVGARQQALALVATQVVEVSLNLDLDTIYTDPAPLEALVQRFGRVNRAGSKGI
                     VPVHVFRSPQDGQGIYLPGLVARTLRKLEQHQSQVIDEVALQHWLDGCDL"
     CDS             complement(545080..545319)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04640"
                     /product="hypothetical protein"
                     /protein_id="BBH92265.1"
                     /transl_table=11
                     /translation="MRTLVETAAVEALRSVGQKLPTDPLTSLPLWWENLARLWAERPE
                     LRLQPSALGGLARHIIDSYLQAVDWHRLAKALHGE"
     CDS             complement(545565..546299)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04650"
                     /product="hypothetical protein"
                     /protein_id="BBH92266.1"
                     /transl_table=11
                     /translation="MSSSSSSQPWKTLPDEELLLRLLLGSSGGRAAAAHRATLQSLLA
                     EYREDVRGLLLGQASELDLLREQLVSQLPRPCRRRLAVLQELARRLTGSGSGCMPVKI
                     TSPDDVETLMRPILAFLHHEEVHLLLLDTKQQLLPSRDRLLYKGTINAMLFRIAELFR
                     EAIRRSATFLIVCHNHPSGDPTPSSEDEAFTRSLIQAGQLLDLPVLDHLIVARRGCYS
                     FRCQRGSLWPKEARAGEAGSFGKVST"
     CDS             complement(546686..547093)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04660"
                     /product="hypothetical protein"
                     /protein_id="BBH92267.1"
                     /transl_table=11
                     /translation="MRITIHLAASWKEVERDTNVQFLFDLSWLCTCPDFQWLCLTLPA
                     TTWRLQVQAASRGLQQARDERNMLLQRQDTGQVPQHWNLHREEVLAHPVFLQLKRELH
                     RLLRGKTHGVFRARISTMTICLQHRPACRSGAS"
     CDS             complement(547275..547970)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04670"
                     /product="hypothetical protein"
                     /protein_id="BBH92268.1"
                     /transl_table=11
                     /translation="MKRGHALGRLFQRVQAICEAAGLLLSLEDASPPLIRLDLDNDPY
                     EPLIIAAWTPPAPLPGERYRLQVAHVGWTSRGLPFPDPELELAVMATGEAPLPVRMRQ
                     TVLGIRETPFLQPDLSQDQRAVQDASELWSVWTRALRWQRWEQAAAEARPRLQTVLLS
                     PDDDADARWLKTALCQAIPLLREDQALQLVRAVQQGETEVQLLCCNRVARLAEALRSW
                     EVSFRVEARKEEG"
     CDS             complement(547967..548518)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04680"
                     /product="hypothetical protein"
                     /protein_id="BBH92269.1"
                     /transl_table=11
                     /translation="MEEDATMPLTLEERARHVPLKAAIDYLAAVCDGARRRDGAGFSG
                     VDVRLGHWLARLPLDAWPDAVFERAWRLAQKYARQLQEAGMDPAALPRPSAARGRHHL
                     AFHPSGEGFMVLFPYNAALIAALRRAFPQARFRQDPVKHFFLPRDPNPGSALLRWARI
                     YEFTLGPGVQAALERPDSKERTE"
     CDS             complement(548750..553108)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04690"
                     /product="hypothetical protein"
                     /protein_id="BBH92270.1"
                     /transl_table=11
                     /translation="MARLAAQVKLEFFPTPPHVVERIAALLTFPSGFYASARLLDPCA
                     GDGRALALLAQRLKARFQQDYGEEAYCSLSTWGIEIQTSLARQARSRLDRVLHGNFFQ
                     TTLSWAGWQLVYLNPPYDWDQTSGKRLESAFLQRATRLLCTEGVLIFIIPQWVLQERE
                     VAGYLAAQYDQLTCLRFPDPEYEQFKQVVLLARRRRAPLPARALAGELKQLSDWARAG
                     KDMPVLPDASDSAQGGPRWPIPRCPPGEHPCFYLGRFEPDRLAKQLCWEGQTARPLTG
                     VWANRDWWQAHIPQPAAPGETETTTGWSPLHAFKPVHLALLAAAGLADRALIRAGSQR
                     LLLKGQTWKDQVTSVEETPEEIIEKVSDVFMGSLQALDLDTGELLLIHPPGREAPMPP
                     GVDLKQVRHRHVSLTTFLNQYGSVVLQTIQQRYPPLFISEAQVPWAERAFSQLQRRPL
                     GKQRESILAHVAAFTRSPSPLRRQLLSAEMGSGKTFMAIAIAFTADLSACHAGGSVPQ
                     HQTPHMFPALVCCPPILAGKWKRELEETLPPRAKVLIVQPVAPVPARHRETEVEAEAA
                     RTALEDYRRFDPSFTGTRLGRIECLDRAVACIRRDLAVWRQQVNRARQQGNSPPPKPI
                     HVLILTTSDAKLGSAWQPVWHPLRLRARNAQGGRVTLVRDAEGHSMSVPACPSCFRPL
                     LFQSSRARATSTSARDATPLTWRRLWVAYEEAGRAAGEALEASSGRLQEYLWEQPEYR
                     RLCEEEQRYRLGDLAPGESDLAPELVRLLESILEHLQVHTTEGATAQPWTLSQPLQWQ
                     RQGQGQGKGRPWQHWQTVLNQCLLTCHICRRLACQLDALLRERELDCRARKRAFCERL
                     ASQDPIYQQLLKEHQTLLTARLHQSGRPTLVEELASLPYERLASEEQLCGKERRIKYR
                     CCFCGERAWQTVAVGQQQRYPLADYLRRHYRRLFGLLIADEAHEGRDGTALGQARQSL
                     MEACRASLLLTGTLSNGFASSLFRPSYLLLPAVRHQFAWEDEQRWISRYGCLQRIRKS
                     RREEAEADGARSRRVQRLGMPVIKEIPGFSPEGIALLTRVSSFTDLREVVPDLVPYRE
                     RVELVPLQAPLGPAYHAFEREITLALRRLLASGDRSALAPWFQALLLYPLFPWRPWCC
                     STRHGTVLGSAPALPEEQCYPLEQRLLSLLYQARQEAPVLIYCGETGHYDLLPRLKRL
                     LEQELRRPNGQPLRVAVLRADTVAPIDREAWLRRLMAEGVDVLLTNPRLVKVGLDLLA
                     FRRIIYFSFPASVSDLRQSARRSWRPGQTGDVEVIFLAYEQTMGERLLHHLARKVSQA
                     LLVEGMEFSATEGGLVTLSGEGEEDEQESLLLTLVRETFALLEAQDAQPSQRIGVDPA
                     QEQRCQEVAPLGTSAGTITLPALPPVQAPLTPPEERTQAPLPVGDVLLLPLPFQDLPL
                     APLSLPAKASRRPRRR"
     CDS             complement(553196..554041)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04700"
                     /product="hypothetical protein"
                     /protein_id="BBH92271.1"
                     /transl_table=11
                     /translation="MSQQSRRYQVPPGIVEHTALPRIGVAFSGKRHSAGGELEYAAFV
                     HGYIAGEPLWDEQQGREVHPLFLLSLVGAPGDSPVLRGLFAALVNTPPRPVTIEGVGS
                     VMLAHQVAPLKDQGPWHWTYSQVSLGDLGLHALIECPALTLLDPRSVQQPASRPGTSN
                     GATLPAVSCRPFLLLVPPDQQEEVAYLHRLDRRVPWPLHERWAAWLWQVAQRQKWVTP
                     LTVRWFFPQASGEVEASCAAQPTEPQPQPIVASAWLCQPEAAGVLAAIQQGLLSGELD
                     RVADI"
     CDS             complement(554176..555231)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04710"
                     /product="hypothetical protein"
                     /protein_id="BBH92272.1"
                     /transl_table=11
                     /translation="MTTDTTLASFAGTLADMPADELAQACVRYERFSLARTVPFPGYR
                     RRHAILRRLCGVYPCRRSIPDWWYSMLNELPSSSTDSSLIRLLEEIEEEEFYGGCLLG
                     TRAVHFKELGNRFAPRPAWAQSPRLARILQALGQGEMTEEARQRFLGWYQLYLNRGSK
                     EEQRVFIVSAHAWDVLSMGSGKGYRTCQALDGDAPQCRRLPTNLLDSGMLVAYVPASL
                     EAIQDRWTLRRMEARCILRLLFCPRFRRWIIYIDRCYGDVSLVQALREGIVQQLQQRG
                     IAYWWPDLSPSSLEDDDFLVEGPLQFFPAPFSWPYLDSWRMDWNDCRRGERIYCRLRG
                     YLRLSMHMQAQLSGQNP"
     CDS             complement(555417..556451)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04720"
                     /product="hypothetical protein"
                     /protein_id="BBH92273.1"
                     /transl_table=11
                     /translation="MPYSSFSRSADASPVLQTALAALEAGISVVPIRSDGSKRPALTS
                     WKPFQQRLPTRREVSTWFARRDVGIALVTGQVSGCLLAVDFDEEGCFLTWMARLRQDS
                     QLARLYEEVASGYEERTPKGGRHLLLRCPAIGRSRVLARSRQGGILVETREEGAIIIV
                     APSAGTVHPTGRPYVLLRGGVQSVRTISPAQLEEICSSLRLLDEQGAPKLIQSSSQPT
                     AGPRRPLQLSATRPGDLLNRDPQVTWESILLPKGWELVRTDGAGCCYWRHPGKRGPHY
                     SATTNHAGDDKLHVFSTSAPLPPGSYTKFAAYALLYHGDFHAAAQALKQRYSSGRPGE
                     GEAFARPASL"
     CDS             complement(556459..556605)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04730"
                     /product="hypothetical protein"
                     /protein_id="BBH92274.1"
                     /transl_table=11
                     /translation="MYLQLLVGLLFLPAFLVAFGVQVLALFDQLKRFSHDVSVSGNQR
                     GGGE"
     CDS             557135..557302
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04740"
                     /product="hypothetical protein"
                     /protein_id="BBH92275.1"
                     /transl_table=11
                     /translation="MEQGPNPGGVTPAALPVESSLAQAVAPGYRQHFLTYPQEQATPA
                     TLSLPSPASRK"
     CDS             complement(557748..558533)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04750"
                     /product="hypothetical protein"
                     /protein_id="BBH92276.1"
                     /transl_table=11
                     /translation="MQSMQYRYPLLDSQAQDQVTEHFLRSLQLALVAAPQAKELLQER
                     QKRLAQQEHLLEQAAQDGFLWSEGISLFPSLLSTWAEKEALRVALAYPSLDFAAQKKA
                     ITSTFKWQLQQEAQVRWSALQLLQEQARRQRQLHDQEQAGYWQTVARQMLEEQRQRQA
                     TQVQWWTQVQQAQQHWAGLAYRGIEMAQHGQEQQYRFAEQIHAQVVQQLNATARRQEL
                     LVEQAVRQAAVRRWSTRCLLLLLLVIFGGALFGCAALAAIYLL"
     CDS             complement(558725..559405)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04760"
                     /product="hypothetical protein"
                     /protein_id="BBH92277.1"
                     /transl_table=11
                     /translation="MQMDWKRFSLLLLAGFSLEVLATATGATVLSGVLRAGEILVVLL
                     ILGMATPRFLSWLYQEGQELAGRLRRWNIRPGQKALVPREELLAFLEDIEGFAQRAQG
                     SSRLQGEALARLLRLCGVSREDEPHIQLTPWALYQLKHCLLRDLKEVEQYERRRREQL
                     RLQVRELDMQLVQLAPAMDHPGLLHLLGQMRIIQQLSTSYPAEPLLILLDHIRAELEQ
                     LCQQRSCS"
     CDS             559946..560128
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04770"
                     /product="hypothetical protein"
                     /protein_id="BBH92278.1"
                     /transl_table=11
                     /translation="MPASCVRAEATLLEQHQTSNIPALAPLTDTQLLPLISGLTCPLE
                     ADNQQRKADQEGERAS"
     CDS             560589..561404
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04780"
                     /product="hypothetical protein"
                     /protein_id="BBH92279.1"
                     /transl_table=11
                     /translation="MDELLRLLLALNNFNPLMPLATSMLFTTSPALTTQNATVMLVWR
                     TLLAISDGLLGLVTIIGTIQMMQSGATGSIRMPLGQFIGRILLSTLLMHSSAFLGEQL
                     IQINNLLCLMLQANAGSSLLLLTGGRGLDSGTSLVLWAVLSIIFGIGFFRWLFQAIAR
                     IVRLDFLFVLSGPAFLCLIHPATSLIFSIWLRFYIVTLFEQFLQMLAFTLGFQLLLSS
                     RQTGLPGFLLAAAIMNFTASVPRLLERFGAATSGHGALSTLASLAVRAVVLLA"
     CDS             561470..561718
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04790"
                     /product="hypothetical protein"
                     /protein_id="BBH92280.1"
                     /transl_table=11
                     /translation="MNTLNNLNTVITQLQQNAARIGITIAGLLVAVYAVKIMLDQDTS
                     PAARAERWSHLKRVFLCAAIIAATGAFVQLALSLGQML"
     CDS             562005..564860
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04800"
                     /product="hypothetical protein"
                     /protein_id="BBH92281.1"
                     /transl_table=11
                     /translation="MLALTGGIPFVPRLWVTGIALLSVLLLVHGRVGGSSLAFWLYWY
                     GRFWWLPKRTRFRPPSAAGAEARRKPPRGHPVASQRWVPAGELQGHLVRHWMRGADGR
                     MKALTCWALLEVQSYSTLRLLPRYEQERLLNRCQRFLDGLSFPVKFLWIVEALDPARD
                     PALQAQQQALVQLKDSPLQHLQRENLQEQLHQQAHCSSIRHLVVVSASSHEATSDQQT
                     AQGRSLLHRMSALLFPRQEPVAEAEVERALRIRLGVVKAGLEALDLQVSLLSGAALLR
                     AFASCLAPGSSVPSFEVDSVSHPHRPGSQGPAGRWVKRLRGLHGELLSYISPRPQAML
                     DPGLPLEELLAPVAVDLAPQGLRVQVGKQGQQSRCLRTYEVVGLPAEVSYGWLEGITN
                     LGIPLIIMLQCQPLPNRVMLRRLELQRTKIESQRLADRKSLRLTKADVEQEATQLLTL
                     IEALASNSLTLCSIQLLLMVHASTLERLEERTRYLLAHLRDQQVRVRALAYRHDLGWQ
                     ACFPTPMTSTALVTPGAITLPSDVVATCLTWSNSRVGTPSGAYLGISRQGPQGAAVAL
                     PVYLNPWDGTRRLPNPHVVICGESGMGKSWLAKTLMLGLLCTHTADVVVLDRDGDYDA
                     IHAALGEASQRINLAGQCPINPLELPYGPGDVDLTDPVDLVAEHIEQHLLPGLALLYG
                     ESLSKTQEAVLTHAARVAYRTRGLYMEAIRTDPQVLLQEPPTFAAFLEVLRTAPTASE
                     VQREMLMERFDQVAYLFSEHTTLTLTPLTIFAIGKLDERWYPFMNYVIYNFVQRYRAV
                     QGGERYLAYVVEEASYLLKHPAGRRYLEAGARGFRKLGIAQITISQHPTDFLEAGQVV
                     LANSGTWFLLGMQRQAAQRLQLPDELERLLEEARPGRVVFRCGRELAPLDVVTYRHSP
                     LLRALLTTDPRDRRRLASLQHRSSLQRQTRIAGPGVP"
     CDS             565154..568042
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04810"
                     /product="hypothetical protein"
                     /protein_id="BBH92282.1"
                     /transl_table=11
                     /translation="MALAWLVPSDDPGGQRQAQAIENWLQACASDLPFALELVGTSQA
                     QGFLLRSCEREQLQLLCRQLEALVPQVEVRWLSAMHDPLRLRPGEQALIGRFSLLAPS
                     YLPIKTFSGKLLTEGADPLPGLLAAMATVGPSQRVIAQVVLARAPDEWVSADLRKTVE
                     HALQAERERYAQQALQDEAEGARVLALVGAAVLMLLASHWWQTHAWLPLLSLGLLGLM
                     AGIGWLWWRLMRASPALYDQHAVAEKLARVGFYAQVRVIVIGPATASRTALTRVLHAM
                     EAAYRQFTQPSSNGFALHRVQHIQAQDRHARQLPDVEAAFPYASLFRRMLHGGARSPW
                     ILNALEVAGLFHLPQPGTDLPLVRRSTHKALLLSPALAQQLLRHHRPFPPALLGYSTQ
                     RGYRIPVALPAEGVLSHTFVVGKSRSGKSVLMQLIARAILHSSPSPSSPSLVLLDPHR
                     DLVEQLLDQIPPARQQDVLLLDLMDTSYPVAINPLDVSLGLSPDELVANLMSCFERIW
                     APQWGPRMAYFLTAALRLLATLNASLVQQGQAEEQYTLLDINPLLQDRSFAIQLLAQL
                     NLSQPQQQELVQFWQTSYWSLHPSFRNEICMPIVSKIGMFREHEQLRRIVGQPVTQAP
                     IHEAITAGKLVLCALASRELPEGAVNILGSTLLNLLHRAFRLQQPLELTQRRKVLVAV
                     DEFHVFSGGDFERLLSEDAKYGCALQLSTQSLKRLSLLREGLLELVLANCQQLFVFSV
                     SAADAMLLEGELHHQVSAAHLVRLPPLHCYARLSVPGFSQQVISLQVQPPPGARLQGQ
                     TSAAIRAQQRRCRRPAAEVDRWLAEQGRRRHPDALLTSRRVQREAERAHQQAQQQEAA
                     IQLEEEQHTRTRSHPQELPGNEPLLTTSLGGAAVEVSLREQPGDEPPVSARKHRRSRR
                     QRRRKVPVGTPPPEPQEQRHLGEEQAEEGAPHDEKMAYRARGSEDQPN"
     CDS             567993..570032
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04820"
                     /product="hypothetical protein"
                     /protein_id="BBH92283.1"
                     /transl_table=11
                     /translation="MRKWLTGPEAVRISPTETALLRWLLWHPLLSAHELARLEQSRQR
                     HAPDAAVARPVLEPASISQVRRDLRRLKRGLVLAFRLKEPGWPVAEERYALTVAGVTA
                     FAHQFQPPLSAEALACAYPIEQEDLLSRLACPVSTLVLATCFTSLIEGARQDWQVRVF
                     QFPCSLRSLQRLAGWSEWSAARTRPLNAALCLLQSSQPEQQSVPLLLLPGPHQEQPFP
                     WRQAANLLGQLARLYQANGQEPQAGIPLVLVVSTAAHLPAWSDLLQQLASTQCRVPQG
                     GMLLVEQVRQEGFLTAPCWRFAELAALRASSTSAWKAAATQRPTVSTLLLEQMRIRSQ
                     QQADLPQPGEDPALLLARQSHLWTRSKQPSWRRLGHPVRLPDARWAASLIRGASRQAG
                     ADVSTAGTLATAARLNLTLTAWQKRLLLLVARFPLLSRAQAAQLLGLKGQAERRLQRL
                     LVALLATDLLTCYRWSAAPGREQERLLPTQAAAGYLVTRGALPPYWGESGQLVSSQHG
                     PLWLPPQARGLLAQMQHTHGLYTCLAALSWAATQEPAIDGSWIWSTRESARRWFDPRR
                     RQWIQLRPDATWIIWLRGQPLPVCLLIEYDRATRQREFLAKAETYAIASQQTGGHFPP
                     VLIITTQPRTVARIHTCWQLSRAPQPMLLLLQAALDQPATLHHMTDWLLQLCSLP"
     CDS             complement(570011..571039)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04830"
                     /product="hypothetical protein"
                     /protein_id="BBH92284.1"
                     /transl_table=11
                     /translation="MPVSLGTYPKRQELLAYLAWNRQGVPRDQLLEEVFGHGQPDEEA
                     HAQKLGERFDSHRKILRRRVREALILQGLLTEREALPAALDPFASEGGIWRLASGCQV
                     IDLEVIQGSYAVLMKMRKEGLLVQEVPREVVRACEELVAAYRGDFLASYIQRYPELVQ
                     PWEGRSSWIRKPFTQGRDWYLEALWWLGEAAWREGLTFGSPPPSELALRQQRQAFARA
                     AQRYADYALGACTTRFDSKVSFGPGSEPGERVLMSERALRRAVLLWGSLGQTGQVDQL
                     WRAYWSQMRKVSDRRWEPRRETLADLETARAQTNAYRLALQLSQQEAFNLFSWSSLAE
                     KSQGSEQS"
     CDS             571551..571784
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04840"
                     /product="hypothetical protein"
                     /protein_id="BBH92285.1"
                     /transl_table=11
                     /translation="MGRSSGAARRRQRRTIGQRLAGSCHRTGKEPTRCQKKDQTGNVH
                     RRKLPMALISKTNRISNCLDRLLIAAETKGHVG"
     CDS             572484..572951
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04850"
                     /product="hypothetical protein"
                     /protein_id="BBH92286.1"
                     /transl_table=11
                     /translation="MTETKTHKGKRTIVLPPLVIDTLKAHQERQLEARRKAGPCWQQK
                     DLVFCTHNGNFLTDSFVRRQYYQILDEAGLPRIHFHDLRHSTATILLALGVPIKVVQE
                     LLGHSHVNTTLGIYGHVLPGMQEEALRKLERVLKGENAQDSRADYCQNNCLEP"
     tRNA            complement(572999..573075)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="KTA_t00020"
                     /product="tRNA-Gly"
     tRNA            complement(573166..573238)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="KTA_t00030"
                     /product="tRNA-Pro"
     CDS             complement(573470..573919)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04860"
                     /product="hypothetical protein"
                     /protein_id="BBH92287.1"
                     /transl_table=11
                     /translation="MPNRYEREIEEILRNLEQSEAQGSRFRGRSRAGRRWRFSLPRLR
                     FPAFAWTLDASQWFLLLSIIAALIAGGFAYAQEGPGVFTGIMAIVSLVCLVAVLVVQL
                     WRRPRYSAAGFYGGGKVSSLRPHPLSWFTTRWHLFLLKLRYRRKRDL"
     CDS             complement(574098..574496)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04870"
                     /product="hypothetical protein"
                     /protein_id="BBH92288.1"
                     /transl_table=11
                     /translation="MKRIIVVDDDKETREIITFVLSRNGFEVVTAADGRQLAALLAVE
                     KPDLIILDVMMPGLDGYQIFNRLRRDPAMRQIPVIIMTAHAEHIYERISVDLGAADHI
                     TKPFHPLELVEKVKGLFRVRSCEAEWGEVR"
     CDS             574831..575820
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04880"
                     /product="hypothetical protein"
                     /protein_id="BBH92289.1"
                     /transl_table=11
                     /translation="MSVSESPSWQSVLQRLIRTTPERQRLATALGVTSMTLSRWANGE
                     SRPHRSHLIRLVQAVHPQYRQELLEALRRSFPDIDTLLRESAVEQVPSEFFAQVLSAR
                     TTTIESLRFWQIGEMVLRQALAQLDPNHLGMSITLIQCMPPHPDGKIRSLRERMGKGT
                     LPWTADLEQMALFLGMESLAGYVVESGRVQSIEDLRKYHLVPAYQSEFEISAAAHPIW
                     LGGRVAGCLLASSTEVGYFSQQRMSLLAIFSDLASLAFDPSEFYAPSQIELRPMPSPE
                     KQRPILATFRQRVARLQYQRRLSNAEAEREAWREIEEELLRLGEQENETLLSP"
     CDS             complement(575954..577354)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010943546.1"
                     /locus_tag="KTA_04890"
                     /product="acetoacetate metabolism regulatory protein AtoC"
                     /protein_id="BBH92290.1"
                     /transl_table=11
                     /translation="MSMLILIIDDEPHLPHQIARYLGRHGYEVETVAEGEAGLRIIQQ
                     CSVDLVLLDLRLPGLSGLEVLKRIRASEPELPVIMLTAYGDVRSAVEAMKLGASDYLL
                     KGFDLEELLLVVQRALETSAMYRELRQLRRERSDNYHFNYIVGHSERMRQVFEMVARV
                     ARSDTASVLITGESGTGKEVVAHAIHEQSPRAAGPFQPLNCAAIAHNLLESELFGYEP
                     YAFTDARKQKRGLLELADGGTLFLDEIGEMPLDMQAKLLRVLETRSFFRLGGSKEVKI
                     NVRVIAATNRDLQKAMAEGTFRRDLFYRLAVMQINLPPLRERPGDILLFASRFVEDFN
                     KSLGRNVRRISPEAQRLLLAYSWPGNVRELKNVIERAMILSSGDEIQPAHLPQEIVGY
                     SESRQRETSDPWEEWLASHPAQSLPLERIVERVERYFIRQALQEAGHNRTRAAELLGM
                     GKVDQLRYLMRKHGIE"
     CDS             complement(577351..579927)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04900"
                     /product="hypothetical protein"
                     /protein_id="BBH92291.1"
                     /transl_table=11
                     /translation="MRTAEHDSGIFASQQSSAAEKGEKASVVEEGEALSALAPLSAPA
                     LVTTILDEFSAIGDYRVLQDNLPRRLASLLRSRHVLLYKRIGETLQFVSGTFDDRPGW
                     STSLLAVAQINPIDLNSERPEARAWRLRQVATAPAGEGRPQLVAVPLIYRQRATGVLV
                     AIRGGEAETKSEQGALSVEAAERALAGGHSQRLPAYWSEEEMRVLEAVAGVCAMLLEN
                     TLLLERDRERIHELSLLNSIGSQINSAVHDFERLCTIIMQRCREIAPLDLCDLLLPPP
                     LSRQAPWISAALSEALFRYAREQGRHPTPLLIERPGSPRTADYLSHLPSSINTFIALP
                     LISGGDPGRRGRLCGAEEREPRVLGLLVGATYRPWKVRHVELMMLQVLASQASAALEN
                     IHLMTEVIEARNEARKLLRQVLDDQRLKELILESIPSGLMTIDLSGQITTFNRAASLI
                     LGYHPYEALGQPVHKILPLKNPQALREAQPSGPDGPGPGQRAPSAYHETLITRDRQGQ
                     DLVLDMTWQPLCNDRGQPIGTLLTFSDVTSMHRLQEEKRRLDELASLGKMAASVAHEV
                     RNPLASIKITMQMLMDDLERLIRREAAETPEVGGEWSGQTAPLEEHRGAQESIAVVLK
                     EVERLDNIVRELLLFAKPRQLHRVPCDLIALNEHVLQTLQPCLTEAGIVVHRVYQRDL
                     LQPSQQRRRAIVLADMEQMEQVLFNLYTNAIQAMPEGGILTVSAQVVQRSQPGTSAGY
                     VLPRVRVTDSERSYIAQEQYEWLELAISDTGIGIPPEQLDLIFQPFFTTKAHGIGLGL
                     AITQRLIESHHGQISVESRLGYGATFTIRLPLASTSDVREGESEPESQTTEPTSGRPQ
                     TT"
     CDS             580531..581241
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530791.1"
                     /locus_tag="KTA_04910"
                     /product="hypothetical protein"
                     /protein_id="BBH92292.1"
                     /transl_table=11
                     /translation="MEEEHDKPHGVPGPQRVEGEQRQTEGPSKIAPRWLALIAALLCG
                     FLYAILPPWLTLGPNWLPLTLEGIIAAVVVAFSLLARLGGQPLPHRLLRRLALGLLAI
                     VTLALGSAVALLIFNLPRDTRADVLLRAAALLWVSNILVFALWYWEVDGGGPVGRHRR
                     GHRAVDFLFPQQAGGNSGGWVPHFLDYLFLAFTTATAFSPTDTMPLTRRAKTLMMLEA
                     LLSLLVLAILAARAINIL"
     CDS             complement(581283..582578)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142523.1"
                     /locus_tag="KTA_04920"
                     /product="cytosine deaminase"
                     /protein_id="BBH92293.1"
                     /transl_table=11
                     /translation="MPYDLLVRHARLHRRDTLVDIAIQDGRFVRIAPELSKESAAREI
                     DAAGRLVSPPFIDAHVHLDAVLTVGQPRYNSSGTLLEGIQIWSERKPSLSHEDVKRRA
                     LEAIRWEVAQGTLYIRSHVDVCDPSLTALRALLEVREEVRDICELQLVAFPQDGIFSF
                     PDGPELMRRALELGCDLVGGIPHYEWTRDLGVEDVRYAFALAREFNRDIDCHCDETDD
                     PQSRFTEVMAAEALSAGWQGRVTASHCTAMHSYDNAYAFKLLRLLARARVNVIANPFD
                     NVVLQGRFDTYPKRRGLARIKELLEAGVTVALGHDSIMDPWFPLGRGDMLAAAQLALL
                     LCHMSGYEEMNTVLDLITTNAARVLRIEERYGIEEGKPADFVILDAPSAFEALRLLPA
                     RLHVFKAGREIATTTPARSLLRRSGESEGREVTFRPPSS"
     CDS             complement(582890..584269)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223436.1"
                     /locus_tag="KTA_04930"
                     /product="cytosine permease"
                     /protein_id="BBH92294.1"
                     /transl_table=11
                     /translation="MSDIVTIPEERGIEIHGIERVAPTARTHVRIFDNFTMWLSANLV
                     ISTVAVGALANLVFGLGFWDGLAAIVIFNALGVLPVAFFSTLGPKLGLRQMTISRFSF
                     GWVGGIVMALFNVAACIGWSAVNVIVGGQLVAALSNGAVPRWAGILVIALLTTVVSIY
                     GYRYVHRYERFAWIPMAIIFAIITVVAAPHMKIVPMPAVSAAWFASLISFGGAVYGFA
                     TGWSSYAADYNVRQPEETPASRVFWLTFLGVFLPCVVLETLGMLLTSWVPKSGGELLA
                     GVLQPLGGFGTFLLVLLALSVVANNIPNDYSLGLSIQVVGKSLQRVPRAVWTLIGAVI
                     YVAIALPAAQNFNQTLENFLLLIAYWLGPWSIILILEHFVFRHGVYNVDDWNTPEKLP
                     VGWAALVALVIGLVGVALGAAQVYYVGPLAKLVNPPYGMDIGFELGIALAAIAYLLLR
                     PIELRRNGR"
     CDS             584896..586992
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04940"
                     /product="hypothetical protein"
                     /protein_id="BBH92295.1"
                     /transl_table=11
                     /translation="MVSRTAPARAGSKRQAEQESCELEELRRENSRLREALATKSQEY
                     ALLNEIIAAVGSTLKLDEILQRLVDAIVRAVSCHAAFLYLYDPERERLVLASASEPYA
                     RFVGKIELALGQGIAGWVATTLEPVILKEQARSDPRFYVVPELDREEFQSVMTVPIVS
                     RERQLIGVLSMNTAAPATFNEEQQRFVCNTAALVAGAIENARLYEHTRRKLNILTSLS
                     VLSQTISSGLYLDEMLRSLAALTAQIMEADLCVIMLVDQARGRLTVRAVASGLTEREH
                     PLLQACDGERSTQEMSREGGGSLPAVGCPAVLSGLVSPAATASGNLDSALGLQSGDYQ
                     ALSFEGFNPLKDGQHRTLLSAPLVSGTEHLGLINCYFRKARRPSPEDQALLSTIANQA
                     AIAVKNSQLVDLLTQKNLVKAFFDELLAGAYESEEALKQRAKLLGCDLERPHTVVLFE
                     LLPAEGGASGNPRPALSEEERQTAYKRTCSLIRRRLHDAYPGSLLHEQERTLTCLVRL
                     SQEESSQRRASSSSISLNPSWNARLKSWLRELVHQIHQEQPLRASVGIGNPCQQLADY
                     RRSAAEAREALQMGRSLNGDGGVTHFNDLGIYRYLYKIARMDDLRDSYQDQIARIAHY
                     DRRKGTDLLSTLETYLECAGNLTKTASRLFIHRNTLIQRLERLQSLCDVDLQDRSNWL
                     SLQVAIKVYKLRNNVL"
     CDS             complement(587225..588970)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000437634.1"
                     /locus_tag="KTA_04950"
                     /product="MFS transporter"
                     /protein_id="BBH92296.1"
                     /transl_table=11
                     /translation="MDSMTPSAGSGPVTERPAPAGSGAASTTAAVEQPRFSVRETALT
                     MAGVLMVMLLASLDQTIVSTAMPHIIAELQGFDRYTWVSTAYLLASTVMVPIYGKLSD
                     LVGRKPIFLFGVVVFLLGSALSGAAQSMNQLIAFRAFQGLGAGALLPIAMAIVGDLFT
                     PRERGKWQGLTGAIWGLSSIIGPTLGGWITQNTSWRWVFYVNLPIGLVALLVLIFLMP
                     ALRGKNRQVSIDYLGAVLLVLGALPLLLGFSLAGNQYDWLSPQIIGLLTAAVVFLAAF
                     LLYEARLERRQGQPIIEPGLFKNSIFTVSTIVTVIFGMGLFGSVYFIPLFVQGVVGTT
                     ATNSGLILTPLMLTSVAGSVLSGQLVSRIGKYKWIAITGMAISVVGSYLLTRLDVHST
                     NTDVLVAMLVLGLGMGFGMSLYTLVVQNAVPVHKIGQATSSLVFFRQIGATVGLAAMG
                     SIMTSAYQPAFDQALPALVKQVVPARFLSVFNNPEVLLSDDARQQMQHAAAAFGPQGQ
                     QLLATILEAVKTGLAQGIHNVFVLSFALMVVALVAVFFLKEIKLRDRRRPQSQDAGQG
                     EEAPAPEAGELVGLI"
     CDS             complement(589013..589651)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_04960"
                     /product="hypothetical protein"
                     /protein_id="BBH92297.1"
                     /transl_table=11
                     /translation="MPPSTAPRSWKEKQRQEREALILQAAEEVFCEKGYHEASIDEIA
                     ARVGIAKGTVYLHFPSKEDLLAALFRRDTEQVIAEVETIASSLGRSAREKLEEILHLL
                     YGELFKKRTRLFYSMYNSPEMRALLAKKEQMHAHWEQLTGRIEQLLAEGQAAGDFNPE
                     LPTSVMLSLFLNLVSVRGYERLVVQEGLAPAEVARYLARIYFKGIAAEHKQC"
     CDS             590332..591684
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002213190.1"
                     /locus_tag="KTA_04970"
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="BBH92298.1"
                     /transl_table=11
                     /translation="MTHTVTRRGLLKRLTQGGLALTTAPLWTGMMLSACGSTSGGSSQ
                     ITVFADANPQGEGLAPLVPLFEKETGIKVNYQVISETEITNKASVALAAGDGSLDVTW
                     GGVSQLPRWETAGWIEPLDSYLADTSLVGKQFNPSDFIPACWQATLWQGKRYGLPTLL
                     DTNILMYRKDILAEHQASVPETIDELLAVCAQVNSTSIPAIVLRGKRGVHANIWIFNI
                     FFYGEGGHYYQGQQPGGPVPAGKLAADLTSPAAIKGLEIYSEFFLKHYTPAGSAAFDF
                     PETTATFKAGRAAMLVDDIAFGQEMVSALGDKVGFAPAPRGPAGQYPGFDTQMWFLAK
                     GSRNKEAAIKFMVWSTSPEIQLQAAKNGQYIGVTRQSTFNDPRFKEFVRPDLLAAFKA
                     DTPHLDLNHFVITPSFDVIGDYVSVAVTQAITGQLSPQAALAAAQQQAASYLATHPSS
                     "
     CDS             591888..592883
                     /codon_start=1
                     /gene="gutB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q06004"
                     /locus_tag="KTA_04980"
                     /product="sorbitol dehydrogenase"
                     /protein_id="BBH92299.1"
                     /transl_table=11
                     /translation="MLAAVLKGRGILEIEDRPEPPPPPPGYVRVAVRSVGICGSDVHY
                     YQEGAIGHFVVRAPMVLGHEVAGTVEAVGPGADGFPLGAVVALEPGIPCGKCHYCRTG
                     AYNLCPEVRFFATPPVDGAMQEYVLHPAEFTYLAPGLTTDEAALAEPLSVGVYAVREA
                     RIGIGTRVGIVGAGPVGILAALAAESAGGRVALVDVREDRVAAARQIGLEAYVQVPPA
                     LDDCEVVLECSGSSGGLRLAQQWVKRGGVLALIGLGEASSMMLDGLDLSLRGLTVRGI
                     FRYANVMPAAISILQRHRERLHIFLGTTIGLRSLPAFLEQKEYLKPLKTIVRVPE"
     CDS             592940..593944
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002213188.1"
                     /locus_tag="KTA_04990"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92300.1"
                     /transl_table=11
                     /translation="MAESLKRRSRLLVAGDRESGRPSPEPAIQRQPTSFQRLSGSRRR
                     PLSAEKLLYGVFLTPYSLAMLAFTLLALGFGVVMSLLNVDLLAPAPLAFAGLSQYLQA
                     LKDATFWSSLKLTLYFITVPVLLEVTLGLLLALLFQRSRLPTLLQALLLVPMFASPIV
                     TGFLWLMFFTPHLGGIDGLLAVFHLPVVAWLDNGQTALIAVTVADVWEWTPFAFVFLL
                     AAVRSLPAEPYEAALIDGANQWQTVRYITLPLLRTPLLTVTLLEIVNYLALLPLIYSM
                     TGGGPGTATEPLDLYAFVQGFEYFNLSYAAALLVILMGVMLIPALALIAGLRRGMVKV
                     "
     CDS             593959..594846
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05000"
                     /product="hypothetical protein"
                     /protein_id="BBH92301.1"
                     /transl_table=11
                     /translation="MLSASSLGDVRRQQALRQRRRQRVWRQVLMRTLRFLVTAALLLF
                     IVGPLIWLLLLSLKPSESIFSAGPFSPTLANYVAVVESSFFESLWHSVLIDGGATLLT
                     MVVALPAAYAIVRQLQHPFFRLMLTYNLAVRVLPGLILLVPLFVIFRRLELLNTFPGM
                     MLAYQVIGLPIAMTSLFGFFAEVPRAIEEAAIVDGASRLQVFWHISLPLARQGIVATT
                     ILVFMMTWTEFLFALVLTGNETVTAPVAILDFIKYANVDWGSLAAATVVLLLPSIAFG
                     FATGRAFIRGLTAGAIQGE"
     CDS             595122..596015
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011389020.1"
                     /locus_tag="KTA_05010"
                     /product="DeoR family transcriptional regulator"
                     /protein_id="BBH92302.1"
                     /transl_table=11
                     /translation="MSTPDGEEPVSDRSWVLSEVRRKTIAEIVLQEGTVSTANLSRRL
                     QVSEMTIRRDLKKLEELGILKRTFGGAIATGRSEDVAISQRAVQNREKKEAIARACAA
                     LVQPGEILLMDAGTTMAACAAALPEESGILVVTNGIMVVNSLLNKTGIQVYVLGGTLE
                     LAPQLITGISVIEKLRSLHADKAFITSSAMGEDGSISDANIHQSEIKRYMMQAASQKI
                     LAIDSSKIGHHSLNRFAHISDFDILVVDDQITPEHLARLGREAKRIIVAPVSSAAPPT
                     SLAKRSPEAAEPGSASRRMPL"
     CDS             complement(596137..597075)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05020"
                     /product="hypothetical protein"
                     /protein_id="BBH92303.1"
                     /transl_table=11
                     /translation="MLWGKEFPQRLIFGEEGFFTEPRYLPRQYPYYVARAFLSVQYDD
                     EPREDEEVYYWYRVAWEATEAFVERWGGVDEETLRRVLREGEGRDRLAAVFALGHSPF
                     EGVNEELAALLEEPDWLLRCAAACCLVLRRDERATPLIERYLALPTPIGVDGGGRVST
                     APQASGWYNLYKQLVPWMLAEWGPSSLLPALRDALLESCREGNDKRLSPAAAGSLKAS
                     AYALGRRGALGALHGVKLPVLRRWLSVLYMALGYLKAAERFSREALYEQLQGDTPLSK
                     EVLALLTEAFALPEQQAQSVLMSWQIERIDGLGVLL"
     CDS             complement(598206..598574)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05030"
                     /product="hypothetical protein"
                     /protein_id="BBH92304.1"
                     /transl_table=11
                     /translation="MSQRDMRAALQRRSEIEITVKGRSSGRAYTYPVWFILEGEALYL
                     LPVRGTETGWYKNLRQAPTLQVRAGQQTFATDVRLIEDQDRVAAITERFREKYGARQI
                     QAYYPLINVAVEVPLSGQPG"
     CDS             complement(598689..599090)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011975073.1"
                     /locus_tag="KTA_05040"
                     /product="cupin"
                     /protein_id="BBH92305.1"
                     /transl_table=11
                     /translation="MEIRRGGSQPSQQGPAATFTGRVRIDPLFEAPSPARVRAASVTF
                     EPGARTAWHSHPLGQILIVTAGCGRAQRWGGPVEEIRPGDVVWFAPGEKHWHGAAPTT
                     AMTHIAIQEELDGKVADWMEHVSDEQYGQQA"
     CDS             599442..600404
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259671.1"
                     /locus_tag="KTA_05050"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BBH92306.1"
                     /transl_table=11
                     /translation="MTITAIAERERQQDERTLRQLQAQREELAERIARAVPRDGAVEL
                     LEGLTLARLSSPSTPLPSVAEPSLCVIAQGRKEVLVERNRYEYDPFHYLLATVELPRF
                     SRVIEASPERPYLSLTLRLTPSQVTEVLLSAGYVPKRSSAHAVNVSPLDERLLDAVVR
                     LVRLLDTPEEAPVLMPLVTREIIYRLLIGEQGRRLCHLVLQGGLPSEIASAIAYLRRH
                     FSEPLRIEHLARELGMSVSSLHHHFKAVTGLSPLRYVKQLRLQEARRLLLNEGLDATS
                     VAFRVGYQDVSHFNRDYRALFGLPPVRDVQRLRQELARLGTGSD"
     CDS             complement(600636..602546)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010878180.1"
                     /locus_tag="KTA_05060"
                     /product="acetyl-CoA synthetase"
                     /protein_id="BBH92307.1"
                     /transl_table=11
                     /translation="MKLITPVVERWLEEARENPEAFWSKAAEQLPWLRRWDRTFEWTP
                     PTFRWFIGGETNLCYSALDHHVKRGWGGHTALIYLNERGERRLYTYAQLLHEVERLAA
                     ALRGLGIQRGDRITIYMPTFPEAIMLMLAAVRIGAIHLVVFAGFGAQALRDRIEASGS
                     RLVFTTDITYRKGKETNLKEIVDAALASGGGSVERVVVLQRGGRPVAMQAGRDLTWQE
                     FLAHASGQSGSYLPLEANEPAYILATSGTTAKPKLAVHVHGGYQVHIHSMGQWVFGLK
                     PNDVWWSTSDIGWVVGHSYIVYAPLIAGATTLAFEGALDYPTPDVLWQTVEEFAISGI
                     FTSPTAVRLLMKYGDEPPRRYNLSSLERVFCAGEVLNAPAWAWLQETVLRNRVPVIDH
                     MWQTETGGPIFGNPYGLGMLPIKPGSATIALPGIEARVVSPLDGAPLGPGEKGVMVIT
                     RPFPGLIPTLWGDPERYARDYWGVLPGVYYTGDSAHVDEDGYVWFAGRADEIIKISGH
                     RIGTIEVETAFLKHPAVAEAGVTGRPDELRGEVIVAFIVLKDGYEPSEALKQELLKTV
                     RTELGPVAVISELNFVNMLPKTRSGKIMRRVLRAVTLGRDPGDVSTIEDEASVSEARQ
                     AWQRLQADISSH"
     CDS             complement(602990..603886)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05070"
                     /product="hypothetical protein"
                     /protein_id="BBH92308.1"
                     /transl_table=11
                     /translation="MAEPENTYVIDPENAGELARLMQQDRLLTEGMGGLLPEPGITLP
                     EQGSVLDLACGPGGWALELAFEHPRLEVIGVDISRQVIDYARMQARSRGLENVHFHVM
                     NVMEPLAFPDRSFDLINGRLLFAFMLPEAWPKLLAECYRLLKPGGIVRLTEMEPMLTT
                     SRAYQTWMAYMSEALKRAGQSFSPDGRQFGITPVLPRLVREAGFASVQLRPSVIEWSM
                     GTEAHYAVLKDSLIGLELLQPFLIKMGIATKEELERLYQLATAEMQQEDFCGLWNLLT
                     VWGRKPADLEAPTAEETTSSDS"
     CDS             604476..605846
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000713000.1"
                     /locus_tag="KTA_05080"
                     /product="dehydrogenase"
                     /protein_id="BBH92309.1"
                     /transl_table=11
                     /translation="MPQKDVVIVGGGLTGLTAATYLARAGLQVAVFERAAHLGGRAAT
                     RQQQGYALNRGGHALYAGGAATRVLHELAISVPAGSPRNVQALLQGQFFAYPGEPATL
                     LSTALLTGAEKRELLTLLARLVLLRPGALASVSVQTWVDQHARSERVHRLLLASARTL
                     TYSANLELISMEPFLTQLRLSLRRPVLYIDGGWQTLVAGLQRAAERAGAHLSSGVPVT
                     AVLQDAGQVRGVELGDGRLYEARAVVLATEPADVTRLVADHRLSQRLAALRPLSVACL
                     DVALQRLPRPDRPVALDLDQPRFYSAQSLFARVAPAGGAVLHALRYLDPLALGDAQQH
                     ERELEELLDVAQPGWRALVVKRFFLPHLQVMGAVPTANGKGLAGRPEPRVAEIDGLYL
                     AGDWVGREGYLADACFASARQAAQLLLSDLARSGSSSRWLVGQGQSWRPRHSMGYHAP
                     DVLSAS"
     CDS             605934..606851
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011140671.1"
                     /locus_tag="KTA_05090"
                     /product="DNA-directed RNA polymerase sigma-70 factor"
                     /protein_id="BBH92310.1"
                     /transl_table=11
                     /translation="MTKTSEETARIFEAYRVLLFSIAYRMLGEASAAEDMVQEAFVRW
                     LQADERAVQSPRAYLTTVVVRLCLDQLRSARRQREIYVGPWLPEPLATAQAPELVATA
                     ELAESLSFAFLLMLEKLSPRERAVLLLREVFDCDYAEIAAALGTSPASCRQLLHRAHQ
                     RLEQDERRFQVSRAQQEALTAQFLRATAEGDVEGLLGLLADEAVFIADGGGKVRAALK
                     PIQGAKRVARGMLGALRKWFPPDLQPQLSEVNGQPAIIGLAQGKAVGVVLLELQGERI
                     RRIYGVVNPEKLHWLTERQIRSLSISNER"
     CDS             complement(606949..607821)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05100"
                     /product="hypothetical protein"
                     /protein_id="BBH92311.1"
                     /transl_table=11
                     /translation="MLASPQEQTRQPLPVPPDVEQAARSADLGLPQKHYRPSILVGLE
                     DFLIMPEIALYLSLGYLIVAIILRHNNILELLYEYFIILLLMAGFLLILGFPFFLLAL
                     FLYLFRGSWGVYVYERGFIYKRGRRVKAWLWDQIMAVWQEVSKETRMISAGDSLIEYS
                     KTNRFYILQIKDSKNFIFDIKLAKMQELIDFLDERIKNRLLPQVIAAFEAGETVTFGA
                     LRLNREGVSWKDKTILWVEIRAMTLTDTTLIIEKTDKKKAYWDLSPMPNISLFRSLKD
                     HIFQRYLGITEPGS"
     CDS             complement(608037..608870)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05110"
                     /product="hypothetical protein"
                     /protein_id="BBH92312.1"
                     /transl_table=11
                     /translation="MWHFTFPWLEFLLLSCAALGSLACATPYLLALNGETFKRAQQRL
                     RHPLWVLLLLQGGQSAALLVMAIGLGLPIAHRIGLGAPLLEGLLEGRSVTAQAQTLVG
                     PALWLGLGPAALLLALEILVFWPRLPESIRTAMPIPALWKRLLACFYGGIAEELLCRL
                     FLLSLCAWLLGFIWHLPGGEPAPGAFWLAAAVAALLFGLSHLPATATLTRLTPLLVGR
                     ALLLNGLAGLAFGYLFWRYGLEAAMLGHFSADLVFHVLGDSIAQAQRAAKAVKTTGER
                     S"
     CDS             complement(609133..611154)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05120"
                     /product="hypothetical protein"
                     /protein_id="BBH92313.1"
                     /transl_table=11
                     /translation="MLARLRVPRPHWWQAACASILLLCLLISALVLLNPLGAHRVSAA
                     GSVQVTVNANQSLGALTTLSRGLNTAVWDSNLLDSTASSAIKNAGIGMLRFPGGSTSD
                     VYHWQTHSLVAGQGWLDPNNTFDAFMGLVQAVGAQPIITVDYGAGTPSEAAGWVQYAN
                     KGGPGYSGPVPTYPGASSTGHTYGIKYWEIGNEVYGDGTYGASWEYNNNPHTSAAYAS
                     NVVAYSQAMKAVDPTIKVGAVLTTPGNWPDGVTNSASPQPWNQTVLSTACSAIDFVII
                     HWYPQNPGSESDSGLLASTSQIPNMVSTLRSELSQYCGSHASAVQILLTETNSVSSNP
                     GKQTVSIVNALYEADDYMTWLENGVTSVDWWTLHNGPVAGNTSSSLYGSAQYGDYGVL
                     ANGGCISGGPCEPAADTPFPTYYGLQMLSYLGSAGDTMVASSSNQTLVAVHAVRQANG
                     SLAVLLINKDPSNSYNVTFALNGYSAASSARVYSYGPTSSSISSTTVSGSPLPTISIA
                     PYTLTTVVFSQSSGATATPTPRPTVSPTVPPTPTATATAAPATPTPSPTPSPTAAAGL
                     SCAVHYAVTSQWPGGFTANLTITNTGTTAINGWTLQFTFPSGQTITQIWNGSYTQSGS
                     TVTITNLSYNASIPPGTTLGASPGFNGTWNGSNASPTAFTLNGRACSVV"
     CDS             complement(611449..611796)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05130"
                     /product="hypothetical protein"
                     /protein_id="BBH92314.1"
                     /transl_table=11
                     /translation="MLICAAGCARAGILLESIYFCPHHPEGTVPALAFRSHCRKPQPG
                     LLLQAAANLDLGLAQPWLVGDILVNCLTASCTHRESFVSSVSGEEALHEALTLFVAGE
                     GQELARQQQDAAR"
     CDS             612104..612505
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011975073.1"
                     /locus_tag="KTA_05140"
                     /product="cupin"
                     /protein_id="BBH92315.1"
                     /transl_table=11
                     /translation="MEIRRSGSQPSQQGPAEHFTGRVRIDPLFEAQAPGRVRTISVTF
                     EPGARTAWHSHPLGQILIVTAGCGRAQRWGGPIEEIRPGDVVWFAPGEKHWHGAAPTT
                     AMTHIAVQEQLDGRTADWMEPVSDEQYQGQV"
     CDS             612854..613303
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05150"
                     /product="hypothetical protein"
                     /protein_id="BBH92316.1"
                     /transl_table=11
                     /translation="MFRVHGDPATYRYSPESVHRSLAGSEAMLQLCRLHWAEHGFGYW
                     AIELAREQTVIGFGGLEQQRWREREVLNLYYRLTPSAWGQGYATEMARTALQLARTYL
                     SPLPVIARIRAANVPSQQVALKVGLRRLPEELEEPGYYIFASESSGW"
     CDS             613612..614823
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011027555.1"
                     /locus_tag="KTA_05160"
                     /product="MFS transporter"
                     /protein_id="BBH92317.1"
                     /transl_table=11
                     /translation="MNGVLLATWAARIPAVQARLALAPAALGSVLFGGAAGALAGMSG
                     GGYLAARYGSRRTVILATLSLCLMLTLVAVVPSLPLLIAAAALFGASAGAMDVSMNTQ
                     GVAVERLYGRPILNSFHACFSLGSLGGSVLGGLIAGYGISLLPHFGGVALVGALLTLC
                     AIPALLPSSHDQPASESAEGRRVLFARPSRATLALGLIAFCSLFGEGAMADWSALYLN
                     SNLHSGAGLAPIGYAAFSVTMMVSRSVGDTLTARLGAALMVRLGGLLAASGLALVLFS
                     PWLLLALAGFALIGCGLGVVFPLTLSAAGHLAGQGQATSTALAAVATCGYTGLMAGPP
                     TIGFLASLMGLRLALGIIILLSLGISLLAGATGGQQAPPTPGSRSPQTGQKGHSPSSS
                     TSSSGSLTTGD"
     CDS             complement(614884..615834)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259051.1"
                     /locus_tag="KTA_05170"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBH92318.1"
                     /transl_table=11
                     /translation="MVKHWQHNVTLYQLRVFLAVLRHRNYTHAAEELHLSQPAVSAQV
                     HELERLLGLPLFEQVGKRLVPTQAALMLEEHARKVMAEIEAAADALESLHRIEAGRLA
                     LVASTTIGNYFLPVALALFHRRYPRVEIELLIANSQVVYEEVRAGRRELGLIESHVES
                     VDDGLLLTPYRQDELVLIVPPWHPWAHLESLPLAALRDVTLLWREPGSGTRSVIEAAF
                     EQAGIRPAITLELGSNEAIKRAVAANMGVAIVSQAAVAAEVTAGWLSTVRIGDAALRR
                     TLHLVQRRTGHLSPAAQAFLTLLLEPEAGHEARERPDPGH"
     CDS             616446..616871
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05180"
                     /product="hypothetical protein"
                     /protein_id="BBH92319.1"
                     /transl_table=11
                     /translation="MPALYKQNRQHGDARLAPPPPPRERSFLLWPITVGGITETVTLI
                     AVMLLCASGQFTFLEYALAVIGICIPLVLSIYGFARLLRSEQQKADLREWEQALDTWS
                     HSFICTADQVIFTPAEQPCSADEKAATGEQSRQLAAAAL"
     CDS             complement(617128..619842)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05190"
                     /product="hypothetical protein"
                     /protein_id="BBH92320.1"
                     /transl_table=11
                     /translation="MDAYAPKITRWRRIARQGLVCGLILLFICSLVLVFPVLRLTPRA
                     HAAAPVQINAGGPAVAPFVADTDYSGGSTASTSAAIDTSGVTNPAPQAVYQSNRYGNF
                     SYTIPNLTAGAAYTVRLHFAETYWSAAGKRVFNVSINGQQVLTNFDIYAAAGGANKAV
                     VREVNATAAANGTLTIQFSTVVDNAQVNGLEILPAASAVRINAGGPAVAPFVADTDYS
                     GGSTASTSAAIDTSGVTNPAPQAVYQSNRYGNFSYTIPNLTAGAAYTVRLHFAETYWS
                     AAGKRVFNVSINGQQVLTNFDIYAAAGGANKAVVREVNATAAANGTLTIQFSTVVDNA
                     QVNGLEILPATASTPTPTPTPTPPAGTPNFGPNVYIFDPSMPSSTIQSTLDAIYSQQQ
                     TNQFGTNRYALLFKPGTYNVTVNVGFYTQVLGLGRSPDDVVINGAVNLDAAWMNGNAT
                     QNFWRGAENLKIIPSGGWNKWAAAQASPLRRVDIQGNLLLWDGGWASGGFLADSVVTG
                     QTQSGSQQQWLSRNDQLGSWNGGVWNMVFVGVNGAPPQSFPNPPETVINQTPVIREKP
                     FLYIDQTGNYYVFVPALRSNSQGTTWANGAAAGTSIPISQFYIAHPGDSVATINNALA
                     QGLNLLFTPGVYQLNGTINITRPNTVVLGLGLPTLVPQNGVIPMTVADVDGVSIAGLL
                     FDAGPVNSPVLLQVGPSGSTQNHAANPTVLSDVFFRIGGAGPGQATQSLVINSNNVIG
                     DDLWLWRADHGSGVGWTVNPAANGLVVNGNNVTMYGLFVEHYQQYEVIWNGNGGRTYF
                     FQNEMPYDPPNQAAWMNGSTRGYAAYKVANSVTSHEAWGVGSYCYFNVDPSIVADRAF
                     EVPDTAGVTFHDLVTVSLGGVGTIQHIINNTGGPSNSSNTTAYLVSYP"
     CDS             620220..621320
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011029843.1"
                     /locus_tag="KTA_05200"
                     /product="transcriptional regulator"
                     /protein_id="BBH92321.1"
                     /transl_table=11
                     /translation="MIPDWLCYNRSETFRGEQAQHKSMARRHNTDGRPTIAQIARIAG
                     VSVPTVSKVLNGRADVSLPTREKVERIIQEYGFVRNRAARALRKGKTGLIDLLLPRLD
                     DEYYLPILEGVAQVLREAGLRLVLTATDYKPEEEVRWINTVTDHSTDGILVVLPSERA
                     IEQLERSGLPFVLIHNQGGLQAMAPSVRITSWEGGFVATTYLIRLGHRRIAYIGKTAP
                     ARDAIERIAGYRAALDAAGLPLLPELECDGDFTETSGYQATLRLLEQEEPPTAIFAGN
                     DRQAAGVYRALHERGLAIPEQMSVVGFDNLPYTEIMNPPLTTIHAPRLELGRTAASML
                     LRLINGEQLEMPRVVLPTHLVERQSCCPPRAG"
     CDS             complement(621461..621949)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011091014.1"
                     /locus_tag="KTA_05210"
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="BBH92322.1"
                     /transl_table=11
                     /translation="MFTLRRYTPADQVAVEQLHVTVLKETGAYLGRGPWDDDVYAIEE
                     HYLNNGGEFLVGECDGKIIAMGALKRTDAERAEIKRMRVLPEYQGRGYGQRLLEALEA
                     RARALGYRLLHLDTSVLQTAAQRLYTKNGFREVGRAFYPQSPTSEEDRPLEMILYEKS
                     LS"
     CDS             622636..625602
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05220"
                     /product="hypothetical protein"
                     /protein_id="BBH92323.1"
                     /transl_table=11
                     /translation="MASLMSRAPLARAATAIQINAGGPAVSPFVADTDFSGGGTSSTS
                     HTVDTSGLSNPAPQAVYQTARLGNFSYTIPNLTPGASYTVRLHFAETYWTSPGKRLFN
                     VSLNGQTVLSNFDIFAAAGGPDKAIIKEFSATASPSGTISLQFSSLVDQAQLNGLEIL
                     PLASSGWTLVWSDNFSGPAGSLPSADNWIIDTGTGYPGGAANWGTGEVETMSNSTSNV
                     YLDGNNHLNITAINNNGSWTSGRIETRRSDFAAPPGGMLQISASIKQPNPANGLGYWP
                     AFSAMGSQYRGNYQNWPAVGQIDILEDVNGRNAEIATLHCGSAPGGPCNEYNGLTSGL
                     ATCPGCQSGYHTYSVVIDRSLSDEQIRWYLDNQQIWIVRESQVGVSAWQAAVDHSFFL
                     IFDLAIGGSFPNTVCSCTTPTSATSSGGTLSIASVAVYQKTGTPPPALTTPSTPSGAS
                     VVKVTGTQGNWQLLVNGSPYLIKGVTFGPPNAAALAYMPDLQALGVNTIRTWGTDSST
                     QSLLNAAAAYGIKVINGFWLSQSADYLNDSAYKASQLSAIQNLVNTYKNSPAVLMWDV
                     GNEVLLNLQNTFSGTQLEQERNAYAQFVDQVAQAIHAIDPNHPVTSTDAWAGAWQYYK
                     ANAPHLDLYAVNSYGAVCNLKQDWLNGGYTVPYIVTESGPPGEWEVPNDANGVPQEST
                     DVQSAQGYATAWNCITSHSGVALGATLFNYGIENDFGGVWFNLKTGGWKRLAYYTVQQ
                     LYTGQTPPPSSTPPVISNLTLSTNTVPAGGQFTLSASVSNPSGNLLRYNVLFSSKYVD
                     GSTGLRYATFSQTGNSTFTVTAPKVLGTWKVYLYAYDGLGNVGIETRSFKVVPPPVNG
                     TNVAIGKPTTASSYQTTGNGAPYPPANATDGNLSTRWASDWSDPQWIMVDLGQVRQIS
                     HIQLIWETAYGSAYQIQVSNDGATWTTIYATTNGTGGVDDFDVSGSGRYVRLYGTVRG
                     TPYGYSLWEFGIYTPA"
     CDS             complement(625806..627011)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011338170.1"
                     /locus_tag="KTA_05230"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH92324.1"
                     /transl_table=11
                     /translation="MAFLELQELTKSFGRTRAVDGVSLAVEQGEFVTLLGPSGCGKTT
                     ILRLIAGFEQPDAGRILLDGDEITARPANRRPMGMVFQSYALFPHLTAEQNVAFGLRL
                     KRLPSAEVRRRSRELLALVGLAERARHYPHQLSGGQQQRVALARALAIEPKVLLLDEP
                     LSALDAAVRVTLREEIRRIQQQLTMTVIYVTHDQEEALAISDRIAVMVRGRLEQLGTP
                     EEIYRRPRTAFVAGFVGTSNRLRARLERAAEGSCLAHGLRLRVTPQPELADGTSVLLV
                     VRPEQVTLRPADDGQAASAAAQGEEENTLLGCVELRTFLGAITRFRVRTDGGQLFTVD
                     RPAVEAGPLLPGQRVALSFPPDACLVLPLSESEAEPFSGSESRPAESLTERAGQHGVR
                     QPEPAGERG"
     CDS             complement(627072..628031)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006310499.1"
                     /locus_tag="KTA_05240"
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="BBH92325.1"
                     /transl_table=11
                     /translation="MLSISRRLGKQRQGPAGRGIARPTENAKPEPRGRRGGALGARLV
                     LLLVLLYLLIPLGATLAFGLNSGRGWGDLALLGAVFADPDFGQTLLTSLGLAVTSTLL
                     VVLLLTPTAYQVRLRLPQARPLLEALALLPFAVPPIVLGTGLLQEYNGAAANNPLVAL
                     LSLGLVPLLSKLVTTLDVPLVLICAYVVIALPFAYRAIDNSLQAIEVKLLTEAAASLG
                     AGWWRTLLLVILPNIWPGILTASLLTFSTVMGELTLASLFNSYTFPIYLDMTGQNDPH
                     RAALLAVLSFLLTLLCVLGMALATRPRMGRATLSGQIEGASLR"
     CDS             complement(628061..629005)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011976265.1"
                     /locus_tag="KTA_05250"
                     /product="ABC transporter"
                     /protein_id="BBH92326.1"
                     /transl_table=11
                     /translation="MVTQVPRVQEEQLTTHAAAASQGQRRRQSGLLTALIAWSTLVPF
                     LLFCLLFELLPVVITIQGSLTNGGSGGLSLASYQRLFAQASNLRAFQNSVALSLVTAL
                     IGGLVGAIAAYGLANLRQGWLRKLLISFCSIAANFAGVPLAFAFVATLGVTGFVTVAL
                     RTWLHLDLYSMGFSIYQFWGLVLVYVYFQLPLMILVTLPALAGLRPEWREAAINLGAS
                     PAQYWRRVALPILWPSLVAGTMLLFANAFGAFATAYALAQGNINLVPILIDFLVNGNV
                     TVDFGLGDALAVGMIVVLLAAVVIYTTMLRRASRWQIR"
     CDS             complement(629245..630447)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011976264.1"
                     /locus_tag="KTA_05260"
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="BBH92327.1"
                     /transl_table=11
                     /translation="MRPEHSREQQLFTAIFGQQSRRHFLRRAGLAGLSASALATMLEA
                     CGSGGASTSATTAGVNMAGPIDMQTLIANAKKEGQLQAVGIPPEWADYRDILAGYTSH
                     YGLPISYKAEAEYSSAQELEVFKQSKTRPHGDIGDVGFKFGPLAVQQGLVAPYKHAHW
                     DDIDANLKDPDGYWCTEYYGAQAFVINTDLVKKPPTSFAELLRGNYKNMVGIDGDPRQ
                     ANDAFLAVFAAALANGGSLDNIQPGIDYFAQLKKSGNFTVARSSIANISTGEVAIAVM
                     WDYLGLGFRDQLAGKPHLEVIIPSDGSIAGPYVSVVNKTAPHPFAARLWIEYIFSDEG
                     QLFYLKGYAHPARYQKLVAAGKVPQELAAKLPPAEQYANVRFPSLAQLNAASTLVNNN
                     WGPQVLGA"
     CDS             631458..632141
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05270"
                     /product="hypothetical protein"
                     /protein_id="BBH92328.1"
                     /transl_table=11
                     /translation="MEQRIYRGNLSPDGLADYLVQTFGQNYTYLGWGGSPLSTIAQKV
                     GQGDHVLVQIAQAGSWSGRLRAALGVSISRLPDGISVSVGQSHWLQAPLTGILWGALF
                     FPPLLIFPLIRGIGAFSFYQDVWQAIETYCAQAQATRTSSSSLHGLYCTRCGAMNDEA
                     AQQCHLCGTALQQPQPVQAASVAGHELVTCGSCNERVVAARFCGNCGAPLTAPASANV
                     PPKESGHEV"
     CDS             632619..634220
                     /codon_start=1
                     /gene="nagE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004195339.1"
                     /locus_tag="KTA_05280"
                     /product="pts system, N-acetylglucosamine-specific iibc
                     component"
                     /protein_id="BBH92329.1"
                     /transl_table=11
                     /translation="MRVANPSPSGVIPSTPPSGLDRILGALQSIGRSLMLPIAVLPAA
                     GLLLRFGQADLLNLPWMAAAGNAVFSNLSLIFAVGITIGLTGGEGAAALAGLVGYLVF
                     TGVFNAIIPQVHGAPDPSISMGVFSGILVGLVTAGLYRRFHDIRLPDYLAFFGGKRFV
                     PIITALVTLVLGAIFGLIWPPIQGAINAVGQGIVALGPIGTGIYGCLNRLLIPFGLHH
                     VLNTYVWLQLGTYHTDHGIVTGDLNRYFAGDPTAGNFMAGFFPIMMFGLPAACLAMIR
                     RAQYPRLAAGILLSAALTSFLTGVTEPIEFAFLFVAPGLFLIHALLTGTALAICTALG
                     IHIGFTFSAGLIDYLINFSKANTTHPLLLLPIGLLYAVIYYFIFSFCIKRFNLATPGR
                     GSTATDSRSDWILPESQRGPRPGRVIAEAGATAESGGKAGDADERLAAELLAALGGKG
                     NVESVEGCITRLRLFINEPGRIDEARLKSLGAAGVIRHGKIVQVVMGTQSDRLASRMK
                     QLMKEGGSEQEQAAVPPVAPGEPQG"
     CDS             634395..634889
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05290"
                     /product="hypothetical protein"
                     /protein_id="BBH92330.1"
                     /transl_table=11
                     /translation="MRSLHLHKSELVILAPLDGQVVPLERVPDEVFAQKLVGDGLAIE
                     PWGSVALAPISGRLVRLFPGGHAFVIAAGPEDREEEAAVIVHLGLDTVELAGDGFTLL
                     AQEGDRVEAGTPVVRFDRARIAARGKSLLSPVVFSGSGTLVRRASGTVQAGQDMLFVV
                     KRSL"
     CDS             635214..635699
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05300"
                     /product="hypothetical protein"
                     /protein_id="BBH92331.1"
                     /transl_table=11
                     /translation="MLEALPGARWSNSYRLFRDGTLLAEIGPALSCRVDGLTVVGRSQ
                     AVRRGRYGLIQTYLLEVNGSLMAQAQPSGSGFGRQWSISYGGDEHGYRLRPRRPLAQT
                     FVLERNGTIVGTIRPQMRRLWWLRKAVLDVPDLPLPLILFVFWLVIIHTQGRDAGGGA
                     M"
     CDS             635848..636351
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05310"
                     /product="hypothetical protein"
                     /protein_id="BBH92332.1"
                     /transl_table=11
                     /translation="MLEAAPRHWYSSMTYVIRQDGQELAEIQRRFFRPEAIITTAEDQ
                     TYSIRRFGWMGPFILCLADGTLLAQAQTYYFKKHIDAYYLGQYYRLRPQSFWKWGTYL
                     LEQNGETVGSIRQKNSWGNKALIDIPGLPLPIVLFFFWLVHRNWQRRRRAAVSSATLS
                     ISARPAF"
     CDS             complement(636462..637025)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012582545.1"
                     /locus_tag="KTA_05320"
                     /product="transcriptional regulator"
                     /protein_id="BBH92333.1"
                     /transl_table=11
                     /translation="MRLARRYPVAAALKSEEDMRLALEADAPLLFLLKGDAFQLAPFV
                     EEARRRGKRVVVHVDLVSGIGKDRAGIQYLHQIGIDAIITSKSQLVTAARAEGLITIQ
                     RLLLLDDSGLEKGVRTIAHAGPDLVEVLPGIMFPEVAATLRRLLPGPFIAGGFIRTAE
                     DVARVQQAGAILSSSSTYSLWRNLSLA"
     CDS             638034..639536
                     /codon_start=1
                     /gene="glpK2_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9X1E4"
                     /locus_tag="KTA_05330"
                     /product="glycerol kinase 2"
                     /protein_id="BBH92334.1"
                     /transl_table=11
                     /translation="MAKYVLALDQGTTSSRAIVFNHDGAVVSLAQKEFPQIYPAPGLV
                     EHDPEAIWSSQLSVAQEALHKAGASAADIAAIGITNQRETTLVWEKATGKPVFNAIVW
                     QSRLTAPICDELKAKGFDSEIRQRTGLVTDAYFSGTKVKWILDNVPGVREKAERGEVL
                     FGNVDTFLIWRLTKGRVHVTDATNASRTMLYNIYTGDWDDVILKELGVPRAMLPQVMP
                     SSTVYGETDPEFFGGPIKIAGVAGDQQAATFGQACFEVGMAKNTYGTGSFMLMNTGDR
                     GVASKNGLLTTIAWRINGQTTYALEGSIFITGAAVQWLRDGLRAIASSSDVEQLAMSV
                     PDNGGVYLVPAFVGLGAPYWDPYARGTIVGLTRGSSIAHIARATLESMCYQTRDVLEA
                     MTADSGVRVKALRVDGGAVVNNLLMQFQADILGVPVQRPKVAETTALGAAYLAGLATG
                     FWSSQQEVAEQWAVDRTFEPQMSADQRDALYAGWKRAVERSLQWERPASA"
     CDS             639780..640682
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003974906.1"
                     /locus_tag="KTA_05340"
                     /product="aquaporin"
                     /protein_id="BBH92335.1"
                     /transl_table=11
                     /translation="MARQFTSRPSVLAGLWGECLAEFFGTMILLLFGDGCVATFALFT
                     NIGANNAATPFANEWIVIILGWGLAVMLGIYVAGAISGAHLNPAVTLALAVRGKFDWS
                     KVVPYWVAQVLGGFVAAAILYFVYQGALVHALSLNHLTIGQIADPNGYGGVFYTSPKP
                     FVGTFGAFCDEFVGTALLVGLIFAITDGRNQPVQANLNPLIIGLLVVAIGASFGLNTG
                     YAINPARDFGPRLWIALVSGGASLSANNYYFWIPIVAPLLGGVVGAFIYDFTIGKVLE
                     ARGMTKSGTAETKGEAVRVPSEAE"
     CDS             complement(641198..641497)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05350"
                     /product="hypothetical protein"
                     /protein_id="BBH92336.1"
                     /transl_table=11
                     /translation="MRALAPLLISQPHACEPRQRGDSAAATGDRREDERLAFRGERET
                     RGLSTQVPVPAVPAWYRTVSCRAIPHCPGSGRTHRRKRDAAEASDWVLHSLSSLA"
     CDS             641590..645033
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05360"
                     /product="hypothetical protein"
                     /protein_id="BBH92337.1"
                     /transl_table=11
                     /translation="MARRTLLTLLLTLLLLGLWSLSPAVPGVQARTAATARPWMNRTL
                     SPDRRADLLLAQMTLDEKIAMLHGWSGGSYVGYIPANTRLGIPALGLEDGPAGVADGM
                     TGVTAFPAPEALAASWDTSLMRRYGQDLGSEEWGKGANVALAPTVNILRNPQWGRSFE
                     TLGEDPYLTAMLASADIQGIQSQHVIATVKHYAANNQEYHRTTVSANVDERTLHEIYL
                     TAFEYAVKQGGVGAVMCSYNKVNNVYACENPYLLATTLKGTFGFPGFVMSDWGATHST
                     VAAITAGLDMEMPDSTYFGAALKQAVLNGQVSMATIDEAVHRILRTMFAIGLFDYPTT
                     GSPNATVTNAQHAQLAREAAEAGTVLLKNDGQLLPLDTNKIHSIAVIGPDASLSPQVT
                     GGGSAHVIPPYVVTPLQGITQRAGSGVTVRYAQGITTTGTLPPVEAQYLTPPSGSGQG
                     LLGEYFNNMTLSGSPVLTRVDSQINFDWNGQSPGPGVPATQWSVRWTGTLTPPVSGTY
                     TFSLTSDDGSRLYINNQLLIDNWRDQATTTETATIQLTAGQPYAIRVEYYQNGGASNV
                     ALGWSIPGQENALLSQAVELARSSDVAIVFVNDVESEGSDRSSLELPGAQDQLIEAVA
                     QANPHTIVVLNTGGPVLMPWVDQVPALLEAWYPGQEDGNAIAAVLFGDVNPAGKLPMT
                     FPRSASDLPASTPAQYPGINDQADYSEGVFVGYRYYDERGIVPLFPFGYGLSYTTFRY
                     SHLRVTPTQADYRSRIAVDLDVTNTGRRAGAEVVQLYVGIPATNVPEPPRQLKGFQKV
                     FLQPGQTKHVHFELNPRDLSYWDVHAHTWVVQDGTYSVQVGSSSRDIRLRGSFTVRVT
                     NGPRYVSVQAPQWLAAGESEWIETSFTNGGDLTAQAVRLGLQVPQGWQVRALSPSTFA
                     RVGAGQTVRTRWQVTAPAGTAPGSYSLQASASFVSADGPGRVQASASLTVPYPSLAAA
                     YNNVGISDDSNPSAGNFDGGGYSYSAQALAAVGLTPGATVTHAGVTFTWPNVPPGQPD
                     NVRTQGQVIAFSAQGTKLAFLGAAAFGTQSGTLTIVYSDGSQQQATLTLADWYANQPA
                     PGDELLATADHWNRPPGDTLGPHAVSVYYTALPLQAGKPVAYLILPTNSNLHLFAAAA
                     S"
     CDS             complement(645426..645659)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05370"
                     /product="hypothetical protein"
                     /protein_id="BBH92338.1"
                     /transl_table=11
                     /translation="MAEDAASQAELMTIVANGQPWHVPRESTIADFLGRLALTPGRVV
                     AMLDGVIVPRERFAETRLREGCRLELVTMVGGG"
     CDS             complement(645738..646475)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05380"
                     /product="hypothetical protein"
                     /protein_id="BBH92339.1"
                     /transl_table=11
                     /translation="MSEERASEAGGERTAGLPLGERPLLCLVTDERHPALVDIARQAL
                     EAGIDLLQLRGPGLSAAQLYELATILGPLARQHGARLIINDRLDVALAVGADGVQLGR
                     RSLPLAVARALRQRCGQSLLLGASVHSLAEAEEAVASGADYLLAGTIFPSPSHPGESG
                     AGPALIRQLRARWPRLPLLAIGGLSAANAAQVIAAGADGIAVISAIYSAASVAQAVDA
                     LRQALAAGNQARRQPGPPVAAYNSQAT"
     CDS             complement(646501..647286)
                     /codon_start=1
                     /gene="thiG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8DMP6"
                     /locus_tag="KTA_05390"
                     /product="thiazole synthase"
                     /protein_id="BBH92340.1"
                     /transl_table=11
                     /translation="MTEDLLTIGSRTFRSRLLLGTGKYRSFEEMRESLEASGTEVVTV
                     ALRRLDLSRPGQPTLLDYLDTERYTILPNTAGCKTAEEAIQIAHLAAAMGLPRWVKLE
                     VIPDPDYLLPDPVATLEATRQLVREGFEVLPYINADPVLARRLQDAGAVTVMPLGSPI
                     GSGQGLLNLPQIQIIIEQARVPVIVDAGIGAPSDAAFAMELGAAACLINTAVAQAGNP
                     VLMARAMKLAIEAGRAAFLAGRIPRRPQAVPSSPLTGLVGSPS"
     CDS             complement(647283..648551)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000333314.1"
                     /locus_tag="KTA_05400"
                     /product="glycine oxidase ThiO"
                     /protein_id="BBH92341.1"
                     /transl_table=11
                     /translation="MQRRTYDVVVVGAGIVGSATAYHLARAGQRVALLDRSGVAAEAS
                     DAGAGMLTPLAEAGASDLSDPLLRLGLAGLSHYETLAAQLERETGMWAGLVHLPTLYP
                     AFDDQQAEALRRDLAALQTLRPELRWLEADEVRQREPLLARHVRGAILSPAEGNVAIG
                     HLTRLLVRAAQLHGAELLAPRSALALLWDGARVQGVLTEEDPIEAPHVVLATGAWSSA
                     WSDRDQQAGIVFPLKGQLLALRPSGQPLRHTIYAGPLGYLVPKADGSVFVGATSERRG
                     FDKTPTAGGLIQLLEVVQRVAPALKEAAVERTWAGLRPVSVDGLPFIGEAPSSPGLWL
                     AVGHGRVGAITGPVTGFIIAELIQGRPVPYDLDLHPFAPERLGSWRRRLAPFSEAEAA
                     SRQLELFSQPSSQASQTVAQQDQADRRERP"
     repeat_region   649373..650951
                     /inference="COORDINATES:alignment:CRT:1.2"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_seq="gtcggaatactggcttgtcccgctt"
     CDS             complement(651238..653259)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204893.1"
                     /locus_tag="KTA_05410"
                     /product="hypothetical protein"
                     /protein_id="BBH92342.1"
                     /transl_table=11
                     /translation="MNGTESWQTSPGLQPARGGAGTRAGTGAGKKRNLRQSVGELRPS
                     QFLFTYGVGAIVDLPYLSVLVMGLEDWESLLPYDKPGGIEFIHEKRLLESVKAVLGPQ
                     VERLQALPRAPEDGGSPNPFDPSQLVGIPVTPFPRWLLCPTCRTLASIKSGLFSLRAN
                     LFHPDRSRYVHTHCPKSKKSPTAVPARFLIACRNGHLDDFPWHYYVHQGKPCPQARFK
                     LIEMGVSGEVTDVQIRCEECETWKPMSDAFGTEASKYLPPCPGRHPHLRQSEDCGEAP
                     RAILLGASNSWFPLLLSTLAVPEVQDPLEELVIRYWALLSKTASEREIALLRSIGQLA
                     GPLEAYDDGQIWEVVARRQRAQEEAEASGENQAARPSLLKVPEWRVLSQPQEAPDVDD
                     FRLRPVEVPEGYGGVLARVVLVERLREVQAMIGFTRIEAPDELLDLRASSAQSKPERV
                     HLTRQAPRWVPAIEVRGEGIFLQLWEEPLRRWEERLMGSVYARDFIRAHSEWRQRHGL
                     LADPVTFPGLRYVLLHSLAHALIRQLTLECGYGAASIRERIYALEPEDEHGPMAGILL
                     YTAAPDSEGTLGGLVSLGEPAQLGRHLRAALEHMQICTSDPLCAEHGALGDGSLHQAA
                     CHACLFLPETSCERGNKYLDRSVLVPTIVPERAGLAFFGELFPELLTGQ"
     CDS             complement(653256..656984)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204892.1"
                     /locus_tag="KTA_05420"
                     /product="helicase"
                     /protein_id="BBH92343.1"
                     /transl_table=11
                     /translation="MTRSQPLPEEDETQPRPERPAPQPARADLSQRPDESTAPAPAAE
                     GAGAPQTARQSGPQPGPVPTPDQLRDELQQLIIRDLLGPADGPEEAVEDQRLSERYLL
                     GVLAPRGARTQPEQLDDRPPLANSDEEGSGEESTLYSPSLCPSSIGLSFTVDGGATAL
                     QIEAAWGHYQRTDSERLPEPLNRGRVWKRHQRRGSTILPLRVGELGPWSPCEEQPDVR
                     VRGLARRIGERWSVSLFLVNEQQEPKRLPDQAWVFQPELSVSAPDGSPIFRQSLFESL
                     RSPAGSQSDPEEQQMAMLYRNHLTFAIGHNVSVHTDILPGDPTRATRLSTCVVPVYEV
                     RPVEAPTPDEIPELSGLVLDMKALAELPAEPEGYRARLQPLVDAYSAWIERQQASLDD
                     PASRLKPHRPAAERALSECRLACARIQAGIDLLTQSEEARRAFAFMNEAMWQQRLHSQ
                     WAEARRQGRSEPLESYDRPEGRSWRPFQLAFILLNLPALSDPRHPERSTSPDQAVADL
                     LWFPTGGGKTEAYLGLTAYTFAIRRLQGTIGGRDGQHGVAVLMRYTLRLLTLQQFQRA
                     AALVCACELIRRRDPERWGQVPFRLGLWVGQRTTPNTTEQSQEAVNQAHSRQHLGSLG
                     GIGSPHQLLTCPWCGSPIDHNRHIRVEPASSARGRTIIYCGDDLGRCPFSQRHSAREG
                     LPVLVVDEEIYRQPPALLIATVDKFAQLPWRGATQTLFGQVKKHCQRHGFWTPDLPDR
                     DQHPAVNKGPYAPLPAARSQEHPPLRPPDLIIQDELHLISGPLGSLVALYESLIDRLC
                     TWEIAGQRIRPKVVAATATVRRANEQIHALFLRRACVFPPAGLNAEDNFFARQRPDRP
                     GRRYLGICASGRRLKAVLIRVYVACLAAAQYLYERYGPSVDPWMTLVGYFNSMNELGG
                     MRRLVEDDVRSRLGHMDRRGLARRRPPVLEELTSRKSSVDIPKVLEQLERPFGAADGR
                     AERQPIDVLLATNMLSVGVDIKRLGLMVVSGQPKTTAEYIQATSRVGRAAPGLVCVVF
                     NWSRPRDLSHYEAFEHYHATFYRQVEALSVTPFAARALDRGLTALLVSYVRLLGDEFN
                     DNGGAQRVSQDNYRLAFQRYIKAALNELPARARAVTGDERCGKLVEEMLRQRIEAWQR
                     EAREREGTGSRLGYSDQTSEQWIGLLKHAGRGPWTIFSCLDSLRDVEPTVKLILDESE
                     PISEAGAGAGAGNESQAAGEQAGGGDDPSLSTGGATEV"
     CDS             complement(657272..661630)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204891.1"
                     /locus_tag="KTA_05430"
                     /product="hypothetical protein"
                     /protein_id="BBH92344.1"
                     /transl_table=11
                     /translation="MSVARQHAEWLSLLEISGPFLSLEVVQRVFPHGLEATQDEGEVR
                     RALRAAYGEWASPESGWRVEPRLHELWLRFVLTEVLGWSEELLAEGERLPSALEAPVP
                     DPTCTERLRPDLALLDPRSGRPRVLVQCWPPTQSLEKAPPKAQWRASPATRMMELLRA
                     CNVRLGLVTNGERWTLVHAPRGETTGYVTWSAPLWLEEPLTLRSFRALLSLRRLFGVP
                     DEETLEGLLDQSAAYQQEVTTQLGYQVRRALEVLVHSLDEVDRDMERELLRSVSEERL
                     FEATLTVMMRLVVLLSAEERGLLALGNPIYDQNYAVSTLQAQLREMADQVSEEVLERR
                     FDAWARLLATFRLVYAGSPHPELPLPAYGSPLFDPDRFPFLEGRPEGSPWYRTWARTP
                     RVHNRTVLHLLEALQFLEARGLDGSLERRRVSFRALDVEQLGHVYEGLLDHQVRRASE
                     PILGLAWPRRRECELPLRVLEEKLAEGREVLLRYLHEQTKADVATLARALDAPPESWP
                     FRLDRLRSACDNDEALFVRVRRFGGLLRTDTFGRPLVILPGSFYVTEGPERRVTGTHY
                     TPRWLTEELVRFTLEPLVYEGVAEGRPQEEWRLRSPEEILRLRVCDFAMGSGAILVQC
                     CRYLAEKLQEAWKEAEARYPGLPLSLRGRPLRAEEAAADPPPGALAPEEGEALLPSLA
                     DLTPEGLPRRQELDEPLPEEDEERERLALRLVAEHCLYGVDRNPLAVQMAQVSLWLVT
                     MQFGRPLLFLGHALRCGDSLLGVRLEQLLLFSLDAEASEVPWLAELVRQALAMALERR
                     QRIHALAERDLYAVLLKQQWQAEAEAALAVVRLGADLLVGLELQPEGERRRLSDELAP
                     QYAVLVAGLHERWQEPLTALAEALQWEEYQRLRTRVDELLGGRRPFHWSLEFPEVFGI
                     EPGAEVEGPWAGFDGLVSNPPFMGGKRISGPLGGDYRRYLVNRLAGGKRGNADLCAYF
                     YLRATGLVRPGGLCGLLATNTIAQGDTREVGLEQIVARNWCIARAVSSRRWPGTASLE
                     VAQVWLYRGAWRGPTLLDERPVSAISPFLTAGEEGHGKPYRLAANANKSFIGTYVNGR
                     GFILQPEEAAGLLAKDPRNRAVLFPYLNGDDLNSRPDQSPSRWVINFHDWPLEQAELY
                     PDCLRIVRERVKPQRERQNDKYGKEYWWNFLRTSPGLRDAIAGLERVLVISRVSKYMI
                     CAWQPTGIVYSEATCVIATDSDADFALLQSTIHADWARLHSSSLRMDQRYTPSDCFET
                     FPFPEDLSGLEAIGQRYYERRQALLLAWQLGLTQLYNCFHDPDDARPELEELRALHRQ
                     MDEAVARAYGWHDLDLGHDFHQTAQGLRYTISESARREVLRRLLALNHQRHAEEVALG
                     LSPSRKKGSGQRKSRARASDQPEREAQEGQSRRLREQPAAYQVGPLMPLAGPGERAAQ
                     DDEEEQDDDAWQAAHG"
     CDS             complement(661829..665152)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204890.1"
                     /locus_tag="KTA_05440"
                     /product="helicase SNF2 family protein"
                     /protein_id="BBH92345.1"
                     /transl_table=11
                     /translation="MTALTRQPPAPGQLVEVRQRRYAVANVRFGARRPLVIYEQGLFF
                     VRSHVVNENQSYHIVTLTSVEDDALGEELEVIWELEPGALIVEEHALPEVDRFDPPKR
                     LDTFLNAVRWGAIASVDTQALQAPFRSGIELEEYQLDPVVRAIEMPRVNLLIADDVGL
                     GKTIEAGLVTLELLLRHRARQVLIVCPASLQMQWRDQMRDKFGLEFRILDSERMRRLR
                     RERGLYVNPWTHFPRLITSIDFLKRERLLNLFREAVEAQREELAEEARQAQAQQREAE
                     KRSGRDGRKQEQKRATPVYRRPFDLLIVDEAHNVAPAGRGLYATDSQRTRALRLIAPY
                     FEHKIFLSATPHNGYPESFTALLELLDPQRFARGVPPNPKLLHQVMVRRLKSDLLAWD
                     GAPRFPRRRLEPLVVSYTQEERHLHRLLQEYGRRRLERTQESEERFAAEFVLKLLKKR
                     LFSSPQAFELTLRQHRETLAGRSASASPRPAVRGRQKTSVLRRQLEDLEEESDNDEEL
                     EEARQEAIEEASRVLSLPTPEEWHLLDELLTLAERASSHADSKAQVLINWLRQTLCPN
                     GPTAWRDERVIIFTEYRATQKWLYDLLNRAGLNGAGRLLLLYGGMPLAEREQVKAAFQ
                     ADPRQSPVRILLATDAASEGIDLQNYCHRLVHYEIPWNPMRLEQRNGRVDRHGQRAPE
                     VNIYHFVSSKYRDVPPGALESFEVGELEDDLEFLAHTLRRVEAIRTDLGKVGPVIAEQ
                     VEEAMLGRRRSLDTRQAEREAAPLRALLKQQERLEERVRLLHDRLLQSKQELQITPEN
                     VRAAVEVALELAKQPPLQPVEVRDPAGKRPPLQAFAVPSLSGSWAASKEGLAHPFTGQ
                     ERPLVFDHGQARQRDDVVLAHLNHRLVAMSLRLLRAEVWSSGERRKLARVTARLARAP
                     LSAPPVVVAHARLVLLGGDSQRLHEELLIAGGELRQGRLIPLPAAQLEHWLSLGTDAL
                     APESVRLRLQQLWPACQEPLRQALVSRMQERLNELRRVLSERERKEMKDMRMILHELR
                     RSIEQELAQPSVTQLSLFSKSEYEEYERNYAALRRRLEQIDQELEQELTLIRYRFENP
                     QSRLFPVALTFLIPEHLAS"
     CDS             665033..665353
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05450"
                     /product="hypothetical protein"
                     /protein_id="BBH92346.1"
                     /transl_table=11
                     /translation="MLIDDQRAPGAKADIGHSVAPLAHFDKLAGGGRLPGKSRHTIQI
                     LLAGTATGRPGPGRVSRLAGQGWLAGAVLWLAICLTGETGSRSLIPGLAVIVVCSQER
                     SFTV"
     CDS             complement(665992..667785)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05460"
                     /product="hypothetical protein"
                     /protein_id="BBH92347.1"
                     /transl_table=11
                     /translation="MKPNLRLRHEREMRGWSQARVAEAIGSSEKNVSRWERGVSSPQP
                     YYREKLCQLFGKSARELGFVEDEFEVGAPSAAGAAAGERGRQERVIDPTIPPLPNEGR
                     GLVGRGALLAELVGQLCAGRSLALCGLPGVGKTALAVTLVHDARVLERFEAGVLWAGL
                     GPRPTVVEHLRRWEQLLGVPAAAASSAELSLEARARVLRAAIGQRRFVLVIDDVWELE
                     AALAFKVGGPQSVLIATTRFPRLALAIAGEGARTIHELESADGLALLAQWAPEAVAHD
                     RRAALTLVEEVGGLPLALTLLGKYLQAQAHSGQPRRLQAALARLRSSHQRLHVSEMRG
                     PLEQPPHLAWGTPLSLQSAIAVSDQQLDEQAREVLRALSVFPPKPNSFSEEAALAVAQ
                     APPEALDALIDAGLLESSGSGRYLLHQTIADYASAHLRDPQAGERLVAYVTDLLERHG
                     DDDAALELESRNIVAGLQYAFENGRHARFIRGVLAFAPFLRRRGFYDLARLYLQRAYQ
                     IAIWSSDMLTQVRLLLGLGEVALRQGDLKAAGGYLREGLTLAREGGLRREQRRLLRLL
                     RYLAWRQEDAERAAAYGRELAALTAEGADGD"
     CDS             complement(667865..669490)
                     /codon_start=1
                     /gene="hyuB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010881258.1"
                     /locus_tag="KTA_05470"
                     /product="N-methylhydantoinase B"
                     /protein_id="BBH92348.1"
                     /transl_table=11
                     /translation="MVDAISLEIFRSALTAIAEEMGAVLMRSSYSPNIKERRDFSCAL
                     FDARGRLVAQAAHIPVHLGSMPDSVAEALVAFDRFAPGDIIALNDPFLGGTHLPDITL
                     IAPIFVEVEEEQRLIGFAANRAHHADVGGMAPGSMPLATEIYQEGLIIPPLKLWEAGQ
                     PNRALLALLLRNVRTPDERRGDLAAQVAANRTAARRLQELVDRWGLAALEEHIDALIE
                     YAARMARATIAAIPDGCYRFTDYLDDDGVSGECIPIAVTVTVRGSELTVDFTGSAPQV
                     RGNVNTVASVARSATYYVVRCLMPEDAPMNHGTFAPVTVIAPRGSVVNARPPAAVAQG
                     NVETSQRLVDAIFGALAQALPEVVPAASQGTMNNIAAGGIDPRTQQPFAYYETMGGGM
                     GARPGLDGLSGVHTHMSNTQNTPVEAFEYAYPMRITRYALRDGSGGAGRARGGDGLVR
                     EITFEAPAEVTLLTERRRLPPYGLQGGEPGRCGENWLYRRNGEATLLPGKVHFRAEPG
                     DRLVIASPGGGGWGRAAEPLEAPAAGAAEAARA"
     CDS             complement(669484..671595)
                     /codon_start=1
                     /gene="hyuA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010880423.1"
                     /locus_tag="KTA_05480"
                     /product="N-methylhydantoinase A"
                     /protein_id="BBH92349.1"
                     /transl_table=11
                     /translation="MTAILAGVDTGGTFTDLVLFQEGRLRVHKVFSTPHDPSQAILEG
                     LQELGALPRLRTLVHGSTVATNAVLEGKGARTGLITTAGFRDVLEIGRQTRPSLYNLR
                     VQKVPPLVPRERRVEVVERLNERGEVLIPLDERSLEEALTTLAREEVEAVAVVLLFSF
                     ANPAHERRVAEAARQRGWYVSASAEVLPEFREYERTSTLVLNAYVGPLIDRYLGQLEQ
                     ALPAGTGLRIMQSNGGSISSAMARREAARTLLSGPAAGVVGARFVARASGIERLIALD
                     IGGTSTDVALVDGAITETTDGRIGGHPTKLPMIDIHTVGAGGGSLAWFDLGGALRVGP
                     RSAGAVPGPAAYGRGGTEATVTDAHVVLGRLLPEAFLGGSRRLDVALARQAVGRIAER
                     LSTSLEEAALGIVRIANANMEAAIRLISVERGLDPRHFTLVAFGGAGPLHACELAAAL
                     SIPRVLIPAAPGVLSALGMLVADVLKDYVRTLMLPIDQEQAQATIAATLQALEEQGRS
                     DLLREGFAPEQIQIERYLDLRYVGQSYELTIPFEGHCARAAQQFHLAHERRFGYSDPN
                     EPVQVVNVRLKARGLVEPPVLERQPLQPEAVAQPLERRRVIFAGEGGPVAHEAAIYER
                     GGLVPGVQFAGPAIVTQYDTTTVVPPGWRARVDAVGNLLIELAGDGPARAQHGQQQRE
                     AAAPATRTAQVRLAEEEMHAW"
     CDS             complement(671752..672567)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I1Z9"
                     /locus_tag="KTA_05490"
                     /product="UPF0317 protein"
                     /protein_id="BBH92350.1"
                     /transl_table=11
                     /translation="MQREELARLSAAEARQLIRTGRWRRPTTGLALGHVQANLVILPA
                     DWAEEFAEFCRLNPQALPLLEMTAPGDPEPRRLAPGADLRTDLPRYRVYRAGRLVEER
                     EDLLPLWRPDLVAFLLGCSFSAERALLEAGVRLRHLEEGRNVAMYRTSVPCRPTARLH
                     GPLVVSMRPLKRDEVERATEVTARYPLAHGAPVHSGEPATLGIADLARPDWGDPISLT
                     SDEVPVFWACGVTPQAVIMESQPPLAITHAPGYMFITDWRDQDIDQRTGACAL"
     CDS             complement(672692..674014)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013230109.1"
                     /locus_tag="KTA_05500"
                     /product="MFS transporter"
                     /protein_id="BBH92351.1"
                     /transl_table=11
                     /translation="MNVEQGHSGSSLAAPQRSRLLSLDWYRTLRGSSRHAFWAAFLGY
                     ALDAFDYQIFSFVLTATAAAFGLTTGQSGLIATVTLVVSAFGGILAGVFADLIGRVRT
                     LMLTIAVYSLFTFLSGLAPNYGFLLLFRSLQGLGFGGEWAAGAILIAEMADPAQRGRV
                     LGMVQSSWAVGWGLALVAYTLVFSFFPASIAWRISFCLGILPGLLTLYVRARVPEPEV
                     FVQTRAAEQQAAGGQVRSTRSSLLQIFQPDLLGRTLAATLLAIGAQGGYYAIFTWLPT
                     FLKTVRHLSVVGSAPYLAVVIIGSFIGYVTSGYINDWLGRRPTFAIYALCSAALIFLY
                     TQIPTGANGLLLVLGAPLGFFASGIFSGFGSFLAEIFPSRARGAGQGFCYNFGRGVGA
                     FFPTIIGFLSAAIGLGGAIGFGACAYALCLIALLLLPETRGKRLVAVD"
     CDS             complement(674940..675497)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05510"
                     /product="hypothetical protein"
                     /protein_id="BBH92352.1"
                     /transl_table=11
                     /translation="MGDSSQTADKGRAIEVAGKPESGATTAGALVISLRDVLIILAAF
                     LGIFLALILVLSNGRLTTTSDIVAVLSVVISGISTITAAAFGVAVGAQAGSQAGQAVA
                     AETKRQVAGIRNQALPNLERLEEGFKLMESEMLKLPLENRAFDLNPDATSRGPSQPIA
                     IPQELLGKMRMSLGAIRGALETLPG"
     CDS             complement(675663..677486)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000966715.1"
                     /locus_tag="KTA_05520"
                     /product="beta-glucuronidase"
                     /protein_id="BBH92353.1"
                     /transl_table=11
                     /translation="MLYPLMTATREVFDLNGIWQFRLDPGQGLAERWYERPLREARPM
                     PVPASYNELGEEAAYREHVGRVWYERELIIPRRLLTQRLVLRFGAVAHAAQVYLNGQP
                     LVTHRGGFTPFEAEMNALAQPGKNRLTVLVDNTLDYSTLPVAHYREERLPDGTHLITD
                     TPNFDFFNYAGIHRPVRLYTTPPTYIRDIVLTSALADGDGLVTYRVAVEGAERDAVTV
                     RVTLLDAEGRAVARGDGAQGQLRIKDVQLWEPGHPYLYTCRVELWRAGAAGECLDSYE
                     EPYGVRTVAVADGQFLLNGKPFYFKGCGKHEDFPVHGRGLDEAVCVKDLNLLRWLGAN
                     SFRTSHYPYAEEVMRLADRLGLVVIDEVPAVGLHLNLSPSAGPERRQTWSELATAAQH
                     EQALRELIARDKNHACVVMWSLANEPATEEEGARAYFEPLLRLARQLDPQRRPLTIAL
                     QMLATPATDTVADLLDVIALNRYYGWYVHGGRLEAAQVLLRAELEEWRRRLPDKPILL
                     SEYGADAIAGMHDEPPTMFSEEYQAALLQTYHEVLDACPAVIGEHVWNFADFQTGQSI
                     TRVQGNRKGIFTRERRPKLAAHLLRARWRAIPDFGYKAGLR"
     CDS             complement(677824..678702)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05530"
                     /product="hypothetical protein"
                     /protein_id="BBH92354.1"
                     /transl_table=11
                     /translation="MDERSEEQPGRNTYVIDSEEAAELARLMQQDRILTEALGGLFPE
                     GRLLPEDGCLLDLACGPGGWALEVAFAYPHVEVIGVDISPPIVEYANAQAASRRLSNV
                     HFRVMNVMEPLAFPDSSFDLINGRLMCGFMRAEAWPKLLAECRRLLKPGGVIRLTEME
                     PTLTTSPAFERFSALGSLAMQRAGQSFSPDARHFGITAVLPRLVRRAGFVDIHLHPVT
                     IEWSADTPYHYPFFKDYLVFLDLIQPFMVRMGVASREELRRLYQQAIAEMQEEDFCAI
                     WNFLLVWGQKPEEEAR"
     CDS             679148..680563
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05540"
                     /product="hypothetical protein"
                     /protein_id="BBH92355.1"
                     /transl_table=11
                     /translation="MSYRDRSLSADGVAQEERAAALQRELQALLPALATAPLVEVASA
                     VLQTLREGTAAEHGALFLQWQAAQQGSRSTEGLQLLAVLRIDEEQARALTSVAGTGAV
                     WSSAMPDAGELRHSSVQTADACWLLLHLPLTGRRATAQAAAAASWPVLLALLGRSGRP
                     APAEAEAWLEASTAVIGANQHLVAALIRQALAAELLSGRLPPETDGRSSRESARGGTV
                     GPQSELLATLSHELRSPLAVISASVSTLQRHGRRLPLSERRSLLAAMEEASERLIQLC
                     DRFLELSELEAGLLRLEPTGVDPLSVVHEALLAAEQRLPAEQMGIFSFRVVLLDAHGR
                     PAERVPPVLADRRRLREILDHLLENAIRFSPEGGEISVILRPQPQPAPTAGMAPPAPA
                     VEICVSDQGRGISPEQLPQIFQRFYRGDTGLARQGGGLGLGLTLCKYLVELQGGQIWA
                     ESEPEQGSRFHLLLPALTLLT"
     CDS             680698..681438
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011391618.1"
                     /locus_tag="KTA_05550"
                     /product="DNA-binding response regulator"
                     /protein_id="BBH92356.1"
                     /transl_table=11
                     /translation="MVRKTTILCVDDDPHLLRLVSRNLELEGYAVLTAGDGEQALTVF
                     KEQQPDLILLDVMMPRLDGFSVCQRVREYSGVPIILLTARGQDQDKVRGLDLGADDYL
                     TKPFSIEELLARVRAVLRRAQFSSGERVSGLRSIITVGDLTIDDTRHLVMRAGREIAL
                     TPTEYRLLVYLAQHAGRVVTQDLLLERVWGAEYVGESHMLQVNINRLRRKLEDDPAHP
                     RYIRTKVGVGYMLVAPEDLAAQAGSPPA"
     CDS             complement(681702..682364)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012259303.1"
                     /locus_tag="KTA_05560"
                     /product="hypothetical protein"
                     /protein_id="BBH92357.1"
                     /transl_table=11
                     /translation="MKIIGVLKPRSVTQIPEPPLARFLFADTRMAWLWLLVRLYVGYE
                     WLTAGLEKLTGYNFAFGAGFGQRSGSPWVFSGHDGVAIQGFVKGALALSSGPHPAVQG
                     WYAAFLQHIVLPNAGLFAYLVTFGEVLVGLGLIFGALTGIAAFFGVFMNLNFLLAGAV
                     SINPVLGTLGLFLMLAWRIAGYYGLDSLLLPLLGTPWTGSLLSRLRAQRTEPLEAGTG
                     SR"
     CDS             682973..684271
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05570"
                     /product="hypothetical protein"
                     /protein_id="BBH92358.1"
                     /transl_table=11
                     /translation="MASPEERKAALEEQEQQQSPHAQAETDRPASKEQATTQRPIILE
                     AGSYRPEIYRQLAAGDGSIVFVRRRQARPAYPWRRIIAPLAVLVTALLIMVAVLSFGI
                     GSTLASGGGPASSGQEQSSAMSNMSGMSTSGQDANATATAAALPRATQSQGNQLATYV
                     RDPDGAKHFTLVAEQVLWEVVKGTWVPAYTLNGTVPGPMIRVTAGDHVRITVINHFHE
                     ATSIHWHGLEVPSQQDGVPGLGQQPIQPGQSYVYDFTVHDQDVGTHWYHSHYNDVNEV
                     AGGCYGAFIVDPRPGSPQARAAVHADVDYTAFIGTLPGGYYVINGKSFPDVQPLHVKH
                     GQTVRLRLIGADTLTTHPMHLHGHIFTVIAQDGHPLTQPYQRDTLQVAPGETYDLIFT
                     AWAAPGSIYPFHCHILSHLMNPGQNESEMGGLVMLVIYDR"
     CDS             complement(684503..686581)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05580"
                     /product="hypothetical protein"
                     /protein_id="BBH92359.1"
                     /transl_table=11
                     /translation="MTAHHPQGQDPKGGGAAVQTRLLKSPLFQQFLDLLPDALIVVDQ
                     QGRLVHANTQATTVFGYSRDELLGQTLDLLLPERFREIHRQHAAHYFKAPRLRPMGVG
                     LHLFARHKDGSEIPVEISLSPLRVGEQLYVIAAVRDMTAQRRAERERALLLQNLSVQG
                     ELLNQAYDAIILRDPLDRILLWNRGAERLYGWSAQEALGRISTRLLKTDFPEGQAAVR
                     TILERDGQWEGELTQVCRDGRLVIVESRQALVRDQQGQVLATLEINRDISERRQRERE
                     ARAMLAGHLSLLEHLFEALPFAVALVAGEAARLLLANQGVRRVWGADWPTGISFLEFL
                     QTHGIIISDIRGKALAPEELITLRVLREQRAIALYQEQIRRADGSTLPVLVSALPLRV
                     PSEALRGELLRQLEPGEPLALVIHQDVTPLKEAEELKDEFISIAAHELRTPLAALTGY
                     AEMLLRQTERGHGPPLAPWQREALEEIQQGTARLASLTEELLDLSRLQAGRLQLQRLP
                     ADIVPLVRQVGRRLQQTTARHQLEIQAPAEPLVALIDPHRLEQVLTNLIENAIKYSPQ
                     GGPIRVTVARDAGEQAPAVLISVQDHGIGIPRHQQGQIGGRFMRAENARAWGIEGTGL
                     GLYLARALVEQHGGRLWFESEEGQGSTFFVRLPLLGEESEERCDRLPRAEAEIATPGI
                     AEAGGGQALG"
     CDS             686492..686692
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05590"
                     /product="hypothetical protein"
                     /protein_id="BBH92360.1"
                     /transl_table=11
                     /translation="MLKKRRFEEPGLNGSPSAFGVLALGMVRCHDFSTVPRRLCRQPI
                     NEQIENSIGGRKRTPPTASLAA"
     CDS             complement(686910..687371)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05600"
                     /product="hypothetical protein"
                     /protein_id="BBH92361.1"
                     /transl_table=11
                     /translation="MGHIWQWQRWPLWLCAPLILLLVACGEAASSPGAASAPAGAQTV
                     TITEGDFSIKASLTTFKAGLPYHFVITNQGIVAHEFLIMPRSMGATTQHMSMEEMHHQ
                     ALAAVENIPPGATVTLDYTFPASAAGSHPEFACYLPGHYEAGMKLAVSVQR"
     CDS             complement(687934..689832)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3DBJ5"
                     /locus_tag="KTA_05610"
                     /product="glucanase"
                     /protein_id="BBH92362.1"
                     /transl_table=11
                     /translation="MTPHTFRRQSLWGRKHLLALLALPVLLLTGLFGSQARVHAASYC
                     QVTYTVVSQWPGGFSVNLVLQNTGSSTWNGWTLTFTFPASGQAVTQGWNGNFSQSGQN
                     VTVTNASWNGTVAVNSSVTLGFNGTWTTSNPTPTTFAVNGNTCGGSSSGSGTPTPTPS
                     PSPTPGSTPTPTPTPSPTPTPGATVTPTPTATATPAPTGTPSPAIHVDNPYAGAQGFI
                     NPYWAAEVKAGAASVGGTLGQKEAQVANYPTAVWLDSIAAVTGGTGYPTNLAGYLDAA
                     EQQAASSSLPIVITFVIYDLPDRDCAALASNGELSVSNNGLAIYESQFIDPIAATFSQ
                     AKYSNLRIVTIIEPDSLPNLVTNLSVPKCAEANSSGAYVQGIQYAINKLHAIPNVYIY
                     VDIAHSGWLGWTNNFQNAVTLISNTIKGTAAGVNSIDGFISNTANYTPTTEPYMTANE
                     LIGGQPVRSANFYQWNNYIDEMPYDIDMRNAFIAQGFPSTIGMLIDTSRNGWGGPNRP
                     TGPSSATDVNTFVDQTRIDRRYSRGNWCNQPGGIGARPQANPAPGFDAFVWIKPPGES
                     DGSSTLIPQGPNNPTGKGFDPMCDPNYGGNAMNNYQPTGAMPNAPVAGAWFQAGFDTL
                     VQNAYPPF"
     CDS             690645..691364
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011405389.1"
                     /locus_tag="KTA_05620"
                     /product="phosphohydrolase"
                     /protein_id="BBH92363.1"
                     /transl_table=11
                     /translation="MTFAFEREAVLTQVYHEVEERFLSQGRADLAHGWDHIERVYRLA
                     LGIGQREGADRFVVGMAALLHDLGRVAPAGEGPEQGQGQASAVQGRHHADLSHELAAE
                     LLTAYRVPEAEREAILHAVLAHSFSRGVEPRTLEARVVRDADRLDALGAIGIMRWAIT
                     GALRATVETRPYHPVDPFARSHAPDDRRYLLDHFYTKLLRLGESMSTATGRALAQERL
                     AFMQRYLDEFRRELTLEGLPG"
     CDS             complement(691448..691678)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012257242.1"
                     /locus_tag="KTA_05630"
                     /product="hypothetical protein"
                     /protein_id="BBH92364.1"
                     /transl_table=11
                     /translation="MPMLEVLRAADHPLTADQKRAFARAATNIFHQVLGTPPGRLRLF
                     FLETAPEGLDGLNEPQPAPAADPDQPGGNQTD"
     CDS             692004..692204
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011229067.1"
                     /locus_tag="KTA_05640"
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="BBH92365.1"
                     /transl_table=11
                     /translation="MLVLKVTMMEGRSEEQKERLIRLLSEAASRELGHPLDEVRVIIY
                     EVPKRNWGIGGRSVASREAGDG"
     CDS             complement(692270..693334)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05650"
                     /product="hypothetical protein"
                     /protein_id="BBH92366.1"
                     /transl_table=11
                     /translation="MKEGEGEAGERLPRRAALLVLAGLPQVLLGLGGGVGEASRKPRG
                     VREGRLREEVLPACAGSIRACWQLLNEGEFEAVERTVRGYLPWLREWAYEPSGVQQEA
                     AYLAAQGHFLLGLAAYHRLRFQQELEHDREGAVLSRLANEPVLLVKALAYLGQDYYHL
                     GAPLQMQGALEEASSLLGCVPLVLHRTVHTGLALAYARQGRAREALEHLSRAKAVSEE
                     PGLRWEELPVYLQADEGVWRLILREGWVHLELSRHGEESEHARAAERALAQIEGWSGR
                     PAVPERIRLEIVNRRGEAAIGRGELEEYVSYTVEGAEGAKRLGSSKRRQELVSNWRKA
                     LERWPWEKRVRELGELVLEL"
     CDS             complement(693383..694462)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05660"
                     /product="hypothetical protein"
                     /protein_id="BBH92367.1"
                     /transl_table=11
                     /translation="MKEGEGEAGERLPRRAALLVLAGLPQVLLGVGGGVGEASRWGAS
                     RKPRGVREGRLREEVLPACAGSIRACWQLLNEGEFEAVERTVRGYLPWLREWAYEPSG
                     VQQEAAYLAAQACFFLRQCAYHRLQFQQELAYGLEGVELSRLAGDSTLLVKALTKVSL
                     DYFHLLYHWQALKALEEAHSLLPQVPQVLGGTVHTGLALAYARQGRAREALEHLSRAK
                     AVSEEPGLRWEELPVYLQADEGVWRLILREGWVHLELSRHGEESEHARAAERALAQIE
                     RWSGRLAVPERIRLEIVNRRGEAAIGRGELEEYVSYTVEGAEGAKRLGSSKRRQELVS
                     NWRKALERWPWEKRVRELGELVLEL"
     CDS             complement(694511..696700)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05670"
                     /product="hypothetical protein"
                     /protein_id="BBH92368.1"
                     /transl_table=11
                     /translation="MMAGKEQLVIEAGDPLPLVRVWMLGPFVVELREADGVWRALPGG
                     VWRTYFYARPLLQRLLCAHGRRVERQQLQADLWPREEPSEAMERYPLTGAGQVRKLLG
                     RKELLRTCGQGYQLADQRWIWTDVDEALGLVGEARRVGLEREEALPLLEGAERLFRRG
                     RLLEEQGALWAVTYREWVGGERWRAGLALGRLYEVLGLESEAGEQYRQLYEEQPYKEE
                     ALLEVYGWWIRQGERERAERVLEAGRRRLEQEGLSLTEEGEEWIRRLREQGVRRAMGW
                     GERAGVVYWGGSKRTGEEERREVSSRKEAPQGLPMPAGVRMLPSGEGEEKAGEGGGEV
                     CGVRVLVWPLVWGRERRGSLRELERAIQEELKMSEREEHETETRTAQGQKLPRRAALL
                     VLAGLPQVLLGLGGGVEEASRWEASRKPRGVQEGRLREEVLPACAGSITACWHLLNEG
                     EFEVVERTVRGYLPWLREWAYEPSGVQQEAAYLAAQACLLEGLIAYHRMQFRQRLSLC
                     QEARALSFLARDDALLVNALGMLGTTAGYLDQPELAIASYEEARQRLSRVVFTSLKSS
                     IFWGIARAYAQWGREDEANAALGMARDQSMAEETDRGLPAYIVADQGIERLIILEGRC
                     YLDLGDRTQKSRLFSLAEQVLARADALDLLPERIRLEIINLRGEAAIGRGELEEYVSY
                     TVEGAEGAKRLGSSKRRQELVSNWRKALERWPWEKRVRELGELVLEL"
     CDS             697312..697878
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05680"
                     /product="hypothetical protein"
                     /protein_id="BBH92369.1"
                     /transl_table=11
                     /translation="MPGTVDIIDDSAVCRLIVALALQRAGFQVRCHSDSLAALQTIAR
                     AEEPPALLLIDLMLPQLNGYELTLLIRKQPRLSTIPIVLMSARHGLRERLRARLAGAN
                     AFLAKPFNIGHLVALVRRLTATSAPPTCPTAPPSASPSALPSPSPLPPTPFIIGSQTL
                     LTPVPMPETGRQPWRSPDPARASRWGQP"
     CDS             697918..698220
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05690"
                     /product="hypothetical protein"
                     /protein_id="BBH92370.1"
                     /transl_table=11
                     /translation="MKGSSQRRGFHRKWGPREPGPPRPREWEVLLLLRQGLEDDEIAR
                     RMGITASTVRGHIYRLRDRLGIASRAELLQRIPWEQCPPELQARAALASPPPTTDQ"
     CDS             698616..701957
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05700"
                     /product="hypothetical protein"
                     /protein_id="BBH92371.1"
                     /transl_table=11
                     /translation="MWKVITAMSTLRERQHHLASVNYSQLFAAIGKQLQRLQQEKRLV
                     GTEGAILQFKKQRLSFNIDNIAHAVASQAKELAHPFENSYGTSYASVYFAEDKARSKF
                     RSDLEQYILQPLRQAFSDLCHLQGQTPEQCANSLFQALSSFSIERFENFNPQKPPETI
                     NNLRYPLRKPSQVRRRRLHFQKQPGTKERTRLKGHKLTIDVQRIDALRDNIIAGIQAH
                     LETYRESGQADAEELKEALAILSQTEGPVADQINTLCETITDEVLARIQRTARLHYLA
                     YIRESLISDPRAGEEERQAARLLQTLIERLRQLEAYIQRYPDSHYIVSYGALPTQQRI
                     NLRDLFSRADAFDPLPIFGEVAGQLGEIINEPQGLKRFIHGLRLKLNGKVHVHGGEGE
                     PSFTFHLALLQPGSSAFAKRRQEAESNGTLEAFYTRIIRVAVLYFFAFKHWGDPHYQP
                     EHDFEQELLPVLRAGSQEEKEAALKRLAAELEPPAAQARDQKSKSTSALLQQLRTVLI
                     ASLTRPSHQARTYRTDLVVSLSTSVLARDANEIFLRHHFFSAELSFQEERRRELLKYI
                     TIERASLSSNVLCKLDVSLQIEPLYFLKVEEASEETIGSYQMSYDLGQLQVLPVILAP
                     VVADEQQKPSIRSLLRQRFGGLRHIALGYGYHYKGPAVRSEAAFVYRFTYLLLAYLFI
                     KLVVDNATAIEPDKCFIPLICIHVEKAEAGQEHYNDESVLHGITKVLEHLLGADYLTS
                     SQGLHRRTLEAGDQASYYMLRSALCSLYAALPHRFKPQAAPTAPNADPAQQGRLDKVA
                     ILVVSSRKCDYNTQARDDYLATIYGEVLGLEREGNDLVLRRLRTFADNHPSESMHTRP
                     DIIIEQARYCARQGYHHLLYVAHAPYSRTLGLTKGGARELFFMSQDIIQAMREVDADF
                     RVYPIFCDLYYVLDLQRSSARQDQESLYIDELRELADVVNDPSKRTVMFLNLYTGYSI
                     PAGSPEAQERVYNGVMAYSTVTHVYDQDPTYEQYIWSDLLAPDQPGTTKHDLIEAITL
                     LHFMRFERPFNPMMMKLDPYKRIIGDRSTGAQAIIPHMKGQCRFNMLAFLTHVRSVLR
                     SHELEQARHANRQQPPADQNPPPAH"
     CDS             702032..705862
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05710"
                     /product="hypothetical protein"
                     /protein_id="BBH92372.1"
                     /transl_table=11
                     /translation="MSVSEPAATQGAEGLEPAGSDQHFAEDMGRLFEIGFASGLLTGL
                     SQQACLPQAIYEYYRQELAQLHFEPLYSQLSKRSCVLSTWDREQLRYWALFILLRGYL
                     GGLSFCQEFLEALAALHSAPPDILYLQCRFHGPNSLGTYDKKESLAFAELLEQLRRRG
                     YALPPSEQIYESYLGRGHFPQADLLLLLRQGRHWRLLSIDLSVFTVRRLSDARSLTSA
                     DEICQLLLRELGYMRTRSVFSNLSIDTDAALLSGQELLASGLKHYFQAFSRQDKESYK
                     LIQAASYAHSFYQFLSFYHILPPEESLTFHIIGYTDRGSNSMTLRRDQLPVLAACAEI
                     YRERDKRQEIEASREQLLTVISNYVRRAFQNGGHFIRQLLERPSRNDGLHWICHEEWL
                     TDFVAMHAPLSAEQVTPELQALFPDTPCVGRNLRDLHAELVLRELEQPTPYLFLTGTP
                     GIGKTTAIVNFLKARARQGEGFLFIYVSPRKQVNIDIIHKFQQDHPEHPRCETLLALT
                     TNSAYIQANGGKHTVHYYSFHRHERFSVGGVDFLPAEGPEAQQQRPRERRLEEVEEGL
                     LIDRGQSVSGVLDSLCSAIDVALTEQLSPTIVATVAVQSLRRTSHEQATTLKHLKRMF
                     QSLLNQGSLQQAALEHLSQRIKYIFFMIDEVTGDESGAAFVEGVHSLLSQYQLFNQAA
                     IHCKVIVADASIVDPQLIQRHLEDSAYEPDKIYFRRATQPPQPLSRSEFSFKRQRAVG
                     INANGYPASALRLRYRVGLEIQPYEDKSALRASSQQLKSSLQEHLLEDLLTILQQPEA
                     PQVLIYIQDKQRLAELIAELQRRLGRFQLYEDYLAIHANISEEEKQNVKNYQNRVRAI
                     FMTASASRGLSFEGAREILVDVPRFAIEQNLMEILQVIYRGRGGAFDRAEKSITFYLS
                     DRFFYERREERASALRESLLALLNILLILKTALLTRIKGEGQIGHQRFLMIPIGGKAV
                     LSAGESLTSRLGRLVDQLDDLCYQHPENPAFRKVASDLINLLSQAHIELTPPRGRRGR
                     HRQQRAVSSPAKGQGQPRLYLTVLDQLAQEFEQAVIQGFDHLLTLPPLERAYIAGSLL
                     IVPLGERRLREEYWISLLKLLETDRRGEELLRRMEALRRHSHCNDEIRLLLKDGIALI
                     KELHRIARENTIIPHFSQETQHADQHYAIPLHTLLVSEVFRSQFQNRAENGDACAANF
                     RRLLESYLRALYPIDSVLPLGQHYEHFPFVIFRSYNLPEARRKIFLDHYLFMSHELNI
                     INMLLARSDQEEQP"
     CDS             706058..706948
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05720"
                     /product="hypothetical protein"
                     /protein_id="BBH92373.1"
                     /transl_table=11
                     /translation="MAAAEAEEPRAHRQSSADAEGTYFIDAEEAAELARLMQQDRLVT
                     EVMGGLLPELETLPATAQVLDLACGPGGWALELAFRYPDAEVIGVDRSPSTVAYANAQ
                     ARARGLSNIHFAVMDVTQPLAFSDASFDLINARFLAGFMRPQDWPRLLAECRRLLKPG
                     GVIRLTESEWGLTTSPATERYYALCSEALKRAGQSFSPDGRHLGITPVLAPLLRQAGF
                     TDVRLRGGVLEWSSGTPYHYSTFKNIFVMFDLLKPFLVKTGVAQAEEVALLYQQAVAE
                     MQADDFFAVWFWLTAWGHQP"
     CDS             707040..707936
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05730"
                     /product="hypothetical protein"
                     /protein_id="BBH92374.1"
                     /transl_table=11
                     /translation="MTDTRENDVTAPADAAQTGSTYPIDTEQVDELARLIQQDRLANE
                     AMGSLFPEGQTLPEGGRLLDLACGPGGWTTEVAFQYPSVEVIGVDISPNLVEYANTHA
                     RSRGLTNVHFQVMNVMQPLAFPDASFDLINGRFLASFMLPEAWPRLLAECFRLLKPGG
                     VLRLTETEGGLTSSPATERYFFLMAQALKRAGQSFSPDGRHIGITPVLARLLRRAGFH
                     DVRLHAGAADCSSDAPLHYAFFKDLFVAFTLIKPFLVRIGLISREELDQLYQQAVAEM
                     QSEDFCAISTWLTVWGHKPATP"
     CDS             708081..708965
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05740"
                     /product="hypothetical protein"
                     /protein_id="BBH92375.1"
                     /transl_table=11
                     /translation="MSYAEPEPQAQSQPANTYPIDPEQVDELARLLQQDRLATEAMGG
                     LFPEGQTLPEGGRLLDLACGPGGWATEVAFQYPAVEVIGVDISSNLVEYANTHARSRG
                     LTNVHFQVMNVMQPLAFPDASFDLINGRSLFSFMLPEAWPRLLAECFRLLKPGGVLRL
                     TETEWGLTTSPAVERYFALMSAALKRAGQSFSPDGRHIGITPVLARLLRRAGFRDVRL
                     RAGAADWSSDAPLHYAFIKDMVVLFELIKPFLTRLGLISREELDQLYQQALAEAQADD
                     FCAIWTGLTVWGHKPVSA"
     CDS             709112..709996
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05750"
                     /product="hypothetical protein"
                     /protein_id="BBH92376.1"
                     /transl_table=11
                     /translation="MTHTEPDPQAQSQPVSTYPIDSEQVDELARLLQQDRLATEAMGG
                     LFPEGQTLPEGGRLLDLACGPGGWATEVAFQYPSVEVIGVDISPSIVEYANAHARSRG
                     LTNVHFQVMNVMQPLAFPDASFDLINGRALFSFMLPEAWPRLLAECFRLLKPGGVLRL
                     TEGEFPLTTSPATERYFSLLAAALKRAGQSFSPDGRHAGITPVLARLLRRAGFRDVRL
                     RAGAADWSSDAPLHYAFFKDMFVAFELLKPFFVKIGVISREELELLYQQAVAEMQLDD
                     FCAISTYLTVWGRKPAAS"
     CDS             710107..710991
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05760"
                     /product="hypothetical protein"
                     /protein_id="BBH92377.1"
                     /transl_table=11
                     /translation="MSYAEPEPQAQSQPTNTYPIDPEQVDELARLLQQDRLYNEAMGS
                     LFPEGQTLPEGGRLLDLACGPGGWATEVAFQYPAVEVIGIDISSNLVEYANTHARSRG
                     LTNVHFQVMNIMQPLAFPDASFDLINGRLLFSFMLPEAWPRLLAECFRLLKPGGVLRL
                     TETEGGLTSSPAVERYFSLLAAAFKRAGQSFSPDGRHIGLTPVLARLLRRAGFRDVRL
                     HAGAVDWSSDAPLHYASFKDMFTGFELIKPFLTRLGLISREELDQLYQQALAEAQADD
                     FCAIWTWLTVWGHKPASA"
     CDS             711139..712023
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05770"
                     /product="hypothetical protein"
                     /protein_id="BBH92378.1"
                     /transl_table=11
                     /translation="MTHTEPDPQAQSQPANTYPIDPEQVDELARLLQQDRLVTEAMGG
                     LFPEGQTLPEGGRLLDLACGPGGWTTGVAFQYPSVEVIGVDISSSIVEYANTYARSCD
                     LTNAHFQVMNVMQPLAFPDASFDLINGRFLSSFMLPEAWPRLLAECFRLLKPGGVLRL
                     TETEGGLTTSPAVERYFSLLAAAFKRAGQSFSPDGRHAGITPVLARLLRRAGFRDVRL
                     RASAADWSSDAPLHYAFFKDMFVAFALIKPFLTKLGLISREELDQLYQQAVAEMQTDD
                     FCAIWTWLTVWGRKPAAS"
     CDS             complement(712304..713230)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258586.1"
                     /locus_tag="KTA_05780"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92379.1"
                     /transl_table=11
                     /translation="MIGQQVQQQQAAPALAAVTQRRLRARRSAFWRRLSDQVITVIAL
                     LIAVVWSLPTVGLLISSFRPPSLISTTGWWTAFLPPWHFTLQNYVQVITAQGLGRAFI
                     NSVIIAVPSTILPALIGSFAAFAFAWMRFPARNTIFFGIITLQIIPLQIALVPLLQIF
                     TNIGLTGQYAAVWLAHTAFGLPFAIFLLRNFFAALPRDLLEAAYVDGASNFRLFWTIV
                     LPLSLPALASLVIFQFLWVWNDLLVALIFLGGNPQSAPMTLTVASLVGSYGENDQVLT
                     AAAFLSMALPLVIFFALQRYFIRGILAGSVKG"
     CDS             complement(713227..714150)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528262.1"
                     /locus_tag="KTA_05790"
                     /product="alpha-glucoside ABC transporter permease"
                     /protein_id="BBH92380.1"
                     /transl_table=11
                     /translation="MDLSIEKAVPLALRPRRRRLRLPLEAWAWIAPAILLLLLFFIYP
                     FINTVQLSFENADSTRFVGLKNYQAIFTDPEMLSVLKNNLLWLVFGTLLTVGLGLVIA
                     VLVDRVKVEGLVKSALFIPMAISMVSASIIWRLVYLYRPPDQAQIGLLNAILVLFKLP
                     PQPWLVNTSVNTFALIAVYVWMWTGFCVVVFSAALKGIPDEIMEAARIDGANRWVLFW
                     RVIVPMISPTIGVVTTTMIINILKTFDIVYVMTGGNYNTDVVAVEFYRQLFTFGDYGL
                     ASALAVLLTLAIIPVMYLNIRRIRLEEGGQA"
     CDS             complement(714732..716138)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012258588.1"
                     /locus_tag="KTA_05800"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBH92381.1"
                     /transl_table=11
                     /translation="MNIYDRRARKELDQLVEEYLTTSNINRRQFLQRATAAGLSLSAA
                     TALLAACGGTSTGTVNTSSGNVPKVSSIDVLTQLSGAELAAFNAINTAFTKKTGIKVN
                     VEPTSDLRAVLSTRVRGNNPPDVAGMSSVPEFQQYAAQGKLLQLDKFFNMSQMEQQYS
                     RIWLDVSSYNGHLYAVIPRVNTKSTVWYSPKQFKANGYTPPKTWDEMIALSNRIASSG
                     KYPWSLGVEGGSSTGWPAADWVDQIYLSLNGPELSQQWVNHKIPWTHPSVKQAFQLFG
                     EIVNGKHYISGAPQSILATNFQDAAYLPFENPPKAYMYFLGDFTASFLKTQFPGIQPG
                     VDFDFFPFPTINPQYANSVTGIVNILSAFRDNDGTRQYMEFLASPEGQSIWPKQGGAV
                     SVNNQVPLSVYPDPVSRRTAELLLNAKYFSVGQDDLLPSSMEQEYWKGLLAYIQNPSQ
                     LDSILRSLEDAASRLYPS"
     CDS             complement(716231..716374)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="KTA_05810"
                     /product="hypothetical protein"
                     /protein_id="BBH92382.1"
                     /transl_table=11
                     /translation="MRGRALAKRLTLGQVSGAAADQGGAALGQGGQAYAEPANQLVSS
                     YLT"
     CDS             complement(717164..717976)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012706191.1"
                     /locus_tag="KTA_05820"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBH92383.1"
                     /transl_table=11
                     /translation="MREEKTQLPEADAAQATTTARGTRPVLEVRDLVKRFGGLVAVDH
                     VSLEIWPGEVVGLLGDNGAGKSTLIKVISGVYRPDGGQVLFEGQEVTFASPMEARRRG
                     IETIYQDLALCENLDAPANIFLGREPTRRRWGLLKELDEQYMLRETQRVLEQLDIRIP
                     DLRQPIRQLSGGQRQSVAIARAIYWNARLMIMDEPTAALGVAEQQKVLELVRTLRMRG
                     VPVILISHNMQDVFAVADRVVVMRRGQKVGERRIAETSSNELVGLMVGAERG"
     CDS             complement(718139..719236)
                     /codon_start=1
                     /gene="rbsC_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006311044.1"
                     /locus_tag="KTA_05830"
                     /product="sugar ABC transporter permease"
                     /protein_id="BBH92384.1"
                     /transl_table=11
                     /translation="MAKMLQQLALPAAKTKGSPLEVVSRFWAWLFLVLLLLFFSLTGP
                     GFFSFLNLQSIANDMALALLMSLGQTFVIIAAGIDLSTGFTMGFAAVIEAVVLNALVG
                     RLPLGLGLALPLSILIALGVGTLPGLVNGILIGRLRVPPFIATLGMYGIARGLGFIFS
                     GGGQPVSVQIPGVGDIGNGYLLYYHPAVGFSFFHAPTLPPGARARDLLAMLPFPLIVA
                     IVAFVLCHWLLSRTRFGRHTYALGGAPEAARRAGIPVARQTLKIYMLSAFLASVAGVL
                     YVLRFTNGDANAGDPLLLDSIAAVVIGGASLFGGEGTLVGTLIGTLIIYVIQNGLVII
                     GIDPYWQFVAIGAVIILAVMMDQAKARVLNR"
     CDS             complement(719504..720535)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011727630.1"
                     /locus_tag="KTA_05840"
                     /product="ribose ABC transporter substrate-binding
                     protein"
                     /protein_id="BBH92385.1"
                     /