LOCUS       AP018794             4521945 bp    DNA     circular BCT 20-NOV-2019
DEFINITION  Lachnospiraceae bacterium KM106-2 DNA, complete genome.
ACCESSION   AP018794
VERSION     AP018794.1
DBLINK      BioProject:PRJDB6766
            Sequence Read Archive:DRR198068
            BioSample:SAMD00112399
KEYWORDS    .
SOURCE      Lachnospiraceae bacterium KM106-2
  ORGANISM  Lachnospiraceae bacterium KM106-2
            Bacteria; Bacillota; Clostridia; Lachnospirales; Lachnospiraceae.
REFERENCE   1  (bases 1 to 4521945)
  AUTHORS   Ueda,K. and Morimura,K.
  CONSRTM   Lachnospiraceae bacterium genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JUL-2018) to the DDBJ/EMBL/GenBank databases.
            Contact:Kenji Ueda
            College of Bioresource Sciences, Ninon University, Life Science
            Research Center; Kameino 1866, fujisawa, Kanagawa 252-0880, Japan
REFERENCE   2
  AUTHORS   Ueda,K. and Morimura,K.
  TITLE     Whole genome sequence of Lachnospiraceae bacterium KM106-2
  JOURNAL   Unpublished (2018)
COMMENT     ##Genome-Assembly-Data-START##
            Assembly Method       :: RS_HGAP_Assembly v. 2; SMRTAnalysis v.
                                     2.3.0
            Assembly Name         :: Lbkm_1.0
            Genome Coverage       :: 109x
            Sequencing Technology :: PacBio RS II
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4521945
                     /db_xref="taxon:2093742"
                     /mol_type="genomic DNA"
                     /organism="Lachnospiraceae bacterium KM106-2"
                     /strain="KM106-2"
     CDS             21..629
                     /codon_start=1
                     /locus_tag="lbkm_0001"
                     /product="stage V sporulation protein AA"
                     /protein_id="BBF41327.1"
                     /transl_table=11
                     /translation="MYVKLEQHSEVYQKLVRIQDVATLYSTNPKIVSDLNRAILFRIE
                     SDKPAKYCFSIIKVVDVILKQYPDLEISNLGETDFIVSLEKKKKKHPYLEYVKVAVVS
                     MMIFFGGAFSIMTFNTDVSLSKVFDKTYELVMGDAKKGGSVLEIAYSIGLPLGIIVFY
                     NHFSHKKRNSDPTPIQIEMRKYEMDTNTALIQDAEREGKTIE"
     CDS             626..1048
                     /codon_start=1
                     /locus_tag="lbkm_0002"
                     /product="stage V sporulation protein AB"
                     /protein_id="BBF41328.1"
                     /transl_table=11
                     /translation="MILLGKYILLIIIGLAGAFSVAGGAFSFVTMIGVIPRLAAKTKT
                     IKYMQHYETAVILGGVLSNFMFVFQMRVPLGAIGLIVYGGFTGAYVGCLSIAIAEVLN
                     VIPIIAQRARLQIGISIIVVAFGLGKGFGAFYQLWWNR"
     CDS             1033..1566
                     /codon_start=1
                     /locus_tag="lbkm_0003"
                     /product="stage V sporulation protein AC"
                     /protein_id="BBF41329.1"
                     /transl_table=11
                     /translation="MVESLKEERKVTMAKKTTIKEVVNEKDSQLREEKYNQYVKQMTP
                     KHSWLLNLLKAYLVGGIICTIGQAIMNMYLKMGDMKQDTASAYTSLTLVLISVILTGF
                     NIYQKLAKFGGAGTVVPITGFANSVAAPAVEYQKEGQVFGIGCKIFTIAGPVILYGIF
                     SSWFLGVIYYIFRLFTK"
     CDS             1581..2621
                     /codon_start=1
                     /locus_tag="lbkm_0004"
                     /product="stage V sporulation protein AD"
                     /protein_id="BBF41330.1"
                     /transl_table=11
                     /translation="MSDKTSKIKGKQSVLFTNPPHVIGFSSVAGKKEGEGPLGSYFDM
                     VDEDPMFGMKTWEEAESKMQKLAADIAIQKAGLQNSDIRYLVGGDLLGQLIATSFGIM
                     SLEIPMFGIYGACSTMGEGLALASMLVDGGFADRTLAITSSHFGGAEKQFRFPNAYGN
                     QRPLAATWTVTGSGAVVLSNKEEGDNPIGVVVKGVTTGKVTDYGIKDSMNMGACMAPA
                     ACDVIYQNLSDLDLKEDYYDKIITGDLGYVGKDIVLDIMKEKGYDITDVYMDCGIEMF
                     CKEEQDTHSGGSGCGCSAITLTGYLLEKMRRREWNRILFIPTGALLSPVSFNEGHSVP
                     GIAHGVMLETIQ"
     CDS             2634..2990
                     /codon_start=1
                     /locus_tag="lbkm_0005"
                     /product="stage V sporulation protein AE"
                     /protein_id="BBF41331.1"
                     /transl_table=11
                     /translation="MDYIKAFLIGGAICAVVQIFMDNTKLLPGRIMVGLVCLGALLGA
                     VGIYEPFIDFAGAGASVPLCGFGSALFKGVRTAVDKDGFIGLFKGGFTASAVGISAAL
                     IFSYIASIIFSPKVKE"
     CDS             3064..3417
                     /codon_start=1
                     /locus_tag="lbkm_0006"
                     /product="hypothetical protein"
                     /protein_id="BBF41332.1"
                     /transl_table=11
                     /translation="MQQRLLNDLQDAGNSIEKFVIRMGGNETFVLMMMKKFLNDPTFV
                     KLQNSLKVFDYEEIENSAHTLKGVALNLGFDSLSEHCKELQSAAKNKNQLLVRKCNKD
                     VRCEYEKIVSMIQEE"
     CDS             3590..3778
                     /codon_start=1
                     /locus_tag="lbkm_0007"
                     /product="two-component response regulator yesN"
                     /protein_id="BBF41333.1"
                     /transl_table=11
                     /translation="MNYLKDIRIEQAKRLLVDTDEKIISISHRVGYENEKHFMKIFRN
                     ECGISPSEYRKSIRIGNE"
     CDS             complement(3819..6578)
                     /codon_start=1
                     /EC_number="2.4.1.129"
                     /locus_tag="lbkm_0008"
                     /product="multimodular transpeptidase-transglycosylase"
                     /protein_id="BBF41334.1"
                     /transl_table=11
                     /translation="MNFSKNEIAKKQRSIRSSSTRMKKKAQINGFRLFLVCVLIVISV
                     GIASGYGVIKGLIDTAPNIDSIDVVPTGYATFIYDNEGKVTQRLVGSSANRIYVKIDK
                     IPDVVKNAFISIEDERFYEHNGIDIRGIMRAFFTGVSSGGFSQGASTLTQQLLKNQVF
                     EGGNEASFITSMQRKIQEQYLAVQLEEKLTKDQILEYYLNTINLGANTLGVQAASQRY
                     FNKKVEDLTLSEAAVIAGITQSPTSLNPITNPDNNAKRRTEVLKKMLDLNYITQHQYD
                     EAISDNVYDRINEVNNDSTKSYGYNSYFVDELIEQVSADLQEKLGYSSTQANNLIYTG
                     GLKIHTTQDSALQETVDSVIDDPSYYPKDTVYELEWRFSVLHSDGTETHYSESNLKSY
                     FLTKDEKNNIPSSQKFTLYFKNKDEAKPYIKEYKKHVLKDGDKVEAETTNFKLQPQVS
                     FTLMDQHTGQVKALVGGRGDKNGNRTLNRASNTVRQPGSTFKVLSTYLPALDTAGMTL
                     ATVQDDSEYYYPGTSKKVGNWDGSKYKGLSTLRDAITNSMNVVTVKTLNEITPQLGFD
                     YLKKLGFTTLVDRRVNKNGSVDSDLNLSLGLGGVTDGVTNLELTAAYSAIANGGVYTK
                     PVFYTKIEDRDGNLLLENKAKSTQVMKESTAWLLTNAMEDVVKTGTGKMVRLSGTRIP
                     VAGKTGTTSKYIDLWFAGYTPYYTATIWGGYDYGETQRNTTYHKLIWKAIMEKIHKNL
                     PVKDFEKPSSIVSAKICTKSGKLAVDGICNEAEGGSTVRTEYFAQGTEPTEKCDVHVK
                     LKICKSSNKLATKYCPEDDVEERVYLLKDETGKTADTPYILPKGLDKTSCNVHSENSI
                     LDISPDETETPKPSNKPNNGDSQEPTPTPDPNSAPVANPNAGAVDAITPDPNVTVTDP
                     PQPGQ"
     CDS             6983..7276
                     /codon_start=1
                     /locus_tag="lbkm_0009"
                     /product="hypothetical protein"
                     /protein_id="BBF41335.1"
                     /transl_table=11
                     /translation="MKNLVLEGVKLLEAEEGRNFTIEYFITKKASRETDQTIYGVAVM
                     KKEGLNAEMESVDNITYNYDEIKKISEGLRKFDVTPMGLVEATDMLVTAIICG"
     CDS             7328..7981
                     /codon_start=1
                     /locus_tag="lbkm_0010"
                     /product="protein co-occurring with transport systems"
                     /protein_id="BBF41336.1"
                     /transl_table=11
                     /translation="MVEDYKIVYEGGSGEIVEKKSRFIATVLPVTTEEEAQFFIEKMK
                     KKYWDARHNCSAYVIGERQEICRCSDDGEPSQTAGKPMLEVLLGEELHNVVVVVTRYF
                     GGTLLGTGGLVRAYSKAVKAGLEESVIVNKHLGKKIHINTDYNSIGKIQYIAAQMEIS
                     FIDTQYTDSVDAYLMVPIAQVDGFVKKIIEATSGKAEIEYLEEIYYTFDTGEMILFE"
     CDS             8000..8176
                     /codon_start=1
                     /locus_tag="lbkm_0011"
                     /product="hypothetical protein"
                     /protein_id="BBF41337.1"
                     /transl_table=11
                     /translation="MSIPKDPVILLSFINTQLRDHYQTLEDLCKSYDITENEIIQKLQ
                     MIDYEYDKETNQFI"
     CDS             8195..8998
                     /codon_start=1
                     /locus_tag="lbkm_0012"
                     /product="hypothetical protein"
                     /protein_id="BBF41338.1"
                     /transl_table=11
                     /translation="MRRIKVFAIIALMGSLLLGCGLGKSSSQKMVEKVTKNTEANDSY
                     GANATLQLQMKIGGQQVNCKEQSELTYIKSPFEFNLRNHKTDVKGNTSDSEVYYNNQK
                     SSNIIYTCMDGESWLKQKYSKKAITNINDQYLVPIGLDVFLSNASSFKKVEGESGICL
                     KGTVEKDKILDVLDNSGVLSLLQIGKLQKEDLSKLADVSVTVHIDQDSEELTELEVDM
                     TKSFQDVVGEMFNQKEKLYEIDSCQLKIDMTEYNKKAIQVPEGLKLTNK"
     CDS             complement(9070..10032)
                     /codon_start=1
                     /locus_tag="lbkm_0013"
                     /product="hypothetical protein"
                     /protein_id="BBF41339.1"
                     /transl_table=11
                     /translation="MPGFITHYLLGQKTLEELDSNQVSNAISNHPNVFSLGTQGPDLF
                     LYYPGCFLPGKLKGLGSRMHREHTGEYLLTCIREIQKENDPKKKEIFLANVSGILCHY
                     KMDTICHPYIYAKSNYVQFQEQQKPHYTPYHCTLETYIDHKLCVHYLDQLPGRFHANE
                     VIHLSKAEREAIGERLAPCLNRTYFNSHSVINTAMVCDAISKMELELKLLSDPNGWKR
                     KLAKIIEQRILGYPLLSCLIPTDKVPENKDYLNLAHHKWHSPWEEEVRKESFLDLFEK
                     SKEDTLAILHLLNEYLEDPDSYFPLSLAIPDISYNSGLPLEEND"
     CDS             10164..11495
                     /codon_start=1
                     /locus_tag="lbkm_0014"
                     /product="ATPase, AAA family"
                     /protein_id="BBF41340.1"
                     /transl_table=11
                     /translation="MDLFDYMRSKNQDKESPLASRMRPTSLDEVVGQSHIIGKDKLLY
                     RAIQADKLSSLIFYGPPGTGKTTLAKVIAHTTSAEFTQINATSAGKKDMEEVVKTAKD
                     NAGMYGKKTILFVDEIHRFNKGQQDYLLPFVEDGTIILIGATTENPYFEVNGALISRS
                     IIFELKPLEKEDINQLIMRALTNEEKGLGIYNATITEEALDFLSEMSNGDARNALNAI
                     ELGVLTTKKNEKGVIEITLDVAKECIQKRNVKYDKNGDNHYDTISAFIKSLRGSDPDA
                     AIYYLAKMLYAGESVEFIARRIMISAAEDVGNADPFALVLATQAAEAVSRIGMPEGRI
                     ILAEAVTYVACAPKSNASYLAIDKALEVVKNEKVGSVPVHLMDAHYKGAAKLGHGMGY
                     QYAHAYKNHYVKQQYLPDELVGRTFYEMTEMGQEKSMKEHMDRIRREADEL"
     CDS             11590..12033
                     /codon_start=1
                     /locus_tag="lbkm_0015"
                     /product="hypothetical protein"
                     /protein_id="BBF41341.1"
                     /transl_table=11
                     /translation="MRQKLTRRSLMLVIALMIAITAQFAVTEQISAKTTTKNVVIAKI
                     NGNTMEYHKSISATRLIKNADWENIVGYGKKYKIKLASNAKFYVLDSYTFKTKKVSKK
                     RFMQNVKAFGYQKSKDKGVTYYWGMACKLTIKNGKCIKIVQRYQA"
     CDS             complement(12060..12293)
                     /codon_start=1
                     /locus_tag="lbkm_0016"
                     /product="hypothetical protein"
                     /protein_id="BBF41342.1"
                     /transl_table=11
                     /translation="MKKANRICAILGVIFLLGLYVASFIGAIISTPHSAALFQASVFC
                     TIVIPILIYGFTVVSKVLSGKNNDPMQDKTNKK"
     CDS             12447..12686
                     /codon_start=1
                     /locus_tag="lbkm_0017"
                     /product="hypothetical protein"
                     /protein_id="BBF41343.1"
                     /transl_table=11
                     /translation="MEEYLIKNTTREQREKIVDDALGYGDIGCENAVGAAMYEMYQPY
                     IDGKMELSEITKQYQTRYVSADYGEHDKGGCGYLK"
     CDS             12711..13760
                     /codon_start=1
                     /locus_tag="lbkm_0018"
                     /product="two-component response regulator yesN"
                     /protein_id="BBF41344.1"
                     /transl_table=11
                     /translation="MEMKQLAKHLIYDCANKETPDNYARFGIMSPEYASHGVEVKPYP
                     LPESEHLFALFWDIHDSNKLSATILPSSVPFTYNKEFQPGTRTQMHSHEYLELFYIID
                     GEYRQKILGNEFTFHKGELCLIDKNCQHQEILDGTSATILFLGITNVMFNDIMNRQIT
                     TERIASFLNMALLEQKTLQQYLYFRPQEGAASLVEDALIALVQELEHHDVATPFITQG
                     FLLRIFWVLSTQYEFSLSKKLRKKMKWILFEEVTDYMKKNLDKMSIRCLTEEFHFQED
                     YFNRLLKVQTGMTYTEYLQFLRLQMAENLLKDTDYSIDRIAKEVGYHNKGYFYKIFTE
                     RNQLTPAQFRKKLLD"
     CDS             complement(13757..16132)
                     /codon_start=1
                     /EC_number="4.1.2.9"
                     /locus_tag="lbkm_0019"
                     /product="xylulose-5-phosphate phosphoketolase"
                     /protein_id="BBF41345.1"
                     /transl_table=11
                     /translation="MTDNNVVEKQPITDEYLEKMNAYWRAANYLGAAQLYLLDNPLLR
                     EPLTMDQIKKKIVGHWGTVPGQNFVYVHLNRVIKKYDQDMVLISGPGHGGNFFVANTY
                     LEGTYSEVYPNIGEDIDGMKKLCKQFSFPGGISSHVAPETPGSINEGGELGYSLAHSF
                     GAVFDNPDLIVSCIVGDGESETGPLATSWQCNKFLNPETDGAVLPILHLNGYKISNPT
                     ILARISHEELEHFFDGCGWKPYFVEGDDPMTMHRKMAETLDTVMDEIKAIQKNARENH
                     DTTRPKWPMIVLRTPKGWTGPKVVDGNQIEGSFRAHQVPIMMDKPEHLEILKKWLMSY
                     HPEELFDENGKLIPELKALAPTGNRRIGSNPHANGGKLLRDLRLPDFRDYALDVPKPG
                     AVEAQDMIELGGFVRDIFKLNDKERNFRIFGPDETMSNRLGKVFEATNRDWNNEKFDT
                     DEFLANDGRVMDSMLSEHMCEGWLEGYLLTGRHGFFASYEAFIRVVDSMCAQHAKWLK
                     VCNQLPWRQSIASLNLILTSNVWQQDHNGFTHQDPGFLDHIANKKSDVVRLYLPPDTN
                     CLLNCFDHCIRSRDYVNVLVTSKHPRQQWLTMDQAIKHCSQGIGIWDWASNDQGQEPD
                     VVMACCGDTPTLETMAAVTILRKAIPEIKIRVVNVVDLMKLEPSTKHPHGLTDAEYDS
                     LFTKDKPIIFAFHGYHTLIHELTYRRTNRNIHVYGYQEEGTITTPFDMRVQNEIDRFH
                     LVKNVIKFLPQLGNRGSYLVQQMNDKLVAHKQYIHEYGLDMPEVRDWKWDL"
     CDS             16460..16978
                     /codon_start=1
                     /locus_tag="lbkm_0020"
                     /product="hypothetical protein"
                     /protein_id="BBF41346.1"
                     /transl_table=11
                     /translation="MKLRKKLVPAVMIGMLCMAASAPACAAETTEFSYLEENEPTYTV
                     SIPASVQMTKEGSDLTIKASDVAYLDGKKISVTIAGTDGYINQMVMEGDTTSPVYSSS
                     LRYQILKGDQVIETTGKKNQVVGVELASFTGNGKETLKVKPVIDGTGRRVEKGVTYTG
                     TMTYGIDLVDAK"
     CDS             17034..17483
                     /codon_start=1
                     /locus_tag="lbkm_0021"
                     /product="hypothetical protein"
                     /protein_id="BBF41347.1"
                     /transl_table=11
                     /translation="MLVVSIGFNYYQSNNRQNAAKNESGIAQNTVEWKKQIVNRSGSK
                     EGIKIPGYGEISVSEGAKEMEMALVNPKDNPCYFQFTVLISVEEKQVTLYESQLIEQG
                     RAITVFPVENLPSAGDYKMKVKINTYSLKDRKTPLNGAQVNTVLHVV"
     CDS             17647..19134
                     /codon_start=1
                     /locus_tag="lbkm_0022"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41348.1"
                     /transl_table=11
                     /translation="MGNTNEEKRKYKELGNRQKYVNFHLFSAIIFMSILSIFPVIKDI
                     MAGELFAMIRVSMIIICVVADVVAFNKDKTSKKFRYVAMGSFGILYGYSVVTADSIAA
                     LGYMIPLLFLCVLYSDIKFSTSAGAYAIVLIVIRLGMCAMGIFENNTTIIFLGVIFII
                     LAVYSILITRNLQMFNNDSYGALEDEKEAQQNMIEDILQIAGTVQGESEAIDRILDNL
                     TKTNETVTQSVKGISSGVLSVTENISEQTMMTGAIQENIQATQERTENIEKIAEKSQV
                     TITENLNNVNELKGQSQKITTVNNTVADRMHRLREKATEVQNITGVISGVAGQTNLLA
                     LNASIEAARAGEAGKGFAVVAEEIRNLSEQTRNASESINTILNELSVYAAEASESVRE
                     SLSATDNQNEYINTVYQGFEAIYHDMNTMDREIKAMGSDMKELTTANNEIVENINQIS
                     AASEEITSSVETTAEDVVVNEKSFVEMRTKFQTVLDKVQDFEKYR"
     CDS             19587..19871
                     /codon_start=1
                     /locus_tag="lbkm_0023"
                     /product="RNA polymerase sigma-70 factor, ECF subfamily"
                     /protein_id="BBF41349.1"
                     /transl_table=11
                     /translation="MQILVNVSKTMIKKKSRLTALDENLLEEQVTLFNIDEMLPLVME
                     LPLEFRMVTLLYYYEDFSTNEISKMLKIPNGTVKSRLARGREKLSQLIKW"
     CDS             19967..20494
                     /codon_start=1
                     /locus_tag="lbkm_0024"
                     /product="hypothetical protein"
                     /protein_id="BBF41350.1"
                     /transl_table=11
                     /translation="MVKETIEECESHTKRKRFKLPRVAVAAIAICVLAGSGIGTTAAV
                     KYFKTEAHCLKYPEERMKKVPKEKKDKYVEDLQEAPVDCDFYSREFTKKEDARMEVLT
                     KKYESKKLYPKGSLLQIKSKKEVDPDKVCFLAKISTFYLPERKLTDEELLQVIDFYYT
                     RDYSLNEQYDAHGAN"
     CDS             20739..21449
                     /codon_start=1
                     /locus_tag="lbkm_0025"
                     /product="hypothetical protein"
                     /protein_id="BBF41351.1"
                     /transl_table=11
                     /translation="MRKLRYLCIIMSVVVIGILTSNSVHAKGRASYQIQRVDQSVHNK
                     AGKVIAKFYYDRVILRGNTKAVKKINKDTKKVCDQFFHTYKKQFLGYVEDKDQPYGPT
                     AEEPYKCYVTSKVAYNKNGIISIKQYSDWFAGGVANSEYTGLTYNTKSGKKLSIVDVI
                     KGNSRTVKQKVERNVRKYLIKNSIVGSQLSSTMNIVKKKKIGDYNFYLYKNKVYVCFL
                     CYELELGNDYTVVPMSRK"
     CDS             21916..22206
                     /codon_start=1
                     /locus_tag="lbkm_0026"
                     /product="hypothetical protein"
                     /protein_id="BBF41352.1"
                     /transl_table=11
                     /translation="MAATFVPISEYDSKDLRKELDLPYTKQLKYMEHKKGNTYVEIQV
                     VDYEVAGAYSPSGMKSLTVSLVNGRKVRILAPFFSQMQKSSFIQDMINGGKE"
     CDS             22206..23732
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /locus_tag="lbkm_0027"
                     /product="DNA polymerase III polC-type"
                     /protein_id="BBF41353.1"
                     /transl_table=11
                     /translation="MRKNRENKGKSIIAFPSEYVVVDIETTGLYPGYDSIIEIAALKI
                     CNDKVVGSFSSLVNEGEVYVDEFITELTGITQEMVNNAPGIETVLPEFCEFVGDSIII
                     GQNISFDINFLYDCILENTNKYFRNDHVNIARIFRKLYPEETHYSLADIALRCNINYE
                     KAHRAAEDCLITYKALRYLHEEILNKYGEESEFEKLFKKNRNKNSKLKASDIIVEGIE
                     WDEDNPLFQKTCVFTGTLQNMQRKDAMKAVVGIGGYVGDNVTKKTNYLILGDLSYCKS
                     VRDGNSRKYIKAKEYKIKGYDIEVIPESLFYEMIDYRGEENVTEVQNYNYKEELYKMI
                     NEVIKETGIPKNSIQFNEQVDNKNKGEYLLQIFEEDWPKNTSLLNPKGVTSPVLIIKE
                     ENKGKYQGSIKIIMKKSQFEVVGCPKTVTSMKSGEDSILVHILRTDPILIPYIRKHII
                     HKLSIYKSKNSFSCCSQFKRCSDERHCVHENLLYSTGCFYRMHLDKDEIFYGKNRNID
                     "
     CDS             24331..24855
                     /codon_start=1
                     /locus_tag="lbkm_0028"
                     /product="protein export cytoplasm protein SecA ATPase
                     RNA helicase"
                     /protein_id="BBF41354.1"
                     /transl_table=11
                     /translation="MKGRAIMSLLQEWRDYAYAQDTNQQEGAMFWANYFNIEKGIYEQ
                     ILATPETVVTGTVKELADKYETDLSHFVGFLDGINDSLKTANPIEEMDENTTVSLDFD
                     SEKLYYNMCEARADWLYELPQWDNILTKERRKELFLEQRKSHTVVKEKKVGRNDPCPC
                     GSGKKYKKCCGANQ"
     CDS             25056..26720
                     /codon_start=1
                     /locus_tag="lbkm_0029"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41355.1"
                     /transl_table=11
                     /translation="MKSAFKNVSFKSKMIVSINLIVMLVLGVTTYASRLDVQKQIQEV
                     LMKRAGEEATQIAKQAELILEFNKENLQTFIDEITKENSHIAYAVVIDENVTAIAHSD
                     EEKIGRTYDDDYTVNAVKGSEQSTSRFYADVQKTWANDICTPIYVNGEKYGILDVGIY
                     ENELSSTVSNVVKKQLMYNAIAIIGICILVVTICTRLFSYIKKITYVCDQIGEGNLQV
                     ALEDKLVARKDEIGKIANGIEVLRGQIKEMVTTIGDEVVKIEGVADDLTSRASETVQS
                     GNEIAMVMLEINKGSAEQKVITDQFETISEEISTGMQQISVNIQEATDSTVETLKKAE
                     EGNQLLNLASNQMNMIDHGVKATRDQMVELEEKSKAIEEIIGIITGIAKQTNLLALNA
                     AIEAARSGEHGKGFAVVAEEVKNLAEGSTKAVEQIAAIIEEVLREIHIVTDYMEKSNK
                     AADEGIRVIDETKESFTHIFEAVQRAARQMEEISAATEEITAGTEELTAGSQDSSIIV
                     SKFATKVEQVSGLTETQNHSMEQVSNAVQELNELNRSLQVIVKSYN"
     CDS             complement(26775..27122)
                     /codon_start=1
                     /EC_number="3.4.21.88"
                     /locus_tag="lbkm_0030"
                     /product="LexA repressor"
                     /protein_id="BBF41356.1"
                     /transl_table=11
                     /translation="MEFNIRLRQLRQKHKLTQAELASILALKPTAISNYESRRNEPSF
                     SKLIALSKYFDVSCDYLLGVSDAYLPIGGEVLDKDIVDFFNMYQQLEEENAHKMKEYA
                     EFLLYQQSKSENK"
     CDS             27282..28652
                     /codon_start=1
                     /locus_tag="lbkm_0031"
                     /product="sensory box histidine kinase/response regulator"
                     /protein_id="BBF41357.1"
                     /transl_table=11
                     /translation="MMNIIVKGGVRMKNEDKIKFMLENTDEIVLFVDQDGNIEDCSDS
                     VFKNFGFLKEELLGKSIQMIFPKLELNSDVEKEMITAYCKNHTCISFYYGMHEMDGNY
                     LICARNVQKCMEVRRELERTKAQAEAAKNIKKEFLANVTHELRTPINGIKGLIKTLED
                     DELTRQQEETIEIIDQCCNNMVKLINNLLDSTKYQSGKVILEEKEFKLDEMLDHVLAL
                     HREKIYEKGLKFSYYESADIPNELVGDELRLSQVLNNLLSNAVKFTKSGQISLEVIAT
                     NITEDEVELFFLIMDTGIGVDEEEKDMIFNSFVQGDASITRRFGGTGLGLSISKQIVE
                     LMNGKIHMTSEKGVGSTFYFSVKVKRKESRNIVGETQERRTMIEQKDWKESVSENMKK
                     LILCIELESWIRAEEFVNLIKEEVEGVNPVLKKKAFLLALAVRKEDYEKSKKAFELFN
                     EELQNN"
     CDS             28664..29737
                     /codon_start=1
                     /locus_tag="lbkm_0032"
                     /product="two-component response regulator"
                     /protein_id="BBF41358.1"
                     /transl_table=11
                     /translation="MKEMTPLNQEANVLIVDDVSSNLVLLSEMVEQAGYVARPVISVK
                     QAIKAIEVCAPQLILLDVSMPDISGVEFCRMLKKRWDTKNIPIIFISALDSTMDKMKG
                     FEAGAVDYISKPFEFEEVTMRISTHMRLCMLQRELQSQNDRLQRLLKQQMDSLTKNQN
                     ALLLLLTEILCMHFSGFRERIKKVSTNAKILALSLQFSNDFRDCIDNDFVQCIELTSM
                     VQDIGLLGVPDEIVYKQEKLTREEEKIFQLHTSTNLAGIEELSKKKKNDKYMRMAMEI
                     AKYHHEEYDGSGYPEGLQGEEIPVAARLVAIVDRFEKLQQGYRQEKKYTREESIEQIK
                     ALGGTKFDPKMVAVFVKISNQLK"
     CDS             29829..30275
                     /codon_start=1
                     /locus_tag="lbkm_0033"
                     /product="iron-sulfur cluster regulator IscR"
                     /protein_id="BBF41359.1"
                     /transl_table=11
                     /translation="MKVSTKGRYGLRALVDLTVNSANSHVSLVSIAERQKISLNYLEQ
                     VFASLRKAGIVKSIKGSQGGYVLSKSPEKIKVADILRVLEGDFHVVDEGIFEEEEQDA
                     IRMAVKTLLWDKINEKVDEYLQSNTLEDLAEEYRHLNQDIPGMYYI"
     CDS             30312..31241
                     /codon_start=1
                     /EC_number="2.5.1.47"
                     /locus_tag="lbkm_0034"
                     /product="cysteine synthase"
                     /protein_id="BBF41360.1"
                     /transl_table=11
                     /translation="MAKVAKKLTELIGNTPMLELTNYEENHKLEAKLIAKLEYFNPLG
                     SVKDRVAYEMIEQGIKEGKINQDTIIIEPTSGNTGIGLAFVCATKGLHLILTMPETMS
                     MERKRIVAALGAEIVLTPGNLGMKGAIDKAGELVKEYGNAIIPQQFENKANPAAHRKT
                     TAIEIIDDMDGKVDFFVAGVGTGGTLTGTGEVLKEKNPEVKIIAVEPATSAVLSGENP
                     GPHNLQGIGAGFIPGVMNLDIVDEIIKVENEQAYEASREVAKSDGVLVGISSGAALYA
                     ATELAKRPENKGKNIVVLLPDSGERYLSTVLFE"
     CDS             31273..32448
                     /codon_start=1
                     /EC_number="2.6.1.1"
                     /locus_tag="lbkm_0035"
                     /product="aspartate aminotransferase"
                     /protein_id="BBF41361.1"
                     /transl_table=11
                     /translation="MSKFEFDQIIDRRNTNAIKVDFSRYYGMEDDMISMWVADMDFEV
                     PKAITDAMKSRCEHPIYGYTMYDDSYVKSVQSWMKRRHSYEFKKEWLLHTPGVVFGIA
                     MAIRALTKPEEAVMIQTPVYYPFSKMVLKNGRKLVKNSLVLQDGRYVMDYEKIEQQIV
                     KYKVKVFILCSPHNPVGRVWTQEELIRLGDLLVRHDVKIISDEIHMDFIYPGHKHQVL
                     AGLRKEYENRLVTCTAPSKTFNLAGLQMSNLFIANDQIRAAVKAEIEKTGYDEPNLFG
                     PIACQAAYDNGEAWLDELLEYLAENIQFTKKFLQEHMPKVKLIEPEGSYLLWVDFRAY
                     GMSNEALNERIRKKAKVWLDAGEMFGSEGNGFQRINIATSRKTLEKALNNLANAFCE"
     CDS             32549..33322
                     /codon_start=1
                     /locus_tag="lbkm_0036"
                     /product="negative regulator of genetic competence MecA"
                     /protein_id="BBF41362.1"
                     /transl_table=11
                     /translation="MEFKRIDNDTVRCIITEEDMQEYNVELEDFFKDKGKIQEFLHTI
                     VEQAVDAVGFEPKDGMVSMQVMPMSQNRIAITFSENSVDDVGGILKQINGMVNEMDGM
                     MKEDTEEEEKPEGLVGAPEPESSKEEKEDKASEEKESEVAKKEKTKRVRKKDPLSIAK
                     RIYRFPSLDNVEEFAKLVPEKWTVKSYLFKDVSADVYYLSMEKGRLSKLHYAYLCNCI
                     TEFGTYVDDNATRFAYMEEHYDCMVEKKALKVMRNMALL"
     CDS             complement(33396..34088)
                     /codon_start=1
                     /locus_tag="lbkm_0037"
                     /product="phage repressor"
                     /protein_id="BBF41363.1"
                     /transl_table=11
                     /translation="MKKIGKTLSRLRIKKGLSQTDVAQKISDLLEPTTSQKVSKWETD
                     YSIPSAYQFLALCQVYGIHDVLQAFSINKPSPLSLNEEGRRKLDEYHTLLIASGMFKE
                     EGASVISMPRRLKLFDLPVSAGTGEFLDSDSFEYIEVGNEVPESADFGVKINGNSMEP
                     RFVSGQIVWVHKQDLLADGEIGIFAYDGNAYCKKLSMTTAATKLISLNTAYQPIEVAK
                     NATLHVFGKVVG"
     CDS             34285..35535
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /locus_tag="lbkm_0038"
                     /product="DNA polymerase IV"
                     /protein_id="BBF41364.1"
                     /transl_table=11
                     /translation="MEKERIILHSDINCCYASIELLHRPEMRGKPLAVGGDPEARHGI
                     ILTADYMAKRRGVKTGMALWQAKQVCPELTIVPPRMDLYLRFSRMAHEIYAEYTDLQQ
                     PYGVDECWLDVTKSKVIHGDGLTIAKKINHRMKEELGITVSIGVSYNKIFAKLGSDYK
                     KPDGITVISKENYKDIAWRLPVGDLLYVGRSTRRKLALMGILTIGELATTPPGILQAQ
                     LGKMGLILHCFANGRDDSVVTPENYQAPIKSIGNSTTSPRDLENNEEVKIVLTILAES
                     VAARMRENGFVCQVVEITVRNKELHSFTRQKKLKVATNITKEISDMAYELFLQNYDWS
                     QPIRSLGVRGSDLLQETTPFQLDLFIDQDKREKMQKADEAVDSIRRRFGFYSIQRGLM
                     YQDRLLSSVNAKEDHTVHPHGYFG"
     CDS             35548..35787
                     /codon_start=1
                     /locus_tag="lbkm_0039"
                     /product="hypothetical protein"
                     /protein_id="BBF41365.1"
                     /transl_table=11
                     /translation="MSKVYVDVIAEFTKEGTLFPIMIGWRDGRKFEIDKVKDVRRAAS
                     LRAGGVGMRYTCMISGQEKYLYYEDNNLWFVEGRE"
     CDS             35912..37297
                     /codon_start=1
                     /locus_tag="lbkm_0040"
                     /product="hypothetical protein"
                     /protein_id="BBF41366.1"
                     /transl_table=11
                     /translation="MSRILMRSAMSQLENPSAIDVVMNNLIGDNTGNMIFANSVMRTL
                     MLEDTIIDTMATNHRFSKEEIANINENYDYFIIPLANAFRKSFQKELRHLTHLISGLQ
                     IPCIVIGVGVQTTVTDDLKHSFDFDEDVKNFMTAVLEKSSMVGVRGPITGAYLKNLGF
                     VEEKDYTVIGCPSMYMFGDSLPEMKQTELTPDSFVSLNRKIELKPDLHHFLMKCTKQL
                     PNYTFVPQGIDDLRLLYLGKPISRERFPKIPESYPEKLDHDMLVQNKAIGFVNVPTWL
                     DFLRSVDFSFGSRIHGNIVSVLAGTPCYIFVSDARIKELAEYHNIPHMLAKDIKADTN
                     IFDLYEKADYSLIQKGHKERFDHYIKFLELNKLPHIYQNHDQRVVFDEKMNQLTVPKP
                     ILPFSAIPLEEQMERLMTYHEYVDEKHEEIKRLNKQYSNLSKRYDSLVNESEIQLAKR
                     LMKKGLKRFQF"
     CDS             complement(37445..39391)
                     /codon_start=1
                     /EC_number="1.3.1.34"
                     /locus_tag="lbkm_0041"
                     /product="2,4-dienoyl-CoA reductase [NADPH]"
                     /protein_id="BBF41367.1"
                     /transl_table=11
                     /translation="MKYKYPNLCKPITLGRVTFRNRMFSAPMGGTDITADGCIGREST
                     GFYELRAKGGVGAVTVSECMVHPETDGSHAYHLDLTVPGSLASFTYTADAIRRHGAIP
                     SLELSHSGQYAGTYMTDKNKKKTMHQYGVSPSVRADGLEIRELSKEQIKEIVAAYGEV
                     AKNAKRAGFEMLMIHGGHGWLINQFLSPYFNKRTDEYGGSLENRVRFACEVLDAVREN
                     VGPGFPIEFRMSGSELFDGGYDLEEGVRIAQAIESRVDLIHVSAGTYQRGFGTTHPSM
                     FKPHGCNVYLAAEIKKHVSTPVATLGGLNDPAQMEEIIASGKADVVEMARALLADHEL
                     PRKVMSNRDEDIVKCLRCFTCMAERAATSTRRCTVNPLIGRELDCTEVIPVAHPKKVL
                     VAGGGPGGLEAALTAAKRGHQVILCEKESELGGILKSEQALPFKHEMYELSLTLGKLA
                     KDAGVEIRLDTPVTKEYVEKENVDALIIAVGSAPLLPPIKGLDGENVVVVNNYYLEKD
                     KVSDEVVVLGGGLAGCEAAIHLGQEGKKVHLVEMRTELAPDANIRHRPILLEEIAKYV
                     TVHTGYRGLEVTANGVLCADADGNEHMVNGTSIICALGQVPRRDVVDDLRGTAPYVAT
                     IGDCVRASTITNAVYQGYHAALDI"
     CDS             complement(39417..40658)
                     /codon_start=1
                     /locus_tag="lbkm_0042"
                     /product="oxalate/formate antiporter"
                     /protein_id="BBF41368.1"
                     /transl_table=11
                     /translation="MNLTKKRWLILTACCFINLCLGSIYAWSVFATPMAEYLSKLTGQ
                     TLTNGDLAIVYTIANSVGPITMITGGWFNDKFGPKKVILVGGLMFGGGMILSGFATSV
                     NFLIVSYGLVSGLGLGMAYGSTISSCVKFFPDKRGLIGGITTAVYGLSSVILPPIVTV
                     IVNHSDATTAFKIIGAVFLLIVCAGSFLIEQCPADFVPDGYIAPSQNGGAPARENKDW
                     KGMLTSPVFYVMIFLLTCGAFCGMMIISQASAVAQNMVGMSALAASTAVSILALFNAL
                     GRIVAGSLSDKLGRINTLTIACLLSIVGLICLYFTGNGSTATFYIGIAVVGICFGSFM
                     GIYPGFTADQFGPKNNSVNYGIMFIGFALAGYFGPTIMRNVFTADNSYQRAFLIAIIF
                     NIISIALCFIYRVVNKKTTNN"
     CDS             40778..41386
                     /codon_start=1
                     /locus_tag="lbkm_0043"
                     /product="negative regulator of phenolic acid metabolism
                     PadR"
                     /protein_id="BBF41369.1"
                     /transl_table=11
                     /translation="MFGMDIVWHREICYNLGRNENGRFEMRTLKYAILGLLNQKSMTG
                     YELTQQFESALCEFWTAKHSQIYPELKKLNEEGMVEYEIEITGTVLEKKLYSITEEGR
                     ADFLKWLEVDAPMKSTPKDVFRLRLFFSNNLESEVRLRLLNSQLLQHELRLQHLKGNQ
                     RKFEGVPDQATDEFSDYLVLMGAVMREEMCCEWLKKCITLCK"
     CDS             41407..42213
                     /codon_start=1
                     /EC_number="3.1.26.11"
                     /locus_tag="lbkm_0044"
                     /product="ribonuclease Z"
                     /protein_id="BBF41370.1"
                     /transl_table=11
                     /translation="MTEKLILLGTGHATVTKCYNTCFAVRKEEEFFLVDAGGGNGILA
                     QLEKAEIPLERIHHIFLSHEHTDHILGMVWMIRMIGTKINKGKYDGKLHIYCHSDLCE
                     ALLTIVRLTLQGKLVNLIGDRILLHSVEDGQQKDILGYEVTFFDINSTKAKQYGFTTK
                     LANGKKFTFLGDEPYRECEYEYAVNADWLLHEAFCLDSEKEIFQPYEKHHTTAADACK
                     MAQDLGAKNVILYHTEDKNLASRKELYTKEGQQYFKGNLFVPDDLETYEL"
     CDS             42313..43506
                     /codon_start=1
                     /locus_tag="lbkm_0045"
                     /product="hypothetical protein"
                     /protein_id="BBF41371.1"
                     /transl_table=11
                     /translation="MKRSAALLKNIAALIMLLALISLLLPFCKVQTGGKTTTVSGLEV
                     IKISASTGYHYYSKGDIPNSYVLKDNLTWGDLKTGLNYASQNNELWKIELGAAVLILP
                     ALLCFFAMIGTFMAEGKKTMLLPTIFLILAVAENVLIILGFSDVMRMILSYAAKKGMA
                     GTPAVTLLIGIYAFTVLCGIALAIILYLWLTGGFRKPRRRDLESDYYDDDDDDGRKKK
                     DRSSGRDKRRKKRRRKKKSRRKKEKRSKDKTNDKDTEKKKDQKDDQKEQDNQKDGKEE
                     EQVSEALGHLTGMTGMYQGANIDLSQYGAGTFTIGTTPEAMNALLNGSLRDATKLDGN
                     NCVINYSHARKQFTITSHSDKNIILETGDSIKNKQILGNGETKTVGKNTVLYIGDLNN
                     AIKLD"
     CDS             43661..44284
                     /codon_start=1
                     /locus_tag="lbkm_0046"
                     /product="hypothetical protein"
                     /protein_id="BBF41372.1"
                     /transl_table=11
                     /translation="MKYEWRKQEKELYIPKREPELIQVPSYNFLLISGNGDPNEEEYS
                     QKVEALYALAYGIRMLPKQGEIPDGYYEYTVYPLEGVWNLTEEGKRSDQLEKEELLYT
                     IMIRQPEFVTEDVVKVAFESVKKKKSLKFLNDITFGTMEDGLCVQMLHIGSYDKEPES
                     FRNMDAFCERNGLEVIRERHHREIYLSDPRKVEPSKCKTVLRYFVRK"
     CDS             complement(44293..44724)
                     /codon_start=1
                     /locus_tag="lbkm_0047"
                     /product="metal-dependent phosphohydrolase"
                     /protein_id="BBF41373.1"
                     /transl_table=11
                     /translation="MLEKTIRYHSRYELPQNLTDREKQFCQIIRDADKIDIFRANYTT
                     GMETIYNTTTEELKNASITPEVYEAFQEKHTVLRTLNKTIIDHLIAHLSLYYGLIYPE
                     SKKMAVEQGYLWKMANFHSDNPETEMILEEIRNEQEQEWQP"
     CDS             44743..44871
                     /codon_start=1
                     /locus_tag="lbkm_0048"
                     /product="hypothetical protein"
                     /protein_id="BBF41374.1"
                     /transl_table=11
                     /translation="MIKLEDQRVFEEEISAEFCVINGNGVDESMISLQLFKSSDIV"
     CDS             complement(45219..45971)
                     /codon_start=1
                     /EC_number="3.2.1.20"
                     /locus_tag="lbkm_0049"
                     /product="maltodextrin glucosidase"
                     /protein_id="BBF41375.1"
                     /transl_table=11
                     /translation="MKKEKIIIAILSILLICSTLKPANASTNVKSKGVAMNVTKATIN
                     TDDVVALDAITKPINSTDTITWTSKNKNIATVNKYGVVTGIGLGKTTITAKTSSGKTA
                     ICKVNVVERISSEDVEEMIDITPCTPLEGLALGTKFRCMPASSFNTKLSNGDSAKITS
                     FKATLSEINKFNANSSKEYYPFGVKVSISGSVDAKYAGKNISIYIKKVGESNSFYYLT
                     KVKSDGSFSTSYTQNWCDVPLLYFTKIKVGSL"
     CDS             46253..46690
                     /codon_start=1
                     /locus_tag="lbkm_0050"
                     /product="hypothetical protein"
                     /protein_id="BBF41376.1"
                     /transl_table=11
                     /translation="MLVPSIFSSSFNDGFFDDLFSFPFAENHINHVSGLMNADVEELD
                     DKYLLNLELPGYSKDDIHADLQDGYLTIQAERHESKDEKDKKGKFIRRERYTGQCQRS
                     FYVGDGVKQEDIHAKFENGVLKLEVPKVEQKPEVEQKSYIMIE"
     CDS             47942..48130
                     /codon_start=1
                     /locus_tag="lbkm_0051"
                     /product="hypothetical protein"
                     /protein_id="BBF41377.1"
                     /transl_table=11
                     /translation="MINRQQEHCAVLLPEGLFDISGRISKFNFRLATDRDISFMKKNY
                     KPNFDVLKLEQYLDQMCC"
     CDS             48209..48661
                     /codon_start=1
                     /locus_tag="lbkm_0052"
                     /product="transcriptional regulator, MarR family"
                     /protein_id="BBF41378.1"
                     /transl_table=11
                     /translation="MKEKKAMGQQIKRVSNLIVQRFSEQLFFADSKDLTSRQGWVIGY
                     ICEESKVRDVFQKDIEKQFNIRRSSATGMLNLLEKNGYLERCPVPHDARLKKLVLTPK
                     AIERQKMIEENIHIFDAGLEEGISEEEKETFYLVLNKIAKNLGYEKLN"
     CDS             48680..50419
                     /codon_start=1
                     /locus_tag="lbkm_0053"
                     /product="lipid A export ATP-binding/permease protein
                     MsbA"
                     /protein_id="BBF41379.1"
                     /transl_table=11
                     /translation="MLKTLLAQVKEYKRDSLLTPLFIVLEVIMEVIIPVMMAEIIDNG
                     VEKGNMKYVVIMGITMVVAAMLSLSFGALAGKYAASASSGFAKNLRGAMFKNIQNFSF
                     SNIDKYSTAGLVTRLTTDITNVQNSYQMVIRLCVRAPIMLISAMAMAFMINAKLACIF
                     LGAIAFLSCVLAYIILHAHPIFTKVFRKYDDLNASVQENVNAIRVVKAYVREDYEINK
                     FHTASNNIYNLFVKAEKLIIMNGPAMMFSMYACIILLSWLGAKLIVVDELATGQLMSL
                     FTYVINILMSLMMISMAFVMITMSKASAERIAEVLNEKSDLVNGENPSTDIKDGSIEF
                     RDVSFSYKKDINNCVLEKVNLEIKSGETIGIIGGTGSAKTTFVQLIPRLYDTTAGQVL
                     VGGKDVKEYDIESLRDEVAMVLQKNVLFSGTIKENLRWGNKDATDEEMLHACELAQAD
                     EFIQRFPDGYDTYIEQGGNNVSGGQKQRLCIARALLKKPKILILDDSTSAVDTKTDSL
                     IRKAFKDEIPNTTKIIIAQRISSVQDADRIIVLNEGVVENIGTHEELLINSPIYRDVY
                     ESQTKGAKDHGEE"
     CDS             50406..52340
                     /codon_start=1
                     /locus_tag="lbkm_0054"
                     /product="lipid A export ATP-binding/permease protein
                     MsbA"
                     /protein_id="BBF41380.1"
                     /transl_table=11
                     /translation="MEKNKEQKAMRGPGRRGAMGPKTKLENPGKIFSRLFGYILKHYK
                     LPCFIVLVCIVVSALANVAGTLFMRDLIDKYITPYIKQASPDFAPLFQVLSIMAAIYV
                     IGVFAQWLNSRIMINVAQGTLRRIRDDLFEHMQSLPIKYFDTHAHGDIMSVYTNDTDT
                     LRQMISQSMPQIVSSVITIVSIFISMIALSLPLTLVTVVMVAIMLQTTKKIASQSGKY
                     FIKQQNNLGRVNGFIEEMMEGQKVVKVFCHEEASVNRFDELNEELFDSANNANKYANV
                     LMPVMGNLGNISYVITVMVGALLVIYDFNGFTLGSLAAFLQFNRSFNQPIGQVSQQLN
                     FVVMALAGADRIFKLMDEEPEVDDGYVELVNAKVDEFGEITETKERTEEWAWKHFHKE
                     DGTTTYQKLEGDVVFDDVDFGYNDEKMILHNIKLYAKPGQKIAFVGATGAGKTTITNL
                     INRFYDIQDGKIRYDGINVNKIKKADLRRSLGIVLQDTHLFTASVMENIRYGRLDATD
                     EEVYAAAKLANAEHFIKHLPNGYDTVLTGDGSNLSQGQRQLLAIARAAVADPPVLILD
                     EATSSIDTRTEKIVQEGMDRLMEGRTVFVIAHRLSTIKNSDSIMVLDQGRIIERGDHD
                     ELLEKKGVYYQLYTGALEQD"
     CDS             52454..53806
                     /codon_start=1
                     /locus_tag="lbkm_0055"
                     /product="multi antimicrobial extrusion protein
                     (Na(+)/drug antiporter), MATE family of MDR efflux pumps"
                     /protein_id="BBF41381.1"
                     /transl_table=11
                     /translation="MNKRKYEIDMCNGPIMRKMLLFSIPLMCSSILQLLFNAADIVVV
                     GKFAGDNALAAVGSNTALISLLTNLFLGLSIGGNVLAGRYYGAKEEKELSETVHTSML
                     LSVFSGLALTVIGIVGAKTILVWMQTPKEVLGLATIYLRVYFLGMTATMIYNFGSAIL
                     RAVGDTKRPLYYLFIAGIVNVILNLFFVIVLKMGVAGVGLATAISQCISALLVVRCLM
                     REEGGMKLELNHLQIHPDKLKRVLAIGLPAGIQGLLFSLSNVVIQSSVNSFGPIVVAG
                     NSAASNLEGFVFFAMDALYQATLCFTSQNMGAGNYKRINKILLTGQICVVVVGTLFGN
                     LLVLLGHSLLGIYTSSSKVITAGVARLAVVSATYALCGMMDVMVGAIRGIGYSIMPMI
                     VTLIGACGLRLVWIATIFQIPRFHSTFMVYVSYPITWLITFFIHVLCYIWAMKRLVKQ
                     "
     CDS             54053..54832
                     /codon_start=1
                     /locus_tag="lbkm_0056"
                     /product="putative cystine-binding periplasmic protein"
                     /protein_id="BBF41382.1"
                     /transl_table=11
                     /translation="MKKKILTAIMAMTMMVVLTGCGTKGAAKTNSDEKVLKIGMEGTY
                     APYTYHDQDGNLTGYEVDVANAIGKKMGYKVEFVEVKWDSMFEALDAKNFDAIMNQVT
                     ITDERLKKYDFSTPYIYSNPVLIVKTDNNEIKDFSDIKGKKAAEGLTSNFGEIAKKHG
                     ATIIGQDEFALAMELVKSKEADCTINDKLTYAYWSKTKKDTTSTKIVAESNDIAKSAV
                     LTRKGNDALLKKINKAIAELKEDGTISKISQKYFDMDISNQ"
     CDS             54851..55531
                     /codon_start=1
                     /locus_tag="lbkm_0057"
                     /product="cystine ABC transporter, permease protein"
                     /protein_id="BBF41383.1"
                     /transl_table=11
                     /translation="MTELFLMSENQIDVAKRAFFPMVEKAIEYTIPLTLISFVIGIVL
                     AVMAALVIINKVPVLSQISKLYIWIFRGTPLLVQLFIVYWGICNPLGIDKWIAAIVAF
                     SLNVGAYSAETIRGAILSIPKGQWEAGYAMGMNYQQVFIRIIIPQAAKVSVPPLFNSF
                     ISLVKDTSLASTIMITEMFRRAQEFASSSLEYLTIYVEVALIYLILCTILNGVQKLIE
                     KKLRVGVN"
     CDS             55541..56287
                     /codon_start=1
                     /locus_tag="lbkm_0058"
                     /product="cystine ABC transporter, ATP-binding protein"
                     /protein_id="BBF41384.1"
                     /transl_table=11
                     /translation="MYQVQDIKKSFGDVSVLKGVTLEIQPNKTTVLIGPSGSGKSTLL
                     RCMNLLEIPDSGVVRLNGDSIDFTEKKKKMKMDHPSLRTMRKKTGMVFQNFQLFPHKT
                     ALQNIMEGLLVVQKQDKKTSEAEALELLRKVGLEEKRDSYPSELSGGQQQRIAIARAL
                     AMKPELLLFDEPTSALDPELEVEVLNLIRQLVDEKRTIVIVTHKMSFAREVADNIVFF
                     DQGNIVKQGSYDELEKSGNERISQFLNMLQ"
     CDS             complement(56366..57079)
                     /codon_start=1
                     /locus_tag="lbkm_0059"
                     /product="sensor histidine kinase"
                     /protein_id="BBF41385.1"
                     /transl_table=11
                     /translation="MQEFTIVLIEDEQNILDFIQKTLKSNDYKVLTAKTGQAGMNLIT
                     SQCPDLIILDLGLPDMDGSLIIPQVRHWSSCPIIVLSARTGDKDKVSALDSGADDYIT
                     KPFSTSELLARIRTALRHSNRINMTQSPSTETYSSAGLMINFLKRQITRDGEEIHLTP
                     VEYKIVAFLARNSGLVMTYASILTNIWGPYMNDDNKILRVNMANIRRKLERNPAEPLY
                     IMTEVGIGYRMREDESPVS"
     CDS             complement(57085..58143)
                     /codon_start=1
                     /EC_number="2.7.3.-"
                     /locus_tag="lbkm_0060"
                     /product="osmosensitive K+ channel histidine kinase KdpD"
                     /protein_id="BBF41386.1"
                     /transl_table=11
                     /translation="MQNKNLIPNILITAFLLALATLLSFLLFSLSPISSANTALLYIL
                     VIVLIGRYTTGYLPGIIASLVGVICVNYLFTYPYFRLNFTLTGYPITFIGMLAISLIT
                     STLTTNLKKLAYTLAEKEKIINETEKEKMRANLLRSISHDLRTPLTSIICSSSSLVNS
                     EEPISESERKELSVHIYEDANWLLNMVENILSVTKIQGTSSSLKKTPEVIEEVLSESV
                     QRLKKRLPDAKITTKLPEEFLMIPMDALLIEQVIINLLENAVTHSESERPIELFVTTS
                     DTSITIHVKDYGIGISITPCDNIFDLSSLPETTADAEKGKGIGLSICKTIIMAHNGEI
                     HARNHEDGSEFYFSIPKE"
     CDS             58243..58395
                     /codon_start=1
                     /locus_tag="lbkm_0061"
                     /product="hypothetical protein"
                     /protein_id="BBF41387.1"
                     /transl_table=11
                     /translation="MKILSGIVNFKLTIKGGSSMSGLQVGAIIVGAAVCIIAVGYNIW
                     NEYVRK"
     CDS             58492..60216
                     /codon_start=1
                     /locus_tag="lbkm_0062"
                     /product="hypothetical protein"
                     /protein_id="BBF41388.1"
                     /transl_table=11
                     /translation="MNSQKAETQLNLALDVSNEVREQTLDLDVGYIEDSNSWELIVKH
                     SGSLDRIRTELGATVTELLNEYAIIVIRQDLIPRLEDYDEIEYIEKPKRLTFAVRDGV
                     DVSCIRAVQNPPVNLTGEGVLVAIIDSGIDYSHPDFRNEDGTTRIEYIWDQTIQGTPP
                     PGYNEGTLYTREQINQALQQRDIGSRLEIVPSTDLDGHGTHVAGIAVGNGRASQGVYR
                     GVAFNSEIAVVKLGSSVGNSFPRTTQLMTAIDYVIRRAAQESQPVVINLSFGNSYGSH
                     AGNSLLETYINEVANLWKNNIVIGSGNDGASSRHAVGVVRNDESVDTEFTVSPNEPSL
                     NLQIWKNSYDFVDITIIAPNGNAVGPINAQLGSQRYQTGNTTVYLYFGEASPYSILQE
                     IYIEFLPIGQFIDEGIWTIRLTGRRIVEGNFNMWLPSGGVLNVDTKFVNPSIDTTLTI
                     PSTASRAITVGAYNGDDDNLAFFSGRGYTTLNQVKPDLVAPGVEITSCAPNGGYTTMS
                     GTSQATPFVSGSCALLMQYGIVQNNDPYLYGEKTKSYLITTARELQVYQQYPNRALGF
                     GALCLRRV"
     CDS             complement(60366..61922)
                     /codon_start=1
                     /EC_number="3.4.-.-"
                     /locus_tag="lbkm_0063"
                     /product="probable dipeptidase B"
                     /protein_id="BBF41389.1"
                     /transl_table=11
                     /translation="MKKVRNANKNHASKVLTNLCFGLAICVLLLANGMIASACTGVYV
                     GKKVSANGSTIISRSEDIDSAHPKCFVVKKAAKHKAGSMFEDSYGFSMPYPSRTCQYT
                     ACFDASKEEGEDAFAEVGHNEYGVAVTATVSADAGEAAQKADPYVETGICEISMGTVI
                     LQQARSAREGVELLASIVDKYGAGEGNIVMIADQKEAWYMEILTGHQYIAIKMPEDKV
                     AVFPNCFMLGKVNVKSKDVIASKNLVSLAKKHNFLSTKDGQIVVAKTYGDGYGEGNVY
                     RIYGGQKLLNPSINVDVDQDFYDLFFKPAKKVTVKETMNVLRCRNEGTKYDPTTKGNE
                     DLADVVIGNERQAECHVLEVRPNVPAKLAGLEWLCMGNSEFSVFLPYYGSLITDTANS
                     SKNDSMTYNPNSSFWAFRSLSALCGINRDLFGKNVKAYWSDYQDALIKQQEAVDKKML
                     TLYKIAPKVAAKKATKLGKEVTTEAISRAQSMFYELITYFAMGQGETQEDAFTPSCMT
                     NNVLPNYRLK"
     CDS             62134..62556
                     /codon_start=1
                     /locus_tag="lbkm_0064"
                     /product="hypothetical protein"
                     /protein_id="BBF41390.1"
                     /transl_table=11
                     /translation="MCMRKKGICIEWAILYLVAVGLFLPLTWFCFDEGIATPYRGIDI
                     LGNAPGVVFCILTFLAILFGVRHAVLALFSVLFVWIQVVIYVYQFCFWYETYIMEFSW
                     KISIDTTRVGFYLAFASVLLYAIAYSWSLRRKIKDNLF"
     CDS             62624..63493
                     /codon_start=1
                     /locus_tag="lbkm_0065"
                     /product="esterase/lipase"
                     /protein_id="BBF41391.1"
                     /transl_table=11
                     /translation="MHAKVKMIRNMFAKSDKKRDRDFTIPEGVKRIDDIRYGKDAKWN
                     LLDVYMPEKIEGVHKTIISVHGGAWVYGEKETYQYYCMDLARRGFIVVNMNYRLAPEN
                     PFPAALEDINKTFWWVNTHGEEYQIDKKNLFVVGDSAGAQLASQYITLLENPEYQKVL
                     KLKPPALNVKGVALNCGVYDMKSYYVNEKDDILKEYFKKDVSEDKIDVMKYMNEKFPP
                     AYIMTAHGDFLKEHADPLYEKLRSLGVNCTYRMYGEEENQEIGHVFHLNIALKEAKEC
                     NDEECRFFDQQIQ"
     CDS             complement(63550..64938)
                     /codon_start=1
                     /EC_number="4.3.1.1"
                     /locus_tag="lbkm_0066"
                     /product="aspartate ammonia-lyase"
                     /protein_id="BBF41392.1"
                     /transl_table=11
                     /translation="MKTRIETDSIGSLAIPADAYYGVQSFRAKNNFPITGHPLHPQFI
                     YSLALIKKAAAITNVQSGKLPEKIGKAIQDACDDLLLGQLHDSFIVDSIQGGAGTSAN
                     MNANEVIANRAIELLGGTKGDYSLVHPNDHVNMSQSTNDVIPTAGKLTVLSLLPGSIQ
                     ELGRLQDALLQKANEFDSILKMGRTQLQDAVPMRLGQSFHAYASAINRCKKRLISISN
                     EMKTLNMGATAIGSAINVDPYYLQNIVPNLNQFTHFDCRQADDLFDATQNLDCFVEVS
                     SSLKSAAITLSKMSNDLRLLSSGPKTGIGEINLPAKQNGSSIMPGKINPVIPEVVSQV
                     AFHIIGNDTTITMAAEAGQLELNAFEPVLFYKLFESLDTLTHAVTTLIDNCIVDITAN
                     EDRCKELLEASVGISTALCPYIGYKRAAELAKYSLHHQIPLKELVLSETDLTQQDLNL
                     ILDPARMTKAAC"
     CDS             65213..67876
                     /codon_start=1
                     /locus_tag="lbkm_0067"
                     /product="ATP-dependent RNA helicase"
                     /protein_id="BBF41393.1"
                     /transl_table=11
                     /translation="MEIKDLIIYEKTLESRNAEYAPFPKELSKEIQTYLEGRGIEQLY
                     CHQAEMFDLAMERKNIVITTSTASGKTLSFLLPVLQDILQNPTTRAIFLYPTKALASD
                     QYRAIQPYLDYFGENRISAGVYDGDTPVSERSRIRKSANIILTNPEMLNGAFLPNHNK
                     YGFDFIFSNLKYVVVDELHTYRGAFGSHLANVFRRLGRVCRYYQSVPQFLCSSATIAN
                     PVELAEGVCGAEFVQVSKDGSPAALRNYCLLQPPKVTGKDRKYYGQIQSTSVAAELIP
                     KLVEEGTSFIAFAGSRRNVEVVLKEARDKLETESFFGKDDVDKISGYRGGYTPMERKE
                     IENKMITGALRGLVSTNALELGIDIGKIDATVLVGYPGTRASFWQQTGRAGRSGKSCT
                     NYLILNNLPFDQYIAINPNWLFDSSSENAVIDKNNLLIELAHIRAAAAEIPLTLDDIA
                     IFPDMGETIPVLIKVKEVTSQGGKFVWNGNGFPAGDYSLRNIDKLRYKLIDRERQVEI
                     TEMDEMQAFRELHDGAIYMHDGMQYQVVKLDVESRTAYAIPFKGNYYTMPGGTTNIRI
                     IHAQKEAGYHRLKLAFGDVNVDDIVFMYKKLQFHNHQNLGFEQLEKPLSKDYDTESTW
                     FKVPQNIVKVYRSLLQEGPSGQIVRNNHFDGLCHAIKNATMMVTMTEKEDIGVTMSAN
                     VLEISDNVVEDVFLFIYDKYIGGLGYSEKAYDLIPKIIESAIELVSGCTCEHGCAACI
                     GDYTLDKKMVLWGLKNLLEEVEAPKDIKMVEYAPRVFLKKEFQFQELPARWKEFCSYL
                     QESGEKLSQFLSAVNKVEVINNTITLILDNPFYKEWVMEEDNRKSIINIIRFYTEAPA
                     VIRLDVSLENLSEERREIRDKLQRRYENLKE"
     CDS             67880..69787
                     /codon_start=1
                     /locus_tag="lbkm_0068"
                     /product="ATP-dependent DNA helicase UvrD/PcrA"
                     /protein_id="BBF41394.1"
                     /transl_table=11
                     /translation="MNYEQYLERLNEYQKMAVYDDSKACLVNANVGSGKTTVLISKII
                     YLHYAKGVPYESMAVLTFTNKAADEIKERLQAIDDSVSSEQLNNFGTFHSVALSILKN
                     CLAIESKGFTKDFLVVEPEEEIDLAMQLIEENKLVIKYKNRLKKRLEQARMIQDEERK
                     ISRYQDDIFTLVTLLKEEKIKQDKMSFTDLIEYANELLQRSDQKPDWIIVDEVQDCDS
                     LQLSFLQQLRKEETSLFAVGDPNQVIYSWRGSECNVFYRLKETYQAKVLSLPINYRSS
                     TTILEAAKCFLQNGGKLSGIRDQGSRIVVNKQYNSFNEACYLAEKIKRLHDEGTAYGD
                     IAIFYRLQSQSKSFEDVFAKEGIPYEVSIKKTIKDIPVLNWLIFVMRYSANPGDQLAA
                     VHALSNKEYGERLTVKKARATIKENQMFLSPLLDRMSGLNQFCGKEQKVSAEKLYEYF
                     EFDSFIRPTSATYQDDKESILRLLTIIGNETEGRPFMEGLKEFLNTSALYGLPVVDRM
                     VSQQKDAVKLMTLHASKGLEFSYVFITGVNYGLIPLQAKSFEDEEEERRLFFVGITRA
                     KDYLELSYYTNPDFPRTMPGESRFLSMIPPHLLSRDGEELEEVNLHDLKKQIQKVKEA
                     ARKDEIQEEAV"
     CDS             69946..70341
                     /codon_start=1
                     /locus_tag="lbkm_0069"
                     /product="transcriptional regulator, MerR family"
                     /protein_id="BBF41395.1"
                     /transl_table=11
                     /translation="MTIAQVSEQSGLTPDTLRYYERIGLIPPVGRTQGGIRNYQEEDI
                     GWIEFIKCMRSAGVGVEALNEYMELFRQGPETSQARKKLLLHEREKLVNRIDEMQQTL
                     ERMNHKIATYEEKDKEKCEDILVKSEENK"
     CDS             70338..71303
                     /codon_start=1
                     /locus_tag="lbkm_0070"
                     /product="possible oxidoreductase"
                     /protein_id="BBF41396.1"
                     /transl_table=11
                     /translation="MKIAIIGTSKITERFLEVVRKVPDLEPVAVVSRKRETGEAYANK
                     HGLKKVVTSIEELTKEDTIDAVYIASPNCCHASQAIQLLNSKKHVLCEKPIASSYEEV
                     QAMVDAARENQVVLLEAMRSVFDPGFDKIEELLPKLGKIRRIHFTFGKISSRYDNFKK
                     GIIENAFNPALSNAAVMDIGVYCIHPLVRLFGRPARISAQSVFLENGMEGAGTAILNY
                     GDMIGEVQYSKITDEYGMSQIQGEEATMLIDSISDTRTIEVIHRNGVKETYLIEKEKN
                     NMYYEVATFVKLIEKQQVEHSFLRSSLDEMAVMDEIRKQAGIHFE"
     CDS             71479..71763
                     /codon_start=1
                     /locus_tag="lbkm_0071"
                     /product="hypothetical protein"
                     /protein_id="BBF41397.1"
                     /transl_table=11
                     /translation="MSVVIIGGHDRMVCQYKKICKEYKCKAKVFTQMSNNLRNQIGNP
                     DLIVLFTNTVSHKMVHCAVAEAQRNHVDVIRCHTSSKNALMEILENACNA"
     CDS             72063..72983
                     /codon_start=1
                     /locus_tag="lbkm_0072"
                     /product="inner membrane protein YrbG, predicted
                     calcium/sodium:proton antiporter"
                     /protein_id="BBF41398.1"
                     /transl_table=11
                     /translation="MMYVWLLIGFVLLIKGADYFVEGSSSVARLLKVPAVIIGLTIVA
                     MGTSAPEAAVSITAGLSGNNELSLSNVVGSNIFNLLVVIGVCAIIKPFASDKAIVKRD
                     LPVNIGATVLVALFLIDRKISTVEAIVALLCMVVYIGFLIRSAAKDRVEIEEEMKILS
                     PLMSTVCIVGGIIAIILGGNLVVNSASDIAASFGMSQTLIGLTIVAVGTSLPELVTSI
                     VASRKGESGLALGNAVGSSIFNLLFILGLSASLHPITVLTENVIDVCVLLVVSVFLWL
                     VGKSKGKVTRVEGFICVAFYIAYMVYAVIR"
     repeat_region   73018..73171
                     /rpt_type=dispersed
     CDS             73279..73941
                     /codon_start=1
                     /EC_number="3.1.3.27"
                     /locus_tag="lbkm_0073"
                     /product="phosphatidylglycerophosphatase B"
                     /protein_id="BBF41399.1"
                     /transl_table=11
                     /translation="MATWLNSIFAEYDHAILSGLHHLAIMTGGALTPLFSIISAFAEK
                     GVGMLLLGLCLMGFKKTRKLGVCVFGAICCGALITNVILKDWIARPRPYIDINSIYHS
                     WWMYAGKTMETGCSFPSGHVTGTMAAMTAIFLTCNKKKSWMAFLVVILMGISRNYLMV
                     HYPSDVLGGMIAGAVAATVSFYITKLIYRYLEDNLEKKLCRFAIRFDVGEVWKRRAKS
                     RK"
     CDS             complement(73967..74335)
                     /codon_start=1
                     /locus_tag="lbkm_0074"
                     /product="iron-dependent repressor"
                     /protein_id="BBF41400.1"
                     /transl_table=11
                     /translation="MNINQSSENYLETILMLSRTLPVVRSVDIANELGFKKSSVSVAM
                     KNLRENNYITVTDAGYIYLTESGKEIAEMIYERHKILTSCLEAVGVDSKTAADDACKI
                     EHVISPESIAALKAYIEKKK"
     CDS             74578..74772
                     /codon_start=1
                     /locus_tag="lbkm_0075"
                     /product="hypothetical protein"
                     /protein_id="BBF41401.1"
                     /transl_table=11
                     /translation="MHVINKVSGKQETKKFLEKLGFVTGSEIMVVSEINGNIIVNVKE
                     ARVAIGKDMANKIMVTPKVA"
     CDS             74786..75010
                     /codon_start=1
                     /locus_tag="lbkm_0076"
                     /product="ferrous iron transport protein A"
                     /protein_id="BBF41402.1"
                     /transl_table=11
                     /translation="MTLNEIPCGKTVKVKKLTGVGPVKRRIMDMGITKGIDIYVRKVA
                     PLGDPVEVTVRGYELSLRKADAVMIEVESV"
     CDS             75060..77207
                     /codon_start=1
                     /locus_tag="lbkm_0077"
                     /product="ferrous iron transport protein B"
                     /protein_id="BBF41403.1"
                     /transl_table=11
                     /translation="MSVKIALAGNPNCGKTTLFNALTGSNQFVGNWPGVTVEKKEGRL
                     KGHKDVVIMDLPGIYSLSPYTLEEVVARNYLIGDKPDAILNIIDGTNLERNLYLTTQL
                     IELGIPVILAINMMDIVEKSGDQIHTDQLEKKLGCPVVRISALKGTGIKEAANRAVEL
                     AQSKQYTEPVHEFATEVESVLDTIEHKLGSEIPAEQKRFFAIKLLEQDSKIIEQMQQV
                     PDVSTEVQLIEKEMDDDTESIITNERYVYISSIIDACCTKAKKGKLTVSDKIDHIVTN
                     RWLALPIFAAIMTLVYYVSIKTVGDWATGWANDGVFGDGWSFFGLFDVPSIPSLVESG
                     LNAIGCADWLQGLIVDGVVGGVGAVLGFVPQMIILFFFLAFLESCGYMARVAFIMDRI
                     FRKFGLSGKSFIPMLIGSGCGVPGIMASRTIENDRDRKMTIMTTTFIPCGAKIPIIGL
                     VAGALFNGAWWIAPSAYFIGIAAIICSGIMLKKTKLFAGDPAPFVMELPAYHMPTAGN
                     VLRSMWERSWSFIKKAGTIILLSAIVIWFMTYFGWKDGQFRMLTEMELDHSILAKMGN
                     AICIIFAPLGWGDWKSAVAAITGLVAKENVVSTFGILYGHAEVAETGNEIWANIASNM
                     TALAAYSYLAFNLLCAPCFAAMGAIKREMNSAKWFWTAIGYQTGLAYVVSLCIYQIGM
                     LITTGTFGIGTAVAFACVAGFIYLLVRPHKENY"
     CDS             77219..77371
                     /codon_start=1
                     /locus_tag="lbkm_0078"
                     /product="hypothetical protein"
                     /protein_id="BBF41404.1"
                     /transl_table=11
                     /translation="MGTVVVGAALAAVVIAIINKMVKDKKNGKSIQCGCDCSHCGGHC
                     HEGNDR"
     CDS             77352..77708
                     /codon_start=1
                     /locus_tag="lbkm_0079"
                     /product="ferric uptake regulation protein FUR"
                     /protein_id="BBF41405.1"
                     /transl_table=11
                     /translation="MKEMIVEKLKNQGCRITKQRLLLIDIILENECASCKEIYYKAVS
                     MDPKIGRSTVYRMINMLEEIGVINRRNLYQVVDLEQPAEGEGCMIRLQDGELLHLTSA
                     QWNRVVQTGLRTNGYL"
     CDS             77823..78065
                     /codon_start=1
                     /locus_tag="lbkm_0080"
                     /product="hypothetical protein"
                     /protein_id="BBF41406.1"
                     /transl_table=11
                     /translation="MRHFFVNLFQKLNAKENIELPLLIGNNKVNGSYVEELIQFLGLK
                     DGENYQKVIMITHNMDLAKEADRMIRIVDGIATCED"
     repeat_region   78383..80228
                     /rpt_type=dispersed
     CDS             complement(78495..79796)
                     /codon_start=1
                     /locus_tag="lbkm_0081"
                     /product="transposase"
                     /protein_id="BBF41407.1"
                     /transl_table=11
                     /translation="MIKINYISTLFVGIDVSSKSNVVYAMDFDENKYIASSFSNNQPG
                     ADMLAELISECMRKHPDLNTIIVALESTSVYSIHIANFLSSCELLMPYKPYVYCLNPK
                     MTANYRKTFVGMDKTDAKDAYLIADFARVGRTKKCEPWHGSQYLALKRLTRHRLHLAE
                     CITREKTYMVSNLYLKFSELQLLDGDEQPFSNLYGSTSSAVLTEFLSLQEIIDTPEEE
                     LLEFLAKKSRNRIADISKTSDLLKKAARDSYRLDKCMYEPLNVSLASSFNCIQTYQNE
                     MKLIDQAIEKCIKGMNPNAFTILKSIPGIGPVWAAGILSEIGDITAFHSSDALAKYAG
                     LTWLKNDSGDFISEDNHISKAGNTYLRYYLGEASNSVRRHMPEYAAFYAKKYAEVTKH
                     QHKRALALTSRKFVRLVFGLLVKNQLYTGEKLDAELNKESE"
     CDS             80222..83050
                     /codon_start=1
                     /locus_tag="lbkm_0082"
                     /product="protease"
                     /protein_id="BBF41408.1"
                     /transl_table=11
                     /translation="MKKLIRYVFSVLLILGMVLSTCYYAEAKDKDVITPEQGEKLTHR
                     MQEKLKENKDKNEKNDYKKGEAIILYHKNNGENSVKTTLDKNDIQLVKTWNFKDTKSN
                     DKSTKGGAANNFVVSQVKSSKYSTEELVNILKKNDQITYAEPNYVFHLTDAKYLDKQW
                     PLDNKGQNAGTQNCDINPEDAWSSASQKDEVVAIIDSGVDYTHEALKGNMWVNTHTNV
                     LKGTYGYDCCNDDADPMDDNGHGTHCAGIVAGNNTYIKGVDPNVKIMALKYANKDGAG
                     YNADAIEAYNYISTAIDAGVHVTAINNSWGGSANSNILAQVVNEVGKKGAVTVIAAGN
                     SFEDVDVKGCSPWDFKSPYTIKVAASGEKDELTSFSCFGKQSVDLAAPGADILSTVSY
                     DCYNPSIHEGDPNYSEIYHPFKANEKLSNMKTLGFDTTASNNNSVSISTSTNFGNYDP
                     NDGALDITFDATAVGKYGAIYGAILPFTLPSSNTDYYYSLQFKLVGPEDAMLILADDT
                     NERITNGDFLDSAITGVIPSGCNVWESFSDRLKVKSSPNDSNSMYFGMFVNKPGTYHL
                     YIDAFGISKQNLAPSQFGKYAFYKGTSMAAPEVTGAVSLIRKLYPNVTADTIKDYTAK
                     SVRKVPALMDKTISGGVLDLSMLNPLQSISFAQSIYQMDEGGQLQLTPTINPDNAFKK
                     EVSYTSSDASITVDQNGLVKALAGSAGHKATITVTSQKNPSIIANTTVEVKQKPAPVP
                     VPVPTPVTPANNYASYKVSGLKATQTTAQVKLSWKRVAGASGYTIYCQSGKKQITLGS
                     NSSVTKTTYTVKKIKGKKLKSATAYTFKVAPYTVVSGKKIYGKKVTIKTGTKPGTAKI
                     SSAKRSGKKVKLSVNKVVRATGFKIYIKVNKKGSYKLVKTVKGGKKFTCTIKVNKLNK
                     NSAIRVRAYKTVNKKAIYGSYSKGKKLK"
     CDS             83172..83564
                     /codon_start=1
                     /locus_tag="lbkm_0083"
                     /product="MTH1175-like domain-containing protein"
                     /protein_id="BBF41409.1"
                     /transl_table=11
                     /translation="MKIAVTYENGQVFQHFGHTSQFQVFEVENNQIKDTCIVDTNGSG
                     HGALAGFLENQGVEALICGGIGGGAIQALKEASIQVFGGVSGATEEAVKAFLEGKLNY
                     NPNVRCSHHDHEHGEGHHTCGDHGCGNH"
     CDS             83589..84059
                     /codon_start=1
                     /locus_tag="lbkm_0084"
                     /product="protein of unknown function DUF134"
                     /protein_id="BBF41410.1"
                     /transl_table=11
                     /translation="MARPTKWRKIGVEPSSPYFLPAKEAAEDSEVIPLLLEELEAIRL
                     KDLLGMEQEECAKEMEVSRPTFQRILLSAREKIADSIVNGKTLHISGGNYTKHICNLA
                     CSTCGKVWTESVENFTKRSCHSYECPSCGSRHVGCAKRCEEHFCQKRCCKKHSE"
     CDS             84267..84554
                     /codon_start=1
                     /locus_tag="lbkm_0085"
                     /product="hypothetical protein"
                     /protein_id="BBF41411.1"
                     /transl_table=11
                     /translation="MFAIGETKGIVHFSKLELPKEYHLRKKKLTAVWIGKNVLYLSDE
                     PDSLKRKAGKEGLFFDPDIDSLGRIEVPHTLEGKMAYVKGCISTIRITFKD"
     CDS             84716..85003
                     /codon_start=1
                     /locus_tag="lbkm_0086"
                     /product="heat shock protein 60 family co-chaperone GroES"
                     /protein_id="BBF41412.1"
                     /transl_table=11
                     /translation="MTLKPLGDKVVLRQKEAEETTKSGIILTSKSQEKPQEAVVVEVG
                     PGGLIDGKEVTMQVKKGDQVIYQKYAGTNVKLGDEEYIIVKQSDIIALVED"
     CDS             85017..86630
                     /codon_start=1
                     /locus_tag="lbkm_0087"
                     /product="heat shock protein 60 family chaperone GroEL"
                     /protein_id="BBF41413.1"
                     /transl_table=11
                     /translation="MAKELKYDVDARKALEAGVNKLADTVKVTLGPKGRNVVLDRGFG
                     SPLITNDGVTIAKEIELECPFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMVNEG
                     MKNLAAGANPIILRKGMKKACDKAIEALKKMSSPVSGKSHIAKVATISSGSEEVGEMV
                     ADAMEKVSDNGVISIEESKTMKTELDVVQGMQFDRGYVSSYMVTDTDKMEARLEDPYI
                     LITDKKISNIQEILPLLEEIVKQGKQLLIIAEDVEGEALSTLIVNKLRGTFNVVAVKA
                     PGYGDRRKEMLQDIAILTGGTVISDEVGLALKDTKLEQLGKAKSVTIQKETTTIVDGL
                     GEKKQIEDRINKIKHQLADTTSSFDKEKLQERLAKLAGGVAVVRVGAATETEMKEAKL
                     RMEDAINATKAAVEEGIIAGGGSAYIHCTNEIKSLADSLEGDEKTGVNIILKALEAPL
                     LTIAKNAGYEGAVIVDAVKKLETGKGFNAYTGEYVDMVENGVIDPVKVTRSALENAVS
                     VASSLLTTEAVVATKKENKKNEMVNNQMM"
     CDS             86653..86850
                     /codon_start=1
                     /locus_tag="lbkm_0088"
                     /product="hypothetical protein"
                     /protein_id="BBF41414.1"
                     /transl_table=11
                     /translation="MNEIFSVGDHVLHPSYGECVVRKIDKLKTGNALTDYYVLESVDA
                     KKHKMYLPVGTHEVKLKKIEK"
     CDS             86989..87810
                     /codon_start=1
                     /locus_tag="lbkm_0089"
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="BBF41415.1"
                     /transl_table=11
                     /translation="MEKLIKIQELTKQFAGREILSKINLEIHRGDSIAFTGHNGSGKS
                     TLLKMIGGLLPYDSGVILRNKNLRVDYIPEHFPKLAITARQYLIHMGKLEGLDSERIR
                     KKIDSLSTAFYMEEMLDTPIRFLSKGTMQKVCVIQAMLGEQDLLLLDEPLSGQDEDSK
                     KNFLSLIKERITQGTAVVMSCHEALLMREVSREIYQIENKRLVRTDLQQLRGARKILV
                     FEKGNKGSKKESLELVRIEEGTKTKVFVSNEDMDQAVKQMLASGYEIRGIYDEEE"
     CDS             87797..88528
                     /codon_start=1
                     /locus_tag="lbkm_0090"
                     /product="ABC transporter, permease protein"
                     /protein_id="BBF41416.1"
                     /transl_table=11
                     /translation="MRKSRELVWYHMHLYFKTNKWVMPFLVWILSLVVSYSVKPVHVG
                     SSILVSAGISFFISLWLGITYYDNVDPVAEQITILKVQNRRLYDISQFLFLGVIASLL
                     STTGVLFPSIKNVTDGLDLYTRTLHVFDMICSLWIHLVLSFLGIGLSMLFQPRIMKNR
                     KFAILLMACISVLAISKSGMIDSAPPLKGLLWVLPPLSDILTMLGNKDYFYVGELCKM
                     TGYSVLYLVVLFVISEVILQKKNNY"
     CDS             complement(88534..89700)
                     /codon_start=1
                     /locus_tag="lbkm_0091"
                     /product="regulator of polyketide synthase expression"
                     /protein_id="BBF41417.1"
                     /transl_table=11
                     /translation="MLQVSEVIHLTLFKDFKLIAGESGLANELNNIVILEYESINHHY
                     DVFKEGDFILTSLFYAKDHEELIYESFQELIKRKVSGIAVKTVFYKDIPDNAKELANQ
                     HNLPIFLFEDAYMEDLILSANELLKTKLSHLVFEEKIKNIIQTRKSPYEIESTMKEIN
                     PSFHPKAITAYITAKSPSGRNTIQNYFTRLIYKKYKTSAHYSYSYVKYGSGMILIYSF
                     SDQFILPSDGFADTVSKLLHSIELEPEYYHIGICDLPMEQNRLDLSIQQAIYANYTAI
                     LKQQDILSYSQMGIYQYLAPLTSDPTIMKQYSSSIQKLKDYDKRHISNLLDTLRIYIH
                     HNGDIAKTAAKIYQHPNTVRYRLKKTAHLLNCDPENQYEQLYLLIHLYELHEVM"
     CDS             89727..89843
                     /codon_start=1
                     /locus_tag="lbkm_0092"
                     /product="hypothetical protein"
                     /protein_id="BBF41418.1"
                     /transl_table=11
                     /translation="MLAGFVIYYKEIINHENILPFFCRKINKKSVECWKSFA"
     CDS             89992..91104
                     /codon_start=1
                     /EC_number="2.6.1.9"
                     /locus_tag="lbkm_0093"
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="BBF41419.1"
                     /transl_table=11
                     /translation="MHRKEINKRWENGKMSNFLNDRYKNMEPYIPGEQPKDRHYIKLN
                     ANETSMEPSPEVLKALRSSRMKDLGHYADPDAKELRLAIAKRYHVTMDQVFAGNGSDE
                     VLALIFLAFFDENSKICFPDITYGFYKVFSKTFGIDGKAMPLKEDFTVDVDAYVKTNR
                     HVILANPNAPTGFYLPVSEIERIVCANPNRLVIIDEAYIDYGNESVIPLVHQYRNLIV
                     VHTMSKSKNLAGAHIGYCIADESLIEDLNGIKFSFNPFSLNDISLAIGTAAMNDQAYY
                     EQCIKEIIANREYTKRELKNLGFKVLDSKTNFIFVTHPLLTANEYNGKLRDNGILARH
                     YNDKRINNYLRITIGTRKEMEEVIFVTSKILDELAA"
     CDS             91118..92089
                     /codon_start=1
                     /EC_number="1.1.1.95"
                     /locus_tag="lbkm_0094"
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="BBF41420.1"
                     /transl_table=11
                     /translation="MKILISDYEDVLKRDLEYEIQLLKEHLEDVEIEVYAYRNYEDYL
                     EKMKDVDVLLMAYLPVDKKVFEHAKKLKLISVNATGYGTIDMEQAALHQVQVVTVKDY
                     CTNEVADHTMALILALIRNLKFYEKDIEQRHHWEYMNVKKMRRIASMTLAIFGLGRIG
                     RAVVKRAQAFGMKVIAVDPYVSQEEADGIGVTMVSKEEALNRADVISNHMNQTKENEN
                     FFQKQTFAAMKKHPIFINVGRGKCVDETALVQAIEKKQLAGAGLDVLKEENPNLIENP
                     LLNRENVILTPHAAFYSEESMRDLQRISCENIIKELKVAEGRKQLCM"
     CDS             92080..92913
                     /codon_start=1
                     /EC_number="3.5.3.6"
                     /locus_tag="lbkm_0095"
                     /product="arginine deiminase"
                     /protein_id="BBF41421.1"
                     /transl_table=11
                     /translation="MYVKNGTGVLKRVLVSRPEYLKAAPINEIAKKWKPELDVEKMKK
                     EHAAFVKAYEDNGVKVEFLEADPNRPNSVFSRDFGGCVQEGYIMGKFKEPIRYQEYTA
                     YKTKMKELGIPMIVEIQNGLFEGGDFAFLNENTIALGMVARTNKQGFLEMKEGLAKYD
                     YEVIPVPCKKEYLHLDMCFNLVDDHLAVAYKEGLPEEFLHRLQEMQIDIIPVKEEAIF
                     THGCNLQSLGDHRVMSLKSNTYVNEELRKRGMTVIELDITEILKAGGGPHCMTFPLER
                     I"
     CDS             93013..93807
                     /codon_start=1
                     /locus_tag="lbkm_0096"
                     /product="hypothetical protein"
                     /protein_id="BBF41422.1"
                     /transl_table=11
                     /translation="MKLKKKGLLAGAVLIGMLGLTACSSVPKNTVFSEKDFPKKTIGV
                     QLGTTGDIYASDYEEKGSKIERFNKGADAIQALKQGKVDCVLIDGEPAKVFVSKNDDL
                     KVLDEPFAKEEYAISLKKGNTELKEKINGALAELQKDGTLDAIKSNYIGEKAGKNPYQ
                     SPEGIDRSNGTLVMATNAEFPPYESKKGDDVIGIDADMAQAVCDKLGMELKIEDMAFD
                     SIIPAVQSGKADMGVAGMTVTKERLKNVDFTDSYTTATQAIVVRKK"
     CDS             93835..94527
                     /codon_start=1
                     /locus_tag="lbkm_0097"
                     /product="amino acid transport system permease protein"
                     /protein_id="BBF41423.1"
                     /transl_table=11
                     /translation="MLESITENITQSFITDGRYRYLTQGLLVTIEITFLAVIIGMVLG
                     FLIALIRSTYDLTGKRKILNFICKVYLTIVRGTPVIVQLLLMYFVILDPFGVDKIPAA
                     VITFGCNSAAYVAEIVRSGIMSVDGGQTEAGRSIGFSYSQTMIYIVLPQAFKNVLPAL
                     LNEWISLLKETSVSGYIAIADLTKGGDVIRSITFRPFFPLVAVALVYLGIVMLMSALE
                     AKVERRLRRSER"
     CDS             94517..95257
                     /codon_start=1
                     /locus_tag="lbkm_0098"
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="BBF41424.1"
                     /transl_table=11
                     /translation="MSDKKELIVVNELEKSYGEFQALRKINLTINHGDVAVILGPSGS
                     GKSTLLRTLNQLETQTKGTISFDGVSITDKEVNINKYRQRMGMVFQHFNLFPHMTILR
                     NLTIGPMKLLKLSKSEAEEKAMNLLVRVGLADRANTYPSMLSGGQKQRIAIVRALCMN
                     PDVLLFDEPTSALDPEMVGEVLEVMKDLARQGMTMVVVTHEMGFAKEVGNRVIFMDAG
                     EILEEAEPEEFFTHPKSERAKQFLEKIL"
     CDS             complement(95307..95636)
                     /codon_start=1
                     /locus_tag="lbkm_0099"
                     /product="hypothetical protein"
                     /protein_id="BBF41425.1"
                     /transl_table=11
                     /translation="MLSLFFIAISMIYLYLTFKQKKAIHLHLREPLKKYYILNLDAYL
                     SVQFIISLICSSLILITSILCLVVFQRKSIMTTGFILIFVTYFVRFFIYTTLPICRKK
                     GYIQKYK"
     CDS             complement(95652..97181)
                     /codon_start=1
                     /locus_tag="lbkm_0100"
                     /product="regulator of polyketide synthase expression"
                     /protein_id="BBF41426.1"
                     /transl_table=11
                     /translation="MALLSQIIHKLEQQFSIQIQGNYEDPASIHTTKELLLPLPNEFH
                     PALDTLYITKEQELPSFHTDIHLLVLGAPSGGVSPYLTTTEVIPIQAIMKAVACITRE
                     SRQLSEQKEVLYDALLNNAGMKGILRIAYSYLGNELSVCNASFSIIDCYPTSMTDSSM
                     LEKQGDTWYLRLSALRTMKEEKLPDQIFRATEAFFFQSKYSDHEMIFCPVRINRSIIA
                     YICILNNERPFTKDDLSFTNVLSGILSLEFQKNAFYSGCSRMQEEFLLSDLLEKQFDN
                     PDYYINRFRQLGFSVKEYCYVLIIDSDSSTSKNLKVDFTISQLKAIFPSNLVAYYNNR
                     ITILISKDHATPFTESEERKLQNFLQFNHYIGVLSYRFQAPGRAANYYNQALKLLDEC
                     MASGTTSSLLYYEDHVTESILSFCSDSEFLQTAIHPDLKLLMEYDEETKSELTLTLET
                     YLKNNRNALRASKELHIHKSTFFYRLGKITDHLSISLEDADKLYEYELSFHILRYLQK
                     Y"
     CDS             97362..99488
                     /codon_start=1
                     /EC_number="1.2.1.2"
                     /locus_tag="lbkm_0101"
                     /product="formate dehydrogenase-O, major subunit"
                     /protein_id="BBF41427.1"
                     /transl_table=11
                     /translation="MANITIDGKQITVPDGMNVLEAALQNGIYIPHLCHHPDLKDIGS
                     CRLCIVEVEGVEGVVTSCKLKAKDGLNICTKSEQIDHLRNLAMELILAAHPEDCSTCP
                     KYGQCELQTLIQYMGVSAARMKTRVKGFAVKENPLIVHDMNRCILCGRCVRACGEMRG
                     VGVLQYQKEGMETYVGTLHNKLLQDADCRFCGACTEVCPTGTIRDLLNYAPTEKRDTL
                     VPCQATCPVHTDVPRYVRLAKEGKFEEATAVIHEKLPFPECLGRVCAHSCEAKCRRGE
                     VNEPVSIRNIKRYAAEHANNTMWKENSKYLPKTGKKVCVVGGGPSGLAAAYYLQKQGH
                     EVTLKEANEKFGGQMQYGIPSYRLPREVVDKEAGYVKDAGVIMESGEKVERPKELLDQ
                     FDAVLMAIGTHNGVRLPMEGNQLDGVLINTDFLKRASMGEPTGMKERVIVLGGGNVAF
                     DCARTAKRLGATEVHLACLEKREMMLADEEEINQAMEEGIEIHPGHTFEKICGNDQVT
                     GVSFCKVDSFTFDENRRPIITKEEDSLYTIETDTVIFACGQRTDISEEAGLELGRGNS
                     IAVAIGKSAKTSVDGIFACGDAVYGTKTVVQAIASGREAASEIDRYLGGDGDISEVLA
                     PVEEKQAYLGKEEGFGYEKREEPVIVEASKRSDNFKEVDHGLCDSSICKEAGRCLQCD
                     LRFEIEEHRIWSDYSDNADAEVKKSC"
     CDS             99482..102250
                     /codon_start=1
                     /EC_number="1.3.99.1"
                     /locus_tag="lbkm_0102"
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="BBF41428.1"
                     /transl_table=11
                     /translation="MLKNTAEALVNVKNESVDKIKMVLRELKDYATGEKILTGQACDR
                     VVAALPNSDTDGMLEALVKGNPAGVVAGIAAITKAVGAKSAVLIIRSAKNRDELQASA
                     ATAGLNLEIVESQMVNKREFEQDQLIHIETAAAAADLMIGKIPGIVIAVNEEPPIEVA
                     FGISLGEVVSINNLKAISYEHHFYDVSRLEESLEECQVYGSGVIRTFTDQNCLVQAMQ
                     KELMILRQKSCGKCTFCREGLYQLSTIVDEMTKGLAKMTDWNLAKEIADAMELSTNCS
                     LGRDAAAPVHSAYENFANEVEAHITKKECPAGECLAFTHIYVDPAKCNGCGECIDACP
                     KSCIEGKEGYIAMIDEFDCSKCGECMGHCKTGAIISTSKRVPKLPNKLTRVKGSKAAV
                     SEEKKNVKKSKSLRRRQMAKIMPLTNIVEETEKIEERKPKEGIIMKKLETDVIVVAGG
                     PAGLAAAITAGENNLKSILFEKSSTTGGAANMGMGPLGIDTKVQKRDFNNISVKEALD
                     MHMKYTHYRVDEDLVQTYFNKSADTIEWLEEMGVEFAGAFRYFKESEATWHIVKPENG
                     VIGPRAAGAMVRKMTERAKELGTEILLETPVISLIQEDGKVCGVIAEDKDGNQIEARA
                     KAVVVATGGFGNNKEMVKKEFGLNMGVDYFPFMIPGINGDGLNMMWKAGAAKFGQNIE
                     AIYQLADNLSWMLLDAALRQPNLLINQFGERFMNEGDMGNTTFTGNALSLQPGNYGYC
                     IMDESILKYYKKNGPDIFDIVHPADCFLAFEGQAAKAVEQGYEGYIEADTVEELAKKL
                     GIDAEVLQDTFDEYNEMCETGVDTKFHKQPEYLHPITGKGKYLVGKFYLGAYGTIGGV
                     RINKYCEVLDENSMPIEGLYSAGTDANTIYGDSYNFTLPGNSMGFAVNSGRMAGESIA
                     DYVASLNE"
     CDS             102263..103048
                     /codon_start=1
                     /locus_tag="lbkm_0103"
                     /product="hypothetical protein"
                     /protein_id="BBF41429.1"
                     /transl_table=11
                     /translation="MAVTITKEEEQLSYASYFHQPLAPIPQDKLDVLKGGPAAPSMAL
                     SIEDRNQFLEEEVPGLQVGYCVAPNGTGFVANTTFMPNVTPEMFYWWFGWHSITSDLR
                     YKIWDPEDHYYARADKPEYVLDPKIPVSEKTWGVTHDILEDIGMGPDPLKIAFKKPSE
                     FGYDMKKLGTKGCAALVCGVGTSSAPAFMSHKCREVEGGIMFESRFWMGYGYQNGQLI
                     KLVPEGVSIPKEAPMALFGHNIKEFTNLAAILPSLYEKEKDNW"
     CDS             103050..103544
                     /codon_start=1
                     /locus_tag="lbkm_0104"
                     /product="hypothetical protein"
                     /protein_id="BBF41430.1"
                     /transl_table=11
                     /translation="MKRITKEERALAFCIAFFPPLWAVVAPHLGVSTGAVALICAGLY
                     VANGNEVKDGVSMSIGFLMGDLWAVLALKIMEYLPWNADITLYITLFVLGAMAVILAA
                     FLPKLIYCPAMLCGWAIGLTIMAPIGIANIGSLPFQIGTAMLIGVWYVGFGVDWVQKK
                     ILRK"
     CDS             complement(103601..104491)
                     /codon_start=1
                     /locus_tag="lbkm_0105"
                     /product="transcriptional regulator, LysR family"
                     /protein_id="BBF41431.1"
                     /transl_table=11
                     /translation="MTTNQLEYFIAVAENLNFTKAAKQFFLSQTAITQQIKVLENSLD
                     TKLFYRTKRHVELTPAGKVFLIEAKAILERTSVAKEKVRVATNGLLGSLRIGYVKSYE
                     HSNLSKILSHFHNAYPNIELTLYRDNADALIKKLNDDLLDLVITLDFSLYHHYPSLTS
                     KKLHSVPLMAVLPSSHPFAGKQSIKRSDLAGETLFIMHSKNMDPANSNEEVLDSNYER
                     GLNPKCIHYSSDIETILMMVSAEMGISILPSYAVINQNYVKNIIVLPLDGLNECIDVT
                     VYWNPLRESEVMGYFFESLT"
     CDS             104602..105411
                     /codon_start=1
                     /locus_tag="lbkm_0106"
                     /product="hypothetical protein"
                     /protein_id="BBF41432.1"
                     /transl_table=11
                     /translation="MQETNKVYRSNAGQTYLPFQENIYVRTLPYTPLEKPIPEIQELI
                     LNERAKEKGLILQSQSQHMLPGVSAKMLDWFWANMEKGYYLWAPGSHKRFNWVKEPWR
                     VGFVNSVHMISESVGENNPVFGGSGIEIHRLSLSEFPFTTALSHVICEGTFNDLGEFV
                     DSTIHMWEDCEGGCKHITAAVANPNIKEPPHFVKEMLALDPNMKLVPPSSTDHGEYEA
                     SRWPVFLPKLYELWENHPDPTQNVQCDLTVMKRDDGSYRYIHTNGPVKVGK"
     CDS             105413..106336
                     /codon_start=1
                     /locus_tag="lbkm_0107"
                     /product="2-keto-3-deoxygluconate permease"
                     /protein_id="BBF41433.1"
                     /transl_table=11
                     /translation="MSMIERVKKIPGGAMLIPMAFGAVFMTWFQKILLIGNPMSAVFT
                     NKGTMTLVGIMLVFAGIQTDLKSIRKCIKRSGLLIVLKLVLNIITGLLILQLFGKNGF
                     WGISSLAIIACLASCNAGLYIALMTQYGDEGDRAGFAILNITGLPFVPVCILSYANGG
                     GIDIGSILSTCLPFFIGVILGVLDSKLKEATKNGNQLIIPFLGFCLGTSIQLETAFHA
                     VLGGILLFFITLVCNNLILYVVEKVILKGSGYVSMAVSSVAGLALTVPELVLAIDKSY
                     QPYVTTAISQIAMVVILSAVVTPFLTKKLIA"
     CDS             106764..108362
                     /codon_start=1
                     /EC_number="3.1.4.46"
                     /locus_tag="lbkm_0108"
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="BBF41434.1"
                     /transl_table=11
                     /translation="MLLAGLYYMCIIYTLLSLQEHRIKLNLFNIYLTAGKHLYLALKK
                     INGKVVLLVISFYVSCNALMIYGVYTRTRIPRYLAKNVMSLNKIEVLFYIGLLFFVVI
                     MIENIMVLPIMLGEGRPYEQSVYIHHRLSRGKKFYLASLIISFEAILIAIMLMLYYAF
                     MFLIAFLVAFSARWTVSTVAFFTIYDRSNMYMMILGAIFSTTANLAFSFMLSLLRNKK
                     ERLIILEEGMQQVSVTSWREKLYPRRVMTMIVIGFLVVDATYFIVHKISNDSPALLEG
                     FSETQITAHRGCSLEAPENTLPAIEKAADSGADYAEFDVQLSKDGFVMLMHDATLLRT
                     TGVKNRVGRLSYDQLKELDAGYLFSQKFKGTRIPTLSEVLEACKGKIFLNIEIKVVDE
                     DTEKELVEKVVGLVKDYNYERQCVITSTSLSALERVKKIEPKVKTGYIITFGFSQCVN
                     NKNIDALSMNSQFITDNVIDRAHREGKAVFAWTVNERREINRMLELGVDNIITDRPKY
                     VKHMILSQRGSNNSFKDLVKIILK"
     CDS             108438..109607
                     /codon_start=1
                     /locus_tag="lbkm_0109"
                     /product="TPR repeat"
                     /protein_id="BBF41435.1"
                     /transl_table=11
                     /translation="MKYRKLCILLSATILAMTGCSSNNASGHYKSGMELFDKGQYEQA
                     SEDFAEAIKQNGDRAEYYIAYGMSLVKLKKYDEAVVQFDKVIMKHENQIVHENNKKAY
                     RGKGIAYYEAQKYDKAQKEFEKALKLTELSDLNSDLYLYLGDCQIKNGDYKGAIATYN
                     ELIAEDKSEATYYVKRANAYQLLGKSKEAIADYDKAIEYDDDNYDIYFGKYFMLLAEG
                     DKSGASEVLTQALAIKNDEADLFNIARIHYYQKDYNNALSEFNNVSSKNANAYFYIGQ
                     IYYSKKDYTNAKKSYEKYIKKVDRVQEVSVYNQLAMCELKNEEYEKAYQYVEKGLSYQ
                     DASLAKVLSFNEVICLEKIGEYDKAYKKAVAYMEKYNSDKEMKKELEFLETRVGE"
     CDS             109616..110860
                     /codon_start=1
                     /locus_tag="lbkm_0110"
                     /product="GTP-binding protein HflX"
                     /protein_id="BBF41436.1"
                     /transl_table=11
                     /translation="MAELYDIEEVKERVILVGVADYDNDDTKESLDELEELAKTANAE
                     TVAKVIQNRDRIHPGTYIGKGKIEEVRLLAEQLHATCIVCDDELSPAQLKNLEDALQL
                     KVIDRTVMILDIFAGRATTREGKIQVELAQLRYRATRLVGLRSSLSRLGGGIGTRGPG
                     EKKLEMDRRLIKDRISQLKKELAGVTQARETLRAQRSKNPIPIVAIVGYTNAGKSTLL
                     NTLTNAGVLEEDQLFATLDPTTRKLQLESGQEILLTDTVGFIRKLPHHLIEAFKSTLE
                     EAKYADIILHVVDCSNPVYDKQMHIVYETLHNLGVKDKPIITAFNKVDRLEEEISLKD
                     LKADKTIKISAKNGINLDGLLNTFEEVLRDRKVLIERLFSYNDAGKIQFIRKYGQLLE
                     EEYKEDGIYVKAYLPKELEGQL"
     CDS             111019..113391
                     /codon_start=1
                     /EC_number="1.17.4.2"
                     /locus_tag="lbkm_0111"
                     /product="ribonucleotide reductase of class III
                     (anaerobic), large subunit"
                     /protein_id="BBF41437.1"
                     /transl_table=11
                     /translation="MIQVIKRDGEIAKFDLSKISDAIGKAFVATNKVYTEDIINLLSL
                     RVTSDFQDKAHDDQISVESIQDSVEHVLEQTGYTDVAKAYILYRKNREKIRNMKSTIL
                     DYKELVNSYVQEEDWRVKENSTVTYSVGGLILHNSGSITANYWLSEIYDEEIAEAHRN
                     ADLHIHDLSMLTGYCAGWSLKQLIKEGLGGITGKITSSPASHLSTLCNQMVNFLGIMQ
                     NEWAGAQAFSSFDTYLSPFVKVDHLTYKEVKQCIQSFIYGVNTPSRWGTQAPFSNITI
                     DWIVPDDLRNLPCIVGGKEQNFTYGDCKKEMDMVNKAFIEIMLEGDANGRGFQYPIPT
                     YSITKDFDWSDTENNRLLFEMTSKYGTPYFSNYINSDMQPSDVRSMCCRLRLDLRELR
                     KKTGGFFGSGESTGSIGVVTINMPRIAYLSENELDFFRRLDHMMDLAARSLKVKREVI
                     SKLLKEGLYPYTKRYLGSFENHFSTIGLIGMNEVGLNASFLGRDLTHKETQDFTIKVL
                     NHMRQRLSDYQEQYGDLYNLEATPAESTAYRLAKHDKEKYPDIKTAGKEGDTPYYTNS
                     SHLPVDATNDIFDALDIEDPLQVLYTSGTVFHAFLGEKLPDWRAAAKLVKTIAENYKL
                     PYYTISPTYSICKTHGYLSGEQFTCPYCHQPAEVYSRITGYYRPVQNWNAGKTQEYKN
                     RKVYDTSYQNAIDPKMKEEKDTISIQLEEEEEERYLFTTPTCPNCKLAKNYLSDISYT
                     TVDASQNPELASRYGVMQAPTLVVVRNGQIRKYVNASNIRAFALNQLVCL"
     CDS             113466..114314
                     /codon_start=1
                     /EC_number="2.1.1.45"
                     /locus_tag="lbkm_0112"
                     /product="thymidylate synthase"
                     /protein_id="BBF41438.1"
                     /transl_table=11
                     /translation="MSLADKIFIDMCQDIIDNGYSTEGEKVRPKWEDGSSAYTIKQFG
                     VVNRYDLSKEFPALTLRRTGIKSCIDEMLWIWQKKSNNINDLHSHIWDSWADKDGSIG
                     KAYGYQLGVKHQYKEGEMDQVDRVIYDLKNNPYSRRIMTNIYVHQDLHEMNLYPCAYS
                     VTFNVTNNKETGKMKLNAILNQRSQDILAANNWNVCQYAVLVHMLAQVCDMEVGELVH
                     VIADAHIYDRHLPIIKELISRPTYDAPTFWMNPEIKDFYEFTVDDFRLDNYVTGPKVT
                     NIPIAV"
     CDS             114326..114832
                     /codon_start=1
                     /EC_number="1.5.1.3"
                     /locus_tag="lbkm_0113"
                     /product="dihydrofolate reductase"
                     /protein_id="BBF41439.1"
                     /transl_table=11
                     /translation="MKLIVAVDSNWGIGKNNQLLVSIPSDMRFFREETTKKVVVMGRK
                     TLESFPGKKPLKDRVNIVITRDNNYKVEGAIVVHSVEEALEAVKDYNTDDVYVIGGAT
                     IYEQMLPYCNLAHVTKIDYSYHADTHFPNLDEMEGWEITGESEEQTFYDLEYRFVRYE
                     NKAQSAEN"
     CDS             114900..115751
                     /codon_start=1
                     /EC_number="3.5.1.-"
                     /locus_tag="lbkm_0114"
                     /product="peptidoglycan N-acetylglucosamine deacetylase"
                     /protein_id="BBF41440.1"
                     /transl_table=11
                     /translation="MKKKVGFTLFVIAAFVACYFINNANKDYVKRHETYGQFIKDKDS
                     EAEVAKVSNDKTNELKVDAENELNKTENEEIKKVAYLTFDDGPSDHTKEVLATLKKYN
                     IKATFFMIGEEITPEREAMVKEMVKEGHVIGVHTYCHRKNEMYQNKESCVKDFTKAYD
                     KLVEVTGVKPSVFRFPYGSANCYCNNFCVDVIEEMDKKGLTYYDWNVSAEDAVGHPTT
                     YSIMKNIATFRKYNEPVVLMHDGSSNGLTAKMLPQIIERIKAAGYEFDTVDKRSKPYQ
                     WPHDWQK"
     CDS             115818..117089
                     /codon_start=1
                     /locus_tag="lbkm_0115"
                     /product="spore cortex-lytic enzyme SleC"
                     /protein_id="BBF41441.1"
                     /transl_table=11
                     /translation="MEKQIVYPAQTDTQSLGRLKVNVTSIVGSRPITDATVSISYTGD
                     PDNRVEEVRTNVVGQTEEVELSAPSVEFSLEPVAEQPYSEYNITISAPGFETLQINGS
                     QILPTVTAVQNAQLLPLDDAVGESEENWVIPPHTLFGEYPPKIAEAEIKPTNETGEIV
                     LSKVVIPEFVVVHAGPPSDRNAQNYYVKYKDYIKNVASSEIYATWPEATIQANVLAIQ
                     SFTLNRVYTEWYRNKGYNFTITNSTAYDHFFVPERNIFEPIDRVVDTIFSNYLSRPNV
                     KQPILTQYCDGRNVQCPRWMTQWGSKTLGEQGYSAIEILRNYYGSNMFINTAEEVAGI
                     PASYPGGQLEIGSNGESVRQIQNQLNVIARGYPLIPKVSEDGVYGERTAEAVEVFQEI
                     FGLDKTGIVDYPTWYKISEIYVGVSRIAELV"
     CDS             117249..118568
                     /codon_start=1
                     /locus_tag="lbkm_0116"
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="BBF41442.1"
                     /transl_table=11
                     /translation="MTKEKHSNEQNITAYVRKNFKGLGLIVGFTVIVALVIIALQTYF
                     TVGLMQKVGVGNQAVKPIAMAAAFFILVIGAGIVFLKKSFKVGMYLENKVNGVSTEVS
                     DMMQKISDGDLHTEFKYLDQDEFTNMFANTQQTVKQLDAYVRNISAVLHYLSLKNMDV
                     NVEINYKGDFAPIKKSLEEIIDSLNTMFHEFNEAIEGIAEGADNVSKTAQSIAEGATT
                     QSTEVKNLVDNINTVTEDVSSNAENAERVSKVSLESLKQVQESNQYMDELLEAMTKIK
                     EQSMEISNIIQVIDGIAEQTNLLSLNASIEAARAGEQGKGFAVVADEIGQLANQCGEA
                     AKTTTDLINKSLQAVERGSELADHTAEYLGNIVTSSTDTADYVGKISAACKQQEDQLH
                     VILDHVKKIEEVVDGNAAASQESTAISEELAAYSERLLQKIDEYKLK"
     CDS             118889..119989
                     /codon_start=1
                     /EC_number="6.3.5.5"
                     /locus_tag="lbkm_0117"
                     /product="carbamoyl-phosphate synthase small chain"
                     /protein_id="BBF41443.1"
                     /transl_table=11
                     /translation="MKAFLILEDGTTFTGHSIGSSREIISEIVFNTSMTGYLEVLTDP
                     SYAGQAVVMTYPLIGNYGVCYQDMESKKAWPDGYIVREIARTPSNFRCEDSIEKFLKD
                     NDIPGIEGIDTRALTKILREKGTMNGMITTNQNYDLDEVKQRIAAYQVKGVVEKVSCD
                     KAATYQAGDLGTSTVETKYKVALMDFGSKNNIVRSLVRRGCEVTVYPALTKAEDIIKD
                     APDGIMLSNGPGDPAECVSIIKEIKTLFDSDIPIFAICLGHQLLALANGASTHKMKYG
                     HRGANHPVKDLSTGRVYISSQNHGYVVDENSLDPTVAEVSFINVNDKTVEGVHYLNKN
                     VFTVQFHPEACAGPQDTAFLFDRFINMMEVCK"
     CDS             119989..123186
                     /codon_start=1
                     /EC_number="6.3.5.5"
                     /locus_tag="lbkm_0118"
                     /product="carbamoyl-phosphate synthase large chain"
                     /protein_id="BBF41444.1"
                     /transl_table=11
                     /translation="MPKNKEIKKVLVIGSGPIVIGQAAEFDYAGTQACRSLKEEGIEV
                     VLINSNPATIMTDKDIADRVYIEPLAVDVVKQLIQKEKPDSVLPTLGGQAALNIAMEL
                     EESGFLRENNVRLIGTTSLTIKKAEDRQEFKSTMEKIKEPCAPSVVVENVEDAVAFAN
                     KINYPVVIRPAYTLGGSGGGIAHTQEELEDICANGLRLSRVGQCLIERCIAGWKEIEY
                     EVMRDSAGNCITVCNMENIDPVGVHTGDSIVVAPSQTLADKEYQMLRSSALNIISELN
                     ITGGCNVQYALNPDTFEYCVIEVNPRVSRSSALASKATGYPIAKVAAKIALGYTLDEI
                     KNAITGKTYASFEPALDYCVVKIPRLPFDKFVTAKRTLTTQMKATGEVMSICNNFEGA
                     LMKALRSLEQHVDSLLSDEYKGMTDDDIFEQLQVVDDRRIFVIAEALRRGISYEEIND
                     ITKIDKWFIDKIHNIVVMENRLHTEDLTVSLLQKAKRIEFPDSVIATLCGKEEESIKQ
                     MRYENGITKAFKIVDTCAAEFEATTPYYYGCYGSFNEVEEKRTKKKVLVLGSGPIRIG
                     QGIEFDFCSVHATWSLKRSGFETIIVNNNPETVSTDFDIADKLYFEPLTPEDVENIVN
                     LEKPDGAVVQFGGQTAIKLTEALLKMGVKIFGTSAENVDAAEDRELFDEILEKCCIPR
                     PQGKTVFTTEEALAAANELGYPVLVRPSYVLGGQGMQIAISDDDVREFMSIINRFAQE
                     HPILVDKYLVGKEVEVDAVCDGEDILIPGVMEHVERAGIHSGDSISVYPTQTISQKCI
                     DVIVDYTKKLARSLHVIGLINIQFIVSNEEVYVIEVNPRSSRTVPYISKVTGIPIVDL
                     ASRVILGQKIRDLGYEPGLQKASKYIAVKMPVFSFEKIRGAEISLGPEMKSTGECLGI
                     SEDFHEALYKAFLGAGIRLPEHKKMIITVKDSDKLEAVSIARRFKALGYDIFATRSTA
                     RVLNENGVLAIPINKLDQEAPTLMDLLLEHQIDLVINTPTHGRIKSRDGFLIRRVAIE
                     TGVTCITALDTANALLTSLETSVGDKLNLLDIATI"
     CDS             123453..124514
                     /codon_start=1
                     /locus_tag="lbkm_0119"
                     /product="hypothetical protein"
                     /protein_id="BBF41445.1"
                     /transl_table=11
                     /translation="MKLKVAMLDTDAIYVERIVSIFNTMFSDKLEVSSFTEYDVAKEF
                     IKQNPLDVILVSDAIDFDLKLIPKRCAFAFLTDKKDIDLFKDQRIIFKYQKVDIIYKE
                     ILSIFSEKSESVISYKTDDLGNTKILTFFSGSGGTGGTTAAVACAVRMARFQKKVLYL
                     DLELSSNVGQFLQGPGQFSMTDIIYSLKSNKSNLMLKLESSVKCDERGVYFYDASQLA
                     LDMMELNVDDIHHLLDELVISNTYDMIIVNGDFNFDKKSFLLMDMARYVIFVLDGSEV
                     GNCKFERIHQSLAALDGQKEKPILPKLSIMYNRYSNKTSNTVNAEVNVLGGAPRYEGG
                     SIKDIVGQLAGLQIFDHLL"
     CDS             124529..125767
                     /codon_start=1
                     /locus_tag="lbkm_0120"
                     /product="type II/IV secretion system ATP hydrolase
                     TadA/VirB11/CpaF, TadA subfamily"
                     /protein_id="BBF41446.1"
                     /transl_table=11
                     /translation="MEQNEIDELVTELKNRILDQLPITKMSDEELETQIESMTAKRLS
                     GIYVPIEDKVSIVQQIYSGIRGFGLLDTIMSDDSITEVMINGTDDIFVEKAGRLLRLD
                     QKFDSERRLEDIIQRIVGMAGREVNQASPIVDTRLPDGSRVNVVLPPISLVGPVITIR
                     KFSKTPMTIEQLIRYGSITKEIAHKLELLVRAKYNIFISGGTGSGKTTFLNALSNYIP
                     KDERVITIEDSAELQIVGIDNLVRMETRNANTSGTGRVTMQDLIKSSLRMRPERIVVG
                     EVRGGEALDMLQAMNTGHDGSLSTGHANSTKDMLSRLETMVLTGAPGLPLDAIRQQIG
                     SALDIIIHLSRLRDHSRKTMEITEVLGYENGEIKLNPLYVFEEDENSTLEKVSGTLVR
                     TKNPMHNKFKLLLSGIKEEI"
     CDS             125778..126569
                     /codon_start=1
                     /locus_tag="lbkm_0121"
                     /product="Flp pilus assembly protein TadB"
                     /protein_id="BBF41447.1"
                     /transl_table=11
                     /translation="MGLLKKKEPYIEKKGITGECKDYHVYHMPLWERSLYMLIGGAVG
                     FVVGWIFYESKMVSIIVGIICAFGFVPIRRDKIIEKRKNKLTMQFKDFLESLATSIGA
                     GSNITDALLGAEKDMIVQYTNNSDIVKELKIINGGIRNNIGVEALLLDFADRSDIDDI
                     RSFANVFDTCYRKGGDMSDVIKNTHQILSDKIEILLEIKTVVSGNKNQQNIMMVMPIM
                     FVFLLKGFGNMIDMHSLKGTMATTIAIFMFAISYFIGKKILDIKI"
     CDS             126581..127444
                     /codon_start=1
                     /locus_tag="lbkm_0122"
                     /product="hypothetical protein"
                     /protein_id="BBF41448.1"
                     /transl_table=11
                     /translation="MNSIGIILLLIVCTIVSVIFIVFWIRGQKYDMMIAVLNKSEYPL
                     KETYVYGFAVMDFLKLKFMDPYSHTMRGYCRILYGEKYADFYYRVNLAQEITFGTLGI
                     ILSCFLGILSKDYLVFGVGILGTLGVVYYFVSLITDKIHKRNDSISRDYPEVLSKQAL
                     LINAGMILGDAWVKISQNGEGVIYQEMRTTVEEIENGTSEYQAYLEFAQRCGINEVTK
                     FISTLVQNMRKGNKELVEYLKTASKESWNEKKQNVRIKGEEASNKLLIPITIMFVGLM
                     LMIMIPLMSNI"
     CDS             127523..127753
                     /codon_start=1
                     /locus_tag="lbkm_0123"
                     /product="hypothetical protein"
                     /protein_id="BBF41449.1"
                     /transl_table=11
                     /translation="MKELVDNLYFKTTTFLKVQKERFFSEERGGAEIIAVIVLVAVAV
                     ALGIAFKTEIKKFADSLWLGITGNKDAVTNKY"
     CDS             127917..128519
                     /codon_start=1
                     /locus_tag="lbkm_0124"
                     /product="hypothetical protein"
                     /protein_id="BBF41450.1"
                     /transl_table=11
                     /translation="MLGFVLNQKAVFEAAANRSVLLAEKVYMNPIFLDVYQQQGESGD
                     DIVGFTKKADKENSFASSNSDPYRFLGNGYQSDGLVDAMTNRAATIIKKNQLFEMSSR
                     MVENPKITVNPPTGIIFKEQTIKIEQDFKMPLSFGMLDLPNICTISASARISITCPPE
                     LIRNTDFVIDVIQRYTGQNITEVFINFFKKITDFLGKVGE"
     CDS             128519..132481
                     /codon_start=1
                     /locus_tag="lbkm_0125"
                     /product="hypothetical protein"
                     /protein_id="BBF41451.1"
                     /transl_table=11
                     /translation="MKRIRGSITIFLTIILLPIIFIVGMIVDSANISLSKSVVESAGE
                     LTLNSGLANYDFVLKDVYGLFAMSQNYESEEARTKDLEDYFNHSLSASNYIDANNDAS
                     KKSFNSDLLNDLADIFNPEKEITTSKNFVDVTASNFSVKVNTDSSLANPGVLKNQIVE
                     FMKYRGPAEVGLKLIDSLACFKKVKNQTDVTKQQLKVNDQLSEVNKSYANLYYVIRKY
                     DSLVKTYKAKEKDYAAVVKDSSKPYMKSLKKAVKVMLMYKNYKIDTKVDKLSGKKPLF
                     TTSLDNRVYDTGSQTDSYDFTNKTWETVWGDLKSTMNDLVDNIDSKSDNGVLKKLKDK
                     SGVLDTNKVDTGDEIIKVVKFTKEYNDCLKKINLVIQLRKYLYKQIPDNIEDLSESYL
                     DHHEEISRKKDCYEYMRDKVDRYLGWAEDDSKTIQNKYSTFHNNYKKIDADSAIEGYL
                     KDAVKETKDAYKELEEIVTKSHQVNSADDSSIGNDKIYKLCDKAIKDAKDTLEKANQE
                     NEKLNHDIDSYNSAMETSGDDDYSSKMREEYKQNKEIFSEKKLNKITEQLDAGKLYLY
                     QDKNSKNAKKTYKDIKVLTCQVATKEYTDIRKETEKRVKNKAKEKCSSSSLEEKIKDE
                     DQLDSFVTELLKDEVTIPTDTVIDNANDGYYLKQISEVIHEKNKEIGVPDFYIYLMTQ
                     FSTKKKELGDKEPSKDQVENSTKKLKEEAKKTTSNDEIADGSGSSKKVSYSSDLLNDV
                     PSDRNPDTFNVIEWGEGSQFEDSANIIGQILSCLEHGLESMRDNLLVCEYVLDNFSYA
                     TGSKEIALQAGSSDKADYIKKHYATMTNVPITSNNNKLYGCEVEYVVFGKKGSGGKGP
                     ETNVSTTKRYIYAIRFAMNTIYALTNKEISAETLPPAVAIQAATFGIVPYKVAQVTIE
                     LGLAAGESALDLKELMDGKSVPLYKSQNTWRFSISGALNYLKTEAAEDIAGVVKNKIS
                     EGVETLNKCISDAADWTTEQINGAKTKVQEGIVDTLAASVDDCADNMADIVSKGLDTA
                     YTELYTNPKADIKAQLNEMSSGIRTQLSDYIKKATNNGEVSSFLTDEVMEPLMNDVVD
                     KVLTDMGSKYQKCLEDTKNNIELDANTYRDYIKDVNDKIHTKLTGLTTKVADKCNTWI
                     GKEAEAISKDVKFQGNKLAAGVSEKVKGEVQTLVDRYVPSTSTSITTGKKAVSGKSSL
                     GSLIEFNYKDYLRLFLFMRLCTGQGSTVERIGDVIQVNCRNALKDYAQTIGASGELAH
                     PKGDAFRMKNAYTYLSIGARISTRLLLLNQPQVTKEYSYGNSLNFDRWSYDYSSFAGY
                     "
     CDS             132481..133341
                     /codon_start=1
                     /locus_tag="lbkm_0126"
                     /product="hypothetical protein"
                     /protein_id="BBF41452.1"
                     /transl_table=11
                     /translation="MWGEKMERKENRGSITIEASISLVFFIFAMVAILSVINICRVQS
                     AIGNAMNLSAEEISQYCYLYQVCGIDTLDKGLAQNGEPAANAIGEGANSVDNILTNVE
                     NIYKLIGTEKSNLGNVTVDTLKSPTEAMEQYDNLKNAISDGEQSASEISSSVKSLWSQ
                     IKEIKKDPFAFVKSMVSLVASKGFTLAKSYIVGSLMGKKFVSLHLGDCTSESGDSYAK
                     ADAYLKQLGVVDGMDGLNFNLSNMMNNNSSDINLVVVYKVEVLPGIFSWKATLAQSAS
                     TRAWLDGDKN"
     CDS             133358..134026
                     /codon_start=1
                     /EC_number="3.4.23.43"
                     /locus_tag="lbkm_0127"
                     /product="leader peptidase"
                     /protein_id="BBF41453.1"
                     /transl_table=11
                     /translation="MRYVVIMIGLIIGAIGVVLYDNKDLWKKHLSIGEFMRDSCLVRK
                     NGMISFCLIIIGGFLLGILSLLYYKHNTYHVVKNLFIYTFLIPVAYTDYKKQIIPNKL
                     VLTGLIAFAVTFLFDLVIYRPGLILEAKTSVFGLLLGGGVFLLCNVLSRNSVGMGDVK
                     LFSVLGLIMGWTGVFNLLFFTILIAAVGGIFLLITRKKNKNALLPLGPFTLLGMTVSL
                     LLGI"
     CDS             134039..135343
                     /codon_start=1
                     /locus_tag="lbkm_0128"
                     /product="hypothetical protein"
                     /protein_id="BBF41454.1"
                     /transl_table=11
                     /translation="MRKAGIIIAIVLILVLSWTVGISAFSGKERKQEIRQAREAVKRG
                     KEQERLGAYGAVIDYYSDAISLDPTVDHYYLLAKFYQSKKKNELYEKTLQAMVEKFPS
                     DPTAYESLASYYESMRSYEECINMVRAADSQKVHTKKLDQIYNQNRYHYHIVGGNYSE
                     CNSFVSGYSQVTYEDHQYLVNEKLELFNKEATYTTLSPFFSDMTGVTTNKGESYFIKT
                     NNMKYLCSEKHYSYLGGLSEGLAVAVRDNKYYYVDGTFREVYGPYEFASTMKNEVAAI
                     KKDGKYYLIDHSGNIIGKDHYDDIKLDDYDICCNQDVIFVKKDDKYHMVDKDGESVGK
                     STFEDAVPFEDDNMAAVKSKGKWGFVNNEGAVIIKPTYEEALSFSQGLAAVKKDFYWG
                     YINANNKMVIKPAFDKAKNFRDNMAPILKDGFWKYIKLDVSE"
     CDS             135359..136828
                     /codon_start=1
                     /locus_tag="lbkm_0129"
                     /product="hypothetical protein"
                     /protein_id="BBF41455.1"
                     /transl_table=11
                     /translation="MYELTYENQGSKTFLVYQLQKQDQLDTFTYGMLSNNKMKGVLPI
                     LFMQMNEKQFVKYDISSKVTLQQFLSGMVRKNDFLTSVISIVSAILDAEEYMIQYDSF
                     LLDTGKIYVDITTGEASVISMPLMGVKNTQSFALFCKQLLFNTQFDQREDTSYVAYII
                     NYLNQNSNLSLVDFKAMLTGQLHPVANKAIAAESNYQEEYIQKKAVENAINMTSQVKQ
                     SRTIQKNAMVARDEMIRKNEIPLDKKIVNQEKKVQNKKVTQNLEFAIPGMDEGMRMPG
                     MAEDEKKEKKLKHKKKAKKEKREKKEKGTGFFHFGKKKKVETPQQQFMPEDQHMEGTP
                     MGEMQQQIPSSPYQVITGEPSFSSGMNQPFGFGETTVLNQGAGETMVLGESGQIQGGG
                     QPYLLRVKNNQRIPIGQGVFRLGKDLEHVDYCIDDNAAISRCHATVIMKNGCYDVLDN
                     NSTNHTYVDGVMLRPNEEKELHDKTKITLGNEEFIFNIQ"
     CDS             136846..137613
                     /codon_start=1
                     /locus_tag="lbkm_0130"
                     /product="protein serine/threonine phosphatase PrpC,
                     regulation of stationary phase"
                     /protein_id="BBF41456.1"
                     /transl_table=11
                     /translation="MNYLTYAASDVGIRKATNQDSLTLKTGNTCLGPLTFAVICDGMG
                     GLQKGEVASATVIEAFSSWFYNELPNVIQNSDLEQSIRRRWAEILKEANQNLQEYGKK
                     CGFELGTTITAMLFIGDDYYMLNLGDTRAYEIGDQVVQLTKDHSFIAREMAMGRMTPE
                     QAKTDPRRNVLLQCVGASKKIAPDITYGKVRQDTVYLLCSDGFRHEITEREMLHYLSP
                     KQLNSRNDMEQNAMYLIELNKSRKEQDNISVILVRSY"
     CDS             137624..139309
                     /codon_start=1
                     /locus_tag="lbkm_0131"
                     /product="serine/threonine protein kinase PrkC, regulator
                     of stationary phase"
                     /protein_id="BBF41457.1"
                     /transl_table=11
                     /translation="MLEIGSVVDGTYKVLNKIGQGGMSVVYLAMNERANKQWAIKEVR
                     RQGVKDFDVVRQSLIAETDMLKKLKHKHLPSIVDVIENEGNFLIVMDYIQGITLKKAL
                     EENGALDQDDVIKWAVQLCDVLGYLHTRKPPIIYRDTKPANIMLKPDGDIVLIDFGTA
                     REYKQYNVADTTCLGTQGYAAPEQFGGHGQTDARTDIYNLGATLYHLVTGQNPSEPPY
                     EMRPIREINPSLSSGLEKIILKCTQRNPDDRYQSCSQLMYALEHIEEIDDKYRRRQKK
                     KMFGFVSVVILMCVSFIASFYTNWLAVKTRTIDYKTEIEIGDKAAAHKEKIEAYKKAV
                     NIDPSKSSAYMKIVDEDVADLEFTSEEELSMRALLQTISTNQKVINQQLLQEDKEEYA
                     KFAFRLGTAYWYYFYADTNSHTQAAAWFKDVVSYGLEDKNDMKKAKLFCDIGTFYKNV
                     KQQQEMGNDDGMYKKYWKTLMNLKREYEKESTGESIMFWLYKEIVSQTSEYRLYFKND
                     GISYEEINQTLLDIQQKLPEFTLMKHSKKEELEQLMENVNDAIILVDSAYHKD"
     CDS             139320..139727
                     /codon_start=1
                     /locus_tag="lbkm_0132"
                     /product="hypothetical protein"
                     /protein_id="BBF41458.1"
                     /transl_table=11
                     /translation="MSHSVYTLQILHYVFLGTGICFLILSIFLFFKLDIRKVVGYLTG
                     ISEKKEMAEIESKSKGISSRLGRSHNKTYEQYVEKGEMDITEELECLATQETMVLDDN
                     RMEETLLLYPKDVFYVESDITLVHTNETIRGGR"
     CDS             139730..143074
                     /codon_start=1
                     /EC_number="3.2.1.55"
                     /locus_tag="lbkm_0133"
                     /product="alpha-L-arabinofuranosidase II precursor"
                     /protein_id="BBF41459.1"
                     /transl_table=11
                     /translation="MKRLHILLISMFAGMILVFGQGKSAMAETYTNGDQVEFEYSKTE
                     DLIIITRITKVPSSFSGTLTIGNVIAGKQTAIGENFIANSEAVFDKAKLKKLVIGDDV
                     IRISKCAFKECTNLREVSLGSTTRFINGDAFEKTLSLQRIEVASGNSEYESKDGLLLS
                     DQGKTLFIVPCCYQKETFTIPEGVDQLAEGCMKYNQTIQSLNISNHITEIPENMCSES
                     KVQRVTLSDSVKSIGGGAFYEASNLSKVRLSKNLTEIPKSCFWGCNLTEIKFPKGLAK
                     IDEYAFYGNNQLNNVVIPSSVQTIKREAFYRYHSENIDKMVQILNPKAEVDETAFDEY
                     WFVSCFKNSNYYQQSQYTYNGESGIGQPYQNITPFYMSMKYQQKSCGLGESMNIPVIT
                     NIRDQLSYQSSNPAVIAIENGAMIPKQEGTSQIEVSYSVNGYTLKSMRNVSYQNGVVR
                     IEDGKNEMTTPNMSQGSSRVKAKISGKTVTDQGIVYQVNTGNENTVTACYLANQSAIN
                     SEGNLSFPETIKDGDVTYKVSSIADYFMDQSESVNPGVRNSVKKVVISNKIQRVGAYA
                     FNHCENLSELSLGEHYLTLADYAFGNTALEKVVLPYQLEQCTSTTFGGCSKLKSFGMV
                     STSRYTAYQCKEGILYDYHEESNVSIVAVPARIEKESYTIPDDVKSANKGFMRGNKTI
                     KTIQFGKNMRSTGISGCRDSVVEEVILPEGITEIDDQSFLDCIYLKKISLPESLNRIG
                     NCGLADTSLEQLILPNALKTLGDYGLEGCHLLEALTIPAQVESIGAGCFYRDRMNLYM
                     TGKQTSFYDTWNTVDKQCKIIGLPGSVAVSYARNNYEDENFNSFQHKYEDYYVKFAQS
                     EISMQQGQESTFSYTTNVPMQITFQSENQSVATVDQNKVHANGAGTTMIQATAQIPQG
                     NNIVVGTMVVTVTKQEESGSSNLAPLSTTPTPTAFSTTNKSTSVKPVLLLKKSTLYIN
                     RNHKQKIGIKKNTTKQKLVYKSSNKKIATVSSKGVITAKKQGTVRITVRTKNGSIKKK
                     VKVIIKELSIKKAKVTLKKGKHYKIAIKKNTTKQKLSYRSSNKKIATVTKKGVVTGKK
                     AGKITITISSKDKRYVTSCKVTIKKK"
     CDS             143088..149090
                     /codon_start=1
                     /locus_tag="lbkm_0134"
                     /product="hypothetical protein"
                     /protein_id="BBF41460.1"
                     /transl_table=11
                     /translation="MKGYHSSKSQRIFALIMSVIMLIVCSGFQDVVFAGSKENEVFKK
                     AEDQPVYDVEAIYSQDKDLSIEIPYASGREKKLKGKIVTVDLIYNDKKDQYIKVAGEK
                     LPNHLEEYISKSEKFGSKIQAGVYKITLSYQDSGDSTPSDASQGDVVKDEFKIKVWKP
                     FGFNDNQYSYHDDDLFEPDIKDVPDNAEVSYSLEFPGNKETATKGEKLPFTGKQYQYT
                     LREIVTLGQSVEEYTCKVQRYEKKTDSMILSKSDKQNYHIELPYDKNQSVSIPYKPEV
                     FSLLKGKKVTYQINYKGLSEAKTWNKTYVHESSEGNLPSTLNEILEKGSVDQKIEPGS
                     YSISIESESVDNESDAATVTYKDICKIRVYDFCFQKPLYGYYIGSTMDDNAIVDGPAN
                     ISYSLGVKDKEGNIKERKEVQLSQELPVDAYEPGEYQLTATGKFYNCMSDQTDGISYD
                     TDCTVVSSMPECDKNVVLVNEDKVGQGLKDWYNETITISGPKGYMINDDLRTWFGIRY
                     FEPTSYVQKIKVEKGKYDKDIAFNNFLKGEYFRKHVSFGIDKTFPGLEVFTDLKHENG
                     TKIYISKHMPRFYIKASDAESGVAKVSYDIDDKIVNITDPEQLKNDITVDVNKCEEGK
                     DYQYILKARDIAGNNLSFREEVVVDNTEPDPPKVTVYQVKGNTAREIKKEDLKKFHDG
                     KIIVRITEGEATSSGVYKMEWRKVNGDSKSKWLEFEQSWSEVANGYTVKNADGSTPKN
                     SGYGLVFDEDTNTVLNFRTESNSGMYTKEEDYNKSPILLQVSKPALAKTEISGATVND
                     AGWYRNALSIDVSQPSYEMYAKSCAPITTEIGVSRNGKVYPLEKKKDKLTILRKDENV
                     NGVCESIPITEDGIYEVNTKTYNDFDSVKDMQEFKLDQKKPQEVSIDYKSLNGSTFYR
                     EDTVDGKKCYLFKDAIQLKLKCLEDANEFASPIAKYSINRVSENGEESGWEEVTNSDH
                     IITVPDNFYGYIYGKVTDLAGNETEIGHKTLIYTSSNIPKAPVISMGSYKENKWTNED
                     VTIQVMNQDPNAADYEYTTNEKDEKSWKKISEGNGKAVKLSKDFNGDISIRGISLTGI
                     RGDATTKGIKIQKTKPENAKVEISPEQPTGKNEWYRKENPTISITKAKHKSDQSKITT
                     YYKFWNETEDEKESTTKVMEYGENGNVVNPKITKDGIYHLKVWTKDEAGNQSADTYHK
                     IVKVDTTKPDAKIKIGSDVWDDTLNKITFGIYKKSKAQVLITTDSKISGTAQIQYQVV
                     SSESQFDSSKGWKNYQAFHLPVNTKAIVYAKVTDKAGNTTIINSNGLVLDDKKPVGED
                     SPKINLEVVNKNDEGFCNKDAKLHLAVVDPDYTLDKKSKSGVHSGLKKVTYKILKNGK
                     SIYEKDLLDFKKEKPSYHDLIASLDKTIKVSAADFESNALTVVVEATDNAGNHSSSKI
                     PVKIDVTKPDIKVSYDNNTAKNEKYYNKTRTATITIKEKNFDKSQVVVKVKKNKSESK
                     RTLRWSQSGDNHIAHIPFSDDGDYSFSIQCEDKAGLKDGFTEKKEFTIDKTKPTLGVT
                     YDNNDAANQKYYKAGRTATIAVKEHNFDSKVKVKITASDNGKKISVPSISGFSSAEDS
                     HKATIHFSKDGTYKVEVSYIDQAGNESDKAIKQDFVIDQTAPKVEILGIKNKSANKGK
                     VEPYVTLSDENYSANQVKVTLVGANRGTVTNNGTMLNDKGSHTYEFKEFPKKEVYDDY
                     YTLVAAMTDKAGNQTKKKITFTVNRYGSVYNVDDSVKKIQDQYLVAGDDITLTETNVD
                     YLTDYFIKCSRDGDIYTLKEGKDYSVTKAGKENEWKQYKFVVFKKNFEKEGYYSLTFY
                     SKDKALNASDNKIKNKSISFAIDKSAPTCAVSGVQAGKTYNSNKVNVRLSVTDNLKLN
                     QVKVTVDGKEAGKWSAKEVEKAQGNLSFAMPSSDKRQNIVITYTDAAGNTSSTQVKDI
                     LITTNFLIRFCENKPLFYGTIAGILACLIGLIGFVLLKKKEN"
     CDS             149157..150170
                     /codon_start=1
                     /locus_tag="lbkm_0135"
                     /product="hypothetical protein"
                     /protein_id="BBF41461.1"
                     /transl_table=11
                     /translation="MKKLNILGKLMRNLLLVGVLSLMFCVVASADENTPVACNVLAPT
                     QNVQDLINSGVAPSSTTALTQYGQNSQTFSFTVDQEGWIYAAGTDDQNGYTKCILYSD
                     PACGNEIASALAKPGEVAKAYVKAGTYYYRINRTYGYSDYAYNTNTYIAFRPTASVIS
                     TSVTYSKDKTKATIRVNLDGNYKASVGSQYYLRVEARNIDAYNLANSGVWHVDTNKNV
                     VKSNTYKASKNGSYSIRLSRPDSDEWYITRVNVRGIQAAPKVPTVKGMKAKAKTISGK
                     AAKKCKVVIYVKGKKYVVNTGNKTSWKLKLKTKLKKGQKVKFYVMNKNGAKSKTITKK
                     VKK"
     CDS             150316..151266
                     /codon_start=1
                     /locus_tag="lbkm_0136"
                     /product="helix-turn-helix, AraC type"
                     /protein_id="BBF41462.1"
                     /transl_table=11
                     /translation="MKATQLEKCFYGSNVRIIERSKECDIYKRENEDGNYLLTSYHVM
                     DGIDLVYNEVHMEQISLDLEPPKGYFEINHCNEGRMECPYKNGDFLYFAKNDLAINWK
                     DGKCMESTFPVGHFHGVSICIEVKKAQHEIDEFFGEGTMDLEAFCNRFCSESSFWVMR
                     SNEMIEHLFAELYRIPDGIRLHYYKIKVLEILLYLSSFEEPPQEQREYYSREQVQKIK
                     KIKAFIVEDLEQSYTLEQLADIHGMALTSMKRCFKGVYGTTIHSYVTEQRMQKAAKLL
                     RSTDYNILEIANAVGYENGSKFAAAFRRSYGVSPKAYRLL"
     CDS             151427..153202
                     /codon_start=1
                     /locus_tag="lbkm_0137"
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="BBF41463.1"
                     /transl_table=11
                     /translation="MKESKERGLMDHAGNYRYITYLGCFLSGISAVVLLLPFISIYQM
                     ADEVLKAMPHVENAKNLTHYGWMAVVYSVLGIIIYFLALICTHIAAFKTAANMRKEAI
                     HHMVQLPLGYFSENGSGKIRRVINESSGQTETYLAHIMPDVVGGYVTPIAMVVMLMVF
                     DWRLGLLSLVPIAISAYFCNKMMGSGLADAMKEYQNALENMNNEAVEYVRGIPVVKTF
                     GQTVHSFESFHDAIVRYKKWAVNYTIRLRVPMCGFTVSINSVFALLVPAAILFVASAT
                     NPRRFLSDFIFYVIFTPVITVVMNKLMFSSENRIIAKDATKRINAILDEKPLTETKSS
                     KQPRNFDISFHDVTFRYPETDQVAIDKVSFRVKQGMTVGLVGPSGGGKSTLVSLIPRF
                     YDVDSGSIKIGGADIKEISNEDLMNDISFVFQNTNLFQMSLLDNIRFSKPQATREEVL
                     QAAKAAQCEEIINKLPNGLDTMVGAGGIYLSGGEAQRIALARAILKNAPIVILDEATA
                     FADPENEAKIQKAFETLTRGKTVIMIAHRLSTIKNADQIYVVQNGTIVEEGKHGALLK
                     KDGVYAGMWKEYEQSIAWKVKEEAC"
     CDS             153203..154951
                     /codon_start=1
                     /locus_tag="lbkm_0138"
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="BBF41464.1"
                     /transl_table=11
                     /translation="MKEYLKRRFALSEKGAKDLIRAIIACTLTNLSFMFPVGLIYFAL
                     QGMLGKYVGTNDQAWPVIYYIGISIVLLAIIYICEYHQYNATFLAAYEESASKRIHLA
                     EKLRVIPLSFFGKKNVADLTSTIMSDCSGMETAFSHFIPQLCGAILSLVFVGIGLLIF
                     EPRLALSLLWVVPVAFMITILGKRQQNRMNLKNDQSKLACADTIQECIENVREIKANN
                     QEVRYLAKVDEKIDELEKISLRSELNTAVFVVPSQMLLKVGITTLALMGSYLIGKNEV
                     DVLTLLMFLIAASRVFDPLAISLQNLAAIYATELKVARMNEIENQEIQTGSDEMNVRD
                     YDIEFKHVKFAYKKDEPVLKDVNFVAKQGEVTALVGPSGGGKSTISKLAARFWDVNGG
                     QIKIGGFNVASMEAEALLKNFSIVFQDVVLFNNTIMENIRLGRKDATDKEVIEAAKMA
                     CCDEFIRKQPQGYETMIGENGSLLSGGERQRISIARAILKDAPIILLDEATASLDVEN
                     ESKVQEAISRLVRNKTVLVIAHRMRTIASADHIVVLADGKVKEEGDHDSLLKKKGLYH
                     KLWTLQTQASNWSLSA"
     CDS             155018..155638
                     /codon_start=1
                     /EC_number="2.1.1.163"
                     /locus_tag="lbkm_0139"
                     /product="2-heptaprenyl-1,4-naphthoquinone
                     methyltransferase"
                     /protein_id="BBF41465.1"
                     /transl_table=11
                     /translation="MYDNKKFWSRNARLYECFTKSGKSAKRAYDEMEVDICAHLDHKM
                     HVLELAAGPGIMSAKIADTCGSLEVTDFSPKMLEEAKKKEIHGEVHFAVADATELSYE
                     DDSFDAVVIANALHIMPNPIRALAEIKRVLKPEGILIAPTFTREHVESKLVLKLMELM
                     GFRTYSKWSHDSFCEFIESQGWEIIDDHVILGHNFPITSLVCKMKK"
     CDS             complement(155700..156362)
                     /codon_start=1
                     /locus_tag="lbkm_0140"
                     /product="substrate-specific component ThiT of thiamin
                     ECF transporter"
                     /protein_id="BBF41466.1"
                     /transl_table=11
                     /translation="MFKYFMDWNSDGGSLKTPGYVLFIALIVVFLLIISLVGNKENKR
                     KFSTKQLVFSSICMALAFALSFLKLFEAPMGGSVTLMSTFFVTLIGYLYGPYIGIVSG
                     IAYGFLQLIANPYLVHPLQILVDYPLAFGALGLSGFFSRSKYGMIKGYLFGITGRLFF
                     ATLSGVVFFASYAGNMNVLAYSFLYNFFYIAIEGAITVVILCLPVVKNGLVQAKEIAT
                     EN"
     CDS             156629..157282
                     /codon_start=1
                     /EC_number="3.1.3.18"
                     /locus_tag="lbkm_0141"
                     /product="phosphoglycolate phosphatase"
                     /protein_id="BBF41467.1"
                     /transl_table=11
                     /translation="MSNIKYILFDLDGTLTNPKIGITTSVAYALDKMGIHVDDLEKLT
                     PFIGPPLTDSFMEFYDMSKEEAEKAIVYYRERFSVTGLFENEVYEGIPEMLEQLSKTK
                     ELAIASSKPTVFVERILEHFGIKDYFHHIIGSNLDGTRCNKDEVVEAAIDEFHSARKE
                     EIIMVGDRKFDIEGGHAHGVKVIGVRFGFAGEGELEAAGADYIAETVAELSEQLEML"
     tRNA            complement(157328..157411)
                     /locus_tag="lbkm_0142"
                     /product="tRNA-Leu"
     CDS             157609..158595
                     /codon_start=1
                     /locus_tag="lbkm_0143"
                     /product="hypothetical protein"
                     /protein_id="BBF41468.1"
                     /transl_table=11
                     /translation="MQNFQVVTEADKTWLQYELPKDENVDTYLLSILTDEEMKSIAKI
                     RDEDKKEGTAIYYDITGLVPLSKYLQQVITVKQLCLLLKNTLESFNRMRDAMIETDKI
                     YMNPKYIFISVINIQPKFICIPSVKSFRHFFLSDFLRHIIANAKLKGVTDPSVMHQIT
                     SYLGAREKFDSNTMLAYLNRILDMKEEEPVTFSLSGKLLTASSIQLAKPVEEVKKPQV
                     PIAIPKKNPADSTIATITRLKTGEKISIVKPIFRIGKDKDSVDYQILQNSAISRCHAM
                     IIARDDKFFIIDLHSTNHTYVNAQMIPTNQETEIFHGYRISLGNETFYFEVM"
     CDS             158696..160339
                     /codon_start=1
                     /locus_tag="lbkm_0144"
                     /product="serine/threonine protein kinase PrkC, regulator
                     of stationary phase"
                     /protein_id="BBF41469.1"
                     /transl_table=11
                     /translation="MSIVYLAMNENANKQWAIKEVRKEGIEDFEMVKHSLIAEINLLK
                     KLSHPNLPSIVDVIETEGTFLVVMDYIEGVALDKILEEDGPIDQDTLVLWGVQLCNVL
                     NYLHSREPAIIYRDLKPSNIMLKPDGTIVLIDFGTAREFKNDSAKDTTCLGTKGYAAP
                     EQFGGKGQSDVRTDVYNLGTTLYHLITGHNPSEPPYEMYPIRHWNPTLSIGLEKIIQT
                     CTQLNPEDRYQTCYHVLYELQHMEEIDDKYRKKKRKHMILFCCSLFLCTALYGISAYA
                     FNKEKTILVDDYNSILEQGELSSMEKVKRECYSEAIRLEPKRKEAYMMLLQQYSEDCI
                     FAKEEELELYHILQEEKKGTGITHLEALKSDEKRYGEFCYNMGILYWYYYEDKGNKHK
                     QAANWFQDSLRYAALDKETTKKAKLFYEICQFHKRVRQLEYTSSFLGEYKKYWTNLVK
                     LKSAFDHHVEEEGLTLQLYNEIVGQVFNYRSYFKADKVTEGEIVRVLNEISQYCDKFE
                     IIKETKRKEIEQLKKEITDTIEVIHSTYHQNQEETRVSD"
     CDS             160528..161067
                     /codon_start=1
                     /locus_tag="lbkm_0145"
                     /product="hypothetical protein"
                     /protein_id="BBF41470.1"
                     /transl_table=11
                     /translation="MPYEPRTHDVISGNNFITEEKGQAFEDIKDDFEWGEELIAAANP
                     NEREDNKQLETIWYFEDGDWKSKEVYLSEIEEKEVESLTSVGKTENDSNATTKLDLDV
                     VGDGVTTKLDLSVSEIGCDVTTKLELDDLDEGVKPTTKLDVSEIDDGSGVTTKLDLSA
                     IDAGSEVTTKLDLCEFGEE"
     CDS             161076..163223
                     /codon_start=1
                     /locus_tag="lbkm_0146"
                     /product="cell surface protein"
                     /protein_id="BBF41471.1"
                     /transl_table=11
                     /translation="MKRHIKWLLTVLMVFMMVSFIRGNSAKADTTEDGHYQYSISSDN
                     EVTKYGPVEGYKPEGVFEVPEKINGMNVVSIDGSLCQDLVGVTKVVIPRYVRKFEYSG
                     LPVRMFSVCINLQEIEVDSNNQYFSSISGVLYDKKIKTVICYPQNKLGDEYKIPSTIE
                     RIEEGAIVNNRVKHIYMEDSVLYIGEMAFCADEKLESIKFSKNIRFIGADAFYNCTEL
                     KGKIDLENVKYLGIGAFCMCNKIESVSIPKIIKINSSCFYKCCNLKDITLGNEVKELG
                     CDAFCETDIKTLHIPQSVSVLEAGALEEMKSLSKLIFHSKVFIDSDYYRCPEWTTKIN
                     HDTLLFYDPTCDFSKVKEPIGISKIIGHSDSTAQSFAQKENIVFESFSLELPRDVSLL
                     QAEQKKIEISTNTEGDITWVSNDSSVVTVDESGILKGKKPGTTQVTASVVLGGIRYES
                     SSEVSVQPNGDRMDVPEASKQPSQPINTDSSGKESATFNGISVNTDKIVMDKGKQIAL
                     PSVENKTDQTLVYRVANQKIAQLTKQGKIQGKSIGTTKLIIETDDGKYKVELKLVVKG
                     ITVNKSIILTKKGSKSKLRIKENVPGKVKFRVKNNKIVSITKAGEIKAKKVGVTNIVI
                     FVGRYQEVCRVQVGRIRLKKTTLSIKRGGSKKIQVIQNTTGMRIKYKSLNANIASISK
                     DGRIQAKRKGTVKIRVMTCDNKIVTVCTVKVKS"
     CDS             163239..168806
                     /codon_start=1
                     /locus_tag="lbkm_0147"
                     /product="hypothetical protein"
                     /protein_id="BBF41472.1"
                     /transl_table=11
                     /translation="MKKWKRYLIGLIILCLFLSQVELGLQNSVHADEPEEQEQRVVNI
                     VITMGKRMDLRLENLNLNLYYRKKGETNFKEVDLRKGKGLFNADDGELYEIKACVGEC
                     VLYEELVKVENDTTILQWCIGDQVEEYSSKKNVEFKKNTPYRMLKNTKSKVCIEDGSD
                     VAGCIESKKYTYFFIRKAGKFEWSEGNGENSTIVTVNKGVNPDDIEFTKGEGMVQIIT
                     PKLSDYQNQFTIGKVTVDDEINSAIAWIDNNQVKINKIKILDSAKIEISGTILENERY
                     QTKKFSKNIVVGWEEGDCNDTNKGYQIQEKSFDGGWYKGEVNIKKEREKDVMYEWTEN
                     GWMSVDEIKINLKKNGKMEVPILINDKLYKEVVWVDNQEPKFQYAISKKGYKEDKVQN
                     ITTGYYGDEIDIIDKSIDSESGIANQIITLKSGESKKFVKVDSTHYHMKSPCKVQFIY
                     KLKDKVGNITMGTIPYIFIVDTTVPPAPTPSFRSKGADYNPGSWTKDDVTIDLQLKGD
                     DVPFSGIESFQYTTKDPKKCKDDDWNIIKVSENKVIDDSKPMFMNKNDVVGGLTLSSH
                     TCETYYFRTISQTGIKSKPTKGYNICIQKDQLQNGSVKISNRNMGKQDWYTSKPEIEV
                     NHPSLTSYSEKHAPVITHYQLLKMEKNDYEIVEEKEFQRGSIREHIAKENVINPQIIK
                     DGKYKIAVWTSDTCGNQTTPIYKEFKVDTNAPSGLAIVFHKSIESGFIKEILSDMGIW
                     AIFQDFARYECEATDEEMEFPGSGVEKLEYSTDQQNWIQVENNSFQLLSNYMGKIYLR
                     ATDKAGNVSTPSDKIIGKDIDTDSISPTSLIVDGEKPGKPVIIATSGKGSYTEDTWTN
                     QAVQINVTSKVPLSGIDYYEYTTKKNAKESDWKKLNQTTNTQIHMDQKVGMIQDRITI
                     SKDENATYYFRAVSNSKKYSDVAGIHVKIQLTKPSIAVVRLTPATPDGDNGWYAKKKP
                     KIMIEHNQKTGKSNEDAAITTSYKLWNTTKGQTEAQAKLNEYIEGKAIPSQTITEDGI
                     YYLKVWARDEAGNEYLSREKNKYDLYTIKVDTTNPKGAVTIGTEKYNRFSRIVDYVLN
                     LNQKVAIQMDAQDELSGIERIEYQKVKDASQYDPNGEWKRYQKFMTAKNERFIVYLRV
                     KDKAGNQIVVNSDGVIVDTKKPTGKNRQAISIVPIGLNEHGIANKNFAVDIIVKDPDY
                     FGVKSGSRGVHSGLKKVNYSISVDGKVKKKSTLFQDNRKKVAYKKLKRTFVKRVKINA
                     KEMEGKQVQFIVHAADRAGNEAINQETMKVDVTRPKIKISYDNNKVFHDKYYSADRNL
                     NININEINFNGNDVVFTIKKNGKTMEKKLLHWKKLNDHQHVASYPISMDGDYEVTASY
                     TDQGGNDAKYSKVDRFIIDKTEPELAFHLDNAQGVKESYYHTNLRGDVEVKDTNFQNN
                     MKLNITVLRDGKKVKVPKLGTWKRSGDTYKAPVLFDQEGDYKIEGSCMDAANNERKLT
                     AVQFHIDKNAPEIKIQGIKSGSSNLDQLKPQIEISDLYEKENGVKITLQGINRGKIPL
                     SVVPTKDKHTMKYLLDVFPRKKSIDDVYLLTVSSEDKAGNKTTKKLNFSVNRFGSVYS
                     YDTNTAAIRNQFKTKAQEVVITETNVDYLSKYYVKVSCNDVVKDLIEKKDYDVEVSGK
                     KNGYKQYQYKIRPEVFENDGYYSVHVYSKDKAANESDNQSKKMECSFVIDKTEPLCVV
                     TGVESGKSYNAKEKNVRVTVSDNTYMNKLIILKNGRQITSLDKEQIDKCKGQVSVKLD
                     GSNEEQILEVTCIDAAGNQKIKTISNVLVTTNPVVRFINNSKLVYCSIFGIAGMLSLL
                     VLVLFHKKKEEAA"
     CDS             complement(168830..169738)
                     /codon_start=1
                     /locus_tag="lbkm_0148"
                     /product="Cys regulon transcriptional activator CysB"
                     /protein_id="BBF41473.1"
                     /transl_table=11
                     /translation="MDINYELYKVFYFVAKTLSFSEASKALFISQSAVSQSIKVLEKR
                     LNQSLFIRSTKKVKMTKEGELLFKHIEPAINLISRGETQILEAHSLNGGQLRIGASDT
                     ICRYYLVPYLEAFHKQYPNVHIKVTNGTSLKCVELLETNEVDLIVTNAPNKRLTTMHH
                     IQEIHEFHDVFVVNKDYFDIPDEKLELSALQSYPILMLEKCSTTSEFLHGLFLQHQLD
                     LVPSVELSSNDLLIDLAKIGLGVAFVPDFCVDNCTELSKIRLMEELPARKLLVVNNQD
                     IPLNAAAQNFINMLAGITEEESEIEE"
     CDS             169938..170876
                     /codon_start=1
                     /locus_tag="lbkm_0149"
                     /product="hypothetical protein"
                     /protein_id="BBF41474.1"
                     /transl_table=11
                     /translation="MIENVVSVDLPVGETMKIVRNRLQPMNLTGKEKRIGIVSGIYGD
                     ELEGQYVCYELIRRINARHDQLKGIVDLYPAINPLGIESISRKVPTFDVDMNRVFPGN
                     ESGDMAEHVAACLVDDLVGADICIDLHASDMFIREIPQVRLVNKENHQLLEYAKLLNV
                     EFVWIHKSQTVLESTLVHTLNSLGVPALAIEMGVGSRITKEYGNQIVDGIFHLLSELG
                     IWEGEVKETKRPIISTDGKVELVHANASGVFIPEVSHWNSIMAGDTIGNIIDPIQGKV
                     LEHLVAPISGMVFSLREYPVVYEGSLIIRILGGVNS"
     CDS             170873..171808
                     /codon_start=1
                     /locus_tag="lbkm_0150"
                     /product="succinylglutamate desuccinylase"
                     /protein_id="BBF41475.1"
                     /transl_table=11
                     /translation="MKKELVYRMKAPYREDLNIYGYNFGKGDKSACIVGPTRGNEIQQ
                     LYICSQLIRVLKTLERTGNITKNNSILVIPCINQFSMNIEKRFWSLDNTDINRMFPGD
                     PKGETTERIAAGIFERVSGYCYGVQFASFHTPGDFIPHVRMMETGFQSNSLANLFGLP
                     YVVTRKPEPIDTTTLNYNWQMNGTNAFSVYTTENEKIDEASAKQAVSSVLRFMTRMGI
                     IKYNCHSGYIASIIEEQCLMPIRANVSGIYRRLKQPGDEVYFGEIIAEIVDPMEGEVI
                     SSIVAPSDGVIFFAHKKPLVMQNGVVYQLIRRIHT"
     CDS             171912..173048
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /locus_tag="lbkm_0151"
                     /product="foldase protein PrsA precursor"
                     /protein_id="BBF41476.1"
                     /transl_table=11
                     /translation="MINKSNKIRKITAMLMVVVCMFTLAGCNKKKASKTSDSKLSTKV
                     LTIDKTSYTLGDLMYTLYMTESDIDSTVSYYNMFGMDYWDTVKEEGGTKQGTIQRAFF
                     DTAIWIHVMEDQAKKAGYKVSDADKKEIKETAKSILDEMSDKYKKQTGFTQDYLESQM
                     ERESLAYDYYMDQLDKIKVEADDVKDEYPYEDYREYETAYIYVPTVDYDEEGNVKKLS
                     KDKIAKAKKKIDSLFAKVQSGTSLKDAYNNDESIEYGTVPVVKDDEGMPAEFTKAALS
                     LKNGEIYKSVVTTDDGYYIIKMKNNNVKENYEDTINTAINDEKEAKFEDTYQTLLKKY
                     KYTEQESALKSLTLGNYAYEHKEDSELEDDHDHEHEEEEAVVQD"
     CDS             173132..174349
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /locus_tag="lbkm_0152"
                     /product="foldase protein PrsA precursor"
                     /protein_id="BBF41477.1"
                     /transl_table=11
                     /translation="MNNSKKSIRKDNKKVITDLNQSSKMATSLKLWIAAGVVAFIVVV
                     VAICYDAFHQDALVTVDGTDYKLNDIEVMYNVYNQESQTEYMNQMYAQLYSQMGQAGY
                     DYWAEDGVVDQVRSSIINNMEQTEVLYLESQKKKANIKLTSAEKKTITTTANDLMSKL
                     SSKRLRKTKFTKTKLVDYLTKQKIADKYKEQLISSYGITEDTAKANVDESKYDERKVQ
                     LIQVATKTTDSTGASKAVSASKLATYKEQMNQYLAKAQAGTDMSKILGKDEKTYTYSE
                     TTFLVGQDKIDSKVEKAALKLKNKEIAGSVIEGTDALYIVKMVDTACKDSYNSAVSSE
                     VKTEQNAKLQAAVKKMKTSYKVKEHTKAINALKIGEISLKKGESLTEYASDSDSKSSS
                     SSKATSTPKASSK"
     CDS             174531..178283
                     /codon_start=1
                     /EC_number="6.3.5.3"
                     /locus_tag="lbkm_0153"
                     /product="phosphoribosylformylglycinamidine synthase,
                     synthetase subunit"
                     /protein_id="BBF41478.1"
                     /transl_table=11
                     /translation="MSNVRRIYVEKKQPYAIHAKELKGEIKSYLGIRSVTEARVLIRY
                     DIENVSEDTYKRALGTVFSEPPVDVLYEKDFPKEKDSVSFSVEFLPGQFDQRADSAEQ
                     CVRLLNESEEPVIRSATTYVLNGTMTAEECDRIKAYCINPVDSRETDETVPDTLITAF
                     EEPADVKIFDGFAAMKEDELKNLYSSLNLAMTFKDFLHIQNYYRNEEKRDPSMTEIRV
                     LDTYWSDHCRHTTFLTELKNVKFEDGFYRKTIEKTFDEYQAAHKEIFAGREGKYVSLM
                     DVALMAMRKLKKEGKLDDMEESDEINACSIVVPVEIDGKTEEWLVFFKNETHNHPTEI
                     EPFGGAATCLGGAIRDPLSGRGYVYQAMRVTGAANPTVSLKETLKGKLPQRKIVTGAA
                     KGYSSYGNQIGLATGLVNEIYHPNYVAKRMEIGAVMGAAPRKNVIREDSMPGDIIILL
                     GGRTGRDGCGGATGSSKVHTEKSISTCGAEVQKGNAPTERKIQRLFRREEVSSLIKKC
                     NDFGAGGVSVAIGELADGLRIDLDKVPKKYAGLDGTELAISESQERMAIVVDKKDVDT
                     MLGYAEEENLEAVVAAVVTEEPRLVLSWRGKEIVNISRDFLDTNGAHQETDVTVTMPS
                     ETENYLDQKPEVKDLKQQWLDNLSDLNVCSQKGLVEMFDSSIGAATVTMPYGGKYQLT
                     PTQSMIAKLPLLQGKCDTVTMMSYGLDPYLSSWSPYHGSVYAIISSVAKIVAAGGDYK
                     KIRFTFQEYFRRLGTDPTRWGEPMAALLGAYDAQMKLGLPSIGGKDSMSGTFNDIDVP
                     PTLCSFAVDIAKVNDIVTPELKEAGHKLVRFQIEKDEFSMPNYEQLMNLYEEVTRLAN
                     EKVLVATYALGFGGVAEAISKMAFGNQLGVKLCDKQIDTYFTKAYGDIIAEVAESDLD
                     KIKVPYTVFGEVTNEKSFVCGDMVISMDEALAAWTKPLEKVFPTKSDVEDKKLETKLF
                     NAKSIYVPKQKIAKPNVFIPVFPGTNCEYDAKKAFEAAGAIAKTVVFKNMTESNIKDS
                     VEAYVKAINESQILMFPGGFSAGDEPDGSAKFIASAFRNERIMEAVHDLLNKRDGLIL
                     GICNGFQALIKLGLVPYGEIRPQTVDSPTLTTNSIGRHVSKSVYTKVVTNKSPWLQNA
                     DLGGVYAIPASHGEGRFVASEDWIKRLFENGQVATQYVDINGNPTMDEDFNVNGSYYA
                     IEGITSPDGRVLGKMAHSERRGDGVAINIVGEQNQRIFESGVEYFK"
     tRNA            179068..179139
                     /locus_tag="lbkm_0154"
                     /product="tRNA-Gly"
     tRNA            179185..179256
                     /locus_tag="lbkm_0155"
                     /product="tRNA-Gly"
     tRNA            179302..179373
                     /locus_tag="lbkm_0156"
                     /product="tRNA-Gly"
     tRNA            179419..179490
                     /locus_tag="lbkm_0157"
                     /product="tRNA-Gly"
     CDS             179786..180583
                     /codon_start=1
                     /locus_tag="lbkm_0158"
                     /product="hypothetical protein"
                     /protein_id="BBF41479.1"
                     /transl_table=11
                     /translation="MTRNEFLEMEKRICDFQYTSLGYCDYDDVEGYEVIEDSKTLLCV
                     KGYDVEAGMIQYHWAADHASWVVGAILESPCYLTFVPKGWVKEFEQVGLRIRNRWHDY
                     FMKDFIQIKDEATDIEFLKVEECEGASKVTMACRGQSRGFTGQTVQWIRDWVTGADEF
                     VRNCRIVIERNEVNEIVGIVCTGTYGHESEKGPTCWIREVAVVPEYQNRGIARKLITQ
                     ALSFGKSLGATRAYLAADEQNAGAIHLYESLGFVASEEESEINMIRE"
     CDS             180622..181479
                     /codon_start=1
                     /locus_tag="lbkm_0159"
                     /product="hypothetical protein"
                     /protein_id="BBF41480.1"
                     /transl_table=11
                     /translation="MDIAVLADIHSNHIAFERCVEDVLERGITTFLFLGDYIGELAYP
                     QKTMELLYRLQEHYQCYFIRGNKEEYWINYRKQGATGWKDYNSASGALFYSYHHLTTR
                     DLDFFEKLPIAKEIAFERMEPITICHGSPFKVNGKMIPEDEATKRVIDQVITPLILCG
                     HTHIQSKIIYNNKKVLNPGSIGIPLRTQGKMQYLILHENQGVWEEEFVSLTYDIEKAV
                     YEMHESGLFEHAPYWSIVTEGNLRGSNLSQSKTITRAMELCKEEMGECIWPDIPDRFW
                     LRAIEEQRN"
     CDS             181578..182183
                     /codon_start=1
                     /locus_tag="lbkm_0160"
                     /product="hypothetical protein"
                     /protein_id="BBF41481.1"
                     /transl_table=11
                     /translation="MKKLRIVVVLAILAVGYFGLQRSEKQEAKFNVEVDGMTVELDKT
                     TVKDLKDHGFTLADGISSDLPATMEPKTVSLSNTGSAMKSDEQYFGFGVINRTNTNVS
                     IEEAKIESVSIHYKDTYIKGNKVDTYQEAKVMGFNPKGMTMDEVKSQLKKEVDEASIS
                     QNKEDQLQVKVDDHYCNYYFDKDGKLETVSTSIAVATTFRK"
     CDS             182276..183250
                     /codon_start=1
                     /locus_tag="lbkm_0161"
                     /product="transcriptional regulator of rhamnose
                     utilization, AraC family"
                     /protein_id="BBF41482.1"
                     /transl_table=11
                     /translation="MNEQLLEQLRMITPEEERLLNGSKEIEKNIYMSSEDGVIEANKL
                     LEAGKLIQVRTHTRFVHFPKHTHNYIEVIYMCSGNSHHVVNGADVYLKQGELLFLNQK
                     AIQEIYPAGENDIAVNLIILPEFFDYVLRMIESEENLLRDFVIDCLRGDNPQGGYLHF
                     KVADILPIQNLVENLIWTIKNRQPNKRSINQNTMGLLFLQLMNYMDKVETNEENSEQK
                     LMIDVLGYIEEHYKDGELSELANLLHYDFYWLSKEIKKLSGKTYTDMVQTKRLNQAAY
                     YLTHTTMSVMEIAMAVGYDNISYFHRIFQKRYGMTPRKYRVGNHNKNR"
     CDS             183380..184783
                     /codon_start=1
                     /EC_number="2.7.1.5"
                     /locus_tag="lbkm_0162"
                     /product="rhamnulokinase"
                     /protein_id="BBF41483.1"
                     /transl_table=11
                     /translation="MEKYYLAIDIGASSGRHILAHKKNGKMKLEEIYRFPNGLMKKDG
                     ELCWDIDQLYTEIKTGMKECVKLNKIPVSVGIDTWAVDFVLLDAKGQRIGNPVAYRDG
                     RTKGMDERVYSFLSEEKLYQRIGIQKQIFNSIYQLMAIKENHPEQMEQAEKMLMIPDY
                     FHSLLCGKTVTEYTNATTTSLVDPETNEWDMELIDLLGFKKEIFQEIKMPGTVLGDLS
                     EEIQKEVGFNCKVVLPATHDTGSAVMAVPSNKDDVLYISSGTWSLMGTELAKANCSKE
                     SRQRNFTNEGGYDHRFRFLKNIMGLWMIQNVKKEIGEGLSFGEICDLASKETITSIVD
                     CNDDRFLAPDSMTEEVKKACKESNQDIPNGVGQVASVIYRSLAKCYADTIDEIEEITK
                     CKYDTVHIVGGGANADYLNRLTANETKRTIYAGPTEATAIGNIAAQMIAEKELEDLTE
                     ARSCIRDSFPLKQYDPQ"
     CDS             184809..186065
                     /codon_start=1
                     /EC_number="5.3.1.14"
                     /locus_tag="lbkm_0163"
                     /product="L-rhamnose isomerase"
                     /protein_id="BBF41484.1"
                     /transl_table=11
                     /translation="MTGLERYESAKKMYAAMGVDTDAAIKRLKEIPVSLHCWQGDDVT
                     GFDHEGPLTGGIQTTGNYMGKARNPEELMQDMDMAMKLMPGKKKLNIHASYAIFGEGE
                     RVDRDQLEPKHFEKWVQFAKERNMGIDFNPTFFSHDKVKDGLTLSSPDEETRKFWINH
                     GKACIRISEYFAKETGIPCVMNIWTGDGFKDIPADRMGPRVRYKDSIEQILSEPFDRN
                     LVKPCVESKVFGIGVESYTVGSAEFTLNFAATHEGCLPLMDNGHYHPTEVVSDKISAL
                     LCYFPEIALHITRPVRWDSDHVVLFDDETKEMAKEIVRNDAIERVYMALDYFDASINR
                     ISAWAVGYRSWQKALLSALVTPNEMLKKLQDENQLSELMVMQEEMKTYPLGDVWDEYL
                     RQCGMSADPNWFTEIKKYEKEVLSNR"
     CDS             186098..186922
                     /codon_start=1
                     /EC_number="4.1.2.19"
                     /locus_tag="lbkm_0164"
                     /product="rhamnulose-1-phosphate aldolase"
                     /protein_id="BBF41485.1"
                     /transl_table=11
                     /translation="MKFLDAEFVKGFIRMANDGWEQGWHERNGGNLSYRVKPEEVDLV
                     KENFKAGDWTEIGTSVPKLAKEFFLVTGSGKYFRNVILDPEDSICMIELDETGEKYRI
                     VWGLVNGGRPTSELPSHLMNHEVKMLATDGKYRVIYHAHTTNVIALTFVLPLKDEVFT
                     RELWEMATECPVVFPQGIGVVPWMVPGGREIAVATSDLMKQYDVAIWAHHGMFAAGED
                     FDLTFGLMHTVEKSAEILVKMLSMQPNKLQTIQPDEFRHLAKDFKVTLPEKFLYNK"
     CDS             186941..188089
                     /codon_start=1
                     /EC_number="1.1.1.77"
                     /locus_tag="lbkm_0165"
                     /product="lactaldehyde reductase"
                     /protein_id="BBF41486.1"
                     /transl_table=11
                     /translation="MANRFILNETSYHGAGAIQEIATEAKGRGFKKALVCSDPDLIKF
                     GVTKKVTDVLEKAGLSYEIYSNIKANPTIENVQLGVEAFKKANADYLIAIGGGSSMDT
                     SKGIGIVIANPDFADIRSLEGVAPTKNKSVPIFAVPTTAGTAAEVTINYVITDSEKNR
                     KMVCVDPKDIPVVAFVDPEMMSSMPKGLTAATGMDALTHAIEGYITAGAWELSDMFHI
                     KAIEIIAKNLRGAVDNTPEGREGMALGQYVAGMGFSNVGLGIVHSMAHPLGALYDTPH
                     GVANAIILPTVMEYNAEATGEKYREIARAMGVAGVDEMNQDEYRKAAVDAVRTLSKEV
                     GIPADLKEIVKKEDIPFLAQSAFDDACRPGNPKDTSVADITKLYESLI"
     CDS             188273..188905
                     /codon_start=1
                     /locus_tag="lbkm_0166"
                     /product="hypothetical protein"
                     /protein_id="BBF41487.1"
                     /transl_table=11
                     /translation="MKRIITRLVMVIVIIVALFLGLQMKNQNQTKKEKPEFKIEVDGM
                     KIELDKTSVYDLTQNGFTITDSSYKELASTAMVPSKTVTSHDAATAMKDNKKYFDFGV
                     INRLSTDRTLTSAELNAVSINYGEEGKDGKKAETDENTKIFNFSPKGMTKSEIEAKLK
                     EEIGEEYVRETDENQLMVTIDDHMCTYNFKKDGKLESVIASVSVSLKIGN"
     CDS             189020..189874
                     /codon_start=1
                     /locus_tag="lbkm_0167"
                     /product="hypothetical protein"
                     /protein_id="BBF41488.1"
                     /transl_table=11
                     /translation="MSKHHQVYSAQSSDPINIQQNNVVVVPDIAMTAASTKELILSGI
                     VYNQNLVGINGISVVLYSATGVPFAQATTETVNKKEGCFSITFEGDMNTSYTLIASGM
                     NYNTSYQEIIFNGKKENVNFYLTANVNTKIIYGVVTDLNGKGLKGAIVRISDATSDIV
                     TVLTMSDGSYVAYDEFTVGTNYTVNVSLLGYISGNMTAVIVDNTNSAFAPIKLTQSDG
                     NVTSVVGTIVNAKSSVPIQNAMVGLYQMTVSSFKLIATTYTDVYGYYAFTNVPMGSNY
                     IVKATKIE"
     CDS             189915..190244
                     /codon_start=1
                     /locus_tag="lbkm_0168"
                     /product="hypothetical protein"
                     /protein_id="BBF41489.1"
                     /transl_table=11
                     /translation="MFQVYGYPVVEQVVSILANEMLLPIGEIININGYVMDWWHHPIP
                     DAILVFENMDFREVARSDQYGYFKLFLPFYHKHCAVRIYVDGCLLYGARRICLRRRYF
                     TFVLPWR"
     CDS             190326..191708
                     /codon_start=1
                     /locus_tag="lbkm_0169"
                     /product="possible peptidase"
                     /protein_id="BBF41490.1"
                     /transl_table=11
                     /translation="MIIPITQERLMEAANVYAESWVESHKTFCTEEYLNQHTVEYQYR
                     FLLEKQENGWSLYAKCVDDSIKGIIGINKNTGEIGLLYVLPQEWGKGYGKELFAFVLE
                     QVGQPYLTVIDHNTRAIALYEKFGFRFSGEKRKLAENLYECKYILEEDQKESVFDCPT
                     TKKGWKKLRHKAERRWYRRLVILNLLIIIGIIGYCSSQVEEHERYFNELQTSAQKSMD
                     HPDSDKASKNLENKLDEFPESLQFLLVGVFIILFLPLVLYYLYAGYRSMSIQITERNF
                     PEIYKIVEEYSKKLGLKKVPKIYIVQQNGVLNALSSFIPFKQYIELYADLVEVAYREH
                     HDMDSLRFIIGHEMAHIYLKHATLHYNYTILFANMIPILSSTASRTREYSCDRIAQRL
                     SQSDGIDAMMTLTAGIHLYKRVDKEDYIEHAKHVKGFFVFCYNIASDHPVISKRVLAL
                     EMKEGSGKLY"
     CDS             complement(191705..193039)
                     /codon_start=1
                     /locus_tag="lbkm_0170"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBF41491.1"
                     /transl_table=11
                     /translation="MKTLLEYCFVLVFINLHNYFFFRYCYQILRPRFTQKWYYILIPF
                     ILSQLSLTLIVLRVFIPLSYVIIFVVYWTVFRILFKDSLFSILFVCLNNTFNMLILRD
                     LTIAVFSLIFNQSMYQVTRVPELNILSLGVTRLLMLILDSFLYKTSGYRSISSLLEAK
                     KGMTFIILTKATLLLIMLNLDCINYYYVDNIKLTGMNLLNYFFAYGCYYFLHTLSGIT
                     FKWSNQEMTHELTLLQLKHQKELYEKQSQSQELQRIYNHDYKDIMQNSINLLNRGDTK
                     GAKKLLNELNVQIDHINQQTKRYSNSLIVDAILNDLDHKCLKEGIKFTGECYIPENMP
                     LCALQLSQIFNNISNNSFEACMRQPEYEHRWIHIKSYVQNHMLIIFAQNSYNGALIIE
                     NNKFMTSKTNKRLHGIGLESIKYTIGKLNGMVLIKTDHAPNVFKLLIKLTYH"
     CDS             complement(193051..193782)
                     /codon_start=1
                     /locus_tag="lbkm_0171"
                     /product="two-component response regulator"
                     /protein_id="BBF41492.1"
                     /transl_table=11
                     /translation="MISICLCDDDITFLDSCTEIIRTIETELGKTFNIKCFTNGESLL
                     FALDDDVNKYDILIMDMIMKQKSGMETTKELRSKGFIGDIIFLSSSKEYAIESFEVEP
                     LYYVLKNSTYKDKLKEILTRAIIEQERKSSQKIIFTMNKKNIIVELKDIIYIESMNKK
                     IILHKTTGDNEECNLPLNKIVEKIEPYGFLQCHKSYIINQEYVEVFTKLECRLRNGIT
                     IPIGRKYATTFAESLAQYEFDHIVL"
     CDS             complement(193913..194224)
                     /codon_start=1
                     /locus_tag="lbkm_0172"
                     /product="hypothetical protein"
                     /protein_id="BBF41493.1"
                     /transl_table=11
                     /translation="MKKGTICFLSLKTEQNEGPLQIRPVVIISAEKNKKKVYVAPITS
                     NEMMATEPTHIEINHKCLSRKSFILMDNTQEVDSSRIIEELEPLTTEELLCLDHILIN
                     Q"
     CDS             complement(194370..195410)
                     /codon_start=1
                     /EC_number="4.1.99.-"
                     /locus_tag="lbkm_0173"
                     /product="spore photoproduct lyase"
                     /protein_id="BBF41494.1"
                     /transl_table=11
                     /translation="MKGCDILFHPNRIIFEKGTRDYEIGQSIYNTFSTNPKIEIVETA
                     ANKIKPLITMDTAAETYQQGKKTLVVSKKRSGAFQTCKPSADYMLPLVSGCMGQCEYC
                     YLHTQLGDKPFVRVNVNLDDIFAKATKYMLERPEQITSFEGSATSDPVCVEPYTHALE
                     QAILFFAKEPLGRFRFVTKYSDVDTLLSLEHNNKTEIRFSINTKRIRDQYEHFTADID
                     SRIKAAAKVMKAGYPVGFLIAPVFLYDGWEDEYQQLILHLQETLPANYPHQLFFEVIT
                     HRFTPKAKDLIQSIFPDSSLPMEEDLRQYKYGQFGYGKYVYKKEDMHSVKAFFQSHLM
                     SAFPNCEIKYIV"
     CDS             195568..197562
                     /codon_start=1
                     /locus_tag="lbkm_0174"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41495.1"
                     /transl_table=11
                     /translation="MKTLKMKLVVLMSVLMLCGCLGVGTVNYTMTVLSIANTLKRDMT
                     VIAEQTAASTEKLIDEKLAALEGVAQLDKIKDPKVSMKVKAEKMTEQVKRIGCLRMNY
                     INTAGDLYNNEGTTYNVSDREYFIKAMAGERNLSDPTLNKIDQSLVVIYAVPIKEDDK
                     VTGVLTAAYDGSELSTSVNENKVGNTGTTFIINKNGTMVADSDINTVKDMLNPLEAAK
                     KDSKYKSLATATQLMMNGKSGMKNYEFAGQEKTCGFAPISGYDLYLGVAIDKSEVYHD
                     LDRLFFIMLGIVVIVLGVSIILGYFVAKRIADSVKMTNDHLANIAKGDLTGSLDIKHY
                     KRKDEIGTMTKSLDSMQSSIKGMVSTIKDNSLQLSDKSYELKDNSEEITKLSQTINNA
                     ISDIAEGTSYQAGELVNINNNLVAFNDKLQLMGEQIEHVNESSKNIDSMAAKSSEEMN
                     ELDASMNQVGDKFNEFKKSIQALGANIQEINNITNMITDVANQTNLLALNASIEAARA
                     GEAGKGFAVVAEEISNLAEQSRTSSASITALIQGISKETSNLVSDASEVDQELQGQVN
                     VIKSSLATFTKIIDEINKINPQIQIVKESASTIEENKNEIVSKVDELSSVSEEISASA
                     EEISASTEEMNSSIVNVADSAKMLSGMTEEMIGQVNNFKI"
     CDS             197731..200301
                     /codon_start=1
                     /locus_tag="lbkm_0175"
                     /product="hypothetical protein"
                     /protein_id="BBF41496.1"
                     /transl_table=11
                     /translation="MRIGKKKRGTAIISLVMTLLMCIMLIPVTWNGMWKHEVRAKSET
                     KAAATEAKEPAYINADFFNYDKTELNKANSDLKVKSGDKENLLFGNEGKAYYNKYVDQ
                     AHDHSAVLGIANDTIGALQPQFNHSTVQLFPNSDGEIAKNKYHVNRYFDKEKWEWVKA
                     HDEYKSVMTADRGYMFPLRPTTENGVTYYQFNSSSDAVKLNNYVNSNGSKKLNLTNSS
                     DGNFYPYYYNGHKETEDKYYFGTRFYTDFTMPYDGMINGKPVTFSFSGDDDVWVYIDG
                     KLALDIGGVHGTCNGNINFATGLITVEKVRYNAKGTALNDIPMYWNLYGSDNLVNGKI
                     DGHTVQKSLGVKRSNYDSHSFKMFYFERGANISNCKLRMNFCVLDKHKVSVQKIVHNK
                     DNDKTKYEFKLTYTKNNKSYTETKTVEGQNVVTFDAELVQGEKYKVEEISTGPYTTTY
                     KAGNKEGKGKVTPEMTISNENYVVFENSYIPDETVKVKKTTENSVSSKEYTFKLYVAE
                     KNADYSKTPADTITVKSGEEKAFTTKVPYGYKYKVVEVIPSADADCTTTNKVDASKEK
                     QGKTTEDVVADGKDSKVEFKNTYSDRSLTLKKTVSGSAKENEDYHFVVKLYNGDGTVY
                     QGKYKLNNSAEKAYDSDGIKITLKANGTASITRLPYGIKYSVDEEYTDGYKKVDKTIT
                     VNGTPKKLGEKYAIDEKRTAADVVVNNDFEIVHDGQITVNKYLVANAKSNTPIADSLY
                     DNTFIFKLENIDEKSPGYKMVSYGSIHLAKGSKEGTFTFGRLPVGTYRITELDHERYT
                     PVDGTTRTVTLMKDHMKDSVTFKNYRLDKGYYTDTAAAVNTGKVSGLEVTYDEKTVLK
                     "
     CDS             200317..200817
                     /codon_start=1
                     /locus_tag="lbkm_0176"
                     /product="hypothetical protein"
                     /protein_id="BBF41497.1"
                     /transl_table=11
                     /translation="MKRGRVFMIASLILVLVLCTGVGTLAYFTDQKNVTNDAKFGKLD
                     VKTKEKVVKKGKEDVGFTVESDSVKCWVRLFVGIPKASGNQIITIDPEDPTVNSKWKK
                     DGEYYYYKEPVNPGESKILFKSIKCTSDLDKDQQYSNFDIIVYAEAIQYDNTVDDPVE
                     AFKLLK"
     CDS             200839..201711
                     /codon_start=1
                     /locus_tag="lbkm_0177"
                     /product="hypothetical protein"
                     /protein_id="BBF41498.1"
                     /transl_table=11
                     /translation="MSRKILKELLFCMMAFIFGTVSFMTASAADNDSISLSDLKQIVI
                     LNDNDLFNNMKELVPGDKVSNDVTITNNSNQEVTFYMYAEVKDSHKNIVLANKKYNNS
                     LLSLLQLQLSLSGNVFYNGPVSGNPADARSGQIISGSLVLDKSKSLYGITLCKLAAKS
                     STTLKIDLAAPGPELGNDYQDTFTAVDWVFTCSGVDQPDQVDVKPNDDNPKTTASPSP
                     SPEKKNGDTTDNNDNNTTNTTDTTSTNQTTSTSSLPKTGSVISYLGEAVIIMAILVIG
                     LCVIDFRRKHKLTK"
     CDS             201912..203189
                     /codon_start=1
                     /EC_number="3.5.2.3"
                     /locus_tag="lbkm_0178"
                     /product="dihydroorotase"
                     /protein_id="BBF41499.1"
                     /transl_table=11
                     /translation="MKLLIKNGHVLNPATNLDRVMDILIEDGKVKTLKQSITNEECDR
                     VIDANGLYVMPGFIDLHVHLREPGFEYKETIESGAKAAATGGFTSICPMPNTKPSTDC
                     REMVELVMDKANKESVVHILPIGAITTNQEGSQLSDFKGMKEAGIVALSEDGKSVMDA
                     ALFMRGMQAAKKLNLPIFSHCEDKSLVGKGVMNAGKKAKEFGLEGICNAVEDVIVARD
                     ILIAKEPGCTLHLCHCSTKDSVTLVKMAKEMGLSVTAEVCPHHFSMSEDDITEDHGRF
                     KMNPPLRKKEDVEALKKGLRDGIMDVIATDHAPHGQEEKNQSMAKAPFGIVGLETAFA
                     LTMTELVKKGYLTPMQMVEKLSYNPAKVLGIDKGNIDEGKVADIVIADFDREYQIDAK
                     KFASKGKNTPFDGKMVTGQVVTTIVSGEVVYEN"
     CDS             203218..204141
                     /codon_start=1
                     /EC_number="4.1.1.23"
                     /locus_tag="lbkm_0179"
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="BBF41500.1"
                     /transl_table=11
                     /translation="MINKLVKKIEQNKAPIVVGLDPMLAYVPDYIKRAAFEEKGETLE
                     GAAEAIWQFNKGIIDATHDLIPAVKPQIAMYEQFGIEGMIAFKKTVDYCKEKDLVIIG
                     DIKRGDIGSTSKAYAVGHLGKVQVGSKSYYGFDEDFVTVNPYLGSDGIKPFMEVCEEE
                     KKGIFVLVKTSNPSSGEFQDQLIDGKPLYEMVGRKVAEWGESLMGDSYSYIGAVVGAT
                     YPEMGKVLRKVMPKSYILVPGYGAQGGKAADLVPYFNSDGLGAIINSSRGIIAAYKQE
                     KYAKFGETAYADASRQAVIDMREDILGALAK"
     CDS             204154..204549
                     /codon_start=1
                     /locus_tag="lbkm_0180"
                     /product="protein of unknown function UPF0047"
                     /protein_id="BBF41501.1"
                     /transl_table=11
                     /translation="MDTFQIRTKRHSEMIDITQEVSAIVKKSGVKSGICTIFIPHTTA
                     AVTINENADPDVVHDFTKEINKIVPWEDGYLHMEGNSAAHLKSSMMGFSETIIIEDGK
                     LVLGTWQGIYFLEYDGPRTRKVFVKIIEG"
     CDS             204559..205329
                     /codon_start=1
                     /EC_number="1.3.3.1"
                     /locus_tag="lbkm_0181"
                     /product="dihydroorotate dehydrogenase electron transfer
                     subunit"
                     /protein_id="BBF41502.1"
                     /transl_table=11
                     /translation="MANKVKNTALVTSVKKVTEDVFSMWLKDEEIAKMAKPGQFVSLY
                     SASGDKLLPRPISICEIDAKEGLLRLVYRVVGEGTKEFSKLNVGDSIAIMGPLGNGFT
                     LMGTKAILIGGGIGIPPMLELSKQLGIETQIVLGYRDGDTFLSNEFAKYGTVYLATDD
                     GSVGTNGNVIDAIKENQLEADIIYACGPTPMLKGIQSYALEHNITAQLSLEEKMACGV
                     GACLACVCKSKEVDGHSHVHNKRVCKDGPVFDAREVTL"
     CDS             205329..206231
                     /codon_start=1
                     /EC_number="1.3.3.1"
                     /locus_tag="lbkm_0182"
                     /product="dihydroorotate dehydrogenase, catalytic subunit"
                     /protein_id="BBF41503.1"
                     /transl_table=11
                     /translation="MNMKVKIAGVELNNPVMTASGTFGSGQEYGEFVDLNQLGAVVTK
                     GVANIPWAGNPTPRIAETKSGMLNAIGLQNPGIDVFVERDIPYLQQYDSKIMVNVCGK
                     TIEDYCEVVERLADQPVDLLEINISCPNVKEGGIAFGQDAKFVEKITYELKKRAKQPV
                     IMKLSPNVTDITVMAKAAEAGGADGLSMINTLTGMKIDIHKRAFALANKTGGLSGPAI
                     KPVAVRMVYQAANAVKIPIIGMGGISNYEDAIEFMMAGATAISVGTANFNNPYATVEI
                     VDGIKKFMKDNNIDDINNIIGCVK"
     CDS             206246..206920
                     /codon_start=1
                     /EC_number="2.4.2.10"
                     /locus_tag="lbkm_0183"
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="BBF41504.1"
                     /transl_table=11
                     /translation="MEQYKKEFIEFMIDCDVLKFGDFVTKSGRKTPFFVNTGFYRTGA
                     QLRKLGEYYAKAIEAKFGMDFDLLFGPAYKGIPLSVATSMAISEHYGKDIKYCSNRKE
                     VKDHGDKGILLGSPITDQDRIIIIEDVTTAGTSIGETMPIIKEQGNAKVMGLVVSVDR
                     MERGKGTKSALSEIEENYGFATTAIVTMAEVVEHLYNKPYNGKVIIDDKLKQAIDAYY
                     DQYGVK"
     CDS             206944..207096
                     /codon_start=1
                     /locus_tag="lbkm_0184"
                     /product="hypothetical protein"
                     /protein_id="BBF41505.1"
                     /transl_table=11
                     /translation="MDEKVYKTMKSTGIVNIVLGIVTIAFAIGAGIVFIVNGARLLKH
                     KSRILF"
     CDS             207290..208801
                     /codon_start=1
                     /locus_tag="lbkm_0185"
                     /product="exopolysaccharide biosynthesis transcriptional
                     activator EpsA"
                     /protein_id="BBF41506.1"
                     /transl_table=11
                     /translation="MKIEDIKKHKVGLAFCVLQVLISLVFFIRILMVNVLKPGIMTGI
                     GFALLCLAAITVLLNLYPRVHIIGKTMAILLSVVLVIGIVYVNKTDSTIDQITTAKKK
                     VANVSVIALKKSGLTTINDAEKDHFGIVSAIDKKSTNKAVENLNTKLKKTISTKGYQD
                     YVSLAKGLYDGEVKTIILNEAYRNVIKGKYKDFDKQTVVLNKYKSETEINLGKVTKNL
                     TDEPFLVFLTGIDTSGKVDKVMRSDVNMVATVNPKTKQILLTSVPRDYYLETSVSNGE
                     KDKLTHTGQYGVDCSVETLEKLFDVDINYYFRVNFSGFKDIINALGGVTVHSDYTFKA
                     DWGPSFKKGDNKVNGKQALAFARQRHEFYKGKKTGLQGGDFQRIKDQQYLVKAIIEKA
                     TSPKILTNFIGIMDSVSKSFETNINSSDIKGLLKMQIDEMPEWNIVMTSLDGKCGMEY
                     TFTHSIPRVKYSVVYVRESQVEASNKMIGRVLDGKKIKKSDFDDLVQEYIDKH"
     CDS             complement(208853..210136)
                     /codon_start=1
                     /locus_tag="lbkm_0186"
                     /product="magnesium and cobalt efflux protein CorC"
                     /protein_id="BBF41507.1"
                     /transl_table=11
                     /translation="MIILLLLLLLSAFFSSAETALTTVNKLRMRSLAEEGNKKAKTVC
                     KLIEDPSKMLGAILIGNNIVNLTASSITTTFATNLAHSNGLGLDASIVIGIATGVLTF
                     LILLFGEITPKNLATMYAENLSLKYGNVIYFLTQLLTPIIFLINKISNGFQIILGFDP
                     NKKTSAITENELRTIVEVSHEEGVIESEERRMITNVVDFGDSLTKDVMIPRVDVEFAS
                     IDLTYDELVEAFSQEKYSRLPVYSENTDDIVGIINLKDIFFYDGDREKFSIESIMREP
                     YFTYEFKHTSELLIEMRRESISMAVVLDEYGATVGIITMEDLLEEIVGEIRDEYDEDE
                     QDPIQPVSDNEFLVDGNTKLDDINEILGTDIESEDYDSIAGHIICLLDHLPDNGETVT
                     DGPLTMTVEAVDKNRIDKIRIKIDPDYEEEIDTDE"
     CDS             complement(210328..211953)
                     /codon_start=1
                     /locus_tag="lbkm_0187"
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="BBF41508.1"
                     /transl_table=11
                     /translation="MIQACNVTLRLGKRALFEDVNIKFTEGNCYGLIGANGAGKSTFL
                     KILSGQIEPSKGEVVITPGERMSFLQQDHFKYDEFNVLDTVIMGNKRLYEIMKEKDAI
                     YAKEDFTEEDGIKASELEGEFATLNGWEAESDASTLLNGLGIETDLHYKLMSELNGSE
                     KVKVLLAQALFGNPDILLLDEPTNHLDMNAIRWLEEFLINFENTVIVVSHDRYFLNKV
                     CTHIADIDYAKIQLYSGNYDFWYESSQLMVKQMKDANKKKEEKIKELQDFIQRFSANA
                     SKSKQATSRKKALEKIELDDIRPSSRKYPYIDFRPSRDIGNEVLTVEGISKTIDGVKV
                     LDNVSFIVGHDDKLAFVGPNGLATSTLFKILAGEMEPDEGSYKWGITTSQSYFPKDNT
                     KDFAGGEIIYDWLMQFSPEKDITYVRQFLGRMLFAGEEGNKKVDVLSGGEKVRVMLSK
                     MMIMASNVLIMDEPTNHLDMESITALNNGLMKFPGVVLFTSQDHQFIQTIANRIIEIT
                     PNGLIDKKTTYDEYLDNDELARKRQVMNIVTED"
     CDS             212146..213954
                     /codon_start=1
                     /locus_tag="lbkm_0188"
                     /product="ATPase components of ABC transporters with
                     duplicated ATPase domains"
                     /protein_id="BBF41509.1"
                     /transl_table=11
                     /translation="MNLLTVQQVTKSYTERILFDNISLGINQGDKIGVIGINGTGKST
                     LLKIIAGLIDPDEGEIVKGNKVHVEYLAQNPEFDSKKTLLQNVISGKHDENEQWGIES
                     EAKSMLNKVGISDYDADPSTLSGGQRKRAALIRTLLTPADILILDEPTNHLDNEMAEW
                     LEKYLNNYKGSLIMVTHDRYFLDKVTNKIVEIDKGKLYTYEANYSGFLELKAQREEIE
                     VATERKNKSLYRMELEWMKRGARARSTKQKARIERFEDLSNRKQIETDGSVEMSSLSS
                     RLGKKTIEVNGISKAYGPKVLIDDFTYIFLKNDRIGIIGHNGCGKSTLLKIINGIIEP
                     DQGTVEIGQTVKIGYFSQENEYLDERLRVIDYVKETAEYIQTKDGTVSASQMCEKFLF
                     DSSMQYTQIARLSGGEKRRLYLLKVLMEAPNVLILDEPTNDLDIRTLSILESYLDGFD
                     GIVITVSHDRYFLDRIVERIFAFEGNGVIRQYEGNYTDYRSVSAEASTEKQEIASEKT
                     EKPKYKKEKDVKLKFTYNEQKEYNEIDSVIAKLESELETIEDGIAKSATDFVKLNEFM
                     EKKAKTEKELEEKMDRWVYLNDLAEKMEEAKKNKDK"
     CDS             213991..215928
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /locus_tag="lbkm_0189"
                     /product="glycogen debranching enzyme"
                     /protein_id="BBF41510.1"
                     /transl_table=11
                     /translation="MVANNTIQLNISRGEPFPLGVKKIQNAIHFSVAAVDRDQCQLNL
                     YIKDSDKKYAVIVMDEQYRCGGIFSVAIEDLDTDLLEYTFEIQGKEFVDPCAHLVHGR
                     EEWGRYLSPEDKRKMRGRFDFSSFDWEADKNPMIPFDELIMYRLHMRGFTKHTSSKVK
                     GKGTFLGCKEKIPYLKELGINAIEVMPIYEFDEIYVKNPYGMNAGMADYYYRNKLPTY
                     PVDMPKVEPEYKLNYWGYSDSNYYFAPKQSYSYSDNPSKELKELIKELHRNGIELIME
                     MHFPFGTNQGVILSCLRYWVREFHVDGFRFNEEVVPATMIATDPYFSNVKLLCSGWDT
                     YQVYGNRFPKYKNVAAYNDGFSVTMRRFLKGDEEQVSGVCSQLKANPEKSGKINYITN
                     GNGFTLMDLYSYDVKHNEANGEENTDGSDYNYSWNCGTEGKTRKKKVLELRRKQIRNA
                     FVLLLLSQATPMILSGDEFGNSQEGNNNAYCQDNEISWLNWNQLRSNKEQFEFVKSLI
                     QLRKEHPILHMEDEMRNMDYISCGYPDMSFHGTKAWCPDYSNYSRVLGVMICGKYIRI
                     DHSYNDNFFYFACNMHWETHTFDVPHIPADQEWTVVVDTFGEEDTKADINSGLSTIVV
                     QPRSIVILMSQKNEKLNQRGK"
     CDS             215928..216626
                     /codon_start=1
                     /locus_tag="lbkm_0190"
                     /product="conserved membrane protein"
                     /protein_id="BBF41511.1"
                     /transl_table=11
                     /translation="MTNKVLDSYKLKWIAIITMVIDHTGAILFNDPKYAYLRLIGRLA
                     FPIFCFLLVEGFYHTSNVYKYLGRLAIFAFISEVPFDMMYAAFGNQVVWSHQNVFFTL
                     LIGLSTVFWIDKIRLKYQEKQVFALIIQLLVLYIGGFLAEICCSDYGALGIFMIIVFY
                     FNRGNLWTITILNGLLIAVLNGPASIEMYALLAIPLLAMYNGEKGKSMKYFFYAFYPV
                     HIVILCLIKYYIVS"
     CDS             complement(216727..218085)
                     /codon_start=1
                     /locus_tag="lbkm_0191"
                     /product="hypothetical protein"
                     /protein_id="BBF41512.1"
                     /transl_table=11
                     /translation="MYSDCDSVIYSTDQKGSYQYDNGWHHLKLSGNPYEIGFQHGELL
                     AHYIVQSIYLAKKLLDSDKDWLYLKQHAMKMWQDHLGNDITEELQGIADGADSIVPAS
                     SAPDFGDILTWNGFYELKNYWLQKDSHILDPLKQLHNIANQGVSFIATGTSTTDGKII
                     ASHNNIATYGLGSCLNVILDIVPDNGHRIKMQSLPGFVHSFSDFYLNSAKLVITGTSI
                     HNFFAYDETKSPEFVRIRHAAQFSGTLNEFSSTMLEGNNGGCAKTWLAGDYKTGEIMR
                     LELGLHYHQLDRTENGVFTASNVPYCNDIKINECRIANNDIIYQQQLARNDRLVELTT
                     LYNGQINFENSQKILSDHHDSYLGFDNPSPRAICTHYDTEDSPYLNLPGLPFDTVPAG
                     CTGGIICTDQSSEEFTFFAKNGSLCGHAFHRNRYLEQHPRFERFRAYLRSLPAQAWTS
                     FQ"
     CDS             218656..220908
                     /codon_start=1
                     /EC_number="2.3.1.54"
                     /locus_tag="lbkm_0192"
                     /product="pyruvate formate-lyase"
                     /protein_id="BBF41513.1"
                     /transl_table=11
                     /translation="MVNFDQWENFQGRQWKEEINVRDFIQNNYTPYDGDSSFLEGTTE
                     ATDKLWGTLQGLQKEERAKGGILDMDTEIVSSITSHKPGYIGEGTKEIEKVVGLQTDK
                     PLKRAFMPYGGIKMAEQACTTYGYTPAPELHKIFTEYHKTHNQGVFDAYTPEILKARH
                     NKIITGLPDTYGRGRIVGDYRRVALYGIDFLMAEKKNDWMNTGDGNMTDDVIRQREEI
                     TEQFRALGQMKKMAESYGFDISVPAKNAKEAVQWLYFGYLAAIKTQNGAAMSVGRVST
                     FLDIFIERDLKAGTLTEKEAQELIDHLVMKLRMVKFARIPSYNALFSGDPVWATLEVA
                     GLGQDGRSMVTKNDYRFLHTLENMGPAPEPNLTVLYSERLPENFKKFAAHISITTSSI
                     QYENDDVMRVVWGDDYSICCCVSATQTGKEMQFFGARANLAKCLLYAINGGVDEKSKD
                     QVGPAYRGITSEYLDYDEVVAKYDVMMEWLAGLYVNSLNLIQYMHDKYYYEAAEMALI
                     DTDVRRTFATGIAGFSHVVDSLSAIKYAKVKTVRGEDGLVTDYEIEGDFPRYGNDDDR
                     ADDIAVWLLKTFLTKIKKFHTYRDSEPTTSILTITSNVVYGKATGALPDGRAAGEPLS
                     PGANPSYGAEQNGLLASLNSVAKLPYEWALDGISNTQTINPDALGHAEGERVDNLVNV
                     LDGYFSQGAHHLNVNVFGKEKLVDAMEHPEKPEYANFTIRVSGYAVKFIDLNREQQLD
                     VIARTCHDRM"
     CDS             221047..221793
                     /codon_start=1
                     /EC_number="1.97.1.4"
                     /locus_tag="lbkm_0193"
                     /product="pyruvate formate-lyase activating enzyme"
                     /protein_id="BBF41514.1"
                     /transl_table=11
                     /translation="MSTAVKGYVHSLESFGSVDGPGVRYVIFLQGCNMRCQYCHNPDT
                     WKKDSNETYTADDLLKKALRFKNYWKTNGGITVSGGEALLQIDFMIEFFRKCKEAGVH
                     TTLDTSGNPFTREEPFFSKFNELMKYTDLVMLDIKHIDPAEHKKLTGFSNDNIIDMAN
                     YLSEMKKPMWIRHVLVPERTDNDEYLKQLDSYIKTLSSVERVEVLPYHTLGIFKWKEL
                     GIDYKLEGIDPPTKERIENANALLHTSEYL"
     CDS             complement(221964..222152)
                     /codon_start=1
                     /locus_tag="lbkm_0194"
                     /product="hypothetical protein"
                     /protein_id="BBF41515.1"
                     /transl_table=11
                     /translation="MHFNSDQPKHFVFPNNLNILDYEQDYALYFPTTSEHSIQKDVLL
                     YKENYNSYDRFRNSKEAL"
     CDS             222266..222763
                     /codon_start=1
                     /locus_tag="lbkm_0195"
                     /product="hypothetical protein"
                     /protein_id="BBF41516.1"
                     /transl_table=11
                     /translation="MIALQIHDVKMFMASLLMNQTFDRFLVNDVEITTFTTFKMQGIL
                     NKDWYSTDEMEAMNDKNYVKWELLRPIAYSIIKGSKTPDHFKIVLQVNAHDNRQMLAA
                     IGKSPEDNDAATFFLNIIFEENSLRVISGTSIKMFTMDKSQEIQWDQAVKQFLTKQKI
                     AFEEI"
     CDS             222925..224931
                     /codon_start=1
                     /locus_tag="lbkm_0196"
                     /product="chaperone protein HtpG"
                     /protein_id="BBF41517.1"
                     /transl_table=11
                     /translation="MNKEHGSLSINSDNIFPIIKKWLYSDHDIFLRELVSNACDAVTK
                     LKKLDVMGEYTLPDDFKGRVDVIVSPENKTIKVIDNGIGMTDEEVKKYINQIAFSGAT
                     SFLEQYKDKTSEDQIIGHFGLGFYSAFMVADKVTIETLSFKDGAESVLWESEGGTEFE
                     MSAGTKESVGTEITLYLNEDSYEFANEFRVKEILNKYCSFMPVEIFFKDADKKEEPKK
                     EEEKKDEVVDATVDENGKAKEEEKKPEEKSINNPHPLWTKHPNDCTDEEYKEFYRDVF
                     HDYKEPLFWIHLNMDYPFNLKGILYFPKINMQYDTLEGVIKLYNNQVFIADNIKEVIP
                     EFLMLLKGVIDCPDLPLNVSRSALQNDGFVKKISDYITKKVADKLSGMYKVDKENYEK
                     YWDDINPFIKYGCLKDDKFREKMKDYVIFKNLEGKYVTLPEYIKATKGDEATEEAKTE
                     EPNAEESKDGAAKEKKKDTVYYVTDELQQSQYINMFKENGMDAVILAHNIDQSFIQQL
                     EMTNDTVKFQRIDADVTESVKEEVSKEDEETLKENAKTLADLFKKVLNKEKLEVKVEK
                     LKNTKVSSMITLSEESRRMQDMMKMYNMGGMNPDMLDGGETLVLNANNKLVQYVLDHK
                     EDDKVNMFCEQLYDLAMISNKPLAPEAMTKFITRSNEIMELLAQ"
     CDS             225226..226062
                     /codon_start=1
                     /locus_tag="lbkm_0197"
                     /product="DegV family protein"
                     /protein_id="BBF41518.1"
                     /transl_table=11
                     /translation="MTYRIIGDSCTDLTDNLLKDEHIKVVPLSIEIDGYRIEDDETFD
                     QADFLRRVAESPNCPKSSCPAPETYMNLFDIEGDVYVVTLSSNLSGSYNSAMLAKQLY
                     EEEHPDAHVAVIDSCSASVGQTIIVMKIKELAESGLPFEQVVEQATKYRDEVTTKFVL
                     ESLDTLRKNGRLSNLSAMIANVLNIKPIMGSTPEGQIIKLDQARGINKALTIMAEYVK
                     KDAFDVQNRILGIAHCNNYERALYIKEEILKRVPFKDCIITDTAGISSLYANDGGIVI
                     AY"
     CDS             226362..226613
                     /codon_start=1
                     /locus_tag="lbkm_0198"
                     /product="hypothetical protein"
                     /protein_id="BBF41519.1"
                     /transl_table=11
                     /translation="MILYYGNGVDEMNAIAFIVMCGCMCGLGITVVEQVFQYKKKRLK
                     EQSRTNNLAIIYQLLSAREDLKLEDVTQMLELSDKELKH"
     CDS             226697..227482
                     /codon_start=1
                     /locus_tag="lbkm_0199"
                     /product="hydroxymethylpyrimidine ABC transporter, ATPase
                     component"
                     /protein_id="BBF41520.1"
                     /transl_table=11
                     /translation="MGQLLTIDHLNYSYHCLDGETKAIDDMSFDVDEGEFVAVVGPSG
                     CGKSTLLSLIAGLLTPGSGSIRINGMDVKEAGKNIGYMLQKDHLLEWRTTLKNLTLGL
                     EIQHKLSDSSYILINQMLNTYGLITFENSKPEALSGGMRQRAALIRTLLLEPDILLLD
                     EPFSALDYQTRLEVADDIWGIIRKEKKTAILITHDIAEAISMADRVVVLSDRPARVKN
                     IVDIHLTMEGVRTPFRARSAPEFSDYFNLIWKELNEDEKSIKA"
     CDS             227511..228293
                     /codon_start=1
                     /locus_tag="lbkm_0200"
                     /product="hydroxymethylpyrimidine ABC transporter,
                     transmembrane component"
                     /protein_id="BBF41521.1"
                     /transl_table=11
                     /translation="MSEAQRSYIKNYLTMLNQVRIYQIIILVAFIALWEGLTAVKIID
                     PFVFSSPSRVIGTFLTMAMDGSIFYHMGVTLAETFISFALVIIIGIIVAVILWWNEKA
                     SRVLEPYMVVLNSLPKSALAPVFIVWLGNNMKTIIVAAVLVALFGTIITLYTDFTGVE
                     EDKVKLIHTLGGNKKDVLLKVILPSNIPSILSIMKVNIGLSLVGVIIGEFLAAKAGLG
                     YLIIYGSQVFKLDWVIMSIVILCLMATLLYKLLNSVEKHFNH"
     tRNA            228434..228506
                     /locus_tag="lbkm_0201"
                     /product="tRNA-Thr"
     CDS             complement(228557..229219)
                     /codon_start=1
                     /locus_tag="lbkm_0202"
                     /product="transcriptional regulator, GntR family"
                     /protein_id="BBF41522.1"
                     /transl_table=11
                     /translation="MGLEPIKKAITLKEQAYLSIKQAIYSNTLQPGAPLVEEQLSSTL
                     SISRTPIRSALQQLVYEKLAFADNTGHIYVSKITEKDIEDITIIRSNLEPLVIDLVTF
                     PLPKDTITNLYDSYHKQLELFENEPDNNIRYAELDCEFHTLLANLSNNTLLVEMIEKM
                     NNMMIRFNVLSGTLNSHKKNALEEHRMIIHYLETGKHEFAKAAILEHVKCVAQRIFSE
                     EN"
     CDS             229512..231152
                     /codon_start=1
                     /locus_tag="lbkm_0203"
                     /product="arginine utilization protein RocB"
                     /protein_id="BBF41523.1"
                     /transl_table=11
                     /translation="MIHDEMLSLAKQMIEIPSINTTNGEREIGVFIESYIRKIPYFQK
                     HPDQVIVQELKDDPLHRRNVTAILLGEKGVSKDTLLFHGHTDTVGLEGYGALEEYACK
                     PDELRRHMQTVELSHEVREDLESGDYLFGRGSCDMKSGDAVFLVTLKQWSEHPEQLSG
                     NIVVSFNPVEENLHTGMIEGLTVLDELKERYSLNFLMGINNDFIAPLYPNDQKKTIYT
                     GMVGKLLPCFYIQGKETHVGQCFEGFDASMVAAGLVHKIHLNKAFSDEYEGEYSYPPS
                     VLKMKDLKPWYNVQTAAEAFVYFNYFVHNASMEEITDKLVTAAGEVFEETVEKINSEY
                     QWFCEKSGQEYMEYHYKKRVVTYDELYQIAKEKPGFSNQKLAEIIQKELEKKTDTREV
                     PIAMIRYLLQTAGITTPIIVVYYAAPYCPHNTLQGENEKLVNDLKKITAEVMDETGDE
                     YRFLRFYPSLSDSSYLKIDDTKESVDVLKNNFPAFEHLYPVPLKLIQKINIPAVNFGC
                     YGKDAHKWTERVNIPYTFGVLPKLIEKTITYYLEKGRD"
     CDS             231152..232303
                     /codon_start=1
                     /EC_number="1.1.1.1"
                     /locus_tag="lbkm_0204"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBF41524.1"
                     /transl_table=11
                     /translation="MKKLVLSGKRIITGAGSLKELEELPYERIAIVTGGQSMIRTGVI
                     EKAREYLGNKEREVTVFSGVPKNPSFEEVQKGIEVLREFKPDCVLAIGGGSAMDCAKA
                     MLLFYEFPFLTFENVLAYNQRGEIPAERSTALICVPSTSGTGSEVTRGTVITDTNKQL
                     KVPIMTDCLRPDIAILDPEITMTMPAKIAAETGMDALTHAIEAYTNHNLDDFDASLCA
                     GAIKGIMEWLPESCEKGTIESREKIHNYQAMAGIGFANVGLGMVHGIAHSFGAAFDMA
                     HGLTNAIILPYVLSYNSRDEVVKEKLEELSYLCHCEDIVKEIRKMRKRLGIPACFLEA
                     GITEQMYQEKHDLLLDHAMLGATNVNPVKMTREEMEKMLVAVVYGKEEE"
     CDS             232317..233591
                     /codon_start=1
                     /EC_number="2.6.1.11"
                     /locus_tag="lbkm_0205"
                     /product="acetylornithine aminotransferase"
                     /protein_id="BBF41525.1"
                     /transl_table=11
                     /translation="MKSMYERCMEVMPEVAGRATTLGVTDSKGCYLYTEDGRKVLDFA
                     SGVAVNNLGNKNERVAKAIKDQLDTMIHVGHNVVYYESYVKLAEKLVELTGGDTKVYF
                     SNSGAEANEGAMKLAKYVTKRPGIISFVNSFHGRTIGSVSITGSNSAYRKYYEPLLPS
                     VYWAQYANCYRCPFHQEKGSCHMECLKQFDEIFSHMIDPECVAAMVVEPVQGEGGYIV
                     PPKEFLQGLRKICDDHGIMLIFDEVQTGVGRTGELYAYQTFDVRPDIFTTAKAIGGGI
                     PLSAIVAKKEIMDQWPAGAHGGTFGGNPLACAAALENLQIIEEDHLLDHCKEMGSYFM
                     KRLYDLKEKYTVIGDVRGVGLMIGMEIVSEDGEPDAALTALIKKQALEKDVLLLTCGS
                     SHNVVRFIAPLIVTQKEIDIAVTAIDAILKEM"
     CDS             233599..234510
                     /codon_start=1
                     /locus_tag="lbkm_0206"
                     /product="malate permease"
                     /protein_id="BBF41526.1"
                     /transl_table=11
                     /translation="MILFKQMIMLFVIMILGYVMARKKILDDHTSKSISWIIVNVANP
                     ALILSGALGGNTISKKDFLTTMVVAFLVFFGLILIAECLIPAFRLKQEDKGVYKIMLV
                     FSNIGFMGFPIISALYGTKALLYGSVFLLVFNVLIYTYGIMSMSKQKMSLKGSLRKCF
                     NIGVAAGIASFVISFCQIPLPETINQIITMLSSITAPLSMMVIGASFIHIELKEIITD
                     WKLLFFACIKLLVLPIVGINLIRLFTDNIIVWEVSMVLLATPSGSMAAMLAQQFGGNY
                     ETASKGIAVTTLLSVVTMPLVFMVAGL"
     CDS             234522..235511
                     /codon_start=1
                     /EC_number="3.5.3.6"
                     /locus_tag="lbkm_0207"
                     /product="arginine deiminase"
                     /protein_id="BBF41527.1"
                     /transl_table=11
                     /translation="MATLQMYMDRSKIKNMFESEVFEEVWGDQFGVDNSVGKIRKILL
                     HRPGIELEQLKDGAYEEEAGARILTDEKGRIRNYFKSRELPDLGLMQEQHDKMAEILK
                     GEGIEVHYLTDPTYKWTNLTFTRDVALMVPKGTILTRFAMYFHQGDTFVTQKFMADQK
                     IPILGAIQGMGTIEGGSFSMLDPKTAIIGRSVRINDAGIEQLRQLLSYQGIELIVIDM
                     PAYYIHLDEAFLPVDRDKILVSTFILPHWFLTMLKERGYTLIETDRDDPMLTNNCLAL
                     EPGKVLFSEKGISTRKNLEKAGVETIPVDISEINKLGGGIHCSTLPLLRDHID"
     CDS             235530..236147
                     /codon_start=1
                     /EC_number="2.7.4.25"
                     /locus_tag="lbkm_0208"
                     /product="cytidylate kinase"
                     /protein_id="BBF41528.1"
                     /transl_table=11
                     /translation="MEKKFIITITRQFGSMGRPIAKKLAERLGVNYYDRDIVDLTAQK
                     LKMPVSVIGDLEESVQGKFFRMKYPLGMGTSDIQDTIFEQQMKIIKELASKESCIIVG
                     RCSDYILREFSNSIHIYIYAPKEKRYQVCLNEFKMEPDEAKKMMLEVDRARERYHKEY
                     AGYLPSDSQYKNLMIDSSILGVDGTVDLLVQYMNLYFEQKKNLKG"
     CDS             236381..237133
                     /codon_start=1
                     /locus_tag="lbkm_0209"
                     /product="glutamine transport ATP-binding protein GlnQ"
                     /protein_id="BBF41529.1"
                     /transl_table=11
                     /translation="MGEENRVEKDPILTVKSLSKNFSTLTVLRDINMNVYKGEVVAII
                     GPSGSGKSTLLRCMNALETISGGDIWFKDILINKEKNLAKLRAEIGMVFQHFNLFPNM
                     TVLKNITFAPMKVRKRDKNEIKEEAIQLLQSVGLEDKKDVYPSTLSGGQKQRVAIARA
                     LAMKPEILLFDEPTSALDPEMVGEVLSVMKNLAKTGMTMLVVTHEMGFAREVADKVIF
                     MDEGYIMEEGTPEEVFEHTKNDRVKAFLDKML"
     CDS             237150..237839
                     /codon_start=1
                     /locus_tag="lbkm_0210"
                     /product="amino acid ABC transporter, amino
                     acid-binding/permease protein"
                     /protein_id="BBF41530.1"
                     /transl_table=11
                     /translation="MTSLFDIAYKYRALLLNGAKITLIVAFITIIFGLLLGTLMALIK
                     MSRFRLLRIFANVYVEFIRGTPVLVQIFIVFYGLPMIGIEIPSIMMGGVDLSRLISGI
                     IALIVNTTAYICEIVRSGIQSVDLGQTEGALALGLNKRTTMLSIILPQAMKNILPALG
                     NEFITIIKTSSQISVIGIAELMYVADTIRGISFKPMEPLIIVALIYFVITFTFSLILK
                     KIERILRKGTR"
     CDS             237903..238736
                     /codon_start=1
                     /locus_tag="lbkm_0211"
                     /product="amino acid ABC transporter, amino
                     acid-binding/permease protein"
                     /protein_id="BBF41531.1"
                     /transl_table=11
                     /translation="MKKRMLSIVLVVAMCFGILTGCGSDKKSSGEKASASMSLLESIK
                     QKGKLVIGTASGYPPYEFVDVTSADQKVIGIDIELAQKIADKIGVKLVVQDMSFSALL
                     SSLPAKKVDLAIAGINPTDERKKTMDFTDNYLTADQSILILKKDADQYKTLDNFKGKT
                     LSVEKATTQETIAQKELPTCKLTSLEKVPDCILELKNGKAAGVVVESIVGQQYVLSDK
                     SLQFSDATFNEKKYSAIALEKGNEDLLKVINEVIKENQDNGNFDKWVEEYSEKATKNA
                     E"
     CDS             238934..240376
                     /codon_start=1
                     /locus_tag="lbkm_0212"
                     /product="biotin synthase related domain containing
                     protein"
                     /protein_id="BBF41532.1"
                     /transl_table=11
                     /translation="MDISLGKQTEKVISKHVHVEEEMTIQQKLAILSDAAKYDVACTS
                     SGVSRKGVKGTMGNAAACGICHTFAADGRCISLLKILFTNECIYDCKYCINRSSNDVK
                     RTSFTPEEVCQLTMEFYRRNYIEGLFLSSGIKHSPNETMEQIYQTLYLLRNVHQFNGY
                     IHVKAIPGADESLIERTGWLADRMSINLELPTAEGLRKLAPNKTRNNILRPMKQIQIG
                     IHDKSYQQHRIEQMNQEAERLSSPILLPERIKQNQLARYQKKSLFVPAGQSTQMIIGA
                     TPENDYEILSVSESLYDKFQLKRVFYSGYIPINEDRALPSLEQKPPMLREHRLYQADW
                     LLRFYGFDANELLSKERPNFNVLLDPKCDWAIRNLDQFPIEINKAPYQILLRIPGIGV
                     KSAQRIVKARRMATLDFSDLKKIGVVLKRALYFITCKGKMMYPVKIEENFIVNHMLDL
                     EDKRALGLGERETYQQISLFDTSLKGALVL"
     CDS             240373..241161
                     /codon_start=1
                     /locus_tag="lbkm_0213"
                     /product="domain often clustered or fused with uracil-DNA
                     glycosylase"
                     /protein_id="BBF41533.1"
                     /transl_table=11
                     /translation="MKVMHVFVCEDSVEGILTGVYRAWESRNGHENNKLELVGESNYE
                     LFCEYHKVEPDAGIADKVIRSIRQKISSEAYEYLYKAMMTRNPMKADYVYRFMILGFY
                     YGRSVVNFLSNDAVSQIMKLSGRVGMEAHHYTGFIRFQEIEGGILLARFRPENNIVTI
                     IAPHFADRFSNENFVIYDEARKVAVIHEKNKPWFLIHSDVFSVEKAGELSNEEANLQQ
                     VWNTFVTSVSIKERENRSLQQNLVPLRYREFMNEFMEQKLGVND"
     CDS             241158..242144
                     /codon_start=1
                     /locus_tag="lbkm_0214"
                     /product="integral membrane protein"
                     /protein_id="BBF41534.1"
                     /transl_table=11
                     /translation="MKKQLRRVDILKAIKIAVIAVISIITATCFKLQFATTAGIITIL
                     SLQNTKRETLTVARKRSMAFMVALLIAWGSYGSLGFTIAAFAIYLFLFSVVCLYFGWT
                     DALAMVSVLMIHFLNAKSMQLGIVINELGLFLIGTGFGVIANLYLRKQGDQYNQLADE
                     VDEQIKKILHGLSMDIVEIKRKDPTSDLERLDKKLRDAERVALQNWNNSLLETDNFEI
                     EYVRIRREQSKVLKRIYASIRMITMVPSQSEMISELFYHIEKEFHRYNTAEKLLEELD
                     GIYQHMRQEELPKERAEFEARALLFYILKQIQEFLEIKRSNMEVIRVRMEAQ"
     CDS             242157..242900
                     /codon_start=1
                     /locus_tag="lbkm_0215"
                     /product="hypothetical protein"
                     /protein_id="BBF41535.1"
                     /transl_table=11
                     /translation="MKSEFERFNKEQWDGKSYVQLQKQIQLLADEQYALFQRKIVPGI
                     EGIIGVRLPVLRKLAKRIAKGNVKSFIGNARYESYEEAMLMGMVLGYVKTSQFDDGIT
                     GLLRAVDSFIPHIDNWAVCDSFCSGFKVTKEYKDEVFQYIQKLLQGTYEYEIRVGYVL
                     LMDYYLEEDYYERIFQACDAYEGSEYYVNMAIAWLVSMAYVKNKAATISYLANCKLDK
                     SVYNKALQKVIESKQVSDEDRAWCRKNKS"
     CDS             243006..243410
                     /codon_start=1
                     /locus_tag="lbkm_0216"
                     /product="hypothetical protein"
                     /protein_id="BBF41536.1"
                     /transl_table=11
                     /translation="MKRRIYILLAVMCLSLFALTACSSNDDGTNNSATTDETTTPGTN
                     DSDIPDQNGNGTGTDNGSGTNNGTGTNGTGTNNGSGTNNTDTNDADSDGVNDIVDDAG
                     DAIENDTTGTDNNNTNNNNANTDATTTPGTTK"
     CDS             complement(243456..243866)
                     /codon_start=1
                     /locus_tag="lbkm_0217"
                     /product="zinc uptake regulation protein ZUR"
                     /protein_id="BBF41537.1"
                     /transl_table=11
                     /translation="MEHTRNTKQKQYILHVLKTANRPMSINEIHASCVEVYPKTAKST
                     IYRNIDALLQQDLIDKYYFNDNELFYQIKDHSTEHKHYVICNTCKKIFNLPVCPIHQI
                     QESLNAYGFVVTDHYIQITGQCEECIKKATKEIK"
     CDS             complement(243876..244133)
                     /codon_start=1
                     /locus_tag="lbkm_0218"
                     /product="hypothetical protein"
                     /protein_id="BBF41538.1"
                     /transl_table=11
                     /translation="MDEIYEIIETKIHEGGYLDEVSGYQIYNEICDFIEDKEPGAYIF
                     MSKDHADVIFEYNIQVLEDNFNLSYIDIKSGDQSYHINFDA"
     CDS             complement(244135..244320)
                     /codon_start=1
                     /locus_tag="lbkm_0219"
                     /product="hypothetical protein"
                     /protein_id="BBF41539.1"
                     /transl_table=11
                     /translation="MEKRIIKKRRILSTPPDDSISAEERRHAATKKVAQTYTQKREST
                     VYSRFYSYKKDQETKGV"
     CDS             complement(244371..245549)
                     /codon_start=1
                     /locus_tag="lbkm_0220"
                     /product="hydrolase, haloacid dehalogenase-like family"
                     /protein_id="BBF41540.1"
                     /transl_table=11
                     /translation="MLKAVIFDMDGVIIDSEPTNLRALHQALLACGIHASKEYCDRFI
                     GCSLPNTASIAGKDFSTEINTKVLQTNYIKYQTELIQSEGYQPIYGTVALIKELHQHG
                     IKLAIASSSSIHEIRQMAESLNLIEYFDELVSGHEVEHSKPSPDVFLLAAKRLNMQPE
                     ECLIIEDSMNGTLAAKAANITCIGFQNTNSGNQDLSKAYSIVLDMDGIDYSYVLEQHC
                     HAHNLPFTVLTTSHVTVRELAVNDIDALIELYECESAKTYLPPLSSREEELEKLSAYI
                     RHMYHFTGFGLWGVFLNDSQQLIGRIGIQSTEIHENTEVELGYFIHDDYQRQGLASEV
                     ISSLLPLVKERFELESIVAKITPNNQASIQLAQKFGFIKEEFLLDAKNNYDLYRLVLI
                     "
     CDS             245646..246257
                     /codon_start=1
                     /EC_number="1.15.1.1"
                     /locus_tag="lbkm_0221"
                     /product="superoxide dismutase [Mn]"
                     /protein_id="BBF41541.1"
                     /transl_table=11
                     /translation="MLINPIEFTFTPDITAVNKQQFDEHLKLYNNYVKSINEITNELV
                     TLNNEEREKANTTNGYFRGLKRGETYALDGVILHELYFYNMGGIKSKPDCSILSLIEH
                     FYGGFENWRADFIATAKASRGWAILCYEQRTKMLRNISLDAHDHGDIMMSLPLLILDM
                     YEHAYFMQYGTNKESYIKAFLNNINWDIVRNRVNLWHLDEETK"
     CDS             246317..246661
                     /codon_start=1
                     /locus_tag="lbkm_0222"
                     /product="hypothetical protein"
                     /protein_id="BBF41542.1"
                     /transl_table=11
                     /translation="MPFINSKVSMELTKQQKDEIKTRLGKAIELIPGKSESWLMVGFE
                     DQYDLYFKGQADEKIAFVEIKIFGSTTDAAYDALTKEVCNIFGEVADIPGDHIYVKYE
                     EVDHWGYNGFNF"
     CDS             246926..247630
                     /codon_start=1
                     /locus_tag="lbkm_0223"
                     /product="two-component response regulator"
                     /protein_id="BBF41543.1"
                     /transl_table=11
                     /translation="MNSYNILIVEDEIEIANAIEIYLKNQGYQVWKAHDGIEGLEKMK
                     SVEFHLAIVDIMMPRMDGIQMTMRLREKYDFPVIMLSAKSEDMDKIMGLNIGADDYIT
                     KPFQPLELIARVNSQLRRYAKYLAVVNQPMEQKNVYQIGGLELNADTMELMVDGELVR
                     LTPIEFKILHLLMKNAGRVFSIEEIYERVWNEVAVNTDTIMVHVRNIREKIEINPKEP
                     QYLKVVWGAGYKIEKQ"
     CDS             247617..249842
                     /codon_start=1
                     /locus_tag="lbkm_0224"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBF41544.1"
                     /transl_table=11
                     /translation="MKNNKKQILNYSCVVLILATAFLFLLIGIPNIEKMSQEKSRHYE
                     SGYLTSQVTSSLGKATYVLNQEIQSKLDPDMTAVTLYTKNLKLDKERTARLNESMQQM
                     LDSWSQNLKDTKNIDYYATGGKKSVSYSVSSNKEFRRLAQQYKTEVSTSFEDEIRNKY
                     CAFIVITSDADGRFKLDYYQGEFEKSIFENINNEGKNHFYDDFYFDNEDYADESGQVN
                     FSPEENVKSPSNVTYLFGIKRDMPEDDALGSAFHYMQREVSQVGYAIILAMVLFGFAI
                     IAAIIPYDYEKKMVGVRKFLKIPFEFLCIGYSILAMIMVLMIAEGFSIIYSNEAAKEF
                     SLNAFSMAFWNRMFYVGSYLLLVLLFVSAIAGIVLLKMLYKDGIWNYLRNRSICLKIL
                     IWFKHRFSNKMRQLSSIDFQEKYNKKLILILIANGGITFILCWMWFFGAFIAIIYNVI
                     VGIYIFRRWTSIRDNYGRIIDATRMMAEGELDCEITGEVAPFDDLRNEMEEIQTGFKK
                     AVDAEVRSQSMKTELITNVSHDLKTPLTTIITYVDLLKSEDLTSAQREEFISIIDKKS
                     NRLKVLIEDLFEMSKATSGNIKFNYMDLDVGWLVKQVLLENDEKIKAANLQVRMDVED
                     KLMVRLDSQKTYRIIENLVCNIAKYAMRDSRVYVSAVHELDQVVITFRNMSASEIDYN
                     GDELVERFVRGDKSRNTEGSGLGLGIAKTMTELQGGSFKVRVDGDLFKVVLSFPVLRN
                     S"
     CDS             250107..250286
                     /codon_start=1
                     /locus_tag="lbkm_0225"
                     /product="hypothetical protein"
                     /protein_id="BBF41545.1"
                     /transl_table=11
                     /translation="MLSIFGVEFVAGTILKHFDACPWDYSKAKYNVKGVIRLDYAPVW
                     FVAGLLYEKILEWLN"
     CDS             250437..251048
                     /codon_start=1
                     /locus_tag="lbkm_0226"
                     /product="hypothetical protein"
                     /protein_id="BBF41546.1"
                     /transl_table=11
                     /translation="MFKKKEFVSKVMDSGFIFIDRQTKEKALLEFNVEKIPNTPFYYS
                     LFEKEWGYGDEMRNWIKAVKGLKGSKLTMIVSDDLFESDQILIRKFFKTYGKIKKIEF
                     VTPNQYLSGVETNYIAITQSNRALTASYIKDGQVWNKKYYDVHNYLLGEVIEEIKGKN
                     SECEYQQVPILYNGFYCDMENAVHVTKEDILNHYIDRYSNDKM"
     CDS             251073..252278
                     /codon_start=1
                     /locus_tag="lbkm_0227"
                     /product="methyltransferase"
                     /protein_id="BBF41547.1"
                     /transl_table=11
                     /translation="MSKAIVALKKGEGRTIKAGGAWVYDNEIDTITGHFENGDLVFVH
                     DFDGYPMGVGFINTKSKITVRMMTRHEDQEIDAAFLKMRVRDAWEYRKKTVDTSSCRI
                     IFGEADFLPGIVIDKYADVLVVESLALGIDRMKETIIQALKEVLEEDGIIIRGIYERS
                     DAKVRLQEGMERVKGFIGESFDTKVEIVENGVRYQVDVQDGQKTGFFLDQKYNRQSIH
                     KICKDAKVLDCFTHTGSFALNAGIAGAKSVLGVDASELGVAQARENAKLNGLEDRVSF
                     QCADVFDLLPELEEKGEKFDVVILDPPAFTKSRSSIKNAVKGYREINLRAMKLVKDGG
                     FLATCSCSHFMDYELFTQTIGQAARNVHKRLRQVEYRTQAADHPILWSGDEASYYLKF
                     YIFQVVDEK"
     CDS             complement(252664..253518)
                     /codon_start=1
                     /locus_tag="lbkm_0228"
                     /product="putative transcriptional regulator"
                     /protein_id="BBF41548.1"
                     /transl_table=11
                     /translation="MFEIYQLEHLVAITEYGTLSLAAEHLHISQPTLSRSIQKLEEEL
                     GFPLFDRLKNKMTLNESGELAVECARNVLKEADIMVQRLNTLERSRHTINIASCAPAP
                     LWMLTPIVSRTFPNMTMSSEIRDIEELKKGLMDDTYQIVILPEPLEDNNIYSHKYCEE
                     QLYVSLPPAHPLCGHKGIYMSELDGESMLLFSEIGFWSKLHKEKMPHTHFLIQHEAET
                     LDVLARASAFPSFTSNLVMKSVGKIPNRVILPLLDEEATATFYICIKQSSNKKFNLLF
                     NRTKFLSQ"
     CDS             253646..254497
                     /codon_start=1
                     /locus_tag="lbkm_0229"
                     /product="oxidoreductase, aldo/keto reductase family"
                     /protein_id="BBF41549.1"
                     /transl_table=11
                     /translation="MQFTTLNNGVVIPLLGFGTFQIPNSKDCEACVAYAIECGYRLID
                     TASLYKNEESIGSAVLHSGIKREDMILTSKVWPQDHGYENTLQAFEQSRKNLGVDYID
                     LYMIHQPYGDYYGSWRAMEKLLQEGLVKAIGVCNFSAERLVDFCMNQEVMPAINQVEI
                     HPFFQQKDLIEIMEKYQIHQEAWGPLCEGQMGIFDNPTLKKIADEYDKTVAQIINRWH
                     IQKGNIIIPRSVQKSHIFENISIWDFELSEKDMYRIELMDLGHSEIIDHCKPSTAKWI
                     NEWKIHD"
     CDS             254514..255224
                     /codon_start=1
                     /EC_number="4.1.1.44"
                     /locus_tag="lbkm_0230"
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="BBF41550.1"
                     /transl_table=11
                     /translation="MYTDEFKVTDPEFAELFEKFAYQEVIHEEGKGLEEKTRYMAILA
                     TLIGCQGAELYREVLKEALSDALTPVEAKEIVYQAVAYLGIGRVFPFLRITNEILKEN
                     KVELPLPGQATTTEKTRLEKGNQTQVEIFGEQMRGYQNMGPEETRHISKWLADNCFGD
                     YYTRTGLDYKQREMITFCFLAAQGTEVQLKGHINGNILVGNDRQFLINVVSQCMPYIG
                     YPRTLNALRCISEALDQK"
     CDS             255241..255654
                     /codon_start=1
                     /EC_number="4.1.1.44"
                     /locus_tag="lbkm_0231"
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="BBF41551.1"
                     /transl_table=11
                     /translation="MSTLEEIKKESPFPVGEENTAYVQYFVGKSYLAGLNMEQVPVAN
                     VTFEPACRNNWHIHHKGGQILLCTAGRGYYQEWGKEPQELHRGDVVNIPPEVKHWHGA
                     APDSWFSHIALSVPAEDGSCEWCEAVSDEDYNKLK"
     CDS             255678..256868
                     /codon_start=1
                     /EC_number="1.1.1.1"
                     /locus_tag="lbkm_0232"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBF41552.1"
                     /transl_table=11
                     /translation="MSFIYSVPTKALVGAGQLQNLHNEINNPMGCVQGKKALVVISNG
                     KSTKTNGSLDKLEEQLKLANVEYVIFDKVASNPLKATVEEGGKFAKENGCDFVVALGG
                     GSVIDAGKAIGLMATNESDDLWDYVMFGTGKKQWPPVPALPIVAIPTTAGTGSETDGG
                     AVITNPETDEKTGVMGAGTTPVLAVVDAELMTTVPAKFKAFQGFDALFHSTEGFISNK
                     RQEMSKMVASEAIRNVSANLVKTIKEPTDIEAMEKVAFASYLSGIQMMVGSCTSAHPL
                     EHALSAYHHELAHGAGLIMISKAYYSFFIEKHVCDDRFIEMAQLMGMKDASKPEDFIT
                     MLVKLQEDCGVADLKMSDYGITTDEFPKMAQNAMDTLGVNFANDMVPLSIEDCVKIYT
                     ESYK"
     CDS             256958..257491
                     /codon_start=1
                     /locus_tag="lbkm_0233"
                     /product="iron-sulfur flavoprotein"
                     /protein_id="BBF41553.1"
                     /transl_table=11
                     /translation="MSKNILAIVSSPRKGGNSERLCEEFIKGAEQAGNNTETIFLRDK
                     KIAPCIACEACLNNGGNCVQMDDMADIIEKLVAADVVVLSTPVYYYSISAQLKTMIDR
                     TLAGGGRLANKEFYLIATAADGKHAMEVTMSDMEGFVRCVPGSKVKGKVYGSAFRVGE
                     IEGNPALSEAFKLGKNC"
     CDS             257522..258289
                     /codon_start=1
                     /locus_tag="lbkm_0234"
                     /product="ferredoxin"
                     /protein_id="BBF41554.1"
                     /transl_table=11
                     /translation="MVFYFTGTGNSLYVAKQLEEERYSIPQEMKKANLEYTAERIGIV
                     CPVYGHEVPDMVKEFLKRAKFHTQYFYMVLTFGRRHGGAAKLAENILEDVGVKPNYIN
                     IIMMVDNFLPSFDMEEQIAIDGEKKVDENINQIKKDIDNKVNFISPVTQEDRDWHQTY
                     LAGRAKMPADAFVHMFHITEDCIGCGICTKVCPSGCYQIKDDKAVQNPEGCQVCLSCI
                     HNCPKKAIGLNMPEKNPNARYRNEHIDLQEIIDANNQ"
     CDS             258322..259836
                     /codon_start=1
                     /locus_tag="lbkm_0235"
                     /product="flavodoxin"
                     /protein_id="BBF41555.1"
                     /transl_table=11
                     /translation="MEKIQWSKGKKRGMVALIIIIVLLLIGGWYFFLGNRIPNVTGEV
                     EKGTEETKSLVVYFSRSGVIKIDGVDATSSASLNLEDDNLMGNTEIPARMIQKVTGAD
                     LFQIQTERYYRSAFMGTSITAWAEEKFNMRPNLAAIPENLDQYDVIYVGYPIWWFNAP
                     MAIGSFFDSYDLTGKTIIPFCTSQDNGIDVSMNYIREVCKDATVLEGRRLNNPSEAEI
                     RSWLEELGVENEITETSKEESQEETVKTAISNNENYDYHMEEIWSENNGNRIYGQAYI
                     PETEEKIPLVIFSHELCNTHTAGIDYAEELASHGVATYTFDFNGGSSRNQSDGKTTEM
                     SVMTEVSDLEAVMKDAKTWGFVDTSRIILLGGSQGGMVSAITAARHTDDLAGLVLLYP
                     AFVIPDAIHNTFSSKDAIPGTFNFLGWIQVGRNYATDVWDYDVYSEIGSFDKDVLIIH
                     GDRDYSVDLSYSERAKEAYENCELHVIKGAGHGFYGSSFDEAMDQIWEYLAEIE"
     CDS             259858..260571
                     /codon_start=1
                     /locus_tag="lbkm_0236"
                     /product="flavodoxin"
                     /protein_id="BBF41556.1"
                     /transl_table=11
                     /translation="MKKRILAIGMVALMSLMTACGNETASENKSNVTQQDSGNVVENN
                     TEDIMNNGSSLVAYFTYSENIGDTSDMSVDAISSASLNRDTKNTEGNLQVMAQEIVSK
                     QGADLHHIIIEEPYDADYSTMLDRVVDEFSDDTKVALQSKIDNLDQYDVVYIGTPVWN
                     GALPPAMETFFEENDLDGKTIIPFGIHLGSRFGSIIDQIEEYCPNATILEGFTINAET
                     SNDEVRIEFDAWLDDLKLN"
     CDS             260595..261149
                     /codon_start=1
                     /locus_tag="lbkm_0237"
                     /product="flavoredoxin"
                     /protein_id="BBF41557.1"
                     /transl_table=11
                     /translation="MRKNFGAKPFLYPQPVLIIGTYNEDGTANAMNAAWGGLCGADKL
                     IIDLASHRTTDNILRTGEFIVSVADASHVVEADYVGIVSANKVPDKLEKAGLHTFKSE
                     FVNAPVIDEFPMTFECKLLRQTEDGIVGKIVNVNIDERVLNEQGTVDVDKLGAITFDA
                     MNSSYVKLGEKVGNAFSDGKKLTE"
     CDS             261533..261790
                     /codon_start=1
                     /locus_tag="lbkm_0238"
                     /product="flavodoxin"
                     /protein_id="BBF41558.1"
                     /transl_table=11
                     /translation="MAENEIKNGDRPEITISVDNVEEYDTVFVGYPIWYDEAPAMIST
                     FLASYNFEGKRLIPFCTSSSDIIDISCWNWRYLYCKQINVN"
     CDS             261780..262058
                     /codon_start=1
                     /EC_number="1.3.1.34"
                     /locus_tag="lbkm_0239"
                     /product="2,4-dienoyl-CoA reductase [NADPH]"
                     /protein_id="BBF41559.1"
                     /transl_table=11
                     /translation="MLIDMVNYNKIDVKTNTFLKGISETAVTVTTDEKVQDIEADTVI
                     LSVGFYADRTLYEALQQEVSNVWYIGDQDTPTNVMNAVADGAAVGFNI"
     CDS             complement(262080..262958)
                     /codon_start=1
                     /locus_tag="lbkm_0240"
                     /product="chromosome initiation inhibitor"
                     /protein_id="BBF41560.1"
                     /transl_table=11
                     /translation="MEIQILNYFLEIAREGNMTRAAKSLHVSQSSLSKQMKELETELG
                     KPLFIRTRQGLSLTDEGMLLRKRAEDIIAMVDKTKAEFASLDEITGGDIHIGCAESYL
                     IKYLARGIKTFKVNYPLLKFHLFSGDTSLVTEHLDRGLLDFAVIVEPPDLSKYNYIEM
                     PGTDQWGLVIKKDHPLASKSEIIVDDLVGIDLICSNQSIKADIPRWCGEKADSLNFVG
                     TGNLTYNGAVFVQEGLGCLLTFEHLANTGSETNLTFRPLSPILETKMYIIWKKYQLFT
                     PISEVLIRWLMSHIND"
     CDS             263099..263332
                     /codon_start=1
                     /locus_tag="lbkm_0241"
                     /product="hypothetical protein"
                     /protein_id="BBF41561.1"
                     /transl_table=11
                     /translation="MAKATDTYGILKQNLEDAGCEKEIIDKCMVLASEDCWNEIPKLV
                     AAHKSKLLDIMHTSQNQIDCLDFLVYKIGKEHK"
     CDS             263352..263876
                     /codon_start=1
                     /locus_tag="lbkm_0242"
                     /product="hypothetical protein"
                     /protein_id="BBF41562.1"
                     /transl_table=11
                     /translation="MKILVLNGSPRPNGNTSQMVAAFKESAECVGSEVTVIEVCKKQI
                     HGCIACEYCHAKGNGQCVQKDDMQEIYDVLKDTDMLVLASPIYYHGISGQLKCVIDRF
                     YSAAYPMGPRNLKKAAMFLSSGASRQYEGAKYSFENDFLGYLGLKNMGFVTCAGGVTQ
                     RTLDEIRSIGARCK"
     CDS             263951..264949
                     /codon_start=1
                     /locus_tag="lbkm_0243"
                     /product="dienelactone hydrolase and related enzymes"
                     /protein_id="BBF41563.1"
                     /transl_table=11
                     /translation="MMNTEKLSLTTEWDKTFAKSEKVDHKKVTFVNRYGITLAADQYT
                     PKNTEGKMAAIAVCGPFGAVKEQASGLYAQEMAERGFLTIAFDPSFTGESGGTPRYMA
                     SPDINTEDFQAAVDYLSVQDNVDPEKIGIIGICGFGGLALNTAGIDTRIKATVVSTMY
                     DMSRIGANGYFDSENSEEARFQKRVTFNTQRTEDYKNGSYASSGALPDEAPEGAPQFL
                     VDYIDYYRTKRGYHPRSQGNGNGWNVTGTMSFLNQPLLNYSNEIRSAVLVMHGEEAHS
                     CYMGKDAYAAMTKDSEYTDNKELMIIPGAVHTDLYDKKDIIPFDHVEEFFHKYLQK"
     CDS             264983..265738
                     /codon_start=1
                     /locus_tag="lbkm_0244"
                     /product="flavodoxin"
                     /protein_id="BBF41564.1"
                     /transl_table=11
                     /translation="MKKKVILCLSLIILVHVMSGCAGLGSEKVVKDEIPVKEEQKASV
                     ETDEDTSIKENKERNKSVLIAYFSRIGNIDSEYKVDATSSASVVIAGDSMLGNTEYMA
                     RLIQAEISGDLHFIETKEKYSSHYDSTDNNKLDVQTNIEHRENARPELVGEISNMEDY
                     DVVFLGFPNWWNDFPMAVYSFLDEYDLSGKKVYLFNTSGGGGAANTLKTIQELEPNAD
                     INENILTVSHFDFDNFDEDDVKDWMEEIEYEKN"
     CDS             265725..266414
                     /codon_start=1
                     /locus_tag="lbkm_0245"
                     /product="hypothetical protein"
                     /protein_id="BBF41565.1"
                     /transl_table=11
                     /translation="MKRIKMLTDICMIILMPLLMLYSLIGEALHEWFGIAMLSLFLMH
                     NLLNWRWHKNLFTGKYNLQRTVRTVVNIMISVCMILTGISGIIMSNYVFHLEFLSDGI
                     SLARKLHLVCSHWLFVLTSIHAGMHLNVMKGYLGKGTVSAGNKFKREAIQMIKAILFI
                     LGIWFFVTTNTWDYMTYQISFMFLDFSRPAIVTHAEYVFIMILFFIVGDGLSSLMKCM
                     AVRKQKRSIGE"
     CDS             266447..267619
                     /codon_start=1
                     /EC_number="1.1.1.1"
                     /locus_tag="lbkm_0246"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBF41566.1"
                     /transl_table=11
                     /translation="MMNFIFNNPTKLLFGSGKLGELHNETLPGKKALLLTSNGKSTHT
                     NGSFDKTVEELKKSGVDYVVFNKIMENPLMEVCEEGGAFAKENGCDFIVALGGGAVLD
                     SSVAVATMATNPGRLWDYVSGGTGKALPLVEKPLPIVTIATSSGTGSEMNEWGGICKE
                     DTHEKIGFGNVACKPVIAVVDPTYMTTVPATYTAYQGFDALFHNTEVMMSTSLNVMSE
                     AIALSAIENIAKWLPIAVKDGSNIEAREHVAYGSTMAGITMQLTSTTAQHSMEHAMSA
                     YHRNLQHGAGLIIISREFAQFFVDRHVCDDRFIKMAKAMGVENPTSPQDFVDALVKLQ
                     EACGVADLKMSDYGFKKEESVTLAINARETMGGLYPANPCEMTDEDVAGIFDRSYK"
     CDS             267843..268661
                     /codon_start=1
                     /locus_tag="lbkm_0247"
                     /product="oxidoreductase of aldo/keto reductase family,
                     subgroup 1"
                     /protein_id="BBF41567.1"
                     /transl_table=11
                     /translation="MGLFDLEKRTVILNSGYEMQINGIGTYSLLDDVCVDSLLEALNR
                     GVRFIDTAYMYHNEAEVGKAVRDSDIPREKIFVTTKIYPDQYSNPEAAINTALEKLDI
                     GYIDLMLLHHPGTGDVEAYKAMEKAVADGKIRSIGLSCYYIEELKEFLPQVTITPALV
                     QNEIHPYYQDTEVIDYIHNLGIVVEGWYPLGGRGHQKELLSDSVLDAIAKTHNKSVAQ
                     IILRWNLQREVVVIPGSSNPDHIQENTELYDFELTDEEMKQIESLNRNEKHDWY"
     CDS             269074..269322
                     /codon_start=1
                     /locus_tag="lbkm_0248"
                     /product="hypothetical protein"
                     /protein_id="BBF41568.1"
                     /transl_table=11
                     /translation="MGRSISIIKDALSELEQFGIIRRKRESKSSRIIFILILEDSIKG
                     RNAIGVGRDNCSYTGHKSVLAEANISATNIRKENVASI"
     CDS             269384..269836
                     /codon_start=1
                     /locus_tag="lbkm_0249"
                     /product="hypothetical protein"
                     /protein_id="BBF41569.1"
                     /transl_table=11
                     /translation="MNSEELWNKFKKEKGLSEEVNYIESFHFELTEYWANALLDMVLE
                     GTKKATSSSVCAYEKEGERIPQKGDYSIVTDWDGNARCVIQTTNVRIMPFQDITYEIC
                     KLEGEDDTLESWQKGHIKFFQLEGKELGYEFTEQMPVIFEEFEVVYRG"
     CDS             269877..270635
                     /codon_start=1
                     /locus_tag="lbkm_0250"
                     /product="Zn-dependent hydrolase"
                     /protein_id="BBF41570.1"
                     /transl_table=11
                     /translation="MDSGRGDKERKHLVKITARIYYFPGEEETDRPYLYYIKGDHYSA
                     AVDAGNSKAHVQAYYEAITKAGLPLPEYTVITHWHWDHTFGIPYVHGKTIANQLTKNK
                     LIEVSQWNWTKKAMEDREKSGEDIAFCNECICKEYPMLSDIKVQTVDQGIIEPMELDL
                     GGVHLQLFPRDSTHSRDALFIYAPEEKALFVGDGDCGDHYENNGEFDPNRLDSLLKFV
                     EKIDFKYYFLGHDVPDTKEGAIKYLGEIRTESRR"
     CDS             270640..271125
                     /codon_start=1
                     /locus_tag="lbkm_0251"
                     /product="hypothetical protein"
                     /protein_id="BBF41571.1"
                     /transl_table=11
                     /translation="MELTFRKITEFDRGILHRLLVDGYSFDDRYRECFEQDWIEFDQF
                     FFDNPEIADNYGFMTVLDGEPIGHISWDPRNQPAYVAIGHNCIATRYKGNGYGKRQLN
                     EALRRIKEYEGLEKIIVETNRNLVAPHNYESVGFQLVDSKKNDSKSAFSGDYLEYEIE
                     I"
     CDS             271241..272290
                     /codon_start=1
                     /locus_tag="lbkm_0252"
                     /product="transcriptional regulator, XRE family"
                     /protein_id="BBF41572.1"
                     /transl_table=11
                     /translation="MKINETIRKYRKEKNLTQEQIANQLGVSAPAVNKWENGISYPDI
                     ELLAPLARLLEIDIDTLLSFREELTEKEIAGFINQLSEGMIKVGFEESYRQAEQKIRE
                     FPNCYKLILWSAQVLNGYLVMKFQDIKEKENYQNQIMKWFEKVAFCDEAELAKAAQIS
                     LAQYYMNSERYEEAQKILDKIPPVGFDKRTTQVQLLVSQSKYDDAYRIQDEMLYQQAN
                     GLINNMMHTLSMLCKQKKQEDAIYYADMINQMEETFQLGCYIGSLAYFTVYAEMGDKD
                     RSMDYLEKMMDGLVSMRMPKTSRLYQHMKFNEDDGLDKMKEMIVKSFDTDKSFDFIRK
                     EPRYQALVRRSETKK"
     CDS             complement(272336..273373)
                     /codon_start=1
                     /locus_tag="lbkm_0253"
                     /product="hypothetical protein"
                     /protein_id="BBF41573.1"
                     /transl_table=11
                     /translation="MEGILLKKFRNILIIVVLVLLIGGFIFYKVKTSQTVELDSNVLG
                     NTSGNIYNNGLFAENDGRIYFSNLSDNGALYSMKNDLSDYSKISSDKIVYINVTDPYI
                     VYSRINNKKEQTSKKVIAFHNVGIYRINKDGSNTVSLDTTAAGMVNQEGNYVYFQHYD
                     KASAYSLYSVKLDGKESKMLEDDPIYPGMIKQNTLYYAGYLKDHKLYKKDLVTNANSE
                     ISEGNYYMPILTDRYLYYIDAGDNYKIKRAKTDGSDPETLVDKRCSTYNLSQNEKYLY
                     CQVDNQTDNGIYSVDTTSNTLTPIMSGNYCNINVTSHYVFFQGFNQNQYYKLTIGNGQ
                     TADMFNPEVED"
     CDS             273503..274633
                     /codon_start=1
                     /EC_number="5.4.99.5"
                     /locus_tag="lbkm_0254"
                     /product="chorismate mutase I"
                     /protein_id="BBF41574.1"
                     /transl_table=11
                     /translation="MIDLRESRDKIDTIDRQIVKLFEDRMKVSNDVAEYKIATGKKVY
                     DKQREDEKLAVLRGYATDEFNKHGIEELFTQIMSISRKLQYGKVANEGLELGFTEGQL
                     HTDKQVRVAYFGEPGSYSEQAMIEVFGENIKAASSSTFQGVMELLKNHEVEYAVLPIE
                     NSSTGGIDDIYDLLVDYNHTIIGEHILKVEHALLAVDGATMDDIKTVYSHEQGLRQCK
                     HFFDDRDVELIKCKSTSGAAKKIIEDGDRTQAAISSKRAATTYGLNILAEKINEEELN
                     ATRFIIITNQKIYLKDADIVSISFEAPHEKGTLYNMLSNVIYNSLNMTKIESRPMKGR
                     RWEYRFFIEFEGNINMPAVKNALYGIREEATNFRLLGNMKTI"
     CDS             274758..276281
                     /codon_start=1
                     /EC_number="3.4.21.-"
                     /locus_tag="lbkm_0255"
                     /product="serine protease, DegP/HtrA, do-like"
                     /protein_id="BBF41575.1"
                     /transl_table=11
                     /translation="MYNNENDMNQNEYTNQEGNGVGTEQFTQQQSQQQYQQQFQQQYE
                     QPFYGQPGFDNSNLNNQARPKKKKKFVKTAGFILAVALVAGGTYYVADRYQINQANEQ
                     LADTQNNSSSSSTSNDTNTTKLETTSKVDSATKGSVSDVVDAVMPSIVSINVKANVQS
                     NYFGQTVEQEQEGSGSGIIIGQNSSEILIATNNHVVDGANSLEVVFSDEKTVTATVKG
                     TDSSNDLAVVSVPTKNVENSTLKKIKIATLGKSDEVKAGEMVIAIGNALGYGQSVTVG
                     YISAVNRTVQTEDYTMKLLQTDAAINPGNSGGALLNASGQVIGINSVKFSDESVEGMG
                     YAIPITYAVPIIQELMNSEPISESEQAYLGIYGQDVTETLAQRFGLPEGVYVTDISTG
                     SPAAKGGIEKGDVIVKFGDREVSTMTELQKLISNKRAGTEVTITVKRSNGSTYKEKEI
                     KITLGKKSESSSSQSNSNSSDSNNNSSSNGYNPYGNSNGNNNGNSSQDSNGYGIFGN"
     CDS             276441..277385
                     /codon_start=1
                     /EC_number="3.1.1.5"
                     /locus_tag="lbkm_0256"
                     /product="lysophospholipase"
                     /protein_id="BBF41576.1"
                     /transl_table=11
                     /translation="MEQVTIRSYVDQLPLSVLISQPKTPKAIVQILHGMCEHKERYLP
                     FMEYLTEQGYVCIIHDHRGHGKSVLRQEDLGYFYQDGARALVEDANQVSRYVRKRYRG
                     LPLYLFGHSMGSLIARVYVKNYDSVVNGLILCGSPSNNRMAGVGTVLAKLVGKLRDDH
                     NPGQWFQKMACGKYNKDITDAKSRNQWICTDEKVVEKYDQDPLCNFIFTINGFENLFK
                     LVHRVYSKYGWTVSNPGMPVWFISGEHDPCMVGEKQLKQAAAFMEQVGYQHVSWKIYK
                     GMRHEILNEQRHKIVFQDIAEKLEIWYDRKNLSKNNYS"
     CDS             277522..277983
                     /codon_start=1
                     /locus_tag="lbkm_0257"
                     /product="hypothetical protein"
                     /protein_id="BBF41577.1"
                     /transl_table=11
                     /translation="MSGIHFEHYLAYQFRKLGYRVKVTPPSGDFGADLIIRKWGRKAV
                     VQAKRYQGSVGIKAVQEAIGAREYYKAKQAIVITNSYYTSAAIKLAKASNVVLWDRGH
                     MIEEFGLVEYKHQKELHCPICQSPLVVRNGKFGEFYGCTNYPNCSYTKNID"
     CDS             278113..278607
                     /codon_start=1
                     /locus_tag="lbkm_0258"
                     /product="transcriptional regulator, AsnC family"
                     /protein_id="BBF41578.1"
                     /transl_table=11
                     /translation="MVQSVREQILHLIESDSRLCPAEIATMVGITEGEAEEEIEQMEK
                     EHIICGYHTLINWAKAKEDDITAMIELRVTPQDGDGYEKIAEYISQFPQVETLYLMSG
                     AYDFLVTIKGKTLKEISLFVSGKLASMKEVQSTTTHFALTKYKELGVDMEAKKIDERM
                     VITP"
     CDS             278604..279773
                     /codon_start=1
                     /EC_number="2.6.1.1"
                     /locus_tag="lbkm_0259"
                     /product="aspartate aminotransferase"
                     /protein_id="BBF41579.1"
                     /transl_table=11
                     /translation="MRELLSKKAVGLKPSGIRKFFDVANEMEDVISLGVGEPDFDTPW
                     HIREEGINSFHKGRTFYTSNAGLMDLRKEICKYIKKKQNLTYDPEKEVLLTVGGSEGI
                     DAALRALLNPGDEVIYIEPCFVSYLPCIVLADGVPKPIALSEENGYRLTREQLEKAIT
                     PKTKVLMLSYPNNPTGAIMERKDYEALIDLIIEHDLIVISDEIYSELTYEKETVSIAS
                     LPGMQERTIIINGFSKAYAMTGWRLGYALANPVIMEQMVKIHQFAIMCAPTTSQYAAI
                     EAMRNGDDDVTMMCQSYNQRRRYLLSEFKRLGLPCFEPHGAFYTFPNISEFGMTSEEF
                     ATRLLKEERLAVVPGSAFGECGEGHVRISYAYSVQEIKQAMKRMERFIHKLRDDQ"
     CDS             279820..280680
                     /codon_start=1
                     /locus_tag="lbkm_0260"
                     /product="hypothetical protein"
                     /protein_id="BBF41580.1"
                     /transl_table=11
                     /translation="MKQVITREKILEYLILTFASVILVLGVYLFKFPNNFSFGGVTGL
                     AVILNRFFRFSASSFTFIINMLLLGVGFIFLGRGFGIKTVYVTVLTSVGFSLMEHFFP
                     MSRPLTTQPVLELIYAIVIPAISAAMLFNIEASSGGTDIIAMILKKYTTLNIGSALFV
                     VDFIIVVCSFFAFDAETGLFSFVGLMAKSLVIDNVIENINLCKYFTIICDRPDEICNF
                     IHNEIHRSATIFKAEGSYEHGNKTIILTVMKRSQAVHLRNHIHEKDPEAFIMITNSSE
                     IIGKGFRGLN"
     CDS             280742..281386
                     /codon_start=1
                     /locus_tag="lbkm_0261"
                     /product="hypothetical protein"
                     /protein_id="BBF41581.1"
                     /transl_table=11
                     /translation="MAYMNIDYLSINMTGMLGDYGIIRSGSYGKLLKKYYAENKNDAA
                     SGSSSTTQSKLMSVKSEADDLKASAESLTVQGSKSLFAEGNRDKIATAVNKFVSDYND
                     TVKGASETKNKDISRYVSSMTFQTNAYKTSLEKVGIKVNGDQTLTVDTTKLKEAKLSD
                     LKTLFSGSYSYADSVANKAEQISKLATKASGFPTYQSNGMFGTTSQYQSYNWYL"
     CDS             281556..282548
                     /codon_start=1
                     /locus_tag="lbkm_0262"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBF41582.1"
                     /transl_table=11
                     /translation="MRKKLLAVGILVILVLTSLMGCSKEGKLTKVRLNEVAHSIFYAP
                     MYVAIENGYFKDQGLDVKLINGLGADKTMTAVLSGEADIGFMGSEASIYVYNQGASDY
                     VVNFAQLTQRAGNFLVSRNADANFKWTDLKGKKVLGGRAGGMPEMVFEYILMKNGLTP
                     GKDVKIVQNIDFGLTAEAFASGNGDYTVEFEPSAEALEREGKGKVVASLGLESGKVPY
                     TAYSAKKSYIEKNPEVIKRFTEAIQKGLDYVNSHTPEEIAKVIKPQFKETSDASLVKI
                     VKRYYDQQTWKDNTVFEKESFNLLQDILINGKELEEKVDYNKLVNTEYAKEAVK"
     CDS             complement(282596..282763)
                     /codon_start=1
                     /locus_tag="lbkm_0263"
                     /product="hypothetical protein"
                     /protein_id="BBF41583.1"
                     /transl_table=11
                     /translation="MVIIKHWKNESKANYLASLIQSYYPSCQITVLEPSYLRTFAMAQ
                     GQLMIDFEIPS"
     CDS             complement(282942..283787)
                     /codon_start=1
                     /locus_tag="lbkm_0264"
                     /product="DegV family protein"
                     /protein_id="BBF41584.1"
                     /transl_table=11
                     /translation="MKYGIVVDSGCDITNIEDFTKCGIAFTRVPLSLQVGNKTFIDDL
                     HLDINDFLEESYAYKGKSGSAAPSPGAWCDAYSSAEYIFVITITGTLSGSYSSACTGK
                     NMYLETDPAKRIHVINSLSAGPYIALLAYKLKELILEDLDFDTIVEKITEYDTHTHLL
                     FVLEHLDNLIKNGRVSKLQGGLAGILGIKMLGCSDEHGQLSVLEKCRGKSTAYDKLVA
                     TMYEKGFHGGKVVINHCNNENMATRIRDKIHETYPDCEITIMTPSGLCCFYEEKGGVM
                     VGFES"
     CDS             283896..284435
                     /codon_start=1
                     /locus_tag="lbkm_0265"
                     /product="transcriptional regulator, TetR family"
                     /protein_id="BBF41585.1"
                     /transl_table=11
                     /translation="MKEHTKKSCFTRTCIAEALLLLMKEKPLKEITVTALVERAGVSR
                     MTYYKYFTSTEEVLEDYLYEMVKKYIREISEREDVGHFHDYVRIQYSFAFFGEYHEFF
                     EILLKSNLYSIIINAVNQFMEEFVLKQVNHTKYELYYYAGALCNTFAKWIEDGRREPI
                     AAIAKEIENYMRIEKKSID"
     CDS             complement(284730..285023)
                     /codon_start=1
                     /locus_tag="lbkm_0266"
                     /product="hypothetical protein"
                     /protein_id="BBF41586.1"
                     /transl_table=11
                     /translation="MNKIEDLMNAVKLGELMGKKKEEEKKCNVCCILAIIGGVIALAA
                     LIYGIYKHFRPDYLEDFDDDFDDDFEDEEFEFESDNDDDLNEDDVNEDKFVEE"
     CDS             complement(285118..287517)
                     /codon_start=1
                     /locus_tag="lbkm_0267"
                     /product="ATP-dependent DNA helicase UvrD/PcrA"
                     /protein_id="BBF41587.1"
                     /transl_table=11
                     /translation="MSIYDTLNPEQLTAVKHVKGPLLLLAGAGSGKTRVLTHRIAYLI
                     DEEGVSPWNILAITFTNKAAKEMRERVDNIVGYGSENIWVSTFHSTCVRILRRHIDRL
                     GYDKNFTIYDSDDQKSLVRDVVKYFDLDPKTFKERAIMTAISKAKDELKSPETFLKEA
                     GGDYIYKKYGSIYEEYQRRLKMNNALDFDDLICKTVELFKTCPDVLDLYQTRFKYIMV
                     DEYQDTNTAQFKLISLLASTTNEFGEIEHNLCVVGDDDQSIYKFRGANIQNILNFEKQ
                     FADTTVIKLEQNYRSTQNILNAANEVIKNNFGRKKKTLWTANEEGDPIQYTQYNNEYE
                     EAEAIVSDIYNQVNNGACYKDVAILYRTNAQSRIFEEKLIYRNIPYKIVGAINFYQRK
                     EIKDILCYLKTIDNGQDELAVRRVINVPRRGIGLTTIDRVTDYALKNEMTFYNALKHA
                     ESIPGMSRALAKVSSFVSLIEVLKSKLHDPQYNLEDLINEILDATGYRAELEGEGTEE
                     SKDRLDNINELINKVVSYEANCDEEPTLSGFLEEVALVADIDNVEESADMVVLMTLHS
                     AKGLEFPYVYLCGMEDGIFPSYMSINADDPQSEIEEERRLCYVGITRAKKVLHLSCAR
                     QRMVRGETQFNKPSRFVNEIPRHLLKQTANSLNSRIGRYDEKPTRPARSSMGQISTNY
                     GRGGMKSVTNDMITNGLYGKRSTPTDKNNPFAGNPLIQKGFGNQTMSSTLFDKPKPAG
                     ASNGVDYGVGDTVKHIKFGTGLVTDLVQKGSDYEVTVDFTNSGQKKMKASFAKLKKLN
                     N"
     CDS             287663..288316
                     /codon_start=1
                     /locus_tag="lbkm_0268"
                     /product="hypothetical protein"
                     /protein_id="BBF41588.1"
                     /transl_table=11
                     /translation="MVESKNDTYIKKILNDLKLMDYIKPGEIPNIDLYMDQVTTFMDE
                     HLYTCKRFEDDKMLTKTMINNYTKNNLLPSPNKKKYSKEHMLLLVFIYYFKNILSISD
                     IQSILNPLTEKYFNSDNVVQLEDIYSEVFGLEEAQMENLTKDVLKKYMKSLKTFDQVE
                     DEEEKEFLNKFSLICMLSYDVYVKKALIEKIIDRELVPLNEKLKEESNPKKKDKDNK"
     CDS             complement(288363..288674)
                     /codon_start=1
                     /locus_tag="lbkm_0269"
                     /product="His repressor"
                     /protein_id="BBF41589.1"
                     /transl_table=11
                     /translation="MNKKIKTPAVDLLFDAILSLNSPEECYVFFEDICTINELLSLSQ
                     RFEVAKMLREHKTYLEIAEKTGASTATISRVNRSLNYGNDGYDMVFERIGEKEMEPTE
                     K"
     CDS             complement(288785..289501)
                     /codon_start=1
                     /locus_tag="lbkm_0270"
                     /product="putative histidinol phosphatase and related
                     hydrolases of the PHP family"
                     /protein_id="BBF41590.1"
                     /transl_table=11
                     /translation="MKLVLDTHTHTIASGHAYNTINEMVLAARDKQLELLSITEHSMT
                     MPGTCHEFYFQNLRVIPREMHGVKLLLGTELNIIDYHGNVDMDESLMKQLDIRIASLH
                     GPCIKPGTIEQNTNAVLGAIKNPYVNIIGHPDDGQYPLDYEAIVKAAKEHHVMIEVNN
                     SSIRPGGFRLNSRENALKYVALCKQYEVPISLGSDAHYTGDILNYEYALDVLKEIDFP
                     EELVMNTNTEKFLSYLHSKK"
     CDS             289675..290535
                     /codon_start=1
                     /locus_tag="lbkm_0271"
                     /product="permease of the drug/metabolite transporter
                     superfamily"
                     /protein_id="BBF41591.1"
                     /transl_table=11
                     /translation="MEKEQKKYFIAIVALFVAAFFWGSAFCVIKGTLDALTPFYLLAV
                     RFLLAGVILLLLFATRLQFMTKRLFKRGLLLGIFLFFEFAFFTVGIKYTTASKSSFLL
                     ASYIIIIPLIYWLVAKTRPTKYAFGASATCMMGLCFILLDDLSALNKGDFYSIICAVF
                     YAIHIVYTSKFVRDDDGILLNMMQILTGGICSLIVALIAEPFPSAVPVSAWGGITYLA
                     IGCTIAPYVCSMFGQKYTKTSTAAVILSFESVFGCLLSALLLGERVSYRFIIGGALVV
                     ASFFVSERES"
     CDS             290611..291969
                     /codon_start=1
                     /locus_tag="lbkm_0272"
                     /product="RNA methyltransferase, TrmA family"
                     /protein_id="BBF41592.1"
                     /transl_table=11
                     /translation="MKKGQTYEGIVEQFDFPNKGIVFLEEGKVIVKNALPGQKVRFLI
                     NKARKGKFEARLLEVIDRSPMETRQAPCKDFGACGGCTFQSMPYETQLELKKNQVKKL
                     IDGVCDDYEFEGIKGSPVEFAYRNKMEFSFGDEVKDGPLALGLHKKGSFHDIVTADTC
                     QIVDEDYNKILTCVLTYFQERGVGFYKKMRHEGFLRHLLVRRAVKTGETLISLVTSSQ
                     EEMDLTELKDALLALELSGKVVGILHVINDSLADVVRSDRTEILYGQDYFYEELLGLK
                     FKISTFSFFQTNSLGAEVLYSTAREYVGETKDKLIFDLYSGTGTIAQILAPVAKKVIG
                     VEIVEEAVEAAKENAALNGLTNCEFIAGDVLKVIDTIEEKPDLIVLDPPRDGINPKAL
                     TKIIDYGVDRLVYISCKPTSLARDLVMLQERGYKVEKVCAVDMFPQTVHVETVCLLKK
                     VK"
     CDS             292001..292162
                     /codon_start=1
                     /locus_tag="lbkm_0273"
                     /product="hypothetical protein"
                     /protein_id="BBF41593.1"
                     /transl_table=11
                     /translation="MSMKDMERMKQLLEEKKGKCNFFYGEKKIGVGKVQQRHKNINTD
                     SERTKKISQ"
     CDS             292327..293664
                     /codon_start=1
                     /locus_tag="lbkm_0274"
                     /product="multi antimicrobial extrusion protein
                     (Na(+)/drug antiporter), MATE family of MDR efflux pumps"
                     /protein_id="BBF41594.1"
                     /transl_table=11
                     /translation="MRTRNERNMTKGTPIKVILLFAIPILLGNVFQQLYNVADTAIIG
                     NVLGDQALAAVGATAAIYGLIIGFANGMTNGFSVVLARFYGAGQKEEVKKTVALTMIL
                     TTMISIVLTLLSLLGLRPLLHFLNTPDSIITQSQRYLSIIFAFSIVTMFYNMFAGLLR
                     AIGNSKVPLWALIVSTVINIVLDLLFVKGFSWGIGGAAYATVIAQGGSVILCILYIRH
                     FCPLLVVKKEDICMDRKLIIELMTTGLSMGLMLAIVSVGSVALQSAVNGFGDKIIAAH
                     TAARKIDDIFMLPLGTLSMAASTFASQNFGAGRMDRVKQGIKASILLAFIWSGISCIV
                     VLAGGGFMARMLTGSTNSIVIETAVKYITINIPFFFVLSILLILRSSLQGVGKKLIPL
                     TASMIELLAKFIAVGMITPVLGYFGVCIIEPIIWSVCSIIVAIDFIRFIEKAR"
     CDS             complement(293976..294137)
                     /codon_start=1
                     /locus_tag="lbkm_0275"
                     /product="hypothetical protein"
                     /protein_id="BBF41595.1"
                     /transl_table=11
                     /translation="MNLDALNTPEFQEDLANAIQQINERYHLSIKCSQISYGSDYLTI
                     YVDEPDEDK"
     CDS             294304..295596
                     /codon_start=1
                     /EC_number="2.8.1.7"
                     /locus_tag="lbkm_0276"
                     /product="cysteine desulfurase"
                     /protein_id="BBF41596.1"
                     /transl_table=11
                     /translation="MRKNSPWRKCFVGTNTTIETACGIQKRIFFNNGATPLILKKVSQ
                     TANQLFPCFTYLNEHNCNSEFITEQYNAVREKAAEFVHADTKKDVVLFTRTATEGLNL
                     VAYLYQQLVPDGIIFSTCLEHMANYLSFQQRMNTKLIPLMPNGEIDLSQYAYMLETYK
                     GQVKLVTVTGASNLTGYVPPYYEMARMAHEYGAHIMVDAVQTVQHMPFSMLSYEDPCH
                     IDFTAFTAHKCYTGLAGAAIIGPKEFFDAKVYPLTFGAGVNAFANMSQVILADTPDRY
                     ECGYPDITGITCFGTAMDFLMDCGMDGIEEYEYELRQYLLEGLLDINGVIVYGPISGK
                     RAIPYVAFGMEGINYKELAQKLGYQYGIAVSAGVAGADIYTQWLLGLTDEQTYQLYQK
                     GETYGTVRVSLGMFNSKIEVDRLLYALYEIGKNECCRH"
     CDS             295663..296226
                     /codon_start=1
                     /locus_tag="lbkm_0277"
                     /product="hypothetical protein"
                     /protein_id="BBF41597.1"
                     /transl_table=11
                     /translation="MKNYIFLSYPKPFLKEQTEFIDRITDYLVQRGYEPRTLGITDMD
                     EGQPLIAIQNLLSQCSGVLMVAFRRTLIKQGICKPQSDLKQQSSMIRGEWITSPWCHI
                     EASMASQTGLPILIFREKDVIADGILESKILNDESIEFDLTQPSDREMKSKRWRKQLE
                     EWQEKCSIQEERNIRYCEFTKKSRNKV"
     CDS             296223..296705
                     /codon_start=1
                     /locus_tag="lbkm_0278"
                     /product="hypothetical protein"
                     /protein_id="BBF41598.1"
                     /transl_table=11
                     /translation="MIDEFEEYLESVEGIKKVYLTSRVIKQIQWYDDAAKKKQKRYKS
                     CMIVSILLTAVIPCLSLFTGYRYGIIASIAIAVLSAASSAILSIVNLCELQKLWIEYR
                     ANCEILKSVLHRYLTRSREFSYGNEEEQFQLLVEITEKYLVEEYGTWSRLSHSDRKES
                     "
     CDS             complement(296710..296901)
                     /codon_start=1
                     /locus_tag="lbkm_0279"
                     /product="phage protein"
                     /protein_id="BBF41599.1"
                     /transl_table=11
                     /translation="MIKKYVKRPVIVEAYQTEKTMTIHTLEGDMKASPGDYIITGVNG
                     EQYPCKPEIFFKTYEYYSE"
     CDS             297098..297502
                     /codon_start=1
                     /locus_tag="lbkm_0280"
                     /product="hypothetical protein"
                     /protein_id="BBF41600.1"
                     /transl_table=11
                     /translation="MMIGLRCKLADEIKKLRFLIRKNGPCTLEDATKQVYDIYPSGEI
                     CGYFYLGTSKHYIEKKQTHVSKKKAFQLMSRLQEQVSKENQDGIIAVVCDGSSYELQI
                     FYTDNRKTVIHGDIGGGTVDRYLMDFLKSVLF"
     CDS             297559..297771
                     /codon_start=1
                     /locus_tag="lbkm_0281"
                     /product="bacterial seryl-tRNA synthetase related"
                     /protein_id="BBF41601.1"
                     /transl_table=11
                     /translation="MADFKYEIVEELGVISENAKGWRKELNLISWNGAAPKYDLRDWA
                     PEHEKMGKGITLNEEEIESLKKILNR"
     CDS             297792..299720
                     /codon_start=1
                     /locus_tag="lbkm_0282"
                     /product="DinG family ATP-dependent helicase YpvA"
                     /protein_id="BBF41602.1"
                     /transl_table=11
                     /translation="MCARLKEPFEYKTKEEFQTNLVEWIGDVLYDILPEHGYEIRDEQ
                     IFTAFQIADAFGKKEVHLAEAGLGTGKTFAYLLSAIPYARFRKKPVVIACATSALQEQ
                     LASEEGDINKLSKVLGLEIDARMAKDPHQYICDVKVEDHMGDFGEMSKEINDWLGKTK
                     LGERSEMPMISDQVWKHIGWDESMGCEVCSNRGYCKLMKAKESYRDTVDLIIVDHETF
                     FHDLWTREERIADGKVPILPSYAAVILDEGHKIMLPAAMQAGDQIDKEEFDAMITSIE
                     EVQGARDSLVSAMVSLEQASNAFFATLDQSVRKQRRSNRQSVRLNPSLFKAADELRKL
                     LDQLLLEMQIEQELYFESIPATLIQAYEGQLERAIRGLARFTRNRAKDMIVWVDSRDD
                     SLWVVPRNLTEMMNQYLYKQDIPIIYTSATLSNEGDFSYFARTIGLKKISKSTVGSPF
                     DIENQVTVTLVPGVKRENDGMEQLLSLLEKNGGRALVLTNSLEEVERIREGIGEREFP
                     FEMLWEDKGDRGYLVKRFREEETSVLVGADFWEGIDVPGDALTLVVIWQLPFPALDPL
                     AEVQRAEAKEQGLDPVKTVDYPEMGLKLKQGCGRLIRTEEDHGEIVILDKVVGTPWEK
                     VVMGSLPEGAHIKKTESF"
     CDS             299717..299872
                     /codon_start=1
                     /locus_tag="lbkm_0283"
                     /product="hypothetical protein"
                     /protein_id="BBF41603.1"
                     /transl_table=11
                     /translation="MISEIVNDNLTWPSSNKKMATVSSKGLVKAKKACNVKIKVRTEK
                     YISVILL"
     CDS             300076..301374
                     /codon_start=1
                     /locus_tag="lbkm_0284"
                     /product="proton/glutamate symport protein"
                     /protein_id="BBF41604.1"
                     /transl_table=11
                     /translation="MKKKISLTTIIFIALIAGAILGVVLNMYVPSGYIKDTIVVDGIF
                     YVLGQGFIRLMQMLVVPLVFFSLICGILAIDDTKQIGKVGIKTLLFYMATTALAVIVA
                     LSVANVIDPGRGLDMSKVQQSEVKITETTSFTDTLLDIIPKNPFESLANGTMLQVIFF
                     ALFVGIVIAHLGEKAKLVAKLCEEGNAIMMLMTTFVMKAAPIGVFCLIARTFSSLGFD
                     AFGPMIKYMAGVFLALAIQCLVVYMLFLKGFTGVNPFKFLKKFAPVMGFAFSTASSNA
                     TIPLSIETLSKKMGVSKKISSFTIPLGATVNMDGTSIMQGVAVVFIAQAFHINLTMMD
                     YVTVIATATLASVGTAGVPSVGLITLSMVLSSVGLPVEGIALIMGIDRILDMTRTAVN
                     ITGDAVCTTIIAKQEGAFDREIFNKDFGELALEEIEAPEL"
     CDS             301553..302011
                     /codon_start=1
                     /locus_tag="lbkm_0285"
                     /product="phosphoesterase, putative"
                     /protein_id="BBF41605.1"
                     /transl_table=11
                     /translation="MKRVAILSDTHGLLREEVKEELKQADIILHAGDINKQEIVDEMR
                     SYAPLYIVRGNNDKEWASEIPNSIVVTIEGVHFFIVHNKKDIPANLEGIDVVLYGHSH
                     KYEEKDVEGMKWLNPGSCGKRRFDLEISMCRMYIEGAKYQIEKITIPNSK"
     CDS             301980..302450
                     /codon_start=1
                     /locus_tag="lbkm_0286"
                     /product="hypothetical protein"
                     /protein_id="BBF41606.1"
                     /transl_table=11
                     /translation="MRKLRFRIPNRKKTNQVEENSFAENGSSEDKKIANALPVCPHTV
                     KELEVYLKENYDVHAVDETDLDYQRLAKRMGEDYQLYRLYVDKLTEQAEQILVALDYK
                     QDQMWIDFDASDEECRRRNEIILELYFYYGIRKEDKEQQTLRFQRLAEILLYLP"
     CDS             302547..302858
                     /codon_start=1
                     /locus_tag="lbkm_0287"
                     /product="hypothetical protein"
                     /protein_id="BBF41607.1"
                     /transl_table=11
                     /translation="MCKIDKSKKNIKKRIKEIKNRMYEIELELSNDYWEQSQDEDEIS
                     YLESIEEEYDKLEEELSLLDEFVDSTSWKKHVLRGAAVFTAIASVATVAFQVRKRFKN
                     K"
     CDS             303005..303685
                     /codon_start=1
                     /locus_tag="lbkm_0288"
                     /product="hypothetical protein"
                     /protein_id="BBF41608.1"
                     /transl_table=11
                     /translation="MSGKSLTGAALIAEITEALAPLQKIKEQYEVIQENVRQVLQNEK
                     NKPATKYGKMSNVVALVIIMPVFAGFAQLIPVVGKYLSVIAWVALMTAGLKYMEYQTE
                     KKYGQITLENEQLKRQNKELTNEMVETIFHGQEQIAILPEEYQYFDAAEYIKKALVNC
                     RADQLDEACELYEKKAADSKKEAFQAKLLGEQQEQAKLISHLLELSKEQAQETASEWL
                     EGLYKIEE"
     CDS             303849..304697
                     /codon_start=1
                     /locus_tag="lbkm_0289"
                     /product="iron compound ABC transporter, iron
                     compound-binding protein"
                     /protein_id="BBF41609.1"
                     /transl_table=11
                     /translation="MLLVSCGKKVEKEDVKKQKVTAVVGLGSYAKLWRLAGGTVLGAS
                     SDAFSEERNDIKDYGENIGGIQSLNVEKIIQLDPDVVLLTSNIKSQVALKTNLEKAGI
                     SVEYLEVETFEDYCKALKKCTKLTGKTENYKKYGMDVKDKITSIINSVPKQKAPRILL
                     MRAFSTGIKTKRSDNMVGAMLKDLGCINIADQEQTSLENLSVEQIRKEDPDYIFITTM
                     GDSTAAKKMIAKELENNPVWNELSAVKNKHYIILKKELFQYKPNEKWSESYQVLAEIL
                     YGREED"
     CDS             304828..305673
                     /codon_start=1
                     /locus_tag="lbkm_0290"
                     /product="ABC-type Fe3+-siderophore transport system,
                     permease 2 component"
                     /protein_id="BBF41610.1"
                     /transl_table=11
                     /translation="MILHIRLVRSLSAVIVGMALAITGVIIQTILNNPLAGPNIVGIN
                     AGAGLGFIIASILFGESMGLPLIGAFAGAMITIRIVLAVSRKIGASRKTTILTGVAVN
                     SLCNAFIDGILVWVPESLAYNQYFKMGSFSGVSFEKLGLPAILIIITMVSVILLHNEM
                     DVLKMGDEIAKGLGLATDRWRNLFLIGAAILVGASVCITGILGFIGLIVPHMGRVLVG
                     EQSKPLLIVSMLLGGIFTLLCDTAARMIFQPYEIPVGILISFIGGGFFIWLLFHHKGE
                     RYVDS"
     CDS             305660..306433
                     /codon_start=1
                     /locus_tag="lbkm_0291"
                     /product="ABC-type Fe3+-siderophore transport system,
                     ATPase component"
                     /protein_id="BBF41611.1"
                     /transl_table=11
                     /translation="MLIVDDVCISYGQKEIIHHISDKIDREDGLTVIVGLNGCGKSTL
                     LRTLGGIYEGYTGEIHYGNRILREIPLRERAKMISYLPQYRRVPNISVERYVLHGRFP
                     HLSYPRHYGKKDFELVDKVLERFQIASLKTKQMSQISGGERQKVYLAMAIVQDACYLL
                     LDEPSTFLDLHCQYEFLRILKELVEEGKTVLMVSHNVQMALQYADNIIVMEKGRIKIR
                     GTPEQVVHSGEIENVFQVKIQKITRDDDKTSSYIVLGVD"
     CDS             complement(306440..307963)
                     /codon_start=1
                     /locus_tag="lbkm_0292"
                     /product="regulator of polyketide synthase expression"
                     /protein_id="BBF41612.1"
                     /transl_table=11
                     /translation="MTISEFLTTIDETHVVTAFTNNPDSIITSIKLMMAPPVEWESDT
                     LYIGQSAQDLIYPDLPISILLCGDIQPQVDTSLHNIAFINDCDLTTLFNEVNELFYQD
                     LTFTANYSKLLSLNLQNESLQKLIDEASLMVHNPLIVLDTSYKILCSSNTYPIKDVFW
                     SETVKTGYCTYEFILAVNELFATQGGSSTGRQAYPITCPVSPYTKVFCNMFWHHSLIG
                     YIIMLNSNQEVEHSHYQLLPKISENASITLSKLPNFHGIHGSMKETILYQLLNEESMM
                     NIEVRMKTASLKTPPNMRLVTILFDSYSDTTIVSPFIKEQLLALFPSAYITEYEHAIV
                     MLQPLNDPVSFSPLQEEGLTSFFQNAHIKIACSDKFSSFAHVKKQYRLCLDLIRTCSP
                     LISHSEIIYFSQYRFYYLLSQIDNKEILSGVLHPALAILTNYDRENNTELYHTLSMYL
                     EKNCNAKETASALFIHRNSLSYRIEKIIALTNIDLKEDEERFQLSYSYRINRHLNSL"
     CDS             308114..310054
                     /codon_start=1
                     /EC_number="1.3.1.34"
                     /locus_tag="lbkm_0293"
                     /product="2,4-dienoyl-CoA reductase [NADPH]"
                     /protein_id="BBF41613.1"
                     /transl_table=11
                     /translation="MSMKYSKMFQTGRIGRLEIKNRTVMPAMGVNLANPTGEASPEII
                     RYYEERAKGGVGLIITEVTRVDDVTGVGTTNQLAVTKLSQIAWLERLIDTVHKYDTKM
                     FVQLHHPGRQTSSALCNGEQIVAPSEVMCQVTQEMPRALSNEECKEMIGKFVQGAAFA
                     QAAGADGVEIHAAHGYLVNEFLSPHTNKRTDEYGGSYENRMRFLLEIIAGIRAVCGPN
                     FPISVRLSADEFMPDGLTGEDTVQIAKDLEKAGVDAINISTGIYESMATIVEPGSYQE
                     GWKKQYATAVKKAVSIPVIAVNNIKKPETAEQLLEEEVCDFVGLGRSLLADPEFVNKA
                     ASDKENEIRSCIGCLFCFGHLGAGGHIKCAVNPRCGRELEYADYKKDGNGQTVAVIGG
                     GPAGMQAARVLAKRDYNVVLFDEGSKLGGTLNVADKPLLKDKITTLVDHMSAQMNREN
                     IEVRLNTKATVEMVKELNPSAVFLAAGATPIVPPIDGIKGSNVVTAESVLKGEARVTG
                     KVAVIGSGLTGCETAELLASKGHKITLVEMAPKIGGSINPTIFMDLMSRFNKFEPVML
                     PGHQLVKVSEHGVAVKEVTSGEVKEVEADTIVLALGVSPRRTLVEEFKQAFDTVRVIG
                     DASRGGRIVEAVADGFGKAFVL"
     CDS             310219..311169
                     /codon_start=1
                     /locus_tag="lbkm_0294"
                     /product="arginine/ornithine antiporter ArcD"
                     /protein_id="BBF41614.1"
                     /transl_table=11
                     /translation="MKERVSYFDNAKLILICFVVLGHLIEPVYNSTQMNGVVMNFIYL
                     FHMPAFIFISGYFAKAGFEEGWMNKIIKRYLLPYLCLQLLFIAYTKWINVGSYQFDLS
                     IPYYTFWYLFAMAVWSITLKIVTVAKLNIKTILVGSIIIGILVGYLDILPVKFSVTRI
                     VIFFPYYLMGYYFKEHHYQPQDIIKSKYLAVFILAVMILFLWLFDREVDIKWLYCNAQ
                     YDDMHVAGIGAGLDRLLLYVGQMIAMFSIFAIVPTKKTVYTSLGRNTFTIYILHGFLV
                     KLFVAFDYYDHMTLLKYIFLVPLLILMVELLGKKKIPVFN"
     CDS             311237..312172
                     /codon_start=1
                     /locus_tag="lbkm_0295"
                     /product="probable transcriptional regulator"
                     /protein_id="BBF41615.1"
                     /transl_table=11
                     /translation="MKFYFAPMEGVTGYNYRNAHHAYFRGVDKYFTPFIVTNQSIKLR
                     TRELEDIRPDHNEGLTVVPQILSNQAHDFIETAKRIVQLGYDEINLNLGCPSGTVVAK
                     HRGSGFLSQIEELDRFLDEVIRADVAKLSIKTRIGVEDPTEFYKLLEIYNRYPLEELI
                     IHPRIQKQYYKGTPDLEIFGYALGHSKNPICYNGDINTVEDYQKFMAQFPQVDRVMIG
                     RGALANPALFQEIKGEEGLDKETFRQFHSMICEGYEEIMSGDRNVMFKMKELWFYMSR
                     LFPDQEKCYKKIRKVEKLADYKAIVRSLLREDLSQ"
     CDS             312319..312468
                     /codon_start=1
                     /locus_tag="lbkm_0296"
                     /product="hypothetical protein"
                     /protein_id="BBF41616.1"
                     /transl_table=11
                     /translation="MQLVQEFLQKIYYGEVGAEFHKENRKVLESTNYKALSIMYVASG
                     AFALP"
     CDS             312518..312922
                     /codon_start=1
                     /locus_tag="lbkm_0297"
                     /product="sensory box/GGDEF family protein"
                     /protein_id="BBF41617.1"
                     /transl_table=11
                     /translation="MGLDYIFKKNYPEIISIDRMDAVFGVSLSCIFTTHIRNMHLSNL
                     KEKMQFERKSRMDGLTGVYCKMYTENLCAAYIERIEKNTCCAVMIIDIDNFNNINDTY
                     GHQYGDLTLRLFGKMLRESFRKKDIIGRIGGD"
     CDS             312932..313168
                     /codon_start=1
                     /locus_tag="lbkm_0298"
                     /product="hypothetical protein"
                     /protein_id="BBF41618.1"
                     /transl_table=11
                     /translation="MVKDIKSQASAEKKAQDFIKRIQHINNKQEVRYLSCSIGICISN
                     HRINTYEQMVASADRVLYNAKGGGKGRVYCCQVE"
     CDS             313365..314099
                     /codon_start=1
                     /locus_tag="lbkm_0299"
                     /product="transcriptional regulator, DeoR family"
                     /protein_id="BBF41619.1"
                     /transl_table=11
                     /translation="MDHYSIDRSVFTDEEQKKILMALESIQATKQIDVEESLLKLRGL
                     FQKRSSNWVEIDFYGWEQSEEHKALFSLLRDCILSDHAVSFLYTDLEGKETERIVEPV
                     KLIFKGYNWYLYGYCRMRKDYRIFKLVRMQQVKKTEELVEDKTREAMPQQLQKRFNKD
                     DLVEVELLIKGKNEFRVYDEFRAGYIEKTDKGIYVRVKLPNNDWLYGYLIGFGTSMEV
                     LGPDWLRERIKEELMKIVKKYLEPDS"
     CDS             314168..314623
                     /codon_start=1
                     /locus_tag="lbkm_0300"
                     /product="transcriptional regulator, AraC family"
                     /protein_id="BBF41620.1"
                     /transl_table=11
                     /translation="MEYEVVRLEEKKVIGGSTRTSNQDPKMGEKIGMLWQKLYQGGLY
                     PQINNKANEKALGIYTNYESDAAGAYDVVVGCEVSKVDDVPQQSTSIIIPAGSYAKFT
                     VEGNMVTAVQDFWKQLWKMDLDRAFSCDFEEYQNADMEHAIIDIYISLK"
     CDS             complement(314706..315593)
                     /codon_start=1
                     /locus_tag="lbkm_0301"
                     /product="gamma-D-glutamyl-L-diamino acid endopeptidase I"
                     /protein_id="BBF41621.1"
                     /transl_table=11
                     /translation="MKKNEASSFLTLYDKTPFSKHVNETLLSLARTNQSLSCIFQIGT
                     SLQHTPIMAFKIGHGPIKILIHGTHHAREAITTILLLDQIQHLLTIYKKGNSVDSISS
                     PAIFEELSFFFVPLVNPDGADLALSNDTYQAWKANIRGVDLNENYPTAYPSDFLTEKP
                     GPNGYPGTHFFSEPETYALKELTEEERFHGTISYHSSGQEIYWYYNQKELSRDETIAK
                     LIAQVTGYELLTASPPAHGSGYKDWFIESYHCPALTIEVAPYIGDKPVPASYYEHIWK
                     KNKNVPLLFGCAVNNYLLS"
     CDS             315776..319327
                     /codon_start=1
                     /EC_number="1.2.7.-"
                     /locus_tag="lbkm_0302"
                     /product="pyruvate-flavodoxin oxidoreductase"
                     /protein_id="BBF41622.1"
                     /transl_table=11
                     /translation="MSRVKQSMDGNTAAAHVAYAFTDVAAIYPITPSSPMADVVDQWS
                     ALGQENIFGNQVKVVEMQSEAGAAGTVHGSLAAGAITTTFTASQGLLLMIPNMYKIAA
                     EQLPCVFDVSARTVATQSLNIFGDHSDVYACRQTGFAMLAETNPQEVMDLSPVAHLAA
                     IEGKVPFINFFDGFRTSHEIQKIQKWDYADLKEMCNMDAVKAFREHALNPEHPAMRGS
                     HENGDVFFQHREACNTVYNELPAVVEKYMAKVNEKLGTNYDLFNYYGAPDADRVIVAM
                     GSICDVAEEVIDYLTAAGEKVGLVKVRLYRPWVATGLTKVLPKTVKKIAVLDRTKEPG
                     SLGDPLYLDVAATLREAGLNDIVLTGGRYGLGSKDTPPSSVFAVYKELEKEAPKARFT
                     IGIVDDVTNLSLPEVKPAPITSAKGTVECKFWGLGGDGTVGANKNSTKIIGDHTDKFI
                     QAYFQYDSKKTGGVTISHLRFGDQMIRSPYYINQADFVACHNPSYVVKGYKMVQDVKP
                     GGIFMINCQWSDDELDSKLNAAAKKYIADNNIQLYTINAIDKAIEIGMGKRTNTILQS
                     AFFKLANVMPIEEAVDFMKAAAKKSYGKKGDAVVEMNYKAIDAGVDAVHKVEVPASWS
                     NPEADAPAKEITGREETVKMVKNLLEPISLMDGDSLPVSAFSENPDGQFEMGASAYEK
                     RGTAVMVPEWDAEKCIQCNNCAFVCSHATIRPFMLSEDEVKAAPSNIKLADTKPKAGE
                     FKYTMSVSPLDCMGCGECITVCPVPDKAIKMVPQETQEQEQPVFDYLVANVGKKPGVP
                     ADHTVKGSQFNQPLLEFSGSCAGCAETSYARLITQLFGEQMYISNATGCSSIWGGPAA
                     TSPYTVNKDSKMGPAWANSLFEDNAEHGFGMYLGQKTLRDIAIAKLEKIAASDKASDS
                     MKAAIAKFMETKDMTKENTPAVNALVPELEKAAAAGCELSKDVLDKKQYLAKKSVWVF
                     GGDGWAYDIGFGGLDHVLASGENVNVMVFDTEMYSNTGGQASKASNIGEVCQFAAAGK
                     EMGKKSLAEIAMSYGYVYVAQIALGANPAQTVKVLAEAEAYNGPSLIIGYAPCELHGV
                     KGGMNHCQDEMKKAVKAGYWNLFSFNPQLKAEGKNPFTLTSKPGDGTYQEFLNNETRY
                     TRLTRSFPDRAESLFAASEEAAKARYEHLLKLVELYK"
     CDS             complement(319547..319711)
                     /codon_start=1
                     /locus_tag="lbkm_0303"
                     /product="hypothetical protein"
                     /protein_id="BBF41623.1"
                     /transl_table=11
                     /translation="MIFSAEDSEYYDEWLNRDTDIADMSLEEYDYLRTVEEYGYDCKD
                     LDSTYLEKFI"
     CDS             319858..320343
                     /codon_start=1
                     /locus_tag="lbkm_0304"
                     /product="secreted and surface protein containing
                     fasciclin-like repeats"
                     /protein_id="BBF41624.1"
                     /transl_table=11
                     /translation="MKRNKILYWISALALCTIILSTVYVKAQNMTTATPDSNEKDIAS
                     IINTDGRLSTLSSALDTAELVTTLRGDGPFTIFAPTNEAFEKLSTQTLKDLMMPENKT
                     KLVDVLFYHVFPGRVSSDQATKLDGQQITMQNGKQVDIYLRDGELYINEAKVIIKDIP
                     A"
     CDS             320696..322594
                     /codon_start=1
                     /locus_tag="lbkm_0305"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41625.1"
                     /transl_table=11
                     /translation="MDEELQRLEMESLKVFSMVDAFEKNKKDQPETHTTNNENSDNSY
                     TRTQESLDKYVEENEGNKAAFLLDASGKVLISSGDSEKQTELSSEPAVVAVLGGKDKY
                     YAYSLGEGENEVIVTVAEAIKDGNDVKGILVVKLDGKRLNDIMIDFSLTGLPAPIVYC
                     VDENGVLVCNSNTVNVGKTTENEVMKKATENLKSGKLVSEVTMDGYTYEGGEVVLGYT
                     QDSQMNLTLTVAVLKDKLYEDVYSIEKTFIMFGVIIVMIASLLMLWISTEFANQIAFV
                     NSMIKKVSTLDFTIDTESKLRKRMSKGSDEMSEMVHSVDEMIESVKTELERVQQSADN
                     IFENAKQLDEIAETIHAGSEETSAITEQLSAGMEETTASTEAIASDISAFKDNVGSIN
                     GQVTDGAKFTNEIMERAGKLKEDAVDSQNVTRQTFADVKVKSEEAVRRSKAVEKINEL
                     TNAIQDIASQTSLLALNASIEAARVGEEGKGFAVVANEIGNLATQSTETVSNITDIVN
                     EVNIAVLNIVDCLEKSQTFVEEKVINDYAKFISVIDNYNLDAKNINDRMVQIDKNTEE
                     LTEAINNIAETVSAINLTMHEAATGITDIAERNNESVEYTTETKQKVEETIGHTSALK
                     DVVNAFKL"
     CDS             322638..322757
                     /codon_start=1
                     /locus_tag="lbkm_0306"
                     /product="hypothetical protein"
                     /protein_id="BBF41626.1"
                     /transl_table=11
                     /translation="MCRSKKVYQKVVTSIVEIVTYQKDDIKKVIDRKKKYDIL"
     CDS             322793..323767
                     /codon_start=1
                     /EC_number="2.3.1.180"
                     /locus_tag="lbkm_0307"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase,
                     KASIII"
                     /protein_id="BBF41627.1"
                     /transl_table=11
                     /translation="MNNKTKFDRKGENNITMTGQIIASGTYIPEQVISNDDLAKFVDT
                     SDSWIVERTGISNRHCTSEKENVTSMAIKAARKALDKSGIAADEIDLIIVATSSTEQI
                     YPAAACQVQDALAAGNAVCFDLNAACSGFVFAYNTALSYLMTGMARYALIIGAEQMTR
                     LLDFTDRSTCILFGDGAGAVLIKAKEGKMVLPKMHSNGSKGEALTCQVNGKIGMNGQE
                     VFCFAVRQVPRVIEELLLDADLKKEEIDYYLVHQANVRIIEAIAKKLGVSLEKFPMNL
                     KEYGNTSSASIPILLDECFQNGMIKRGMRLVIAGFGAGLSWGATLIEY"
     CDS             323788..324009
                     /codon_start=1
                     /locus_tag="lbkm_0308"
                     /product="acyl carrier protein"
                     /protein_id="BBF41628.1"
                     /transl_table=11
                     /translation="MLEKMKELIVDELGVETDKITEATSFKKDLGADSLDLFQLVMRF
                     EEEFGVEIPSEELENMDTVGDVMAYIEKK"
     CDS             324028..324960
                     /codon_start=1
                     /EC_number="1.3.1.9"
                     /locus_tag="lbkm_0309"
                     /product="enoyl-[acyl-carrier-protein] reductase [FMN]"
                     /protein_id="BBF41629.1"
                     /transl_table=11
                     /translation="MKFKNELQELLGTKYPLIQGGMAWVADYHLASAVSNAGGLGIIA
                     AANAPAEWVRDQIHEMKQRTDQPFGVNIMLLSRYAKEIAQVVAEEKVKVVTTGAGNPE
                     EYMELWKSAGITVIPVVASVALAKRMERCGADAVVAEGCESGGHIGETTTMALVPQVV
                     DAVTIPVIAAGGIADGRGVAAAFMLGAKGVQLGTRFITAKESAVHENYKQRVIKAKDI
                     DTKVTGRTTGHPVRSLRNDMTRKYLKLESEGAPFEELELLTLGGLRKAVVEGDISEGS
                     LMAGQIAGLVKKEASCEEIMKEIVQEAKSLMEGE"
     CDS             324964..325899
                     /codon_start=1
                     /EC_number="2.3.1.39"
                     /locus_tag="lbkm_0310"
                     /product="malonyl CoA-acyl carrier protein transacylase"
                     /protein_id="BBF41630.1"
                     /transl_table=11
                     /translation="MNKIAFIYPGQGAQYSGMGKDFYEQSSVAKAIYDKASERLDFDL
                     LSLCFQKDSRLNQTEYTQPALVATELAITAEVMSLGLLPDVTAGLSLGEYTAIATAGG
                     MDLLDAISLVRKRGIYMEEAVPAGQGSMAAILGLSAEQVENAIEPIEGVSIANYNCPG
                     QIVITGLQQAVQQGIDVLLEAGAKRAIPLIVSGPFHSKYLKVAGDRLEKEFKQVSWKP
                     LTIPYVTNVTAQYVRESSDIAELLVNQVSSSVRWQQSIEKMIDEGVTHFIEIGPGKTL
                     SGFMRKIDRTVSTYHIGTMEEADQVIGELVCRTIR"
     CDS             325881..326621
                     /codon_start=1
                     /EC_number="1.1.1.100"
                     /locus_tag="lbkm_0311"
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="BBF41631.1"
                     /transl_table=11
                     /translation="MSDNKVAIVTGASRGIGRAIAKQLAEDGMKVMINYRGQVKAAQE
                     VKKEIEILGGEAYLYPCDVADQEACDTFIKSVIKDHGRIDILVNNAGITRDGLLMAMK
                     ECDFDAVINTNLKGTFHMMSKASRYMMKQRSGKIINMASVVGISGNAGQANYAASKAG
                     VIGLTKSAAKELASRGITVNAVAPGFIATDMTDELSDKVKENVKKQIPLGSFGSTDDV
                     AGVVAFLASDKANYITGQVICVDGGMVM"
     CDS             326638..327876
                     /codon_start=1
                     /EC_number="2.3.1.179"
                     /locus_tag="lbkm_0312"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase,
                     KASII"
                     /protein_id="BBF41632.1"
                     /transl_table=11
                     /translation="MKRRVVVTGMGAVTPIGNDVTTFFESLKEGRVGIGPITRFDTTD
                     YKAKLAAEVKDFDPKDYMDFKTAKRMERFSQFGVAATKEAIKESGLDLTTEDPYRMGV
                     IVGSGIGGLASMEKEHEKILKKGPRFVNPILIPLMISNMAAGNIAIEFGLKGKCTSVV
                     TACASGTHSIGDAFRAIQYSDLDVCIAGGTESSITPVAVAGFTSLTALSTSTDPHHAS
                     LPFDEERNGFVIGEGAGIVVLEELEHAKARGAKILAEVVGYGATCDAYHITSPAEDGS
                     GAAKAMTLAIEEAGITPNEVDYINAHGTGTHHNDLFETRAIKLAFEDAAKKVKINSTK
                     SMIGHLLGAAGGVEFVACVKSIEEGYLHATVGSKNPGEECDLNYLFEHGVYQDVNYAI
                     SNSLGFGGHNASILVKKYEG"
     CDS             327880..328308
                     /codon_start=1
                     /locus_tag="lbkm_0313"
                     /product="biotin carboxyl carrier protein of acetyl-CoA
                     carboxylase"
                     /protein_id="BBF41633.1"
                     /transl_table=11
                     /translation="MEYEKLLELVKVVSESNLSKFQYQDGDTKVELCAGGTVVAAPAS
                     VVVNTGTTSLTKEQEKAETETGNLVKSPLVGTFYAAASEGVEPFVKTGDVVKKGQTIA
                     IIEAMKLMNDVEAEFDGVVEEVLVKDGQTVEYGQPLFRIV"
     CDS             328321..328743
                     /codon_start=1
                     /EC_number="4.2.1.59"
                     /locus_tag="lbkm_0314"
                     /product="3-hydroxyacyl-[acyl-carrier-protein]
                     dehydratase, FabZ form"
                     /protein_id="BBF41634.1"
                     /transl_table=11
                     /translation="MLGIKEIEQIIPHRHPFLLIDVIEDYEPGVYAVGYKCVTYREDF
                     FRGHFPQEPVMPGVLTVEALAQVGAVAILSKEEFKGKTAYFGGINHCRFKGKVCPGDK
                     LRLETRIIKQKGPVGVGEATASVDGKVVVKAELTFMIG"
     CDS             328759..330105
                     /codon_start=1
                     /EC_number="6.3.4.14"
                     /locus_tag="lbkm_0315"
                     /product="biotin carboxylase of acetyl-CoA carboxylase"
                     /protein_id="BBF41635.1"
                     /transl_table=11
                     /translation="MINKVLIANRGEIAVRIIRACRELGIATVAVYSEADREALHVQL
                     ADEAICIGPAKSSESYLNMESIISATIVSGADAIHPGFGFLSENSKFAKTCEECNITF
                     IGPSSEVIQKLGDKQEARNTMLGAGVNVIPGSEEPIHAVEDGIELARKIGYPVIIKAA
                     LGGGGKGMRVAKREEEFRSAYETAAKEAKMAFGNDTMYMERYIENPRHIEFQILADSY
                     GNVIHLGERDCSIQRNHQKMIEEAPSMAISKELRKRMGDTAVRAAKAAHYVNAGTIEF
                     LLEKDGSFYFMEMNTRIQVEHPVTEMVTGIDLIKEQIKIASGEPLTIKQEDVVLNGHA
                     IECRINAEEPSKNFRPSPGTITDVYLPGGMGVRVDTAIYNDYTIQPYYDSMVAKLIVH
                     GNDRKEAIAKMQSALGEVIIDGVETNIDYLYEIIENKEYQSGNITIQFIEKLRGEM"
     CDS             330120..331790
                     /codon_start=1
                     /EC_number="6.4.1.2"
                     /locus_tag="lbkm_0316"
                     /product="acetyl-coenzyme A carboxyl transferase alpha
                     chain"
                     /protein_id="BBF41636.1"
                     /transl_table=11
                     /translation="MFKKIKKEDSNPTAAVKPEVPEGLMRRCNNCKAAIFTQEVKENH
                     YICPKCHGYFRMHAFKRIEMIIDKGTFEQWDVGLAVENPLGLKGYEGKIRELKEKTGL
                     DEAVITGAARIGGEKTVLCVMDGRFLMASMGHVVGEKITRAIERATVEKLPIIIFTCS
                     GGARMQEGAISLMQMAKTSAALKLHSDAGLIYISVLTDPTTGGVTASFAMLGDIILAE
                     PKALIGFAGPRVIEQTIGQKLPEGFQRSEFLLEHGFIDAIVEREEMKETLHKLLRLHK
                     EGKEVCQCNTENQVTEQRIKELEAWDKVLLSRKMERPVANDYISELFEDFIELHGDRC
                     YFDDPAIIAGIATFCGRSVTVIGQAKGHDTKENVKCNFGMPSPEGYRKALRLMKQAEK
                     FHRPIICLVDTPGAFCGIEAEERGQGQAIANNLYELSTLKVPVLSIVIGEGGSGGALA
                     VALADEVWMLENSVYSVLSPEGYASILWKDSKLASKAAGVMKMTAQDLLEFGIIERII
                     KEPEDLTVETMENVIVQLRNCIYHFMKTRENKDLTTLLEERYERFRKF"
     CDS             331802..332869
                     /codon_start=1
                     /EC_number="1.3.1.9"
                     /locus_tag="lbkm_0317"
                     /product="enoyl-[acyl-carrier-protein] reductase [FMN]"
                     /protein_id="BBF41637.1"
                     /transl_table=11
                     /translation="MKEKTLNIRNYIAKIPLIQGGMGVGVSLGGLAGAVAECGAVGII
                     STAQIGFREKTFRSNPLKANLLAMQKEFEKARSLAREGIIGFNIMVATRNYKEYIKKA
                     VELKAPLIISGAGLPMDLPEYTKGTDTCIAPIVSSAKAAKLILKYWDRKFGETADLVV
                     IEGPMAGGHLGFKYEQLEQLDAITYEQEILKIAEVVREYEKQYERKIPIVFAGGIHDK
                     KQVRHVFSLGLDGVQVASRFVTTKECDASDAYKDAYLHARKEDITIIKSPVGMPGRAV
                     RNEFVKRLEKGETKAVTQCYQCLSHCNPKEIPYCITEALIRAVSGDIKEGLIFCGGYS
                     YMSKKIESVKEVIDSLMNLDV"
     CDS             332914..333357
                     /codon_start=1
                     /locus_tag="lbkm_0318"
                     /product="transcriptional regulator of fatty acid
                     biosynthesis FabT"
                     /protein_id="BBF41638.1"
                     /transl_table=11
                     /translation="MNAYSTINDVLVKLFNEIWDLEEKALITGEFRDITINDMHIIEA
                     IGLGEGNNMSTIAKKLNITVGSLTTSMNSLVKKLYVVRERSETDRRVVNIRLTDKGER
                     AYNHHSNFHHMLTDAVVGSLEEDEIPVLTKTLAGLSDFFRKYEVK"
     CDS             333708..335477
                     /codon_start=1
                     /locus_tag="lbkm_0319"
                     /product="hypothetical protein"
                     /protein_id="BBF41639.1"
                     /transl_table=11
                     /translation="MKKKILALLLCVAMVMSLLSGCSSKDEKTTTNTKSTKTKSGKVK
                     KGSDYGDEITIDVFDSLANYQGIQSGWFAKIVKDKFNMKLNIIAPNVAGGGDTLFQTR
                     SAAGNLGDLIVVGTENGRFKDMVTAGLLEDMTPYLKDSDLVKNYGNGIKSLNAKVEQK
                     GTFAIPSEISSQSATTPSEGLQLTYGPYIRWDLYKAAGYPQVKTLEDVIPVLKQIQTE
                     ARKTDKKAYAMSLFKDWDGNMMCLAKQPTCFYGYDELGFALCRADGSDVQSIIDSNSQ
                     YVRTLKFFYNANKEGLVDPESTTQKYDTLQAKYKKGQILFSFWPWLGASDFNTPAHTK
                     EGKGFELMPIDDMQIISNGCNPEGNQKCVMAMGSQCKDKQRVADFIDWLYSPEGIRCS
                     QAMQTQGSSGPEGLTWEMKDGKPVLTEFGKQALYGETMKVPAKWGGGTWKDGVSALNY
                     KAVNQTDKDPNGITYSYTLWDSVINADETNLTKDWKKQMNAKTDFEYLQKNKKMMVAP
                     GNSYGQPEEESEIATLRGQCKAIIVEYSWKMSFAKSEAEFDSLLKEMQKTVKGLGYDK
                     VFKVDQKNCQELTDARNAAKNAK"
     CDS             335617..338145
                     /codon_start=1
                     /locus_tag="lbkm_0320"
                     /product="ATP-dependent transcriptional regulator,
                     MalT-like, LuxR family"
                     /protein_id="BBF41640.1"
                     /transl_table=11
                     /translation="MIVPLTETYSKWKKYFKDYRYVYLCAMSGYGKTTSAQYFAKNYM
                     KCWYYLSVEEADFIEKLNHILNQKMDGRVSPLIIIDDLQWLSSERWNQFISAIVSDNV
                     VLHKFHFFLLSRAELPPNLKPYQLTGHLLEIDNTSMRFQRPQFEKLLELRGMGRTQKE
                     VEFLEKNAHDYPVAAMIIVNRLKKYSIDELQKSNTLMKEFKFWVIQDIYIYFDQRLFN
                     RWEEDIREFLIEIAGFEVFTVEMADYIRGRNDSETILHKIMKVGSFIKQVGNRIVIMN
                     EDKENAKKLAAVSKADREAILRNEIPAANLEKEYSIFPFFRYYLVNRQVKELSKERWK
                     LLYSRAGYWYEKKRRFLQAMDSYQTAGEKNKVKELIIQNDDLYGGVSGVEKIASYIDQ
                     MEKKDLLDSPEILAVAALLESIRLHKEISEAYLDRLEYLMESMDKDSTLYYKMRTKVI
                     YLKLVFPHRETYNLLGNINKYGEICREYRVHLNNACITANIPSVINGVKDICTWCRHP
                     DEICDCVREPMRYLLGERFTGAVDIGVGENYYYKNQINEAISNVIKGQSASLVKNNLI
                     LTFAANGCLARVFIAEGNIDTAQSIMTDLEKLVHTKKVYSLLANINTFKVRIAMYRDD
                     IPTIHSWLIEDAPNEYGEIFITLSYQYMTKLRAYIRNNELTKAMILIEKIEELCLRCH
                     RSFVWMKVMLLKSLVLYRQHEKWEAVFDTVIKKAASYHFIRVVADEGVCIYELFMLAK
                     KKGRFHSFQDQKFLDELQAELEKMARYYPNYLKYKSKSNLYLSPIEMSVLQKIVEGKS
                     NPIIADELNMTVHGIKYHVTNIYRKMKVRNRAEAIAIAKEKKIV"
     CDS             complement(338474..339052)
                     /codon_start=1
                     /locus_tag="lbkm_0321"
                     /product="transcriptional regulator, TetR family"
                     /protein_id="BBF41641.1"
                     /transl_table=11
                     /translation="MNHSPKYIHRKEELYKQMKAIIMRDGYEHITVRGICKEINISTG
                     TFYHYFPNKGDLASVLFQSMDSYLTEHANTYFTEDAHRNLLLFCTWYASYTVHQGIEA
                     CRLISSEPLCSDEFNHLDEERPIFQLLHQCITDGQNRNQLISTISPDSLTRMILISIR
                     GYSSDWAKHHGNYDLEKELLNFMTLLSRSFVV"
     repeat_region   339125..339357
                     /rpt_type=dispersed
     CDS             complement(339396..341273)
                     /codon_start=1
                     /EC_number="1.3.99.1"
                     /locus_tag="lbkm_0322"
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="BBF41642.1"
                     /transl_table=11
                     /translation="MKQNFIQKTKKQALALGLVALLATTSLTGCSSKDSTKDAAKGNA
                     AISYKAGTYTAKATGMHDLTVTVTVTKDKITDVKIDHQETAGIGAPVAESFPNEIIET
                     QGLGLDVVTGATLTSNAILNGTADALKQAGLSDSDIETLKAKKKDVVKEEDKELTADV
                     VVIGAGGAGMAAAVTANQQGKKVVVIETTTKMGGNTILSGGALNAVDDGSKTAKDNKD
                     SVAKHYEQTYEGGDKEGDTKLVHTLTDNAWSGVEWLKSLGMKFYDQPFTVTGGLWPRA
                     HKPEEPEGTGFFKTYQEYMDKNDGITMLYETTAKSLIKDGDVVTGVECTGKTGNKITV
                     KSNGGVVLATGGFGQNVEMRQEANEINKKWPTLDDSIKSTNTSTIKGDGIKMAEEVGA
                     DLTQMGNIQLLPLGDPETGSLSGNIEHAVESRIFVNLDGKRFVNEAGRRDDMTLGLFE
                     QKDKTMYIVMDSDTYPNGDELNNFGEKMSDLVAAGRAIKADTLEDLAKQMGVSADNLK
                     ASVKEYNRYCKGGDKEGKTDEFGRSLFTDTDGVNNGINTAPYYAAVRVPTVHHTMGGV
                     KINTNTEVLDANNKVIKGLYAAGEVTGGIHGTNRLGGNALTDTVVFGRIAGEKAASFT
                     K"
     CDS             341473..342846
                     /codon_start=1
                     /EC_number="3.4.11.-"
                     /locus_tag="lbkm_0323"
                     /product="probable M18-family aminopeptidase 1"
                     /protein_id="BBF41643.1"
                     /transl_table=11
                     /translation="MERKSAWEMNYDENAVKDLCERYKNYISDCKTERECVTEAVRIA
                     KEHGYKDLDEVIKAGTKLKAGDKVYATNMKKNIVLFCIGKKKLEEGMNILGAHIDSPR
                     LDIKQNPLYEDTDLALLDTHYYGGIKKYQWVALPLALHGVVALKDGSVVEVVIGEKDD
                     DPVIGVSDLLIHLAADQMDKKGSKVVEGEDLNILIGSIPLKGEDKDKVKANIVKILKD
                     TYGFEEEDFLSAELEAVPAGRARDYGIDRSMIMGYGHDDRVCAYTSLEAMLEVENPER
                     TSVCLLVDKEEIGSVGATGMHSRFFENTVAEILDCMGEYSDLKVRRAMQNSKMLSSDV
                     SAAFDPNYAGVNEKKNTAYFGKGIVFNKFTGSRGKGGSNDANAEYVAEIRNIMDKHEV
                     AFQTAELGKVDQGGGGTIAYIMANYNMQVIDSGVAVQNMHAPWEVVSKIDVYAAKKCY
                     HAFLIEA"
     CDS             complement(342896..344596)
                     /codon_start=1
                     /locus_tag="lbkm_0324"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41644.1"
                     /transl_table=11
                     /translation="MKKKLKRKILILISLIIIASSCFMSYTLVWTAKDKNIESFKSTT
                     SDAYKLVNELYEQRYPGDWSITNGKLFKGVQCVTSNNDYVDTLFESTGYQVTLTVGDV
                     RSATSFKDSKTKSHLTGTKIDSKISKIVLGGNTYTGTVENGGVSYMATYHPIVDRNQK
                     VIGIFYVGADESQLDQSIKILVERAIIITIFCCLFAILLASIGARKLVGPIVIINEQL
                     KQMANKKYTVLPKLKKIHYKDELGMITQSTITLCESFGAIMKKFEEESNQINTAMDKA
                     YRSLEELSSDVDNVAATTEEISAGMEESAAGSEQVLSSVNQIESNTQSLSDHMSEGHE
                     RANAIYQRAGSIKQNAVGEQDIAKETIADAKVKVEKAIQESKGIQEIKVLAETITGIA
                     EQTKLLSLNASIEAARAGEAGRGFTVVADQIKALSDQSAEAVSEIHTVVDNTMVSVNN
                     LITSSQDIITFVNENVLSAYELLVKAGDTYEGDSSFMTEFVQNIDSAIGAITTELKDM
                     STAMEGITNAVNESAAGGSSIAEHNSDISTKVSDVLEISRRTKESTKHLEKYINQFEY
                     "
     CDS             complement(344735..345517)
                     /codon_start=1
                     /locus_tag="lbkm_0325"
                     /product="transcriptional regulator, AraC family"
                     /protein_id="BBF41645.1"
                     /transl_table=11
                     /translation="MSNTGISQKFLFESNQYSDFLRQFSPTSIDLDHSIQQSCLMKFK
                     KNDTLYKLVLNGDLDAVTHELDYESSNMLSIYSKNPIDNRRISMTNSLHTIAYLLSMQ
                     GMDQDRICSLLIPYLQLLSSLKTVNELNRLYRYAILSFTRFKKNHNEYLTLNEPTRDC
                     IHYISNHLHEPITLSQLSAISNLSLRQINRNFHAAFQCSPGNYILSERLEASKTLLIT
                     TTQSIVDIASALSFCSESYYIKLFKNYTGISPKQFRQIHKLF"
     CDS             345654..346076
                     /codon_start=1
                     /locus_tag="lbkm_0326"
                     /product="hemerythrin-like protein CA_C0069"
                     /protein_id="BBF41646.1"
                     /transl_table=11
                     /translation="MVDFKFNWQEELEVDFPDINEQHKELFRIGRDMEQLLIRYCIGV
                     QTSELLEIVGDLRNFVSYHFYFEEEIMLAAGYEDFENHKKGHDDFLNKINSIDLPSLA
                     SNPYIGINKIRDDLVDYVFQHMMCDDVKMVDAVIKKAE"
     CDS             complement(346119..347276)
                     /codon_start=1
                     /locus_tag="lbkm_0327"
                     /product="permease"
                     /protein_id="BBF41647.1"
                     /transl_table=11
                     /translation="MNKNNSINTNDMKKTLFYITFTVCLLVGLLNIEVILNLFQYIIR
                     LLGPFILGACIAFVVNIPMRIVENKLQKYCKKNFIGKHSRPISILITFIFIFTLLFVV
                     SVLIVPEIINTLSGIMKAIPDYAEDINNRINHLAKEYPAIRDFINKLDIDWAKAGREA
                     IHFFQNIANGIVLSGIDIIGNIVNGLMKFFIGFIFSVYLLVQKESLKRQGKQVLFAYL
                     KEKHATHFCSFCRLTNRTFSNFISGQCTEALIIGGLFFVVLNLLQFPYALLISVFIAL
                     MSLIPIFGSYISSYTSAFLILMVNPWQALLFLLVFAVVQQFDSMFIYPHIVGGSVGLP
                     SMWVIVAVTLGGSLMGIIGMLIFIPLFSIFYTLLRMNVYHRLKTKNLKISE"
     CDS             347414..348700
                     /codon_start=1
                     /locus_tag="lbkm_0328"
                     /product="hypothetical protein"
                     /protein_id="BBF41648.1"
                     /transl_table=11
                     /translation="MDYRDHNFNRNNRNNLGDQIHNTVQDALDSMNFERLNRDISDSV
                     SRAINEAKRCLNGNDPYQNSGENPYRENGHRNDDRQYQAENGADRNPWNRSFRYGGFR
                     YPPRNNKVRQVAPYTLSSPPGRVSSVLCLVFGYVGAASFGIATFVLALLAGLSIASSV
                     LGTIAGALLPFFVLSVGLIFRGNTLSKRVKRYRQYCSVLGKNTFCDLKEFEQQVGKSH
                     KFVVKDIRMMIHKGMFPQGHLDDKASCFMLNHETYEQYLQTKERFEEHVKEKQEQEEN
                     EKKKEEMSELERTIEEGRRYITEIKLANDKIPGEEISRKLARLEEVIRKIFDCVKEHP
                     EQLPELRKFMDYYLPTTLKLVKAYEDFDSQPIQGENIKKGKEEIGKTLDTINTAFETL
                     LDSLYESTTMEVSSDISVLKTLLAGDGLTKKDFKVK"
     CDS             348721..349866
                     /codon_start=1
                     /locus_tag="lbkm_0329"
                     /product="tellurite resistance protein"
                     /protein_id="BBF41649.1"
                     /transl_table=11
                     /translation="MMEDMKDMIGQAPTLTFEPFADTKEEVAVQQEQQAPVFDESSLT
                     AEEQQMVSDFASQIELTNSNVILQYGAGAQKKIADFSENALNKVKTKDLGEVGDMLSG
                     VVTELKSFDIEEEEKGGFLGFFKKKANKVTALKAKYAKAEVNVTNITKALESHQIQLL
                     KDVAMMDQMYELNKTYFKELNMYIIAGKKKLEQVQTTELPRLQQQAQATGLPEDAQAA
                     NDLAGLCNRFEKKIHDLELTRMISIQMAPQIRLVQGNDTLMSEKIQSTIVNTIPLWKS
                     QMVIALGLNHSIQAAKAQHEVTDMTNALLKKNAENLKLATVETAKESERGIVDIETLK
                     TTNETLISTLDEVMRIQSEGREKRKAAEAELSNIENQLKDKLLQINH"
     CDS             349887..351704
                     /codon_start=1
                     /locus_tag="lbkm_0330"
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="BBF41650.1"
                     /transl_table=11
                     /translation="MNEKHKILKHYFGYDGFREGQEVLIDSILAGKDTVGIMPTGAGK
                     SICYQVPALMMTGITLVISPLISLMQDQVSTLNQAGVHAAYLNSSLSYNQYRLALRYA
                     EEGRYKIIYVAPERLMTEEFQQFAAGADISMISVDEAHCVSQWGQDFRPSYLKIMEFV
                     DCLPNRPIISAFTATATKQVKEDIISILRLQDPTCLTTGFDRSNLFFSVKTPGDKFAE
                     VSRYLMEHGKQSGIIYCQTRKVVEEVHERLLKEGYAVTRYHAGLSDRERKQNQEDFIY
                     DVKPIMVATNAFGMGIDKSNVRFVIHYNMPKDMESYYQEAGRAGRDEEPSECILLYGG
                     QDVVLNQFFIDQNRDNDELDEETLEVIKQRDRERLKKMTFYCITNECLREYMLRYFGE
                     FGDNYCGNCSNCLTQFETEDVTESAKKIIGCVASINERFGMTMVVDILHGSKAAKIKN
                     YGFESNDFYGTLSEVTIPKLRQILNHLVLLNYLHLTEDKYPVLQLTDESQTVLDGDEE
                     IVMKMAKENERPVKKKAKKKSAVLHDVDENLFEQLRELRMSIAKEEHVPPYIIFSDKS
                     LVDMCAKLPKTKEDMLEVSGVGDVKFEKYGQRFLDIINQ"
     CDS             complement(351778..354075)
                     /codon_start=1
                     /locus_tag="lbkm_0331"
                     /product="transglutaminase-like enzymes, putative
                     cysteine proteases"
                     /protein_id="BBF41651.1"
                     /transl_table=11
                     /translation="MTINKLQLKLNINDFFLSIFLSGTIAFYLLTMIAPSYPLMLSLI
                     FVILTTIFWSCIHERIILPAFCIIQTSLFFLCLLFFHSKLIEGMILLWNLAAHTIGTH
                     STLYLPVYQTILPKQQNTVCLSMLLFFFFFTISFISNRVAKQRNVFLYLLLLFPLFVF
                     QLLFHIQLSFLLVVAVIVSIFLLRIAKLLSPSEMNSRFLKQLLLYIQQLFLLALLGLL
                     TFHISGKLSLVSLQQEILSSISNFIYDNTLDPLSEGKLSVIQSQSRSKDSALSITMEH
                     PSSMYLKGFIGSVYEHDHWTDLSYQERYENNNLFYWMKEDGFLPASQLSLIHALEQDR
                     KVSSLSSNTTISIKGANKRYFYLPYELSSIQHPEINESALIQNEGFQAKNLKRISNYT
                     FCASSSLVPNYPDIAAKLQEQEAAPSKKLKQYLSDESYYNIFVYKTYCQIPENTRILL
                     KNHLGDVSIKKHSHFSYSSAVDHVRSYLKEHITYSTKKWVLPAQKDFLAYFLEEKPSG
                     YSVQYATAATLMFRYLGIPARYVEGYLVTPENIKGLSDHSTIDIKKSNAHAWVEIYQD
                     GVGFVPIEVTPPYYHVMEQPKAGKLTQEIQSVRQSQKNQSTQNIYHDDPLNLPHEVKL
                     PDSLIDYLQYLRMLVALILIILLGLFFYLQLKKWHTLRVWKRQFHDSDSNCAAIAMFE
                     YVKILLPQITYHSPSDQALLTAEYQEYYENMYALYEKALYSKHSLSPEELTSMVHFLN
                     ETIVLLIHHSSLFKRIKHRYYDFLY"
     CDS             complement(354086..355159)
                     /codon_start=1
                     /locus_tag="lbkm_0332"
                     /product="hypothetical protein"
                     /protein_id="BBF41652.1"
                     /transl_table=11
                     /translation="MMHILIILLVTSVSFLIFLFLNARMGVFLFLLWIGYMVISLLSL
                     YQIKRQLDSGFEGTNKAHRKEPLHFTLLLCNHSRISAAACKVEIDCKNEINLTTTTIE
                     KCSYLLPKEILQLSLQLTPEWCGVYTLSIRKLILSDFLGFFHITLHPCKHYQFTIYPD
                     LIDIRIQNLDGSRFESDSSYYPDHSQLDPYEVNGIREYQDGDSLKQIHWKLSNKLDRY
                     MVKEYSLPSYQMIQLFIDTTYSTQDHPSLDQIEHFMESAYSLSTLLLHLQDYLTISFY
                     DGKRQQIQTYTIQTEDELSSLLDSLLQQPFLAKEELLESPFLNGFQERFLSLSLHKEQ
                     AIDPNIISISYDEMKHNSFELIL"
     CDS             complement(355171..356103)
                     /codon_start=1
                     /locus_tag="lbkm_0333"
                     /product="MoxR-like ATPases"
                     /protein_id="BBF41653.1"
                     /transl_table=11
                     /translation="MENYKKAISEIQKVIIGKDEIIEKIFLSILSKGHILLDDIPGVG
                     KTTLALAFRKVLGLDYKRIQFTPDVVPSDVIGYTVYHKDTGEFAFQPGAVMCNLLLAD
                     EINRALSRTQAALLEVMEERQITVDGVTHPVPSPFIVFATQNPIGSVGTQLLPQSQLD
                     RFLVCLHMGYPDFQSQVNILRDRQTSNPLDEIQQIMTVEELLSLQASVRQVFVSDSIL
                     EYITHLCEKTRNDERIALGISPRGALALNNIAKANAFYQGRDYVIPEDILTLVNDVFS
                     HRIILSSKARLDHIEIDALLAEILSSIPLPAQKH"
     CDS             complement(356507..357826)
                     /codon_start=1
                     /locus_tag="lbkm_0334"
                     /product="putative surface/cell-adhesion protein"
                     /protein_id="BBF41654.1"
                     /transl_table=11
                     /translation="MGKRMVNPTIRHFITKLLLIMFLFLPYSKIHATSNDIITKTLSG
                     ILNWQKMNYNLSSNDSLLASEFTDASGSSNADWFVFGMARSGVADYYHVYQNALSDGL
                     ITRYANRTELANEKPTEWHRLCLTILALGGDPTSITCSDTKQSINLIKDGVYDRSDLM
                     SLKSQGLNSYIWALITIDSIRYPIPKESNCSRESLIQSILSYQLKDGGFSLSSTGCDV
                     DITAMAIQALSPYYNLEQSFSYIRKCDGKKIDETIRSVIDRSLHILSQSQGKDGDFMS
                     YGESNVESTSQVLVALCSLGIDYKTDSRFIKKGHTILDGILKYKQKDGGFAHCIQRDK
                     HSDVMASGQVFYSLSALLRYKDHLRNLYDLRPSMDAKTTNRIASLTKKIQAITIHSKK
                     DFISILYDEYCKIEPSERCYVHNYFQLSDAMKRNDLPISHPTLLSDF"
     CDS             complement(357808..359931)
                     /codon_start=1
                     /locus_tag="lbkm_0335"
                     /product="hypothetical protein"
                     /protein_id="BBF41655.1"
                     /transl_table=11
                     /translation="MFHKKNWKSLILTLCCILIPLALILSGFCIISHQTKQVIENPIK
                     GINPNRNFVMLSAGERGKLQIFGPSHSSSPQHTNTPNHNIQNSDKHSDKISVSQKKET
                     NSAAPSATFSPTPFTKVPTTKKQQKLASTTNTTALPSSMPSQTPPDKQTNHDLIAPSP
                     VPSIQPSSTPTPYVENKYFTTTIKDYETVSTKQYNFHIIQYKNNLNVKNTEVFVNQTI
                     VKQFHETVLLQEGENTIKIQVTYENPSDGSLFQISKTYHIKVQLDAPVIDTTLVDHTI
                     VKEKELTFQAHAFENGKELALSAVHNDQKLSISKDTYHLSLENGKNLITLSAVSSEGK
                     STSKQYEITYQPSTEKIMISTSLTNQTITTSSLRFTASAALGQDEVPISLTCNDAVLS
                     PLKGHQYEASLKKGKNTIQMTASKGGTSVYKSFTVKYTPIVDDTNPDDESDDSLAPKL
                     ITDLKDHSTVTGNIRTFYIKPVDHNGERIYGDNVTVTCNGSPVKYTWDDSTKTSYKLT
                     LKSGENIVIIVIKDSENRKKTTTFHITCNCKQDGDVIGTATFSIEATTIGLGYLIPPT
                     KVELHQGEKATYVLDQLLKKNNFTYQKNGTSEASFYLSALEKENLVVNPSIPNDLKEH
                     LEKAHISLDLDSYQKNKLGEMDFTPQSGWMYSVNGDYPNYGFADCYLTDGDVIRIRYT
                     LALGRDIGGGSSLGKGDDGNWEKEW"
     CDS             360591..363203
                     /codon_start=1
                     /locus_tag="lbkm_0336"
                     /product="hypothetical protein"
                     /protein_id="BBF41656.1"
                     /transl_table=11
                     /translation="MVYAEEASEVAKEQISLQFQVNPRDAVIDLRDSENNRLLGTNNE
                     FQLNKGDTYTYSIAKYGYLSQTSEITPDDNEVVTIELKNAPVSDLEEVSAEWSDFRNS
                     STNMGITDKLTPTDALSTELKWGVKLGSGWASAVGTPILVDHSLICTQGDKLVKYSLK
                     DGTPVTDSEGNAIEGTMVSSAGFSIMPPTYAQGMIFVALSDGRIQAFNAKTLESLWVY
                     QDPLKGQPNTSIKYSDGYIYTGFWNGEEKKGDYVCIPVTDEKPSETNEVKLATWKFDT
                     IGGFYWAGAYIDGNHLIVGTDDGKSGYTSDTAKLYSIDKTTGNVIDVMDNFLGDIRSD
                     VSYDEETNRVYFTSKGGYLYSVKINEDGTINKDSLQSFELGGMSTSTPVIYHGRAYVG
                     VSGASQFGTDGHCVKVIEVANDGTMKEAYKVPAKGYPQTSALLSTAYEKSDGCVYVYI
                     PYNAMPGGILCLKDKKGQTEADSYEIFTPEGAMKQYCICSVICDNQGTLYYKNDSGYM
                     MAVYQKRSIESLSLNQKELKLHIGDTSELKVSVTPENTNEDTDVKWSSDHTEVATVES
                     GVVKAVGNGSATITAEVSGKTVSCEVEVTTLCERVQLDKNGISLKENEKQQLTAAITP
                     STASNKKLKWTSSNESIAKVSDDGMVTAVTEGTAIIRVVTVDGSEKSAECSVTVTKEA
                     APILPSPSTTPSPSPDTVIQPQPQTTVTPLPTTIPSVSKQLPKKGKTVWVGSLKVKIT
                     KSAKKNGTVAVVSYNKKKSKGKSITIPDQVKINGIMFKVTKIEKKVFLNKKNLANVII
                     GKNVSNIGAQAFKGCSKLKKITIKSNNLTSVGKDALKGISKKAVIKVPSKKLKKYKAL
                     LKKKGISKTVVIKK"
     CDS             complement(363249..364271)
                     /codon_start=1
                     /locus_tag="lbkm_0337"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41657.1"
                     /transl_table=11
                     /translation="MSILVSFAAFYVTKLADRFNKDMESRLLHEKEEQSQLLEKVLSI
                     AATINEQSVEADELVHSLQESSTVVSRAMEEISSGIVNTSDNIQNQTLMTKNIQDAMT
                     NTAKHTNNIVVVAEQSKETLDNSFNMVKELISKSENISKTNHNVVSVMNLLQEETKKV
                     LDIAGVIFNISSETNLLALNASIESARAGEAGRGFAVVAEQIRQLAEETRKSTEDISN
                     IIEGLYKNAINATNVVNESIENVTEQNVLINQVGENFSVVSENINILSRDIQDVDYLV
                     NGLVTSNNQINDSISQLSATSQQITANTEEATSLSAQNLTQAIQVTELLEQVRNSSNE
                     LEQYAN"
     CDS             complement(364870..366048)
                     /codon_start=1
                     /locus_tag="lbkm_0338"
                     /product="proton/glutamate symport protein"
                     /protein_id="BBF41658.1"
                     /transl_table=11
                     /translation="MKKINLGLLPRLILGILAGILIGSTGSLFHSEQNIVFITIVRSF
                     TTFTSLFSTFLNFMIPLLILSFVSVGLAELGKKANKLFGITLLIAYLSTVGAGFLSYL
                     LGSSLLPSLIKPIAKKTIESATFEALFTITVDPVFGVMTALILAFVLGLGMANTNQQN
                     LLNCLRDLQQIIYKVLNKVIIPLIPVHIAGLFCEIAASGKLLSTVKVFFKLFLFILIF
                     QWIYILVQFAIASIFRKENAFCKLKNLVPAYFTALGTQSSASTIPVNLDCAKKNGIKS
                     DIADFVIPLGATIHLAGDTICLVIGSMGIMIANGMEPTLAMFTPFIFMLGVTMVAAPG
                     VPGGGVMAALGLISSLLGFTEPMKQLIISLHFSQDSFGTACNVTGDQAIALLVDQIDN
                     "
     CDS             366212..366889
                     /codon_start=1
                     /locus_tag="lbkm_0339"
                     /product="putative predicted metal-dependent hydrolase"
                     /protein_id="BBF41659.1"
                     /transl_table=11
                     /translation="MTINNIKIHIVRKKIKNMYLTVHREDGSVEVKAPLGISEEQIER
                     FVRSKMDWIMKHQEKFKNLEIVSTLQFEDGAKIPFLGSWYPLKIADHRWKDAVRLEDD
                     ILYVYMKDGYRKEYCQAIVEMWYREQLFAVMPALFAKWEQIMGVHAKEVRVRKMKTRW
                     GTCNVRDHRIWMSLELAKKPIDCIEYIVVHELAHLIEPSHNKVFHGLMDRYMPDWKLR
                     KQKLNEV"
     CDS             complement(366950..367846)
                     /codon_start=1
                     /locus_tag="lbkm_0340"
                     /product="hypothetical protein"
                     /protein_id="BBF41660.1"
                     /transl_table=11
                     /translation="MNLSILAGPILGAAIGYCTNYIAVKMMFRPLKPVYIGKHKLPYT
                     PGIIPKGKGRLAKAIGSAVGTNLLTTESLVEHLSSNDIRESLKDQIHQTVIDLENNDT
                     SLKELTIEFISESQYETSLSTMKETITDKITNKVTEMNVGDIIAKQVVEAISDKVKGT
                     LLAMMVNDSLLNSILDPIASAVNTYIEEHGQEMIEPGVSSECDAFMAQSVGDITKKVT
                     ATSISINDIVLKIYDSFVSTKLESILNKLDIAAIVEKKIDDMDVLELEALVLSVMKKE
                     LNAIVNLGALIGFILGLINLLF"
     CDS             367977..370061
                     /codon_start=1
                     /locus_tag="lbkm_0341"
                     /product="penicillin-binding protein 3"
                     /protein_id="BBF41661.1"
                     /transl_table=11
                     /translation="MKKRWIILIIVLLLILSGGTFFYFKWHENKNIKKPDELLQTYMK
                     HIEKQDYSSMYDMLDQSSKLNYTKEKFITRNQKIYEGIGATTVKIRIDSTQDVSDGSK
                     VVAYHTTLTTYAGEMNFDNEATFVKEDKEYRLEWDDNLIYPKLGKNDKIRITNVEAKR
                     GSIYDCNGVMLAGEGIASSVGLVPGNMSKDPSLDIEQLAKLLNVSKESIEKKLSASWV
                     KKDSFVPIKTIPKLEGSELTVDKISDETKEKKKLQDGLLTIKGLKIIDVKTRVYPFAE
                     KMAHLIGYVQNITKEELDKDKEHIYDSNSQIGKVGLESLYEDRLRGTRGVEIDLVNSD
                     GTTKEVLAAVLAEDGADIHLTIDSDIQSKVYAQYKKDKSATVVMNPKTGAILALVSTP
                     SYDDNEFIRGISSESWKKLSEDEDKPMYNRFRATFVPGSSIKPIIGAIGLTTSKFSAT
                     ESFGKSAKSWTKDKSWGGYKVTTLHTYDNMILKNALIYSDNIYFAKAALKIGSSSFMK
                     ELEKIGFKESYPFDIKLTASTYASGDNKIKSSIQLADSGYGQGQMLVNPVHMASIYSA
                     FVNEGSMITPFIEAKSESSFYKENVFSKDAVNEIVRDLIQVIEDKHGTAHSGKLKGVT
                     LAAKTGTSEIKASKGDKNGTELGWYAVFTPKADVKDSLLMVSMVEDVKDRGGSAYVVG
                     KAKKILEKVGVK"
     CDS             371173..372618
                     /codon_start=1
                     /locus_tag="lbkm_0342"
                     /product="ATP-dependent RNA helicase YxiN"
                     /protein_id="BBF41662.1"
                     /transl_table=11
                     /translation="MDMNRFTEFGLSEDIIEALSLLGYLMPTEIQGAVIPRALCGQDI
                     IGKSKTGSGKTAAFAIPVCEAVVWEDNLPQAIVLEPTRELAYQVKDEIFNIGRMKRIN
                     VPVVFGGFSFEKQANTLKQKSHIVVGTPGRVLEHCQMGTLKCEQVKYIIIDEADLMLD
                     MGFIDEVKQIFAFMPERKVTLLFSATMSDSLYSLADEFMNKPLEIKLESDTETVDRIV
                     QEGYFVEEEDKFDLFLKVLYKENPKSGIIFCGTREMAEVLYYKLKKEQIMCGVLHGLI
                     DQRQRIRTIEKFRSKGFRYLIATDVAARGVDFEKITHVFNYDLPTSKETYVHRIGRTG
                     RNQSDGKAISLIKQDEIKMYRAIEQFTQAPIKICSSPKDEETSENKIHFEETQHVKQR
                     RQKKKGDVFKNQIMKLSIGGGRKSKLRAGDVVGTIAGIDGINANEDIGVIEIRDSMTY
                     VEILNGKGNRVLEELPKRTMKGKYRKVNRVR"
     CDS             complement(372672..374588)
                     /codon_start=1
                     /locus_tag="lbkm_0343"
                     /product="similar to carbon monoxide dehydrogenase CooS
                     subunit"
                     /protein_id="BBF41663.1"
                     /transl_table=11
                     /translation="MSEELKEKLKDRWSYHDSVEEMLKRIETDGLSSVFSRWGPQEKI
                     RCKFCLEGLSCQLCSQGPCRISEKAGATKGVCGIDADAMAMRNFFMKNIMGAGTYAHH
                     CYEAIRSLRATGEGTSPFKIKDEEKLKWMCEKVGIDTNQDINQLAIQLADLLDKDMKS
                     GPEQPSVMTEAFAPRKRIPIWHEHNIYPSGVDHEIQNSIASCLTNVDGDYVSLARKAL
                     RLGLSTIYTAQIGLEMIQDILFGTPMPHEVNVDLGIMDPDYVNIVFNGHQPFVGAITI
                     EKLRNGEYKEEAKAAGAKGIRVVGSIETGQELLQRFEVDDIFVGLMGNWLSIEPLLAT
                     GTVDVIAMDENCSPPAIDQYAEKYQLALASISTIIGVPGTANRLAYHPQEAADMADNL
                     IKIGIENFKKRNGKIEPMVPNYVTKAIAGFSTEAVLGALGNKLDPLVDVIASGKLKGI
                     VALANCSTLRNGPQDWNTVNIAKALIERDILVVAGGCGNHGLEVAGLANLEAIDKYAG
                     EGLKEVCHMLNIPPMLSFGTCTDTGRISMLVTALADHLDVDIPDLPIAVTAPEWMEQK
                     ATIDGIFAVAYGAYTHLSPTPFITGAPNLVKLLTEDVEGMTGGKVALGDDPVEAAKAI
                     EAHIISKRKKLGLQ"
     CDS             374741..375601
                     /codon_start=1
                     /locus_tag="lbkm_0344"
                     /product="acetyltransferase, GNAT family"
                     /protein_id="BBF41664.1"
                     /transl_table=11
                     /translation="MRIREYRDSDKERMMQLLMMGLTVINEEDQEFLFCKENKILVFD
                     LENVGVVGFCSFGRWGKQKENGKLFLYVGQEYRRRKIGTALHQAIMAYAKPFQLNVIE
                     TVFRIDQNDATEYFSKLGYRKWYGLHVMSYHGGMQPRSNMEIVPYEDRFYESYVEEIR
                     KSFYEMRQVNDFKPYNCVEFSEKQRKELIQDKEHLYVLLVDGKFAASAAVHTELTDVC
                     GPIFVASAYQGKGYGKIITQFVMNEALHRGMKSITLEVVEWNERAVNLYKSLGFEIIQ
                     TTNSFRLFLK"
     CDS             376249..381195
                     /codon_start=1
                     /locus_tag="lbkm_0345"
                     /product="hypothetical protein"
                     /protein_id="BBF41665.1"
                     /transl_table=11
                     /translation="MKRSKVNRFLAVLLSFIMLFMTLIGDDRFSMTASADESEPEKVV
                     ETEGITTGQYVIYNPEYKMALSSTKSTGNSNYNAGVSMSLNESGSFDSVERTEVWTVT
                     KSDTGYTIADQDGKKLSMDVSYSSTPFDKENDKWELSDVGNGMYNVKNIGRTSYLEWY
                     SSKNYYSAYTKIASGSEGMFAMQFVPVKEEAIATAKPDATATPAVSEKLEDGRYFIYS
                     DKATGVMAYSIIGGCASYISATPDKDTKKVSFSEGDGKGAAVYTFKKQEDGSYLIQCG
                     SKFLAANSSEELYLADEKIDSETACTYWNVENNSELGGYTIASKTVTYNKNKVYMEYY
                     SSKGFCLYTAKSLSAIYSFHFYDATDVKDDDGYVGTKPASAALPDVGSKYVIYCGTGS
                     GVMGAEVAGVDGAESSMGLVAASLDKEGKLSVQNGGLIFTVGKTSDGYYTFENNGKYL
                     ASNNEEELFVQKDCDEYAEWSLINASTGFLMKNKKAAWSSSSGSKYPVYVEYFSGGFA
                     GYSFKATTADIFTMNFFPYEDTYETGYVVNPKVLFSTSADANLGVDYEMEFTLDDLGK
                     IQKTDVNVSFEDSTQKNYKATMDGYSGKVTIPAEDLKGHTSMKIKVDVESNETDTNKA
                     AYSGEKTVPINDEPMILKVSPAANAQTGSNVRPEISVKYANIGTKAEVKMTINEEVVI
                     PVQKESEHLYCYTSTADMTKGKQVINVTITREDGKKVTKKWAFTIGSEGVQPYFGQIH
                     SHTAEYSDGSGTLEDAYDYAMNKAADTDYMIVTDHSNYFDTTSSATTDSIYDDGASSI
                     LASKTVDDNGKTLNLWQEAKQTASHYNSLSSKFVAAYGYEMTWSGGPGHINVFNSKGI
                     VSRNNNTLNNKTNNAGMFTFYDLLVDANGKGVTSSGQGAISAQFNHPGTTFGYFDSFT
                     GWTKERDDVMNLIEVGNGDGAIGSTAYFPSYEYYDMCLSAGWHVAPTNGQDNHKGSWG
                     DANTARTVMLANSFNEDGLYEAMGDRHVYSTEDQNLSILYYLDDTLQGGIIDGYDKDK
                     VKVSVSLADKDSEKLGHVYVIGENGKVLYTSDTLDSNTADLDITLDNTSAYYYVKVIE
                     KDGDIAVTAPVWVDDVNSGKANVKASLHNASEDTDSKPVVGKEEALTTILTNHEDSNI
                     VLNGYSITIDGKSVASESDLSNEIAANGTRNYTYNWKPESNGTHEVVASFVVTVNGEA
                     QTITATKSIYVAGKDYETVSSIAAAKAGSENQEFTVEGIVTTNSSGYDKNTAFFDCIY
                     IQDGTAGINIFPVSGNFKIGQKVRAHGAVTYYNGEIELNLSEKYGGYIEVIDSTVNER
                     KPTAVTCKEAMADHNIGNLMQVTGTVKKTHETSGVIDRIYVEDGSGEAACIYINGYIL
                     NSIKNDTNFGKDGTKIQSGDYITVTGIGSIDVDELGEVDYLHRLRVRDRAEVMITEKP
                     VIPTITPTTPSTTPSTTPPTTALTGTPTPAPTPTMAPTVTPSVTPPQVTQKTARVSVK
                     KKSVSVAPNGKVTVSYQASGKVKVKASKNLTASVNSSKKKITIKAKSSAVMGTKGTVK
                     LQCGKKTATVKVTILKTANVKKGKTSNYVVAHSKVNAKTKKKAVKLSYNKKIAKVTIQ
                     KTAAKTIRFKVIGLKKGTTTITCSVNNKKVKVKIMVKK"
     CDS             381224..382390
                     /codon_start=1
                     /locus_tag="lbkm_0346"
                     /product="integral membrane protein"
                     /protein_id="BBF41666.1"
                     /transl_table=11
                     /translation="MNQIKENKLTIGILLVCFLVFGFLLTYANSDPARDSGSTRESYT
                     TYETAKVSKIISQKLEQSDLYEGSYTGSQSLMIEIKSGTYKGSTMSATNYLGALYGTK
                     LKKGNSIVVAIYVAKGKVDNITVYEYDRSLSILVILGLFIIVTVIVGGRKGAQSLLGL
                     VFSIVSLIWILIPLLMKGYPTVLTTFAICLYVAMVSYLLLGGITKKTICAMTGTASGL
                     VLAILFGLAAQSVVKVNGMRMGDYLDALLQIKQGGTPLELKGLLIGGMIVASLGAIMD
                     VAMSISSAMQELITVNPELQKHEMWRSGMNIGRDMIGTMTNTLILAFVGSSFVMVIYI
                     WTLKLPLYELLSSNLVATELVHSIASSIGVILSVPLTVLISTFIYCQGKKVKSA"
     CDS             complement(382353..382994)
                     /codon_start=1
                     /locus_tag="lbkm_0347"
                     /product="ThiJ/PfpI family"
                     /protein_id="BBF41667.1"
                     /transl_table=11
                     /translation="MYTIYVYVLDTLADWEIGYVTSELNSGRFFKKEAPLVSLKTVSY
                     SKELVHTMGGLAIVPDCLIADIVLDRTSILLLPGADTWNDPRHGAILEKASEFLSFGA
                     TVCAICGATAALANLGLLDHRPHTSNGPGFLEMFSPKYKGQSFYIDSPSVADNNLITA
                     SPTGSLLWAKQIIKHLGVFQLDTLESWYQYFSTGDPNYFYALMQTLPSYPDNK"
     CDS             383117..384049
                     /codon_start=1
                     /locus_tag="lbkm_0348"
                     /product="transcriptional regulator, DeoR family"
                     /protein_id="BBF41668.1"
                     /transl_table=11
                     /translation="MKVDRLVSIIMILLDKKRIGAQELADMFEVSSRTIYRDIDAINM
                     AGIPVRSTSGVGGGFEIMPNYKIDQKVFSTTDLATILMGLSNLSNMIRGDELINALAK
                     VKSFIPADRAKDIELKANQIYIDLSPWMSNRNIEPYLKIIKTAVQESRLLSIEYTDHH
                     GNKTVRTVEPYQLVLKSSHWYLQGYCYIRNDFRLFRISRISNLQVKEETFIPRDYQKP
                     QFDFGDIVETMLTNIKIRFHKSVMDRVLDYCSFEQFIPDGGEHYMVSFPFIENDYYYN
                     ILLSFGDKCECLEPLHVRAEMKRRIHEIASLYEN"
     CDS             384275..384391
                     /codon_start=1
                     /locus_tag="lbkm_0349"
                     /product="hypothetical protein"
                     /protein_id="BBF41669.1"
                     /transl_table=11
                     /translation="MLDHIIDLDDWMSEIRNKLRAAQEIKRNQALRLHRWNA"
     CDS             complement(384561..385727)
                     /codon_start=1
                     /locus_tag="lbkm_0350"
                     /product="hypothetical protein"
                     /protein_id="BBF41670.1"
                     /transl_table=11
                     /translation="MKKIEEFWYCVACQEDLPLYKGHELDSKISDNLITCIHFYRKRK
                     ISGAPIELILSNLLLEYPSMISDIRLLLGISDKRLYLDLTYLNSRAKLGNGRALGDGR
                     EYVIKHDTKFFTGKLKTDVNREAYASLIAGYFIDKGIEVILNTFASLDDAVIKQLFNN
                     LIAPKEIQQKQAKYRGHGAEMTFANVFADCNMKFIPDDKHIDPMASMDPNVDLETMEL
                     VGREVKKQSVHSFDLVVLDEDKNVRILVQSLIHSSDPGQYGVNKSDETVLIKQAITDY
                     NQDHPDKPVYLLGSVDGVGFCENPNGTIVKMLDAFDDFFQMHTLFKIPLFLQRTGFID
                     NINGVHLHDNFFETYARDHMNKAYIIPSHARLLDEEELTQTKHKTIGQAEVGFE"
     CDS             385833..388529
                     /codon_start=1
                     /locus_tag="lbkm_0351"
                     /product="hypothetical protein"
                     /protein_id="BBF41671.1"
                     /transl_table=11
                     /translation="MINLAQISLDLKDKNKSLTKQSIAVTHDFYWKLKKDEESLKDVL
                     TAWKEDFGFIYGDIKNNLSSNNKIKPEELAAYYQIEDESLDVLYLFFSIQTYFSVLVK
                     LLTFHMLASIHGEAGVFQKSNLTLRSLTKLLEGKSYQEYGVTNFASIDWYCWILETKD
                     KKLIKKIDQLKNEICSYDSIMELEEFTQIHNYDYIKQIYETVIPKQLRHALGEYYTPD
                     WLADYTIEHIAEFAKQQKEEMRYLDPTCGSGTFLFKSIKQIQKKGEWKIPQITANVMG
                     YDINPLAVLTAKANYLICLLSQMKDQKKLSIPVYRYDSLNVPEIQDDVILIDLNGTME
                     YAIPIAFMKETRFQKLYQQMLLAKARGNFYPLKKQYKKYGKHVLSQLRQFFDALGDNE
                     FVVKERLAAIRDRINGFFEKKVDIIVGNPPWVNWEYLPEVYRQKSKHLWKDYGIFSAS
                     GRDLSFSKEDISVLVTYAVLERNLKEGGYLAFVIRQAMFKSAQNGIGFRKFIINKEDG
                     NTSMKVLRVDDLSKIRPFENATNSSAILYLKRDEETTYPVPYYVWKKDSLERKGLNAY
                     ASLKEILSIMSIEEMVAMPVNESDPTSLWITAKLEALKAVKQVLGSNSYRARTGVFTG
                     GANAVYQLNILKEQEDGMILVQNQVGKAKRKVKEITKTIEKALVYPLVQGSDLKKWKV
                     SSKVNLLCPHTKVTKMKPIDHETMQEKYPLTLDYLEEFHNELDERKGFAGWEKEMQKE
                     FFYAILRIGEYTFSKYKVAWRYIASEFITAVIDETDDEILGRKMYLPNEKIMYVSTDD
                     EREAYYLCGVLSSTPIAFCVKSYMNPTSISAHVLDKLQIPDYDPDNKLHQEIATACKR
                     GHETSDHKEIEQLQEVIDTKVAKLYQFSELEMTTMRDSLRTC"
     CDS             388578..389657
                     /codon_start=1
                     /locus_tag="lbkm_0352"
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="BBF41672.1"
                     /transl_table=11
                     /translation="MITISLCMIVKNEEDNLGNCLESVKEAVDEIIIVDTGSTDRTKE
                     IASRYTDKIFDFTWIDDFSAARNESFRHATMDYLLWLDADDIIKKEDLDKLIALKKEF
                     PTEYECVMFDYDYAFNEMGKPILTFKRERLVKREANFLWEGFIHEVIDCHGKCLNANI
                     TVTHNKKHGNGMRNYNIYRKHIDAGETLNVRDQYYYAKELWGQEKFDEALKAYLDLID
                     SEEGWYENRIDAINQSADILIGEKEYRQARNLLWRAFEITTPRAEALFRLAFTFEQEN
                     RIPEAIYWFTQILTLQKPKTAGFIFDEYWNWRPYLELCVCYDRMGQKKLAYEFNKKAA
                     SYMPDHPSIVHNNQYFEEYFKKEKE"
     CDS             389763..390710
                     /codon_start=1
                     /locus_tag="lbkm_0353"
                     /product="hypothetical protein"
                     /protein_id="BBF41673.1"
                     /transl_table=11
                     /translation="MSEDKRFAVLIDSENVASKYIKYILDEVSTYGVATYKRIYGDWT
                     RGNSSWKQVLLKNSITPMQQYNYTTGKNATDSAMIIDAMDILYSGNVDGFCIVSSDSD
                     FTRLAVRLRESGMQVVGMGETKTPESFRAACNIFKFLDKVTLTEVKEVIPKVDKQHKR
                     EVTKIDEIESYILKVVNDRLSIGKEISIAELGNLLQKRYSDFDVHNYNFNKLSDFLKS
                     FSKFRIIHKNNVYCITLAAMAKMGQPSDQIVSAIHRMISEQKEKEIDLSILKQRLIRE
                     DKRYGHEMGQVKMFTKFLKKVPDIKVVRKENNHNVATFV"
     CDS             complement(390758..391213)
                     /codon_start=1
                     /locus_tag="lbkm_0354"
                     /product="hypothetical protein"
                     /protein_id="BBF41674.1"
                     /transl_table=11
                     /translation="MLLKGIVFVLFCLILGKQIAFIKRLVVATKKSMLDNVSIFFGIL
                     ILLWLTYQYANTILDYSFAVLGISALLTMIYKQGIAMDGLILLSRGHEFYPWSEIGSV
                     KIEEADDIKVIYYSTIGSPIIKQRYAKKNKDKLFDILEKNSLYKEPDPK"
     CDS             complement(391240..391740)
                     /codon_start=1
                     /locus_tag="lbkm_0355"
                     /product="hypothetical protein"
                     /protein_id="BBF41675.1"
                     /transl_table=11
                     /translation="MNIKTERLLITDLSLDMAADIQRNSVDEDNKKFVPDEVFETVEQ
                     TKEVVQWLLDSYHSPTGPFLYPILTNNQENIGYVQVCTIDEGWEIGYHIAKEYTGKGY
                     ATEAVKAFLPVILPQLHIHKIYGIVLEENIASHKVLEHCGFRLDYKGIALYQGENRSL
                     RKYIFE"
     CDS             391924..392829
                     /codon_start=1
                     /locus_tag="lbkm_0356"
                     /product="radical SAM domain protein"
                     /protein_id="BBF41676.1"
                     /transl_table=11
                     /translation="MKNEQLYESCTLCPRRCKVNRLAGGRGYCRETSELVVARAALHM
                     WEEPCISGEEGSGAVFFSGCAMGCVFCQNHNIAEGKAGKKITVERLAEIFLELQEKKA
                     NNINLVTPSHYVVSIIEVIDLAREKGLKIPIVYNCSGFELPETLRLLEGYVDIYLPDF
                     KYRKEEVAKRYANAPRYADYAKEALKEMFRQVGTPEFDDRGMMKKGMIVRHLILPEHT
                     EDSKEIVKYLYDTYGDSIYISIMNQYTPLTHVAAYEELNRPLTDEEYDEVVDYAIDLG
                     VENGFIQEGETAKDSFIPEFNNEGV"
     CDS             392848..394545
                     /codon_start=1
                     /locus_tag="lbkm_0357"
                     /product="RNA methyltransferase, TrmA family"
                     /protein_id="BBF41677.1"
                     /transl_table=11
                     /translation="MRQEQYKSNKDNKNNKKKAYQPKWNDVKASDYKRGSENRKDEKR
                     NDGKRNDERRRDERRRDESRKGDRRKDDRNKDDRRFSSKRRPEKSKKVLADGACPFSD
                     RCGGCHYQEVSYKEQLQIKQNQLKELLGEYGKLEPIIGMENPTHYRNKIHSTFHRKKD
                     GTIISGVYEEGSHHLVAVENCMIEDKRADSIIKDIRDLLKSFKILIYNEDSGYGLFRH
                     VLIRTGYHSGEIMVVLVMASPIFPGKNNFVKALRKLHPEITTIVMNINDKNTSMILGD
                     RQTTLYGKGYIEDTLCGKKFRISPKSFYQVNPVQTEILYQKAIDFAFLRGNEVVLDAY
                     CGIGTIGLIASDYAKQVISVELNKDAVRDAISNAKLNGVKNTRFYNNDAGKFMLGMAE
                     TNEKVDVVFMDPPRAGSDENFLSSVVKLAPKKVVYISCNPHTLARDLEYLTFNGYEVE
                     KMQGVDMFPYTSHVETVVLLSQLKADHHIEVDLNLDELDATSAETKATYNEIQQYVLK
                     ETGLMVSNLYIAQVKKKCGIEVGESFNKPKSENAKQPKCPTEKEKAIRDALVHFGMI"
     CDS             394818..395495
                     /codon_start=1
                     /locus_tag="lbkm_0358"
                     /product="transcriptional regulator"
                     /protein_id="BBF41678.1"
                     /transl_table=11
                     /translation="MKLGKNIQYLRMLHNNITQEELANQLGVSRQTVSKWELNQGNPE
                     LSKIQEICTLFNCTADELLFGNINIQNSAYSEIKIETLEAFEYIKYTVISSEPEDDAI
                     YKIKQIAKNLGIETPKIIGWDFSHLSQEQINVYHMHGYTAALVIQHELILNKSSIPLE
                     MVEKQNYVTITIKNPMDNPFGLISNAYKAVFQYITVNRYKYNHFAFEQQFYKEGIEYM
                     KICVAIQ"
     CDS             395517..395990
                     /codon_start=1
                     /locus_tag="lbkm_0359"
                     /product="hypothetical protein"
                     /protein_id="BBF41679.1"
                     /transl_table=11
                     /translation="MNKYEEGLKILNDKFGNGKDNVISLATIAIEHSEDGNPKPCVRD
                     VDAIYENGVFYIVTYAKTNKVKQIEANGEVSIAVHFEDFFSSGIGRNLGWVLQPRNAE
                     IRNRLRSAFKDWYDFANNEKDEDCCIIAIYMKKGTLRINHGEMFYYFDFENKIAK"
     CDS             396011..396616
                     /codon_start=1
                     /locus_tag="lbkm_0360"
                     /product="hypothetical protein"
                     /protein_id="BBF41680.1"
                     /transl_table=11
                     /translation="MQIGDKISFGNYTWIVLDIQIDRALIITEYIIEQRSYHDAYVET
                     TWADCALRKYLNGDFYDAFDEKNQLRICSTINQNTDNQWYGINGGDDTRDNIFLLSME
                     EIVCKYFGDSSEKLYNPGKKQRYWFERKDLNNSKRIARLLWNKEQVWWWWTRSPGRVG
                     VKAVYIHGDGNIGIQGNNILKGNIADGCCTGGVRPALWIRI"
     CDS             397116..397466
                     /codon_start=1
                     /locus_tag="lbkm_0361"
                     /product="hypothetical protein"
                     /protein_id="BBF41681.1"
                     /transl_table=11
                     /translation="MGIKTDKTEDIHFRVTPEEKLQMQTKAEKAGLSLSEYLIRQGLS
                     RKVTVVPPELFAEYRSMCAEFGRLGNNMNQIARHLNSGGSDSTVIRWFENNCRELDDI
                     VMKLKMMYEKKLAA"
     CDS             397505..398809
                     /codon_start=1
                     /locus_tag="lbkm_0362"
                     /product="Rlx-like protein"
                     /protein_id="BBF41682.1"
                     /transl_table=11
                     /translation="MAILKHIASKNKIYSGAEQYLCFEHDAKTGKPLLDEQGRMIPRE
                     GILKASINCEFETFAAECMEINHQFHKNRGRSDIKSHDYIISFDPKDDITAEEAMEMA
                     KRFADRFLEGHQTIIVVHPDGHNGSGNIHAHIVANSVRKHQAVRQEWHEKACEYKQGC
                     KHKCTNAMLRAGKQWVMDECRSRGLNQVDLFSSKVREDYWVQKRGTGKVADFVSDKEF
                     LRSFIDMEIETVSSLDELGKKLDDIFGIEVRITNKTISFKEPNRKQAIRGKRLGDDYD
                     KRRIEERIKEAIQRKGQHKQEMMEKYSGVITDKQQEQTKPQEQNAVSQLANAIKEMNK
                     ALGSLNDKMDATALRAENLVDSYITEDYPVAAIEAEQEAEEELRLYPRPKELSEAMKE
                     FSASNPGMERDDFLEQFNIWYDEHWRLYEEQTVQRDIKTKSR"
     CDS             complement(398851..401241)
                     /codon_start=1
                     /locus_tag="lbkm_0363"
                     /product="hypothetical protein"
                     /protein_id="BBF41683.1"
                     /transl_table=11
                     /translation="MNLCSCYNSVIYSLRMLTDRYMVRKDTMIRLDFHSVSTILMDNQ
                     KNTDISQIDFMYQLFAAFMNDESTNFDFDNGLVCHWLKGEVRVSPKIINYYIPKAHHQ
                     LMYNDMINEVFPFISDPASVTLAIKELLIADVSISETERERLLGFLSADTSECYAAFI
                     AETLIFGMSRCFVNAGNGAKNSSPLIDDIILTTNLPTPARTFVAREAELTDIEELLSA
                     NPLVFLTGIPGIGKSEVAKAYMKAQKKYYTNILYLEYIGSFYEMIADLDFVDDTDRLS
                     EKERFRKHFRFLKTLKADTLIVIDNFNTTATEESLLNQISSLKCTILITTRNNFALGT
                     EYAIESSKELALQVLQQNVKTSALDIIHTYSNEIELLLETINYHIMSAGLIGRLLSYK
                     NMLPADLAKHLHDNVLLPDNQNKLSISKDNVTVKSEYQNIMQDLLQYGALAPALQQTL
                     SIIALAPETGFPLRYLSKWHHDCTNEVDELEELGLLELNHHSATLNPYIRKLVNAGKH
                     LAISSCNELWKNLLAECQDVDSGTATLALQIIDTALRFALKDDKQLWLSVIRTSLESN
                     HCLHRYRSYSNLLNEYEYLCLDHSICATDDQYLLFHFKAIEVAEIHTNVNKAIQFEEK
                     AIAIAGKNGTSQVLNFSTLYLDIGRYYHIQGNLGKALDYTKKSTGILQETQMQYSPNG
                     IASLVQYARYLFENRQINETIRIYQNCLDIINVCFGDTSLTYGYIAQNLAAILASVNK
                     SKAALIYYDKAIIALENLLGSEHEDVMLCKEQMHKLLATTTPVLLSAPALPMKITA"
     CDS             401362..401556
                     /codon_start=1
                     /locus_tag="lbkm_0364"
                     /product="hypothetical protein"
                     /protein_id="BBF41684.1"
                     /transl_table=11
                     /translation="MNADFVRCCDFLARMIEKYGASVMQEYYAGLRIKLDKWKPDTRA
                     SEDRIFSYAEKLGDYQEKAA"
     CDS             401718..401939
                     /codon_start=1
                     /locus_tag="lbkm_0365"
                     /product="hypothetical protein"
                     /protein_id="BBF41685.1"
                     /transl_table=11
                     /translation="MEEEKDLKDKLIELRKSTGMNRRQFCEYFEIPYMTVSDWEHGNR
                     RVPAYLFRLLEYYVRMEQMKKEDDFSEEK"
     CDS             401926..402780
                     /codon_start=1
                     /locus_tag="lbkm_0366"
                     /product="hypothetical protein"
                     /protein_id="BBF41686.1"
                     /transl_table=11
                     /translation="MKKNNVITVQNTPITVALSDESDYICITDMAAAKSDSARAADVI
                     RNWLRNRSTLEFLTTWEEIYNPDFKVFESEHFKKDAGLLTFTPSVSEWVEQTGAIGIY
                     VKKGRYGGTYAHKDIAFEFASAISPVFKLYMIKEFQRLKEEENNLQKIEWDAKRFLSK
                     NNYLIQTDAVKNYLIPKCNFKENLHWLKYSEEADLLNVALFGFTAKAWRDANPELAKK
                     TNVRDYASISELTVLSNLETHNAQMIREGKSKEERFEILKEIADYQMSVLVEAERIEI
                     ARNEISLN"
     CDS             402847..404532
                     /codon_start=1
                     /locus_tag="lbkm_0367"
                     /product="phage integrase"
                     /protein_id="BBF41687.1"
                     /transl_table=11
                     /translation="MKKKQLKCYIYTRVSTSMQVDGYSLDAQKDKLHKYADFQEVVIA
                     GEYSDEGKSGKSVEGRPEFMQMLRDIEDGKDSVDFVLVFKLSRFGRNAADVLSSLQRM
                     QDFGVNLICVEDGIDSSKDAGKLMISVLSAVAEIERENILVQTMEGRKQKAREGKWNG
                     GFAPYGYKLENGELHIAEDEVDIIRLIYDKYINTNMGINAIASYLNQNGYRKKKRQNN
                     TLDTFASSFIKGVLDNPIYCGKLAFGRRKNEKIAGTRADYHVVKQDEYMLSDGIHEAI
                     ISEEEWKLAQKKREDTGVSHEKVHSLEHEHLLSGIIKCPICGSGMYGNVNRKKRKDGT
                     LYKDYFYYACKHRTYVDGHHCSYHKQWGEDKVNDAVAEVIRKLVKNPKFEEEIKRKIG
                     KSIDTDELENELTNMRKQMKQLVGSKNKLADQIDALDIMDKHYDRKYQDMQNRMDKFY
                     DEISTLEDSISEVEDRMLSIRQQKISGDNVYEFLLLFDKLYDRFIDKEKKEFLNSFVE
                     QVDLYEKELEDGRFLKHIKFRFPVFYDGIETEELCWDNESTVESVILLHRKNI"
     CDS             404809..405831
                     /codon_start=1
                     /locus_tag="lbkm_0368"
                     /product="chromosome (plasmid) partitioning protein ParB"
                     /protein_id="BBF41688.1"
                     /transl_table=11
                     /translation="MGAKMQEYSSSQEEIVTEGKTNTQVDEIKNLRLNQLVNFKDHPF
                     KVETNTELFELMQSIEKDGVLVPLLARPNPNGEGYELISGHRRKAACEWAGVTEVPVI
                     VRDLDNCQAVIAMVDSNLQRENIKPSEKAFAYRMKLEAMKQQGKRTDLTSGQLVQKLE
                     LKNPTLVLAEVECGIDEDGLWGLNNIDKAERIDSNKELAEHYGENERQIRRYIRLTYL
                     IPKILDMVDEGKIAFTIAVELSYLKEEEQYELHAVMDLEQCTPSLSQANRLKRMSQKG
                     ELDMDEMYNILGEEKPNQREQIKIQSEKLNKYFPADFTEHQKVELIENLVKDWHAAQS
                     LKKGSR"
     CDS             405855..406028
                     /codon_start=1
                     /locus_tag="lbkm_0369"
                     /product="hypothetical protein"
                     /protein_id="BBF41689.1"
                     /transl_table=11
                     /translation="MDTRIEVIGINHGWSMMKSVSEVFVTGIKEITTIPALYKDTLRN
                     LGLQSKRCWKRWS"
     CDS             406019..406273
                     /codon_start=1
                     /locus_tag="lbkm_0370"
                     /product="hypothetical protein"
                     /protein_id="BBF41690.1"
                     /transl_table=11
                     /translation="MELRLDAAIDKTENLARDVEINHMMMTFDSLMVKAQDEKVSAMI
                     AEPNSQYGADVFEESIQARWTVKKALNIMSSTVKKDCKSR"
     CDS             406425..406766
                     /codon_start=1
                     /locus_tag="lbkm_0371"
                     /product="ferredoxin"
                     /protein_id="BBF41691.1"
                     /transl_table=11
                     /translation="MLTMATQKNQTCIDACARCAQACYECFQLCLNEPDLNARKNCVS
                     MLVECAMMCQMSVSMMSMNGQFSKEHCALCAKICDTCAKECNMFKDDHCQKCAQECTT
                     CAQECRNMSAM"
     repeat_region   406938..408650
                     /rpt_type=dispersed
     CDS             complement(407113..408471)
                     /codon_start=1
                     /locus_tag="lbkm_0372"
                     /product="IS1380-Spn1, transposase"
                     /protein_id="BBF41692.1"
                     /transl_table=11
                     /translation="MKKLVVEFSEERLITPSGLSLVGSMLGKRDFAKKCNRMSVSAKR
                     SQPQIKNGDILLTYIGLLCQGKTEYEAVHEMMDDPEYYKMALGIAYAIPSAETLRQRM
                     DDIGSSLRDTILQANVDMFKTYNIRPTALENGYVPVDIDVTPFDNSKTSKEGVSRTYK
                     GYDGYAPMMAYIGTEGFLVNCELREGKQHCQKHTPEFLKETLQLCHQLTDAPLLIRLD
                     SGNDAAKNLDILIEDGSWFIVKRNLRRGESKDDWISLAKECCKDIRNPRDGKEVYVGS
                     SWKDVTYTDDENNDKTMCMRIGYEIIERSIDKHGQFLLPADIEANTWWTNLGATDDEV
                     IALYHAHGECEQYHSEIKTDMDVERLPSGKFETNELVLELTIIAYNILRMIGQESLKS
                     KKAPKTKHVVKRRRLRTVISNLILIAGHITSHARKVVLALGCSNTWRYVFMDLFQKFA
                     LA"
     CDS             408606..409355
                     /codon_start=1
                     /locus_tag="lbkm_0373"
                     /product="hypothetical protein"
                     /protein_id="BBF41693.1"
                     /transl_table=11
                     /translation="MVSNTYFLYEFHGLWYKTIGLTVFAYFLALILSRLMGRKAISQM
                     TFFDFVVGITLGSITSNLLSDKNHPVVSSTTGLIIISLLVIILDYIHLKSYKTAKIID
                     SEPVVLVENGNMVNKNFLKTRITILEFMQLLREKNCFNIADIEYAILETNGKLSVLFK
                     SQKQALTPSDMKIPTEYKGLTKDIILDGNIMFENLKEVKQTKDWLLNELKHFNVSNVN
                     NVFYAGLDTSGKLYVSIKNNSSEKEGKYGIE"
     CDS             409460..409987
                     /codon_start=1
                     /locus_tag="lbkm_0374"
                     /product="mobile element protein"
                     /protein_id="BBF41694.1"
                     /transl_table=11
                     /translation="MAREKKPVHKVQMTDGKRNIIQQLLHEYDIQSAEDIQDALKDLL
                     GGTIKEMMEAEMDDHLGYEKSERSDTDDYRNGYKSKRINSSYGSMNIQVPQDRKSTFE
                     PQVVKKHHILIICADGLSGIKEAIATAFPKTEYQRCIVHQVRNTMNRLKYKNTYISNE
                     QFRCIDRRSIESALL"
     CDS             410445..410579
                     /codon_start=1
                     /locus_tag="lbkm_0375"
                     /product="hypothetical protein"
                     /protein_id="BBF41695.1"
                     /transl_table=11
                     /translation="MFKRIKEVINKFLEDLAKENKELYGNGRMDCCNLNKTNDKSIRK
                     "
     CDS             complement(410662..411951)
                     /codon_start=1
                     /locus_tag="lbkm_0376"
                     /product="spore cortex-lytic enzyme SleC"
                     /protein_id="BBF41696.1"
                     /transl_table=11
                     /translation="MNQKVKSKSSFIHVYPAEMGTQNFGRLQVRCTTVGLVPIENAVV
                     RISSSVDPDGILAEYTTNINGLTEEIELPAPAIDYSLDPSSLAQPYTEFNLTILAPNF
                     SPVKVSNAQILPSITALQEVTLPAEALRVEGELFVIPPHTLYGDYPPKIEEPEIKPTG
                     ETGEIVLPNVVIPEYIVVHDGPPTDKAARNFYVRYRDYIKNVASSEIYATWPESTIMA
                     NILAIQSFTLNRVYTEWYRNQGYNFTITSSTAFDHKWMEGRNIYNNIGLLVDKLFTNY
                     LSRPNVKQPILTQYCDGYRVQCPNWMTQWGSKDLGEDGLSAIQILEHFYGETIFINTA
                     KEVSGVPASWPGFNLTIGSTGPSVRMIQEQINRIAEAYTVIPKVAVDGQYGPQTAQAV
                     RTFQQIFNLPQTGVVDFTTWYKISHIYVGVTRIAEYN"
     CDS             complement(412040..412615)
                     /codon_start=1
                     /EC_number="3.5.1.28"
                     /locus_tag="lbkm_0377"
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="BBF41697.1"
                     /transl_table=11
                     /translation="MAIKIFIDQGHNPTGYHNTGARGSGLIEENITFQVGLYLANLLE
                     NDPRFNILLSRPTPTTVLGTTNASSLAERVRLANEWPADYFISIHANANINPAINGAE
                     IYVYSYYTQSYWLAQHIMEELVRFTGLENNGIRINKSLYVLRRTNMPAILVEMGYLTN
                     VADAAILREKQWQIAYGIYRGILDYFGFEPL"
     CDS             complement(412762..413850)
                     /codon_start=1
                     /locus_tag="lbkm_0378"
                     /product="hypothetical protein"
                     /protein_id="BBF41698.1"
                     /transl_table=11
                     /translation="MYNIPLMQLIRNNIFLLEMPLYPGENLTISYHIIGDITSIGFAY
                     PYIKYETLFKSLPSLTYLSIFNYRVSDQGDIIEYHDDSEIIKTSIDYGTIPIMMMSSA
                     SPMGEPNVEMEYNLLLNEEAQENNINQVINIMRSKGYYGFIITFNYLNENSLELYLNF
                     TKKISERLHKVGFLFFITVNYINQETANGMQVSQIDYTSFSTYVDGMIFLKFLWRTIN
                     TPPLPVCNMSNLATLIDYVVTKVPSDKIIIGKPLLGYDWELPFQTDRSKTVSLSLEAV
                     YNLAQATGAFIQYDEKSQNPYYLYNQINIGIPVQHIVWFIDARSLNVIDELIKNYSLI
                     GCGAWNIMVYYAPLWTLINSQFNIIKLI"
     CDS             complement(414377..414748)
                     /codon_start=1
                     /locus_tag="lbkm_0379"
                     /product="polypeptide composition of the spore coat
                     protein CotJC"
                     /protein_id="BBF41699.1"
                     /transl_table=11
                     /translation="MELLKGASPEEIQKAGAGAYYADHDKGVYPVSSTGVPFTAAYLQ
                     VKGNPIIDLNEDLAAEQKARGTYEWLLNMAHDPDVIEPLKYLRQREVVHYQRFGEALR
                     IVQDYLQEPHLFVIPKPEFMK"
     repeat_region   414745..416457
                     /rpt_type=dispersed
     CDS             414924..416282
                     /codon_start=1
                     /locus_tag="lbkm_0380"
                     /product="IS1380-Spn1, transposase"
                     /protein_id="BBF41700.1"
                     /transl_table=11
                     /translation="MKKLVVEFSEERLITPSGLSLVGSMLGKRDFAKKCNRMSVSAKR
                     SQPQIKNGDILLTYIGLLCQGKTEYEAVHEMMDDPEYYKMALGIAYAIPSAETLRQRM
                     DDIGSSLRDTILQANVDMFKTYNIRPTALENGYVPVDIDVTPFDNSKTSKEGVSRTYK
                     GYDGYAPMMAYIGTEGFLVNCELREGKQHCQKHTPEFLKETLQLCHQLTDAPLLIRLD
                     SGNDAAKNLGILIEDGSWFIVKRNLRRGESKDDWISLAKECCKDIRNPRDGKEVYVGS
                     SWKDVTYTDDENNDKTMCMRIGYEIIERSIDKHGQFLLPADIEANTWWTNLGATDDEV
                     IALYHAHGECEQYHSEIKTDMDVERLPSGKFETNELVLELTIIAYNILRMIGQESLKS
                     KKAPKTKHVVKRRRLRTVISNLILIAGHITSHARKVVLALGCSNTWRYVFMDLFQKFA
                     LA"
     CDS             complement(416430..416693)
                     /codon_start=1
                     /locus_tag="lbkm_0381"
                     /product="polypeptide composition of the spore coat
                     protein CotJC"
                     /protein_id="BBF41701.1"
                     /transl_table=11
                     /translation="MWMYEKILEYPVKIKNPDPAMAMLIITQYGGPDGELAASLRYLS
                     QRFTMITPQAIATLNDIGTEELAHLEIVGSMVRQLPESVKLTD"
     CDS             complement(416714..416980)
                     /codon_start=1
                     /locus_tag="lbkm_0382"
                     /product="polypeptide composition of the spore coat
                     protein CotJB"
                     /protein_id="BBF41702.1"
                     /transl_table=11
                     /translation="MKLNIMELKKEITAIHMMLVELKLYLNTHPSDREAIAQHNAYVK
                     QFRALMDEYNQCYGMLTPNDALSPYPWQWINQPWPWDYEANFKL"
     CDS             complement(416977..417159)
                     /codon_start=1
                     /locus_tag="lbkm_0383"
                     /product="hypothetical protein"
                     /protein_id="BBF41703.1"
                     /transl_table=11
                     /translation="MIDNVRLAAAYIPYQYLCQLFNPIEALKKGTAFPELFSPYNVKY
                     KACEKPAYKEYKEATS"
     CDS             417461..418363
                     /codon_start=1
                     /locus_tag="lbkm_0384"
                     /product="ribose ABC transport system, periplasmic
                     ribose-binding protein RbsB"
                     /protein_id="BBF41704.1"
                     /transl_table=11
                     /translation="MNSKKFITDLYVTALNKTNIYLITMDKEDQFWYIMDQGARDMAQ
                     LIGVNYIWDAPKERIVDEQINIINEAVKAGADAIILAASDPVRVSQAVEDAKARGVKI
                     IYVDAPAVEEAIITLATENYSAGKIAGQQMISELEASGIKSGAIGIIGVTPEKITTMN
                     REKGFRDIVRLDNRYHILDTIYTNGDALVSRNAVLEMNEESMDLVGVFGTNEGSTIGI
                     GNAIRIINNNITGIGFDMTDEIQDMLREGVLNAVLVQNPYTMGYLGMAEAVAAIKNYN
                     TGPKFIDTGVSVITKYQPRRPLEN"
     CDS             418518..420227
                     /codon_start=1
                     /locus_tag="lbkm_0385"
                     /product="Ser-type protease"
                     /protein_id="BBF41705.1"
                     /transl_table=11
                     /translation="MNAEERDRIINDNYADLLIEYSGDYSVLQRFTNATYTIINYLYA
                     VVHIPAEQLTIDLIAEWGYSSLPKGFGIISEASLEASGIQRLRNIPNFNLRGQGVLIG
                     VIDSGIDYVNPVFRNADGTTRVVSIWDQTIYGGNIPENFIYGTEFTREEINLALASEN
                     PLEIVPTTDEVGHGTMVAGIAAGNVMPENNFYGIATDSELVVVKLKQAKAPLRKFLMI
                     PEDAVCYSEVDILFGIYYLIQVANKLERPLVICIAVGSSQGGHDGRGILSNTLSLIAT
                     RPGIAVVVAAGNEGNERRHYFGTVNRVTGYDAVELMVGENEGGFILELWGDSPSIYSI
                     DITSPSGEYIPRISASLSESNEISFLFEQTVIQLLYITVETQTGDQVIFLRFVNPAPG
                     IWKFNVYVRGDLNLGFHMWLPMDKFISDETFFVRSDIFTTVLALGNAIAPLTVSAYND
                     VDESLYLYASRGYTRTEVVKPEITAPGVDIIAPTPGNGFVASTGTSVAAAHTAGAAAI
                     LMEWGYVRGNIPRMSTIELKKLILRGARRDPDIVYPNREWGYGILDVYNVFDALRTGI
                     APR"
     CDS             420312..421154
                     /codon_start=1
                     /locus_tag="lbkm_0386"
                     /product="hypothetical protein"
                     /protein_id="BBF41706.1"
                     /transl_table=11
                     /translation="MKVPTNLNLYTQQIPIQNRYVNPDDILIPRGYKVEVFAQGINTP
                     ICIDFTESGDMLIADSGILSGNPQVILLSNGEFSIIAEGFNVPISGITYRNGDVYVAH
                     RGVITLVKMNGAKQDLMYGLPSMGDFTNNKVAFGPDGKMYFGQGAATNSGVVGLDNEW
                     VFEHPFFSDRPGSYIMMNGQNFETRNMLMPVGDDIAYTGAFFPYAVASLQRFEILRRA
                     IRASGSILKANANGTELEQVTWGFRNPFRIQFDRFNRAFITNRVMITGAAGQLLMLLT
                     NYIY"
     CDS             421202..421660
                     /codon_start=1
                     /locus_tag="lbkm_0387"
                     /product="glucose/sorbosone dehydrogenases-like"
                     /protein_id="BBF41707.1"
                     /transl_table=11
                     /translation="MTLPKFVPVNGPMPETLFTNPPGIAPRPFAIFPPNSNIMGFDFN
                     YNPRFGREGDIYIASFGPIESNMPGGNLRTGVGHNIITVDINNGQISTFLMNKSGFAA
                     SEGDGGLGRPTDVKFGPDGAMYISDYSMTTIDNMGVNYPNTGVIWRVSRI"
     CDS             421697..423400
                     /codon_start=1
                     /locus_tag="lbkm_0388"
                     /product="Ser-type protease"
                     /protein_id="BBF41708.1"
                     /transl_table=11
                     /translation="MTGENRIGIISEEYADFIIDYRNNPQLLEGFDNAYVHIMNEAYA
                     IVHIPLNTLPERILSEYSYTIIPKVLGLVSEVSLEASGVERLRNQPAFNLTGRGILIG
                     IIDTGIDYLNPVFRNENGLTKIVSIWDQTIQSEGGYPFETYYGTEYTAEQINLAIASE
                     NPLEIVPSMDYIGHGTMMAGVAAGNENEEVDFQGVAPEAEIVVVKLKQAKEYLREFFL
                     LPADVAAYQENDIMWGVQYCLQVARRIGRPIALCIGLGTSQTSHAGQSNLSNFLSILA
                     DFVNVGIVTAIGNEGNLGRHFFGTVTQETGNVTVELNVGPNENRFSMELWGGFPGLLS
                     IDMLSPGGEYIPRIASGLKVNREVRFIFEPTVVNVDYQLTETLSGNQLILFRFLNVSE
                     GVWRFTVYSQSDLPTPFHIWLPMGNFISDNTYFIQPNIYTTVLTPGTAFTPLAVTAYN
                     PINGNLYVNASRGYTNDNAIKPELAAPGVNYIAPTLNGEFMNYSGTGVAAAHTTGIIA
                     LFLEWAVVRQNMVGVDTVVIKSFFIRGAKRRENLTYPNRDWGYGIIDLYNVFDILRSG
                     L"
     CDS             complement(423626..424411)
                     /codon_start=1
                     /locus_tag="lbkm_0389"
                     /product="glycine-rich cell wall structural protein
                     precursor"
                     /protein_id="BBF41709.1"
                     /transl_table=11
                     /translation="MDENGIVRDPDLYNEIYDDDYIDAPGVDNGIYENNGIGRPGVYN
                     GIYDNRNIGAPGVDNGIYENNGIGKPGVYNGIYDNRNLGAPGVDNGIYENNGIGTPGV
                     YNGIYDNRNLGAPGVDNGIYENNGIGTPGVYNGIYDNRNIGAPGVDNGIYENNGIGTP
                     GVYNGIYDNRNIGAPGVDNGIYENNGIGKPVVYNGIYDNRNIGAPGVDNGIYENNGIG
                     RPGVYNGIYDNNVKRRPELYNGNVSENPNIDYNIDTYGINKND"
     CDS             424412..424621
                     /codon_start=1
                     /locus_tag="lbkm_0390"
                     /product="hypothetical protein"
                     /protein_id="BBF41710.1"
                     /transl_table=11
                     /translation="MIIKTRYAYIVAVIITKGTTYIIIVFVYSINNPRPNIIINTIIH
                     ALNLRVFLFFLNFNTIFAFGYYIRY"
     CDS             424808..425494
                     /codon_start=1
                     /locus_tag="lbkm_0391"
                     /product="polypeptide composition of the spore coat
                     protein CotJC"
                     /protein_id="BBF41711.1"
                     /transl_table=11
                     /translation="MFKHEKKLLNDVRVDAPNPNYAAMLQEQLGGPQGELKAALQYLA
                     QSFRIKDPQIKDLFLDIATEELSHMEMVATTVNLLNGHQLDAQNATVGNVEAHVLSGL
                     TPMLTNASGQLWTAAYVNETGDLAADLLSDIAAEQRAKVVYEYLHRQINDKGVRDTID
                     FLLNREEAHNALFREAFNKIQDTGSLKDFGVTKDSRLYFDLSSGKNNFNVDHPQAPSF
                     NEVNKELVTK"
     CDS             complement(425832..427586)
                     /codon_start=1
                     /locus_tag="lbkm_0392"
                     /product="hypothetical protein"
                     /protein_id="BBF41712.1"
                     /transl_table=11
                     /translation="MINQINSGKIENELNLALDLPEAERAKTYNLDVGYSAVTNMWEL
                     IVKYNGSLNRIRDELGITVIELFYGYAIMIIPEELIPRLTLYDEIEFIEKPKRIYFEV
                     NHGRSVSCINSVQTENLYNLLGAGVLVAIIDSGIDYSHPDFRNVDGTTRIAALWDQTI
                     PGAPPPNYAIGTLYTREIINEALLIPMPERMEIVPSVDLSGHGTHVAGIAAGNGRASN
                     GLYRGVALLSELLIVKLGTSVGDSFPLTTQLMLAIDFCIRSAIELDRPLAINLSFGNN
                     YGSHTGRTLLESYINDVSNLGKTSIVVGTGNEGISGNHTQGVLSMGRNEVIELAVSES
                     TFGLSLQIWKNYFDHFDIIIIAPDGTRVGPIPRRLGTQQFVIGQTEIFLYYGDPTPYN
                     VQQEIYLEFTPVNTYINSGVWKFELIPRMIKAGDYDMWLPAGGALNPGTRFLAPSEFT
                     TLTIPSTAYRAITVGAYNGYTDSYAPFSGRGYTRDLDIKPDLVAPGVDITSCSPGGGY
                     TARTGTSMATPFVTGSAALLMEWGIVRENDPYLYGEKLKAYLIDGTRPLRIENIYPNR
                     TLGYGALCLRNTFDNITL"
     CDS             complement(427970..428662)
                     /codon_start=1
                     /locus_tag="lbkm_0393"
                     /product="hypothetical protein"
                     /protein_id="BBF41713.1"
                     /transl_table=11
                     /translation="MEILAYMIRCIIMFLVTWTGVRLSGKKSVSNMTTYELAAMMLLT
                     TVAAEPLVYKISSKATIGVATITAITILIGSLSLKKFFYNFDTEPIVLIINGKILKKE
                     LKKTRMNIPLLMSELRTMGYPNLSEIAYAILEPNGKLSAIPMSQKRPVQPSDMAINTK
                     PVNISFPVIIDGELRKKNLSFFKKDESWLLSQLKNAGANSFKDVLFAQIDSEGNLFVD
                     LQNTNETYPSLD"
     CDS             complement(428679..429044)
                     /codon_start=1
                     /locus_tag="lbkm_0394"
                     /product="hypothetical protein"
                     /protein_id="BBF41714.1"
                     /transl_table=11
                     /translation="MKSKTIDIILVIFIFVYLFTYITTRKGMFDDVSSLFDQTEKYIQ
                     EEKWEEAEESSEQIKEKWNDQLFILMMNYGEGDITTIEEYFRQLISGVKTKDDTTALS
                     SLLIVKDIWKNTTNIVPKP"
     repeat_region   429037..430883
                     /rpt_type=dispersed
     CDS             429470..430771
                     /codon_start=1
                     /locus_tag="lbkm_0395"
                     /product="mobile element protein"
                     /protein_id="BBF41715.1"
                     /transl_table=11
                     /translation="MIKINYISTLFVGIDVSSKSNVVYAMDFDENKYIASSFSNNQPG
                     ADMLAELISECMRKHPDLNTIIVALESTSVYSIHIANFLSSCELLMPYKPYVYCLNPK
                     MTANYRKTFVGMDKTDAKDAYLIADFARVGRTKKCEPWHGSQYLALKRLTRHRLHLAE
                     CITREKTYMVSNLYLKFSELQLLDGDEQPFSNLYGSTSSAVLTEFLSLQEIIDTPEEE
                     LLEFLAKKSRNRIADISKTSDLLKKAARDSYRLDKCMYEPLNVSLASSFNCIQTYQNE
                     MKLIDQAIEKCIKGMNPNAFTILKSIPGIGPVWAAGILSEIGDITAFHSSDALAKYAG
                     LTWLKNDSGDFISEDNHISKAGNTYLRYYLGEASNSVRRHMPEYAAFYAKKYAEVTKH
                     QHKRALALTSRKFVRLVFGLLVKNQLYTGEKLDAELNKESE"
     CDS             complement(431012..431542)
                     /codon_start=1
                     /locus_tag="lbkm_0396"
                     /product="rubrerythrin"
                     /protein_id="BBF41716.1"
                     /transl_table=11
                     /translation="MDFQQSRTYQNLLQAYENELLSSARYLIYEDIARNEGYIEIGNI
                     YETTARNDKEHARIWLRRINQGTLPNTATVLQESIQVESEMAGEMYQEFARVAREEGY
                     SDIAALFSGVANIDYNHGFQFTELYENVENNQVFCKPEPTLWICMQCGNVMSGECAPV
                     ICPVCGFPQGYYRLYD"
     CDS             431727..432347
                     /codon_start=1
                     /locus_tag="lbkm_0397"
                     /product="hypothetical protein"
                     /protein_id="BBF41717.1"
                     /transl_table=11
                     /translation="MDNRYNSGSDTATQYTYITIMALVDSIIPRTPLLAELFGEVLLY
                     GALDLYTDEYMVMILNNYTIPLSDVTAQMLNIAAKEYMGSKGIVSNDDPQRYTLFVTL
                     SSIQRFQALTLLDNIEVYFSDVIFFQQYPGLLSIASSINRFTMLGYYSEWYGYGTTRL
                     EQPNSRVLQYYPLSWDQVGYPGPSLSYIAYVNDYYQIKEKLLEDTI"
     CDS             432376..434076
                     /codon_start=1
                     /locus_tag="lbkm_0398"
                     /product="glucose-methanol-choline oxidoreductase:NAD
                     binding site"
                     /protein_id="BBF41718.1"
                     /transl_table=11
                     /translation="MNNEMDVIIIGAGGGGAVAAKELGQKGLKVLVLEAGPWYGNALW
                     PNPNTEHGAIGSSSYENLSIELLKKQFSDLEDDMNNFIYGKFRWGPANREEGPWPRNL
                     VDRGYTWQNSGVGGSTLHYLANCPRAFPQAIDNVWPISYEELIPYYEKVERTLPVYPA
                     PSTPKEDLFYYGAQKAGWSLLDSPNVTVPGYRPQPNAILRPNFSSAATVSQTIQPVGC
                     TLRGHCINGCHIGPTVEGVAKRSTLVSYIPRALATGNVEIRPNAFVIKILTEESSELG
                     LHAIGVLYRDTWTGEIVELRARVIVLAAGAVESPRLWLNSNLPENEWVGRGMINHWMD
                     CVSGIFDESVLKDVLGVPAAQPFVGQNAAARLDLPGLGAIETIGFTPGIFSSFLYGTS
                     HKGYSMFRPSNPDEPWDVEGLVVGERLKEFMRAYPRTLSILIITNDEENLRNSITLDP
                     VLKDENGFIPVINYYPSEADAVKRDRLAYIAADLLRNAGAKTIIRSNWPPEAFIHIAC
                     TMRMGFVTDINCEAFQVKRLFIADNSVLYNGLGGVNPTLTTQALATRTSDRISDLYFK
                     "
     CDS             434184..435467
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /locus_tag="lbkm_0399"
                     /product="spore cortex-lytic enzyme,
                     N-acetylglucosaminidase SleL"
                     /protein_id="BBF41719.1"
                     /transl_table=11
                     /translation="MTIHVVKSGETLISIAEQYGITPEIIISVNELPNPEDLVVGQSL
                     AIRIPEVVHTVEEGDTLYEIAETYDVSPTQILQNNPSIAVVEFLTPGETIVIRFRGEE
                     IIDNIEINGYAYTFIDRTVLRKALPFLTYLSIFNYGFTPAGELVPAEDEELIALANDF
                     SVAPVMVLAPMTAEGEFSSEIASELFANDEAEDRLIENIVTTMQAKGYRALDIDFEFI
                     LPEDKEEFLSFITKVQARLSQEELLTFVALAPKTSGEMTGLLYEAHDYPTIGAVADRV
                     LLMTYEWGYTFGPPMATAPLNNVRRVLEYGRTVIEPDKIWMGIPNYAYDWPLPFVRGT
                     TKAESISNQEAIERAALNNVAILFDELAQSPYYYYTDAEGIEHVVWFDDVRSINAKLR
                     LIPELGLNGAGVWQIMKFFPGLWNVVSAFFSVEKV"
     CDS             complement(435472..436869)
                     /codon_start=1
                     /locus_tag="lbkm_0400"
                     /product="Na+/H+ antiporter"
                     /protein_id="BBF41720.1"
                     /transl_table=11
                     /translation="MAWLSLLPVLITIFLTFKTKKLIISLFIGIVIGSILYNGILGGI
                     TAIGDYMMGAIASKESAYTLSFLIAFGSLAELIEMAGGISGFSNKVSKYMKDEKSTLK
                     WAWILSSITFFDSSFHTIAVGTVLSPIIKKVKGSKEKFAFVLSVSSLQLIILIPIATA
                     YLGYMVTLVTNNLKGQAVEESAYSIVVQSVIWNFFSWTMLIIAIGISLFGLGFGRIRF
                     GKAPKIQDEFTKAHIEKETLRNVSIEEYPKNSKNLIIPVIILLISTIFFFWWTGRENA
                     TTFFEAISNADFSASIFSGIMITLLLTSIYFLLQKISLAEIETHIILGGEKLLSLVIV
                     LILSWALTSVTQDLGFNNLINAELVKSIPLPLIPPLLFLISGVIAYSLGSSWATWALI
                     MPLAINFSSNTGVSIPIMVGTVWAGGAVADVISPLAAEMADTTFGEHLTTGFPFLIGG
                     VIITALEYLLLGIFL"
     CDS             436970..437659
                     /codon_start=1
                     /locus_tag="lbkm_0401"
                     /product="hypothetical protein"
                     /protein_id="BBF41721.1"
                     /transl_table=11
                     /translation="MHNKFKTLLLFICIIISIIIFMFTFLDTEIFLKGSVFFSFILLQ
                     LYIYRYHLKKPTKENRSKRIAIMGLFMALSVLFQCSPVFYPAVGLILSPLSSLPISMG
                     CILFPQGAPAMIIGTSLLVSFISMEEAMIFALATGVVGIAVSMVIISKKAIIKSIWVP
                     GLSLYTGILTLTYIIGVPGMKDFFSDIGIVETNLIVLIFSMIYSYLWIMIIKFFLKVM
                     MRILLKDSYLN"
     CDS             437913..439235
                     /codon_start=1
                     /locus_tag="lbkm_0402"
                     /product="probable lipoprotein"
                     /protein_id="BBF41722.1"
                     /transl_table=11
                     /translation="MKHKEAAIHNLRLEAGYKVELAAAGFTFPTSITFDEMGNIHVGE
                     SGFSYGPAKVEGGGKIYRIKQSGDISLVAEDFEGPLTGLTWYKGFFYVITGSNPGKVY
                     QVDDRGNRKVIIDGLPTGGDHYTSNIIFDNRDKMYFGTGTFTNSSVVGIDNFMMGWLA
                     SHPDWHDIAPVDYRLRGINYESLNPFKLDHPEILYTGAFHPFGELSEEGEIIKGNLKA
                     NGVIYRANIDGSELEQYATGLRNPFALNIAPYGGLLCIDQGYDARGSRPVANAPDPLY
                     LIREGGWYGWPDYVAGIPISDPRFQTDNKELELVLAEHPPVTGETITNFEPHAAAMQF
                     DFSYSSYFGHMGDAFVAFFGSLAPMTGKTPNHPGHRVVRLNMTTGEYSDFLTSEHDNG
                     HASIRPIDVKFNPFDHSLYVLDYGRIDVNEAEMTPYAESGALWRVSKS"
     CDS             439884..440504
                     /codon_start=1
                     /locus_tag="lbkm_0403"
                     /product="HNH endonuclease"
                     /protein_id="BBF41723.1"
                     /transl_table=11
                     /translation="MAVDIERAIDENGYKKVILEDHKVFHRKCLGDDYRYTTFELAIL
                     HYHGSIEKMKVWITDNIDDSQFDYLDIAAEYTNYLESQYYDVIVNIKRDVLHLLFQNR
                     MLLMHFNTFMSDSLQGKSSRKNMLQWVKRAVYYRDNGRCVMCQKDLSGLVDVEEEYEK
                     QFDHIVPLEQGGLNDISNIQLMCSCCNQKKGTQTYTSNVYRFLYDD"
     CDS             complement(440835..441389)
                     /codon_start=1
                     /locus_tag="lbkm_0404"
                     /product="uncharacterized immunity region protein 2"
                     /protein_id="BBF41724.1"
                     /transl_table=11
                     /translation="MTIDYVVNQVEALVKKVGSRDPYVICNELDYKLHYIDLKQRLKA
                     YYFYQSRINNIIIDENVIELFRPILISHELGHGLLHREIAMMSGFQELEVLEKRSDKP
                     LEYEANLFAAELLLEDETVLNHLNEYTFFETASILNVPAALLDFKFAILKSKGYSINS
                     MQIAKSSYLKEEKGAYEISNEPTC"
     CDS             complement(441479..441937)
                     /codon_start=1
                     /locus_tag="lbkm_0405"
                     /product="predicted transcriptional regulator"
                     /protein_id="BBF41725.1"
                     /transl_table=11
                     /translation="MTFGEKVKEARLLKNLSQTELAAITGISERSLYTYEQLNTLPRK
                     SNIKKLADALSVSVSYLVDDEEADKQKNIENEDFLDTVKDKFGYKGAKEAKDVLDRAG
                     ALFAGGDLDYDAKEIFMQSLMQVYISSKKEASEKFSRKKKTKPPIDESVL"
     CDS             442133..443380
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /locus_tag="lbkm_0406"
                     /product="DNA polymerase IV"
                     /protein_id="BBF41726.1"
                     /transl_table=11
                     /translation="MGKRVILHSDINACYAAIEHLHRPELNGKPLAVGGDPEARHGIV
                     LTADYIAKKYGVKTGMALWQAKQVCPELNIVSPRMDLYLRFSRMAHEIYGEYTDLQEP
                     YGVDESWLDVTASSSLKGDGYKIAKEISNRMKSELGITVSIGVSFNKIFAKLGSDYKK
                     PDAITTMYEDEFKSKAWALPVSDLLYVGRSTNQKLARFGIKTIGDLARTDEHLLMSLL
                     GKMGGILWAFANGYDDSPVKMEHTPAPIKSIGNSTTTPRDLENDEDVKIVLYILAESV
                     ASRLRDNGFKCRVVEISVRDNELYSFTRQHKIDHATNITGEIATEAYRIFKENYNWRK
                     PIRSVGVRGADLVNDNYWEQMDLFSSVEQREKQMKLDDAVDTIRRRFGFYSVQRGLMY
                     RDKMLSSVNAKEDHTTHPIGYFG"
     CDS             443397..443618
                     /codon_start=1
                     /EC_number="3.4.21.88"
                     /locus_tag="lbkm_0407"
                     /product="SOS-response repressor and protease LexA"
                     /protein_id="BBF41727.1"
                     /transl_table=11
                     /translation="MAYMRYDLNDKQNKIYDFLCDFLKAHGFPPTVREIAEMAGLASA
                     SSAHHYLKQLEEKGYIRRVEGSPRAIEIM"
     CDS             443634..443885
                     /codon_start=1
                     /locus_tag="lbkm_0408"
                     /product="hypothetical protein"
                     /protein_id="BBF41728.1"
                     /transl_table=11
                     /translation="MESVKVYVDVTAEFSKEGVLTPKSFIWKDGKVYEIQRVKDMRRA
                     ASMKAGGVGMRYTCVVDGRESYLFYEDNNLWFVEGKTGA"
     CDS             444056..444274
                     /codon_start=1
                     /locus_tag="lbkm_0409"
                     /product="hypothetical protein"
                     /protein_id="BBF41729.1"
                     /transl_table=11
                     /translation="MMRELKQIEFYCKKCRKSMKMAYLLTGNDDAPVLPGMIIRCHTN
                     RCTRVMVLKKYTEGMLIAQADNEGKVYI"
     CDS             444991..445599
                     /codon_start=1
                     /locus_tag="lbkm_0410"
                     /product="type I restriction-modification system
                     specificity subunit"
                     /protein_id="BBF41730.1"
                     /transl_table=11
                     /translation="MSVIELDKLASEIISGTVVSRLESKDGNKIDKIGVLTLKSISNG
                     KIDTEYIQNINVSKRVQDNKLTKYGDIIIKMSTPYDSVYIEKEFEDMIVPSFCCLIRG
                     TQNEIVDPYYLVGYLNSALAKEYLFTSNSSSAASLLKIRDIKKLPVPLPEIVEQRAIG
                     KVFQACSERQVLLTKMMTHEMCMAENIVMDSVREVLKYEEKK"
     CDS             445601..447007
                     /codon_start=1
                     /EC_number="2.1.1.72"
                     /locus_tag="lbkm_0411"
                     /product="type I restriction-modification system,
                     DNA-methyltransferase subunit M"
                     /protein_id="BBF41731.1"
                     /transl_table=11
                     /translation="MKTSEIISVITHLEKELSDWKYYNAIRGRSHVAVVYLLFLKFLS
                     DIEVTQEKSILVEMEDRFNQYSDFSNSVVHAFLSEKLLDDRENDSIIIKYLDEIHFEK
                     MPLEFGDIIKELSKFDFTIEDEKKEVVLALVMIFSALYGTTPLKDDIGQNDISLIQSA
                     AELLEVEDNMEIYDFSCGVGNLLAMSVKVGCKIYGEEDDIEKAVIASILLRMAGVKDP
                     IIEVGDVLQNPMTVRYKEKLFDRIISAPPIKDKNISAQKLVKMDYIDEFLFRDSFSES
                     GAWIYARHIIQKLSLNGKGILIAPISILSREGVTKDDRTRLAKRESIEAIIQLPTGIT
                     SSAIRLCLIILRKGHDDYRENTKIFLVDLSSRKGNDYFKGKNNQALDHEKLTSIVSSK
                     EEIDGISKMVSLHEMDNTEMNFTPAIYMRTITEMVSQGENTEHMRVIHKQLLDQYYQS
                     EKDLNIAISNYYKIKRDE"
     CDS             447021..447206
                     /codon_start=1
                     /locus_tag="lbkm_0412"
                     /product="hypothetical protein"
                     /protein_id="BBF41732.1"
                     /transl_table=11
                     /translation="MKEKNKNIKKNPNAVTTPGGMLLGILGEVNDMKVFQVKRDGNYE
                     IFDVEYIKNQLDKPITK"
     CDS             447338..447694
                     /codon_start=1
                     /locus_tag="lbkm_0413"
                     /product="transcriptional regulator"
                     /protein_id="BBF41733.1"
                     /transl_table=11
                     /translation="MAEIEETYDPIDFGKRLKKIRKQHNITQERFAEILNVSTDSITK
                     YETGKVNIGHDYIIKICKMFNISADYFYFDQNKHLKVDNEINDEDLRCIFSKLDEEER
                     TRAIEILKLAFPKTVA"
     CDS             448041..448181
                     /codon_start=1
                     /locus_tag="lbkm_0414"
                     /product="hypothetical protein"
                     /protein_id="BBF41734.1"
                     /transl_table=11
                     /translation="MPTRVATGGTIVVPMNEIDGAPEFQPKAFSEGGTFRKSKMGMDT
                     TK"
     CDS             448421..448798
                     /codon_start=1
                     /locus_tag="lbkm_0415"
                     /product="hypothetical protein"
                     /protein_id="BBF41735.1"
                     /transl_table=11
                     /translation="MKAYFYFRAPVDEDEAKAISKQIAEVIVSSGFKIVEGDICISPD
                     NNNPEYILESFNICMAGIIATESDALVVPSLSTIHPKEEFAKAMLGMLVDAGLLVFVI
                     KNNELVAYKSSIDKELMYEEFTR"
     CDS             448871..449230
                     /codon_start=1
                     /locus_tag="lbkm_0416"
                     /product="hypothetical protein"
                     /protein_id="BBF41736.1"
                     /transl_table=11
                     /translation="MDSVLNRKIKEKEEVHGLIYIGKDDTQLANELEKDAREMGIKVT
                     DTLLKIDNGPELLRWYMKNSSITAILIRRMSDLSVESEVQNDILVEAKRNGISINVKE
                     MGWKAVESVPWDGSAGC"
     CDS             449351..449875
                     /codon_start=1
                     /locus_tag="lbkm_0417"
                     /product="hypothetical protein"
                     /protein_id="BBF41737.1"
                     /transl_table=11
                     /translation="MRITENNRSVYYKSTQSNYPKRTEKVRISQPDVVIVEDGRSPYG
                     SGTPDNVERAMKMPYYHRYDIVLVDFGNDYEHCLTCETRPAIVISPTDYSSKSPILLT
                     IPMTKHFKFIDMECHLFIDKCDCAGLTDSGMALGEQIRCVDRTQVKRKIGMITDDRLM
                     EKLDKALAAAVGIC"
     CDS             449885..450025
                     /codon_start=1
                     /locus_tag="lbkm_0418"
                     /product="hypothetical protein"
                     /protein_id="BBF41738.1"
                     /transl_table=11
                     /translation="MKNLELAKKLAVLGVIFHAGLISEDEYSITKNRIMMDYNIVSFL
                     NN"
     CDS             450169..451854
                     /codon_start=1
                     /locus_tag="lbkm_0419"
                     /product="site-specific recombinase"
                     /protein_id="BBF41739.1"
                     /transl_table=11
                     /translation="MAQVEVIKASEGTVNRRRNIIGSGVTFDRKRVAAYVRVSTDGEE
                     QLQSFHSQKSYYEEKISKNKDWAMVGIYADEAITGTKTAKRDGFLNMIDDCMNGLIDV
                     VLTKSISRFSRNLVDTLQYVRLLKEKGVAIIFEKENINTLSMESEMALALLSTLAQNE
                     VESLSANVKMGIKMKMKRGELMGFNGCLGYDYHPEDKSITVNEEEAEVVRYIFDQYVQ
                     GYGAYTISRQLEKLGKKNKKGTVKWSDSGVLGIIKNEKYKGDLLLGKSFTVDPISKRR
                     LENMGEEEQYYLKNHHDPIVSAEIWDKAKEIREERYRINNTVVDGTRMKATRKFAFSS
                     MCQCGFCGKYFSRRSHHQDTHNKKPVWKCTTATKSGIDKCPNSKSMDEVIIENAFLEM
                     FNLLADNFDDVLESVLKSVEETICNDESAAKLSRIDKSLSALESKRKKLTDMLLDDKI
                     TKDAYDEKYDDITRKIKQEKEERSLYASNVNAQRDVGKRMRDIRILLNEAEGIKKFDR
                     VVFESIVEKVIVGETNADGSSDPYKLTFVLRGIDNRMVPDAKNRYLNLRKKTG"
     CDS             452101..452379
                     /codon_start=1
                     /locus_tag="lbkm_0420"
                     /product="hypothetical protein"
                     /protein_id="BBF41740.1"
                     /transl_table=11
                     /translation="MEFKGTKLEDIIVTLPFADGTSVECGVYSYFEVNNKQYFAMLPL
                     KGKKQLDFSQSYMLYEVKEDEENNPNVFYIESDEEYAIAAQYFSNQLK"
     CDS             complement(452751..453272)
                     /codon_start=1
                     /locus_tag="lbkm_0421"
                     /product="transposase"
                     /protein_id="BBF41741.1"
                     /transl_table=11
                     /translation="MEKYMKFTMFKKETSDKKYHENPYRAVNFKRDENGNLICPSGKA
                     FHFKSKQHVYKNKYGRTEEIYECESCEGCQYKNECCPKATKSRIIRMNQELTSIHQEV
                     ITNLESIHGALLRMNRSIQSEGTFGVLKWDKSYKRLFRRGEKNVILELTLISCGFNLY
                     KYHNKRQRIELAA"
     CDS             complement(453390..454118)
                     /codon_start=1
                     /locus_tag="lbkm_0422"
                     /product="transposase"
                     /protein_id="BBF41742.1"
                     /transl_table=11
                     /translation="MEHGICSLREIERLCRNDIRYMYLLDGMKAPSFATFGNIIRNEL
                     VDSIEQIFRDLNTYIFEKDHVDLEHTYIDGTKIEVNVNRYTWVWKKSCTKNREKVFEK
                     ISMLIDAMNQEVLGYLSVKLEKRDEYAVEYISELLEMYKNATNLDESTFVSGCGHRKS
                     LPQKQYQELQGYLERLKTYGHHIEVCGDERNSYSKTDHDATFMRIKRDYMGNDQLLPA
                     YNLQTAVCDEYIAVVDVKPYTSDM"
     CDS             454444..454767
                     /codon_start=1
                     /EC_number="6.5.1.2"
                     /locus_tag="lbkm_0423"
                     /product="DNA ligase"
                     /protein_id="BBF41743.1"
                     /transl_table=11
                     /translation="MMDIKNIISDLTDELLEARRNYYSGQIESMSDASYDDKEYYLMS
                     LEAKYPQFSRSDSPTKGVGYKPVSKLPKVTHKTPQLSLDKRYDVEEIIDWARERYSDP
                     IRQMD"
     CDS             454722..455342
                     /codon_start=1
                     /EC_number="6.5.1.2"
                     /locus_tag="lbkm_0424"
                     /product="DNA ligase"
                     /protein_id="BBF41744.1"
                     /transl_table=11
                     /translation="MGKREVLGPYKADGLTVVLTYMNHKLEDSVTSGNGIVGERILAQ
                     ASEIINVPHFIDEPGEVIIRGEAVILSNMFEVINESLPEGAEKYKTCRNLASGTIRNL
                     DLSVVRNRKMHLFAFEVQKSGDQEFQTDSEERAWLEKQGFDLVPYEVLHTANDIRQYV
                     KKLGDLRESGTMLFDTDGAVFKLNDKQLCKKSGTTAKYPRYSLAFK"
     CDS             455541..456440
                     /codon_start=1
                     /EC_number="6.5.1.2"
                     /locus_tag="lbkm_0425"
                     /product="DNA ligase"
                     /protein_id="BBF41745.1"
                     /transl_table=11
                     /translation="MVKIERSGEVIPKITEVYFGDDCEIREAELPSLCPCCGHNLEKR
                     GVDLVCTNQDCVGKLKVKLRLMNSREALEIVGLGEETVEILVDKGFISTLGDIFSLKF
                     HSKELIELDGMGEKSVSDLLSNIESAAKKDLPSVITSLCIKDVGPKIAKLIAQKLHPQ
                     GIMGLILVPEEDLLSIDGVGPVISKNILSFIHSTEECKLLYIYTYNGVGQINTCKPIV
                     CGALNGKTFVVTGTLSKERKLIEQDIVEAGGKVSSSCSSKTSYLVCGDNPGSSKVASA
                     EKHSISMIDEQLLYEMINNVHII"
     CDS             456513..456806
                     /codon_start=1
                     /locus_tag="lbkm_0426"
                     /product="hypothetical protein"
                     /protein_id="BBF41746.1"
                     /transl_table=11
                     /translation="MLKKNANEESKSCVGIVSYKVVSEREFYILERLDRDTYALIVMD
                     NVPTDMEQKSLEKFMGEHETEGSSEAGTIEEIFKDVDDEIKEYLLKFLDYNEL"
     CDS             457513..458010
                     /codon_start=1
                     /locus_tag="lbkm_0427"
                     /product="hypothetical protein"
                     /protein_id="BBF41747.1"
                     /transl_table=11
                     /translation="MSNYYASRTTYEGTSAVRYYTGGKVFYRVGGSRSWRNNNPGNLR
                     PSSITESCHQIGKEKTSKESAYFAIFESVEYGRKAHNKLLTSVYSGSTINDMVHKYAP
                     KSDKNNPTKYVNYICEQTGLSKKATVGSLSASQLNSLEKAMSTYEGFKAGRVVHTNEK
                     PILKN"
     CDS             complement(458155..459414)
                     /codon_start=1
                     /locus_tag="lbkm_0428"
                     /product="internalin-like protein"
                     /protein_id="BBF41748.1"
                     /transl_table=11
                     /translation="MKKKYFIPIAIAACTIMTSCNISNNHDDRVAKQTKQPAEVTSQE
                     ENFSNKKLIKIIQNKIDKKKAKISKSDLEKIEELDLTGTNITDLNDIEKLPNLKTLDL
                     SNTGITDLEPLSNLKQLEDLRLGLNEINSLTPIQNMISLKKLDLDNTYITDINPLNKL
                     VNLEELNLRNSVELQDLTPLKNMVKLKILNINGCERIGEYQSNVKILESLKLLTTLRM
                     QSTGIEKQMFLANLPNLKVLQADLEFNNKKLLNDLGIIELDTMISNDTDLSGLTGLKN
                     LERLYILDGTLQEIPKPIGSLTKLTELVIIDRMGESTIANISCLKKLTQLEKLQIAGN
                     NIKDLDPIKNLTQLKYLDLSNNRITDLSMLGNLINLEYLDLSDNSIEDVGVLKNMRHL
                     KELNIKGNNILDTSGLKKLENETVITN"
     CDS             complement(459607..459756)
                     /codon_start=1
                     /locus_tag="lbkm_0429"
                     /product="hypothetical protein"
                     /protein_id="BBF41749.1"
                     /transl_table=11
                     /translation="MALNSEKTRILVNIPISLKEKIEIEAKKENRSVSNYIVNLIMQN
                     LENKN"
     CDS             complement(459826..460014)
                     /codon_start=1
                     /locus_tag="lbkm_0430"
                     /product="hypothetical protein"
                     /protein_id="BBF41750.1"
                     /transl_table=11
                     /translation="MNELTVREFFIIQDYINEMINLYDNTMVMNNEPLYLSEKHIPVY
                     RDELLRLKKKLNLSSYNA"
     CDS             460194..460547
                     /codon_start=1
                     /locus_tag="lbkm_0431"
                     /product="holin, toxin secretion/phage lysis"
                     /protein_id="BBF41751.1"
                     /transl_table=11
                     /translation="MHILFGEFDIHFQALLILMVCDYISGVLIAIYKKEFRSSIGYKG
                     IVKKVGMLLCITVARQIDNLALYNGELETRSVVLLFFSINETLSINENLNKIGISIPK
                     KITKTIKSAKQKLEK"
     CDS             460887..461024
                     /codon_start=1
                     /locus_tag="lbkm_0432"
                     /product="hypothetical protein"
                     /protein_id="BBF41752.1"
                     /transl_table=11
                     /translation="MQKQYTEIPYQKGTSIRKECSFFLVSGFLPPAEHFASEALLPAL
                     Q"
     CDS             complement(461239..461820)
                     /codon_start=1
                     /locus_tag="lbkm_0433"
                     /product="transcriptional regulator, TetR family"
                     /protein_id="BBF41753.1"
                     /transl_table=11
                     /translation="MQHRNTDLRIQRTRNAIKTAFQDMICEMEANEITVAELTRRAQI
                     HRKTFYLHYTSIEALFEDMLSELAENYYAMWDQLEPPFSFLEVNRVFFEFCAKNTMYQ
                     ERLMCDPSYRDFCNKLFTTTLQHNRDHYNPYAHCSERVQRIINKFLTTNSLEFYRDWV
                     AAGKDLPLEELIDITGTLLNDAISSFVEPEYYL"
     CDS             461978..462691
                     /codon_start=1
                     /EC_number="4.1.1.44"
                     /locus_tag="lbkm_0434"
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="BBF41754.1"
                     /transl_table=11
                     /translation="MTNFTEEQRKNDPEFTELFDQFAFDEVANANDIDEKTRYTVILA
                     TLLGCQGVDEFKRILPLALDGGVTPIEAKEIIYQATAYLGIGRTYPFLDAANEVMAAQ
                     GIPLPLKAQGTTTKENRREKGTNAQIDLFGPQMADFWKASDMNRFLAGNCFGDYYTRG
                     GLNYSQRELVTFCYIAAQGGCEPQLMAHTMANFMQGNDKNFLIKVVSQMVPYIGYPRS
                     LNAIGVVNQMEEKRLQQNK"
     CDS             462711..463148
                     /codon_start=1
                     /EC_number="4.1.1.44"
                     /locus_tag="lbkm_0435"
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="BBF41755.1"
                     /transl_table=11
                     /translation="MKYSKKEEFDKANMFKTGVPNDAFAKYFVGDSFLNPLTKPGEAP
                     LFLANVTFEPGCRNNWHIHHAKSGGGQMLVCTAGEGWYQEEGKEPVSLAEGSFVYIPA
                     EVKHWHGAKADSWFSHISVEVPGEDCSNEWLESVSDEEYAKLK"
     CDS             463170..463532
                     /codon_start=1
                     /locus_tag="lbkm_0436"
                     /product="hypothetical protein"
                     /protein_id="BBF41756.1"
                     /transl_table=11
                     /translation="MPAPIVIKAGDMVIPATLNDTVAAQEFKKRLPFTVTGCKSEVDF
                     CCCTACGVFDPTETQIGWKNGDISLAGGWFAILFAGEEKSSSYRGMMIIAHIEEKYLE
                     LIKGLPYSSKFIVDLEES"
     CDS             complement(463733..464509)
                     /codon_start=1
                     /locus_tag="lbkm_0437"
                     /product="transcriptional regulator, AraC family"
                     /protein_id="BBF41757.1"
                     /transl_table=11
                     /translation="MFTITQGGIFSKHSTSFVMNRPNGLNDYLLLLIKSDSRATIAGN
                     TIECKPNSVMLIKPNMAYSYFNPNGRYVDDWLHFNCEAKDLEELDQGLFHQSIPISNP
                     RLLSTYINQILWEQNYASKEFRSAHVDTLFRILIQHIIADYRSETKEAYHPYRFSMQQ
                     LRLTIQGAPYKSYSIQEVAAQIGISGSYFQHLYKEFFHISFRADLINFRLDYAKDLLH
                     TTNLSVEEIASSCGYASEVHFYRQFLSKTGITPGEFRQLG"
     CDS             464664..465788
                     /codon_start=1
                     /locus_tag="lbkm_0438"
                     /product="putative unsaturated glucuronyl hydrolase"
                     /protein_id="BBF41758.1"
                     /transl_table=11
                     /translation="MNEKDKSWALSIAEQIDKKVKVTSERNQHKIPYTSEKGHFNDCS
                     DQISWWTNGFYAGQLWQLYHAYGEESFKREAEEIEKKLDQNLMDYRGMDHDSGFKWML
                     TAVADYKITGDERSKNRGMLAANNLAGRFNLSGGYLRAWNDAETGEQAGWAIIDCMMN
                     LPLLYWAFEVTRDPRFTQIAKAHADTVIQNFIREDGSVDHIVTFDPATGEKKQALGGQ
                     GLAVGSSWTRGQAWALYGFTLSYIHTKEERYLQTAKRTAEYIIKMIPETGILPVDFKQ
                     GKECEWEDSSAAAIIACGLLELERYVGENDQKRYHDQAVCLLHTLTDKRCNWDNGIDP
                     IVENCSAAYHDKDHNMTLIYADYYFTEAILKLCGKEIFLW"
     CDS             465798..466736
                     /codon_start=1
                     /locus_tag="lbkm_0439"
                     /product="malate permease"
                     /protein_id="BBF41759.1"
                     /transl_table=11
                     /translation="MKNQILFSQMIQLFLMILFGFILFKVKLMSVELNQKLTKLLVDF
                     TLPMLIVSSVLTQQGERELDKVGKVFLISIVLCLVLPVISYVVIKLLHFPKGQQGIYM
                     FMFQYSNIGFMGFPILDALYGKQAVLYTAVLNMIVTLSVYTIGVAMMYAKGEDGTSVK
                     EQIHLNQLLTPGVIGSCLAIVLYFTAIKLPKEITGAIQSVGNLTSPLAMLMIGATLAN
                     MKLHEILDDKRVYVFAVIKQIVFPLLCWPLFRQWISDSYMRGVLFILLLMPVANTAVL
                     FATRYHADEKLAAKTIFVTTVLSILSIPLCFAVTGM"
     CDS             466769..468856
                     /codon_start=1
                     /locus_tag="lbkm_0440"
                     /product="hypothetical protein"
                     /protein_id="BBF41760.1"
                     /transl_table=11
                     /translation="MIFKPKTVDYELSPYTGLGREAWIEAAEHLLQGIFQNIAHFEDP
                     VIMPRKENEITYPHLNAPALIQEVEKRAEIFEGLTRSLFLAAPLLKIKPDLELCGYHI
                     ADYYKAQILRSCSSCDPIAVGSYEKMQELTNHEDPFRAYQQTVETCALVIGLWISRDA
                     IWDTYSKEEKDQIAGFLTTYAHANTVPQNWRLFNMLDLAFLHREGYPIDEEIMMDHAS
                     EILNYYAGDGWYRDGQSFDYYSCWAFNVYGPLWNQWYGYENAPDMAKRFEENSNELMK
                     SYAEFFDADGYTNMWGRSNIYRNASTSAFIGNLFLKHSTVDCGLARRICSGSLMQFIT
                     REDFYDKGIPTMGFYGQFAPLVQGYSCTESPFWMGKAFLCLALPKDHPFWREKENNGV
                     WEQLEKCEVQETTLNGPALCMTNHAANGSTILRSGKVLKKRGDEAGMWNYSKLSYHTK
                     YPWESTPIVTDGETERRNGEVESEQYVLKDLTSGEIQKCNATFWHGEKNRILYRRQFF
                     DFDLSREMTWMQAMNLADYAVPYGIMRVDKIRFYRKPVSVTLGAYGFPDNGTQIIERQ
                     EKNAKALILKGWDSQGRKKQLAMTIYDGWEELKLVKSCGTNPESEHSIILYAVTTRRK
                     QYGSKESYVLVSQVITREDHEDFLDTDLFPIESITYADQMQSGGYGKIAIQMKDGSVK
                     KVEFDRIEGGLSI"
     CDS             469075..470586
                     /codon_start=1
                     /EC_number="3.2.1.23"
                     /locus_tag="lbkm_0441"
                     /product="beta-galactosidase"
                     /protein_id="BBF41761.1"
                     /transl_table=11
                     /translation="MKQTIRKTKFAIKSILSLLFLVAMTFGMSKAASAAPMTEIATNT
                     DVIDHTTSEQSERYYTFTMDKTGYYQIEFGVPDVTANTKAGWVLELYNFETNNLMMRK
                     EVKSKTILPELPFKQGSKFYIKMSMPQNTNALAYNLDYSLKVNTVERNDWEQELNDTV
                     ATANVLKSNQKLIGSLYQCDDTDYYTYTVDTTGYFNMNFAVEDLTMSTGSGWRVMIYH
                     AKNYEKLLTYSFDKTTTLPEMNFAKGTQLYIQVERNVKVTDASVPSNVPYSITMNATN
                     NSLWEKETLCLASDAWGTRTKNATALTLSKTLTGNLWSVDDDDLYKIVMKDNGYLTVT
                     FDPNEVENNLGSGYQVKLVSSSGKQAFDLNTKVKLSKKCYLTKGTYYFEIGRGINCTD
                     ASVPTLRNYKLKASASKSAPSKVANVKVKKQKGNKVNASWKKQSSVSGYQVRYATNSK
                     LTKATMKTTSKNTYSISKIKKGKTYYVQVRSYKTDTFGKKIYGTWSVTKKIKY"
     repeat_region   470685..470793
                     /rpt_type=dispersed
     CDS             470881..474285
                     /codon_start=1
                     /locus_tag="lbkm_0442"
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="BBF41762.1"
                     /transl_table=11
                     /translation="MKREKRGCKRILLFAFSFLLLWGVGTKQAKAEMNSVTSLLIGGT
                     AKDRVTNVGVALQQGEVRYNQGGSADNYKWKVELVTGEDYPTATARITLNNCNIAEEF
                     VYQGSTRMYGIWARGNIELVLIGENVIGNPSYDPESNDSRLAAGIYSENGMISVKGDG
                     TLKLCGCENGMQTSGDGLIKIDGADITVNCIGDSVSGFRSAGDIWIANNVCNITVKDL
                     DGYSYNDFGIQAETTYYDDTKDNVIHLENVQYNYHGSYDAEPLECDNFYISDSKLNLQ
                     TDGYESQSGKSAVYKSAAAKGFNITMQESYLYGTTINMKGGASIEADKLTMQKCTLRA
                     DTSLDSDDYSEIYLKVNELQAAHTTFADSCGDGLYCGNATFEDCEFTYPSGSSRIFGD
                     DIVFKNCTGELGNGVSGKSMVFSGCDFLIESAWGDSAIAVGNGGSGAIEIKNQSVLEI
                     HGKYACISNYNEVDSSVTGDAEKKSVKIIQSKVKLYGARSNSFLVEHCGIYSKGKVMI
                     DGSDLSMELSQEWDKKSAWVGAIYGIQGIKGVEVSNSNIAMDLDILDEDDPSSVAGDK
                     GIVSDGAVKVDRCTVNITSKADGTKGSVGLEGSRINLSDTKFDLDLTQLRGQGIYSYV
                     NLTLKDCTGKIYGGGEGLYNAGNVTIEGGNLHIKANSSTGWGICTEANLTPEYEPGDL
                     TIGDGTRLQVEGNNAAIGILLRGGKQATVYDKLKVSENVYCSKQQESFYWISWDGNDR
                     AAIIGYMDEDYLDFYGATFGGAATKLIYEPSITNCTYQMNDTTFDYTGEPIYPKVTDV
                     KRNGTSLIEGSDYMLHYENNIASGTGYVVLTSLTYDGNQLRIPFTIKRDLVDIKGAEV
                     ALSGHSYEYTGSAITPAVTVTFDQQELKQGVDYTLTYSSNTTVGTATITITGIGSYTG
                     SKQITFEIVEVKPVQQPVQQPEQQPEQQPEQQPEQQPEQQPEQNIQQVEQRRNIVKLS
                     FSKIGTLSYTGTAIKPRITIKDGTKKLKEGVDYSIQYTSNKQIGTATVTIKGKGNYSG
                     TKKLTFTITPKKTMLSSVKAGKKNSMIISWKKDKTVSGYEISYSMKKSFATQKKITVS
                     GAKKTSKTIATVKKGKTYYVRVRSYKVVKGKKVFGAYSKVKTVKVK"
     CDS             474416..474652
                     /codon_start=1
                     /locus_tag="lbkm_0443"
                     /product="hypothetical protein"
                     /protein_id="BBF41763.1"
                     /transl_table=11
                     /translation="MGRYYHLSRQVTNLESAMILRDMKQLKNVKNVEITDDHAYLKVI
                     TMDDQYAEVMTSAVNICSKVARGLELSFRRFVLE"
     CDS             474711..475541
                     /codon_start=1
                     /EC_number="1.11.1.10"
                     /locus_tag="lbkm_0444"
                     /product="non-heme chloroperoxidase"
                     /protein_id="BBF41764.1"
                     /transl_table=11
                     /translation="MGYYIQVESEVKLFVEDLNPQSNDVIVFLHGWPGSHKLFEYQFN
                     CLPKMGYRCIGIDQRGFGQSDKPVTGYDYDRLADDVSAVLCALDLDHVTLLGHSTGGA
                     IAVRYMARYHQERVSRLVLCAAAAPSLIRRSYFPYGQTKETVEKIIQDTYEDRPNMLR
                     GFGNLFFYQHITEAFSDWFFQLGLQAAGWATAEIAKTWLLEEELFEDLKRIHAPTLIL
                     HGIHDQVCYFPLAKAQQHAITNSILIPFRDSGHGLFYEEKDKFNQELMTFICGNNEAI
                     "
     CDS             475709..476428
                     /codon_start=1
                     /locus_tag="lbkm_0445"
                     /product="conserved protein"
                     /protein_id="BBF41765.1"
                     /transl_table=11
                     /translation="MAIKKNSLCIGVDGCKGGWIVASLQNGTLTINKRSSVSEIIQGN
                     PDFDEFFIDMVIGLPGDQQQIRPDQAARRLIKERSSTIFPVPCRQAVYAKTTAEAYDE
                     NVRVLGKKFTPLTLGIMPKMRELDTFLQENPAYRNVLKESHPEVCFSRLNGKTVVTKK
                     SELEGIKERISILKRYINMPTLSKIQALAKEYRCHVDDIIDAICLAVAAYQVHEGHGE
                     VIPKEPMEDDTGLLMRMVIPK"
     CDS             476534..477931
                     /codon_start=1
                     /locus_tag="lbkm_0446"
                     /product="hypothetical protein"
                     /protein_id="BBF41766.1"
                     /transl_table=11
                     /translation="MSNLDREKIAEETLQIIKNGFYVKNDVKIQLPHADYKKVQLFNP
                     QTVDAIVNDEDEMLERCLNASKECAIHVENMDSYEAVHRFDMDHALVMNFANAVTPGG
                     GFLHGANAQEESLCRNSTLYKSIGSVQAKEMYDYNREIQSPIDSDYMILSPEVCVFRD
                     SRAQLLDHPYMTAVLTIPAPNLNGRAKGLDRDEIRDVMLHKIKTFLYVAARYGYRKLV
                     LGAWGCGAFGHDARTVAGYFSTLLIKEKYWQFFDEIVFAVYDHSDEQYNYQSFAEVFQ
                     DYKYLGDTREVVAKADDNFILFSDLMPCVSGGFDHVNRDYDIGYTQGIFLDGKGFIAE
                     LFNLEGMQDKQVAIVMPEKIFIGLSEKEYVADFKTGSEETWNIAICQDIKDKKEIVDP
                     SVIEQVSNYLEENQVMDFNNGFQAFGCKGKDLNGENVIVMGYTLGEGNRVICKTNLEF
                     WHYEDKWRRMRIKCY"
     CDS             477922..478362
                     /codon_start=1
                     /locus_tag="lbkm_0447"
                     /product="hypothetical protein"
                     /protein_id="BBF41767.1"
                     /transl_table=11
                     /translation="MLLGSVYLIVKDFQKTIHFYETLLEQKVSAKNMERFASFEFGGH
                     NISIMNGYFDTEHPDLTEHKGKVEPKFDDLKAIAEAPNTRKFVLNFWTEDLRKERTRI
                     IDAKISNLVTEIKYVNNVMPYYYFQVEDPDGNVIEITGNYNEEA"
     CDS             complement(478433..479644)
                     /codon_start=1
                     /EC_number="4.3.1.17"
                     /locus_tag="lbkm_0448"
                     /product="L-serine dehydratase"
                     /protein_id="BBF41768.1"
                     /transl_table=11
                     /translation="MKSLKDLYKAGNGPSSSHTIGPSNAARKFVMEYPDEDTYKVILY
                     DSLAKTGKGHRTDNAIQMAFAPKEIEIVFDPDTKDLPHPNTMDFFAYKAGKETAHWRV
                     LSVGGGAIKILGRETEDLPDIYPLTTFDDISKYCKEHNLRLWQYVEEIEGPEIFEYLS
                     NIWTIMKASIYDGLTATGNLPGALHIPRKANQLFSEHHMDESPQTKENRIVCSYAYAV
                     AEQNASNGVVVTAPTCGACGVLPAVLRYEQDVKGYTNDDIIHALATAGLIGDLIKTNA
                     SISGAECGCQAEIGSACCMASAALGELFGYDLHQIEYAAEVAMEHHLGLTCDPVLGMV
                     QIPCIERNAVAAMRAINAVTIANFLSDSRKISFDEVIHTMYETGKDMHSRYRETSEGG
                     LAKLYKDSGLD"
     CDS             479783..479917
                     /codon_start=1
                     /locus_tag="lbkm_0449"
                     /product="hypothetical protein"
                     /protein_id="BBF41769.1"
                     /transl_table=11
                     /translation="MNIKRMQEDEHLIGVIATRSEGSHIALFFVNGDLSSSRLCGYGV
                     "
     CDS             480048..482720
                     /codon_start=1
                     /locus_tag="lbkm_0450"
                     /product="ribosome protection-type tetracycline
                     resistance related proteins, group 2"
                     /protein_id="BBF41770.1"
                     /transl_table=11
                     /translation="MKKIVIGILAHVDAGKTTLSESMLYLSGKIKKLGRVDNKDAYLD
                     TYELERARGITIFSKQAILETEKMQMTLLDTPGHVDFSAEMERTLQVLDYAILVISGA
                     DGVQGHTKTLWRLLERYQIPVFLFINKMDQPGTNKEALLEELKTNLNDGCIDFTQTET
                     EEFYDQIAMCDEKLMDEFLDTGSIEEFKIIDEIKERKIFPCFFGSALKTDGVEEFMDG
                     IARFAKMAIYPDEFGAKIFKIARDEQGTRLTYLKVTGGSLKVKMPLTNQADGRKAEEV
                     WEEKVNQIRLYSGEKYEAVNEVEAGSICAVTGLTMTKPGEGLGREAASIVPVLEPVLS
                     YQIILVDGLDPRMVLPKLKQLEEEIPELHIVWNEKLQEIQAMLMGEVQIEIIKSMIAE
                     RFQIAVEFGEGNIVYKETIANTVEGVGHFEPLRHYAEVHLLLEPGERGSGMQFATSCS
                     EDELDKNWQRLIMTHLEEKEHRGVLTGSYITDMKITLVAGRAHKKHTEGGDFREATYR
                     AIRQGLKEAESVLLEPYYEFRLELPNQMVGRAMNDVEKMCGTCELTQNEGEMAVLTGS
                     APVVTMRNYQQEVIAYSKGHGRLFCTMKGYEKCHNTEEVIEAMEYDSERDIMNPTGSV
                     FCAHGAGFLVTWDEVKDYMHVESVLKEKKETALTQKRVLEVEEEPDWIGTDEIDEIIA
                     RTFYANTGNNMAWKKNREKAKDYSSGPTTFSAPRKEKKEEYLLVDGYNVIFAWESLNE
                     LAKINIDSARGKLQDILCNYQAIRKCELIVVFDAYRIEGHQTEIFNYHNIHVVYTKEA
                     ETADQYIEKFAQQHGHKYDVTVATSDGLEQIIIRGKGCQLLSARDLEKEVKRANEITM
                     KAYEEKKQGKNFLFDQLSKEAGAEIETYLKNIIE"
     CDS             482819..483742
                     /codon_start=1
                     /locus_tag="lbkm_0451"
                     /product="Ion channel family"
                     /protein_id="BBF41771.1"
                     /transl_table=11
                     /translation="MGKVLIYLVTIICAIVGLSTFRRIRANMKYLFKWINDGYLTVYK
                     RQAKWKRYGMNLFGVLSVIFATLITYERTLRLTDRRVDGEFFLLFIGITIVVLFLIYL
                     VLGILFEIVIVLDKIVNAMRKTMITTKILVSFGILAVYLGVALYSAKEIKECIWVCYI
                     GLMISYILNIQVLMKIVSNPMCFLRDSKTFRYADKHQQNRDGVIIILGAIFVLCMLIL
                     NLYLAVIFIRFSSKGAYLCSSGQPITNWSLFYYTVISFTTIGYGDIVPTNIPSQFMAI
                     VISVTSVLCLIIFMSSILGIKDKLSKQGEES"
     CDS             483846..484304
                     /codon_start=1
                     /locus_tag="lbkm_0452"
                     /product="hypothetical protein"
                     /protein_id="BBF41772.1"
                     /transl_table=11
                     /translation="MQQFQAEIKQVEGKDASYIEIPFDVEEIYGKKRVKVKATFDGVS
                     YRGSIVKMGLPCYMIGMTKEIRKAIGKSFGDIVIVTVEEDKEERQLELPEEFMNELGK
                     QEQAKQFWESLSYSAQRKFVQWITSAKKEETRLKRIQSSIEKLEHHEKIS"
     CDS             484318..485013
                     /codon_start=1
                     /locus_tag="lbkm_0453"
                     /product="sugar/maltose fermentation stimulation protein
                     homolog"
                     /protein_id="BBF41773.1"
                     /transl_table=11
                     /translation="MKYENMKEGRFLSRPNRFIAHVELEGQEVVCHVKNTGRCKELLI
                     PGETKVWIQDHGENTTRKTRYSLINVVKNTSHGNMMINMDSQAPNKVAKEWLENGGFG
                     KEVTFIKSEKTYGDSRFDLYFEYVGEDEKIVKAYMEVKGVTLEEDGEVRFPDAPTSRG
                     TKHIEGLMKAKKNGYDAYILFVVQLETFHSFAANAATDPAFAMALSKAKKQGVHILVK
                     GCHVTKDTLEIIR"
     CDS             485061..485690
                     /codon_start=1
                     /locus_tag="lbkm_0454"
                     /product="HD domain protein"
                     /protein_id="BBF41774.1"
                     /transl_table=11
                     /translation="MLPSIDDALEELRIAGEMNPGPWTKHSINVGIAARNIAEKIPEL
                     DANQAYIVGLLHDIGRRVGIVNIPKHVYEGYQYCINRGWNEAAKICMTHSYVLMQKEF
                     DYEPTTEEERFIKDYIMNCELDDYDRLIQMCDALATDYGFVILEKRFVDVTRRYGIMK
                     KYIAGWDITFETKEYFERKMGCSIYDVLPDIEKTTLLSPKPWVPPVTKD"
     CDS             complement(485814..486848)
                     /codon_start=1
                     /EC_number="4.1.2.48"
                     /locus_tag="lbkm_0455"
                     /product="low-specificity L-threonine aldolase"
                     /protein_id="BBF41775.1"
                     /transl_table=11
                     /translation="MIRFNCDYSEGAHEKIMEQLLATNMEQTEGYGLDPHCENARKLI
                     KKACNDDTLDVHFLVGGTQTNLIVIAAALRPHQGVLGAESAHVNVHETGAIESCGHKV
                     LTLPSDDGKITADQVETYYNDHYSTDGREHIVQPKMVYISQPTELGTLYTKAELTAIS
                     EVCRKHNLILFVDGARLGYGLTAKGNDVTMEDLAALSDVFYIGGTKVGALFGEAVVIR
                     SEALKEDFRYIIKQKGAMLAKGRLLGIQFETLFTDDLYTKISAHANEMADLLRDAFTK
                     AGFDYLVPNTTNQLFPILPDRALAKLESKYSFAYQERVDATHSAVRFCTSWATKEEDV
                     KTLIADIENL"
     CDS             complement(486875..487210)
                     /codon_start=1
                     /locus_tag="lbkm_0456"
                     /product="transcriptional regulator, HxlR family"
                     /protein_id="BBF41776.1"
                     /transl_table=11
                     /translation="MKQIMSIHCPVEATISLIGGKYKVVILYHLVKKTLRFNELQKLT
                     PNATPKMLTQQLRELERDGLINRKVYPVVPPKTEYSLTDFGESLIPVLDSLCAWGTEH
                     QDQISLIRS"
     CDS             487318..487812
                     /codon_start=1
                     /locus_tag="lbkm_0457"
                     /product="nitroreductase family protein"
                     /protein_id="BBF41777.1"
                     /transl_table=11
                     /translation="MNSIFTRTSVRAYTNEVVSEEKIKQLLKAAMAAPSAGNQQPWEF
                     YVVEDRDTLEALSKTSPYAGCVKGASVAIIPCYRTKKLMFPEYAQIDMSIACQNIWLE
                     ATELGLGAVWLGIAPLEDRMDAVGKVIGLPEELKAFAIISVGVPAKVKDQQDRYDETR
                     IHRL"
     CDS             487919..488368
                     /codon_start=1
                     /locus_tag="lbkm_0458"
                     /product="hypothetical protein"
                     /protein_id="BBF41778.1"
                     /transl_table=11
                     /translation="MKLELQQDNQVKETEVRIRYAQMDSRIDHMVTYIRQYDHCIEVS
                     LEGEHMTLPLETIYYMDCADGRTFVYDQSKVYECKQTIRQLAENLADTSFVQISKNCI
                     MNTSYLKSFKPYPNHRLLAKMKNNEKLIVSRKYIDQVKESIRRGWNA"
     CDS             488361..488786
                     /codon_start=1
                     /locus_tag="lbkm_0459"
                     /product="hypothetical protein"
                     /protein_id="BBF41779.1"
                     /transl_table=11
                     /translation="MRKWVEVYIPALCMGFTFIICGICLSELFAGNESREFALWILEF
                     LGFLALTMIVDMLISNIDFKTYTGHLLAEMAACYPLLLLACYLGHWIGFRFYPILLVS
                     LIYVICMGLIHLYYYEMSKRQAEELNEMLRNGGKDGKSN"
     CDS             488770..489387
                     /codon_start=1
                     /locus_tag="lbkm_0460"
                     /product="putative protein-S-isoprenylcysteine
                     methyltransferase"
                     /protein_id="BBF41780.1"
                     /transl_table=11
                     /translation="MGNPISFHNIVEYDVFQITFLCLVLMESIIWFMTSSPFRKEKAK
                     KSSDHGSMILIMAGFYICIYISIKAVSQDMVAAIRNLVLPAFLSYIGIGVVWIGIVVR
                     IMAVLKLKKAFTYNVQVADEQNLITDGLYHIVRNPAYTGSVISLIGIALAFRNIVAII
                     LVIGICRFCYGKRIQIEEKALKNEFTNEFIAYCNRTKYRVIPFIW"
     CDS             489470..490033
                     /codon_start=1
                     /locus_tag="lbkm_0461"
                     /product="transcriptional regulator, TetR family"
                     /protein_id="BBF41781.1"
                     /transl_table=11
                     /translation="MRISKDPEVRKQEILAAAMELFDEKGYEATTMTDIAKRVGVVSG
                     LCYRYFKSKHELYETAIQSYVTECSAEMIKVLTRDEENLEVYFKLLENSFLKSDGKEM
                     YHDFFHKKGNEMFNAQMSCAMCDHVGPYMEQFLERMQEKGMIKVTDCRAASGFLLYGQ
                     IPILNDESLSSEEKVERVIELIKKVIY"
     CDS             490129..490917
                     /codon_start=1
                     /locus_tag="lbkm_0462"
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="BBF41782.1"
                     /transl_table=11
                     /translation="MKGKVLITGATSGLGLGFATEYASQGYDLIVTGRRKEKIEANMD
                     AIRKKYGVKVKVILVDLSSEEGLTYLLQEIAGEEIQVLINNAGFGLKPCFSDLSEDQL
                     NRMLFLQTAVVTRLTHDVLQQMIQRNEGTIINVSSDSAFAVMPHNVLYASTKTYIMTF
                     TEGLYMELVDTNIKVQVICPGFIDSDFHENAQMKVNKARKGFMKFHSPEEIIAKSKKD
                     LERGRIVCKPSRDVKVIALLSRILPRRWFYKIILSMASKLMHKK"
     CDS             490947..491180
                     /codon_start=1
                     /locus_tag="lbkm_0463"
                     /product="hypothetical protein"
                     /protein_id="BBF41783.1"
                     /transl_table=11
                     /translation="MIYIFYALDEVTYELIEGIIKEFYRLLKNDGRLVIKEPKRKGDG
                     MPAEEIENLMSQQGFYKKTAIQDKDTFTAEYRK"
     CDS             491270..492862
                     /codon_start=1
                     /locus_tag="lbkm_0464"
                     /product="esterase/lipase"
                     /protein_id="BBF41784.1"
                     /transl_table=11
                     /translation="MMRKQVSYFLVFLLAATIFTGCAKEPKSEASEPKNTPKEKAKAM
                     ATMAPTTSKSLAFPTEDYEEQTETVPTSAGERVVTYRYYKHICYVKQPVDSDYQSMDV
                     KVPIRIDNEEIDASEAPILFANSVGGYLSASNADTEGNNQFTEDIRTEEEKASGKQDP
                     MKRASKDELNINNKLALAAGYVVVEPGCRGRDNQDKDEKFYGKAPAAVVDLKAAIRYL
                     HYNDETMPGNADYIITTGTSAGGAISAVLGASGDSILYEDALNKLGAANASDKVYACA
                     CYCPITDLNHADMAYEWMFGTSKVEGKLVDQNMSKELKAAFREYQQSLMLEGKNHYGV
                     LSADNYSDYLLQEYLIPAANRYLKNLTDSERATYLKNNPWIIWKEDNASFTFADYQSH
                     IGRSKQLPAFDALDLSTAENSLFGTNTTNARHFTKFSIDNTTVVANEVIDLSLEDTIN
                     MMNPMYFIDKQNKTCADYWWIRYGTSDTNTSLPVIVNLATALENTGHQVDLSMYWDGG
                     HGANEDPEEFIAWIGQVTGYPE"
     CDS             492964..493635
                     /codon_start=1
                     /locus_tag="lbkm_0465"
                     /product="two-component response regulator"
                     /protein_id="BBF41785.1"
                     /transl_table=11
                     /translation="MKTILVADDELDIRIMLKEYLELEGYFVITAGNGAETIKQVAKN
                     PDLILLDINMPDIDGFTVCEKIRDYLSCPILFLTARTEEMDKVNGFRAGGDDYIVKPF
                     GIEELLARVKAHLRREERSKLNHHIYMNGDLVVDFSSHVVTIDGEEIVLTNTEYKIVE
                     FLITHAGRVFDKEQIYEKVRGYDGDADATIVTEHIRRIRKKMKVQENNEYIKTVWGVG
                     YKWIG"
     CDS             493623..494807
                     /codon_start=1
                     /locus_tag="lbkm_0466"
                     /product="sensor histidine kinase"
                     /protein_id="BBF41786.1"
                     /transl_table=11
                     /translation="MDWLEEQYLRVKAYFTRSSLIKSLIFYCLTGMVSAVILSLFVNN
                     ICSSWLAALLKHYKTAWYYSNGGLGYEVLGIPNGVKKWIYLCLYIKRYSLVVNLVIMQ
                     ILSITLCYKQKMKSVFQAINEQMNYIKAGDYSHQIAIQGENELEQLSGEVDLLCKLLL
                     EEKRQRWNEDEEQRTVNAAFAHDIRTPLTVIKGYTEFLLKYIPEGKVSEEKLLEKLSI
                     MQAQEIRLFEFSKTMTTIQAMEKWELKCKNIGMDELIRQIDQSINGVKETTTKRIEVD
                     FDLEEKQDILLDEHLVLEVMENLMNNAIRYATEQIHILIEEKDSFLWIHVSDDGPGFS
                     TNALRHASEVYFSEADKNSEHFGIGLTIARMLCKKHKGNLYLINGVESGAICSGSIYI
                     SR"
     CDS             494865..495746
                     /codon_start=1
                     /locus_tag="lbkm_0467"
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="BBF41787.1"
                     /transl_table=11
                     /translation="MMETTIQIHNLTKKYKSTCALNQINLEIHQGMFGLIGPNGAGKS
                     TLMKILATIQNKTEGEVTICGLPLEKRSEVRSMIGYLPQEFSMYGNMTVYEALDYLAV
                     LSGLDRSTRKRQIPKTLELVNLAQQAEVKVKSLSGGMKRRLGIAQAILHDPKVIIVDE
                     PTVGLDPEERVRFRNLLCELAENRIVLLSTHIVADIEATCDQVAVISEGNLIFQGHIQ
                     ELLQKVDKKVYSVEISTTELSMIKKKYLVTGILTTGAVSRVKIVSDSVPLPNAKQVEP
                     DVEDAYLYFMHQKNGEV"
     CDS             495750..496907
                     /codon_start=1
                     /locus_tag="lbkm_0468"
                     /product="hypothetical protein"
                     /protein_id="BBF41788.1"
                     /transl_table=11
                     /translation="MLWSLIKKECSQIVRSFSFYLYLIIFILFVTSQFGDIPHLQKPV
                     PGLKDYGTTSSKDPEVIMKDGLNNLFLELCNNKFATYPFMIIKNVNLDKQDLERAKEY
                     FKDCTGVEFDQARADETYQVKVKKDLEYSHFLNDMKQLCKLIGSGSYYEKDNLENRVE
                     RPMTYKEALKEYEDICRIDHITNAYNRVFCDYVGIILAILPMLLGVTRAVRDRRSNAI
                     EIIYAKQISAARLLLSRYLANVIMTMIPVYVVGILAQLPIVFDAKVANLSVSYVTLIK
                     DMTIWLLPEIMVVLACSSLLTELFGGLLAIIGQTVWTISSLASSMTLMGHFGYHLIIR
                     WNQVGSSRLFLQTRTQLYQNRGFFFVFSILLLAANIAIYEYKRRRGGVLLG"
     CDS             496867..497517
                     /codon_start=1
                     /locus_tag="lbkm_0469"
                     /product="hypothetical protein"
                     /protein_id="BBF41789.1"
                     /transl_table=11
                     /translation="MSIRDVGEVYCLDRYIDYLKIYLRKQYSPHILLLLALAVCSNGV
                     MSYGNLTLQQSATVFEMYYLFIGIILFTPLFTAEQDEKIREVVLAKEMSYWKLCLIRF
                     LFALTVLLVSTAMVLYVLIENGSRTNGLCMWWIACCEMLLVGGVGYMISAITNQVLIG
                     YLCAILYYFGSIYGGNKLSVCNVAQMMAGNYHEWPYTLVIGAMLFTAGFYIRVRRK"
     CDS             497597..497995
                     /codon_start=1
                     /locus_tag="lbkm_0470"
                     /product="small membrane protein"
                     /protein_id="BBF41790.1"
                     /transl_table=11
                     /translation="MGKVMYKMVDIIADIHRYILSINDSNQIGLTDKQLHFIVIGILG
                     MLMLFVVYPVFKWLSEKHVMVIAWIYVFTLLLVITFAIEIGQKLTNTGNMEFADVMFG
                     LVGFLIMFTIFSVIRSIYHLILDCIDKYMK"
     CDS             498052..499470
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /locus_tag="lbkm_0471"
                     /product="putative tryptophan synthase beta chain"
                     /protein_id="BBF41791.1"
                     /transl_table=11
                     /translation="MIGNCVAIPYKTERREGMKREIPYKIYLEESEMPKAWYNLRADM
                     LHKPAPLLNPATLQPMTKEELMQVFCEELVEQELDDRTRELPIPKEIQNFYKMYRPSP
                     LVRAYCLEKKMGTPAKIYYKFEGNNTSGSHKLNSAIAQAYYAKKQGLIGVTTETGAGQ
                     WGTALSMACSYFDLACKVFMVKVSYEQKPFRREVMRTYGASVTPSPSEATEVGRRILA
                     EHPGTNGSLGCAISEAVETSMKTKGYRYVLGSVLNQVMLHQSIIGLETMAALKKYDVK
                     PDLIIGCAGGGSNLGGLIAPFMGEKLRGEADYEFIAVEPASCPSLTRGTYSYDYCDTG
                     KVCPLSKMYTLGSGFIPSPNHAGGLRYHGMSSTLSGLYHDGYLKARSVEQTAVFHAAE
                     EFARIEGILPAPESAHAIMVAMEEARKCIQTGEEKTIVFGLTGTGYFDLYAYESFHDG
                     KMKDDIPSDEDLEKSFAMLPNV"
     CDS             complement(499547..499678)
                     /codon_start=1
                     /locus_tag="lbkm_0472"
                     /product="hypothetical protein"
                     /protein_id="BBF41792.1"
                     /transl_table=11
                     /translation="MKGKNAKKQATSKVSEAISGGTEGGSTVVANKKHHKKPKKQYL"
     CDS             499956..500411
                     /codon_start=1
                     /locus_tag="lbkm_0473"
                     /product="response regulator of the LytR/AlgR family"
                     /protein_id="BBF41793.1"
                     /transl_table=11
                     /translation="MRIQIEVEESLQENEVIIRCNQITDDVIALQKAISQQSSSMNQI
                     VFYKGETEYFVVLDDILFFETDETGICAHTKKELYQVKYKLYELEELLPGHFMRVSKS
                     TILNINRIYSITRNLTGASLVEFQDTHKQVYVSRYYYKPLKCRLNEKRN"
     CDS             500413..501117
                     /codon_start=1
                     /locus_tag="lbkm_0474"
                     /product="membrane protein"
                     /protein_id="BBF41794.1"
                     /transl_table=11
                     /translation="MRKSNILWGIIFILFGSLLIVSKLGLVANVNLLTLGITVILVVV
                     MLKSLWNLQFGGVLFPLAFIGILYDEQLGITAITPWTILVAAAFASIGLDMIFHKCKV
                     KVNLGHHYHKNHHDPDVINIDDDSYVSQETSFGDSVKYINSNDFKRADLSCKFGGLTA
                     YFDHAILQGDSAVVNVDCSFAGIELYFPKEWKIDIQMNAVFGGVEEDGRNTADGSKVV
                     TLLGDVRFGGVEIHYV"
     CDS             501129..501905
                     /codon_start=1
                     /locus_tag="lbkm_0475"
                     /product="xylose isomerase domain protein TIM barrel"
                     /protein_id="BBF41795.1"
                     /transl_table=11
                     /translation="MEFGMPTLIECHSLEENAILAKKLGLSFLELNMNLPEYQIGNMD
                     LDHFQEIQRKYGIYYTLHLDENLNISDFNELVATAYLKTVQQAIAVSRRLNIPILNMH
                     LSEGVYFTLPDHKEYLFQQYQDVYLAQMRRLKEKVSEWIGDDPILICIENSDGFHPFH
                     KEAISLLLESPHFGMTLDIGHDAIAKQSDLEYILQTQRLRHIHLHDFNDRSCHLPLGT
                     GNVDVNKMLSLAKSYGTRVVLETKTISGLKESVEYVRKQV"
     CDS             501908..502819
                     /codon_start=1
                     /locus_tag="lbkm_0476"
                     /product="magnesium and cobalt transport protein CorA"
                     /protein_id="BBF41796.1"
                     /transl_table=11
                     /translation="MFYRIQDGRLVESKKDHWLTMQNGVGIVTPEEWRSETEIREKYQ
                     LTRNQDNIRFCKLECFSEYAFGTIHIPSKKAGKSSTSFAFYLVDRKIIFVDRTGYVKK
                     LLRKMNERGLRPKDTIERFLYDFLVAITEDDLIYLESLETKIAKEEEKVLANQADEFN
                     QTMLELKKEILKLYRYYSQLMDVGEGLAEDISDLMEETHVELFRIFSQRVERLKTETQ
                     MLREYAMQVQDVYQSEIGIRQNDVMKILTIVTTIFLPLTLIVGWYGMNFSHMPELGYR
                     YSYPIVIIVSVLIVVVSIWGLKKKKYL"
     CDS             502934..503812
                     /codon_start=1
                     /locus_tag="lbkm_0477"
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="BBF41797.1"
                     /transl_table=11
                     /translation="MLDKVTFMETLRSVAEIAKTSPEPLKREEVDQYFEGMDLSKEQR
                     EMVYQYLLNPVEEETKEEETTPESDQEATETVENKNEKLSDSAFFQMYMEDLNELDKY
                     TVDEVNDMFQKLQSGNEEMIAKLSDYYLPKVIDLAKQYQSRTVNMEDVIQEGNIGLLY
                     GLKQLAGDRQVTDAEGYLIQSIKESMEQFIDEMANEGDWENTVVAKANLVYEAQKILA
                     EQMGRVPSNEELAEYTKLSLNEIDDIVGLFKKESSSTAKEESKNVATKETTKETMTET
                     TSQDMDTPWSDFKYDK"
     CDS             504479..506800
                     /codon_start=1
                     /locus_tag="lbkm_0478"
                     /product="cell surface protein"
                     /protein_id="BBF41798.1"
                     /transl_table=11
                     /translation="MKDNNKVRRVALMLTVCLFIGSLASSNYVIATTINSVTGTDTKD
                     QQEENLLPLEEALYSIPTDWENDVWVNRDYKELTIGETDQIYPRRIPQIVGSSVANDI
                     WRPTFHFTIVEGDSVTLNHKDSNQDATVTAVKPGISIIKVTYDRTTYKGTTYGASSNS
                     NSAYIIYEVAEKGNRADIKIETSITETPYDTVYYQNGNYVPYTFTVSTDRAKSRVVSC
                     NGSILKGEDGSYTARLENRSNIIGITATDQEGKTRSKYYVIDARKIAISVVNKTRGGT
                     KIFAGDKIGISFKGITNPVPKLASIYNPTFYSPNYGNKGTCVTYTNELLGKVSGYCKQ
                     WDLATNNTIEVQFQKEGTYTFTNGQITSQWWGEKLGTDREVITLPQNTNAATNEGTFS
                     SLPEFTIEVEKAGENTPAVTGIQLNKKRISLLEGGKYQLRAKVLPRTAGNQKIRYESS
                     APSYVKVNQEGKITAIKATGNKQVMVRAISDEGNYIASCKVQVNKKPVIDFDQAEESV
                     SPKPTKAPQRTKEPDKDKDQKNQTATPVPSASTKPVQSTESLSKEAKEVKKVVTSLNK
                     KFSDKDLLKTYRIYNALSKKEKKKVDPNGLLKQAVEKMIKTNHQDKKTDITIWNAENQ
                     TRLVVEEKEDLITKMQQKVRGYTLIKLWNISLFDIETDKEVEPEKTVKISVPLKESDD
                     YDGYVIVHFTDDGKVHYIKAELKADQLIFETPSLSNFGIIGYQGASPLDLNAAVKKED
                     HIPWTVVGIGAGLILLLGVVMGYRMKNRTKSAE"
     CDS             506810..508039
                     /codon_start=1
                     /locus_tag="lbkm_0479"
                     /product="cell surface protein"
                     /protein_id="BBF41799.1"
                     /transl_table=11
                     /translation="MKKKIYANLAMVIIMIAIVCGGSYYVFNLKTGHDNDQIATVERV
                     KGNVDIERKGISYSLAEKTKLAKGDSITTREGSSFAIQIDEKNEMNLDEDSILEIKEK
                     NQFSLKSGNLFVTIEQKEPVIIQVDSYHIKVSDATVGVSSYQGSKSFCVLSGEVTYLN
                     GDKENKISDGMMVTISDDGKAIKETLKAESLNDFFLSQAGESASTAISKKEIQTVKEE
                     RKEQVDQVVKAEKEEATKAPISNTVEASTKPKASKEPTKKEDKETPTASPKATSAPTA
                     KPTDKKYVKVAIVCDTILNNWDDLKKGKSKYVPSNGMILNAMKIELKDGDTAYDVLKR
                     ACSQKNIQLEASYTPGYGSYYVEGIHQLYEFDCGSGSGWTYKVNGYKPNYGSSSYQVK
                     DGDVILWSYTCDYGNDI"
     CDS             508054..509682
                     /codon_start=1
                     /locus_tag="lbkm_0480"
                     /product="duplicated ATPase component CbrU of energizing
                     module of predicted cobalamin ECF transporter"
                     /protein_id="BBF41800.1"
                     /transl_table=11
                     /translation="MEHIKIEHLSFNYPEEEKPALNDISLSIKKGEYIVICGISGSGK
                     STLLQQLKPAMSPHGNREGTIYFEDQELSTLSFEEQSSKIGFVMQDPSQQIVTDKVWH
                     ELAFGLENLGLSQEVIRQRVAENANYFGIQTWFHKKVTSLSGGQKQLLNLAAVMAMQP
                     DVLILDEPTSQLDPIAAEEFLNTIRKINADLGVTVIITEHRLEEIAPFADRMIVIDEG
                     KICLDAPIRKAASILHELEHPMFEALPTPMKVYAALKKKDGGESPITIREGRNFLSET
                     ITEHRELGLPKEEKIEDSEVIAQMKEVYFRYEKKETDILRGVNLQIGQTDIYAIVGGN
                     GSGKTTMLKVLSGSLRPYAGKVKYAKGQLSQNEIALLPQDPLSILIHRSVREDLIEMI
                     ATSDGAEQTVLAMADKFGIQHLLDRNPSDLSGGEKQRAAIAKVMLRNPKLLLLDEPTK
                     GMDADRKQQFAKLLKELTKEGVSIVIVSHDIEFCARYATKVSMFFDGIIMATNTPRKF
                     FANNNFYTTAANRMCRHICKDAITEEDVIILCQS"
     CDS             509670..510260
                     /codon_start=1
                     /locus_tag="lbkm_0481"
                     /product="substrate-specific component CbrT of predicted
                     cobalamin ECF transporter"
                     /protein_id="BBF41801.1"
                     /transl_table=11
                     /translation="MPILSCSIIIGIATLPYLIRYLKKKLTMREVILVGTFTLAAVLG
                     RVVFQFFPFIKPLVAITMLAGMSMGMGAGFFCGSVSAVLSNFVFGQGPWTPCQMICFG
                     LAGALMALIYNKKKESQLAPFIGGMLVLVVIGPLLDISTEIVKDGTFLSEQIVAVIHS
                     GIPANAVHGISTTIFLLLLKNPVLTRIDRICKKYGI"
     CDS             510273..511145
                     /codon_start=1
                     /locus_tag="lbkm_0482"
                     /product="transmembrane component CbrV of energizing
                     module of predicted cobalamin ECF transporter"
                     /protein_id="BBF41802.1"
                     /transl_table=11
                     /translation="MRFDHYYPIISFFYFVSILFCTIRFDHPICIAITLVAACIYTIR
                     LNGFKKMFFCIFAIAVGFLYAIYYSSYQHFGITTLAINFVGNEITLESILYGVARGMI
                     LSSVLMWFSAIHVIFTREHILFLFGKISSTVSLFLCMALRIVPDTVTCYREMKQARKS
                     LGYSKRRVLLEEKLILSAVLTRQLESFVEKTKSMKNRGFSMRHRTQFAIYRFDHRDRS
                     LVIVMTMLVTVIGMGYALEQMNMSYDPELVMGKMTGMSLLFYGAYGLFCLLPFLLQTY
                     EEIHFARLRAKQMK"
     CDS             complement(511198..511695)
                     /codon_start=1
                     /locus_tag="lbkm_0483"
                     /product="substrate-specific component CbrT of predicted
                     cobalamin ECF transporter"
                     /protein_id="BBF41803.1"
                     /transl_table=11
                     /translation="MINTKLLVSLAMLTSILLLGQIALAPLPNIEIVSLLIILYTLLL
                     GKYVYYIIYGFAVLEGLVYGFGLWWFMYLYVWTILAIITMIFRKNRSPVFWAIVSGLF
                     GLSFGFLCSFPYFITGGIGGGVAFFLSGIPFDITHSIGNVIVALILFQPLYSILKRFL
                     PGTES"
     CDS             complement(511710..512099)
                     /codon_start=1
                     /locus_tag="lbkm_0484"
                     /product="hypothetical protein"
                     /protein_id="BBF41804.1"
                     /transl_table=11
                     /translation="MKSRKNLVGALLLILLIVAMFFLYKATAPKTNDSEKRVSVTVIH
                     LDKSRKEFNYRTNAKFLGDLLKKEKLVKGEKGQYGLFITTVDGEKADDSKKQFWSISK
                     KGKSVNTGVDSTPLADGDRFELTLTTY"
     CDS             512210..512794
                     /codon_start=1
                     /locus_tag="lbkm_0485"
                     /product="acyl-phosphate:glycerol-3-phosphate
                     O-acyltransferase PlsY"
                     /protein_id="BBF41805.1"
                     /transl_table=11
                     /translation="MERLLCMMIGYGCGNFLTAYFVVKMKLDKSIFMLGSGNPGMTNT
                     IRVLGKKYGSIVLAGDLSKTILAYLIGLILVPKERVIVALYTGIGTVLGHNYPIWYHF
                     HGGKGVATTCMALVLVDPIIGISSCLLGLIVVVLVHSLAYGAVIIPMIFWISTCFGQN
                     RESSMITGLLSLLMLVKHRKGLWDGKEKDGGKER"
     CDS             512791..513015
                     /codon_start=1
                     /locus_tag="lbkm_0486"
                     /product="hypothetical protein"
                     /protein_id="BBF41806.1"
                     /transl_table=11
                     /translation="MNFGSTMKMAKMWKEFQGEHPMFCRFLNAVKTEGMREGTILEVV
                     VTTPEGKKMTSNIKVSRKDMELFQNLGNLK"
     CDS             513348..515258
                     /codon_start=1
                     /locus_tag="lbkm_0487"
                     /product="oligopeptide ABC transporter, periplasmic
                     oligopeptide-binding protein OppA"
                     /protein_id="BBF41807.1"
                     /transl_table=11
                     /translation="MKKMKKQAVSLLLVLAMVLATVTGCGNNSGVSSDNSKNTTKDKK
                     TEDTNKKETTTKVTNRTPAGKLVIGQNTDLTGDFMTGWTNGAADMDVRRLTQEYGTVV
                     RTRDGSMQLNNTVVKKLDTKENSDKSKTFTYTINKGLKYSDGTEITAKDFVFYLLLNS
                     CKAFGDSEADITMYTVFDGYNDFSTGKKKEFKGVRLLGDDQFSVTISAKELPDYYDMA
                     RTAASPYPISVYLPGVDVKDDGNGAYFTKDVTKAMIKKTIEKERYNPTIFSGAYTIKD
                     YNKSAGTVTLEANTNYAGNYEGQKAQIKTLVIKKYNDDTAIDELKTGNVDLLISAGGG
                     DVVNAGLDLADKGEYKYNNYYRNGFGKVVFTCDLGPTQFVKVRQAIAYLLDRTEFASQ
                     YTGGYGTVVNSNYGLAQWMYTDMKDKVDKELNTYAYNVDKAKELLVSDGWTLNKDGKE
                     FKEGKDDVRYKKVDGKLMPLEIQWANTANNPVSDLLSTMLPDNMKKVGMKLKPTTLDW
                     GVLTNNVLRQGIDKPVYNMYNMASEYGDIPSYEMEANPDKAYGGLYNENWINDKELFQ
                     LAKDLKATESTDREGYDAKWLKYIKRWNELLPSLPLYSNEFYDFYNKKLQNYSATSVY
                     SYSYDIIYSYVK"
     CDS             515379..516362
                     /codon_start=1
                     /locus_tag="lbkm_0488"
                     /product="oligopeptide transport system permease protein
                     OppB"
                     /protein_id="BBF41808.1"
                     /transl_table=11
                     /translation="MVKYVAKRICYIIFVFFLMSIIMFGIFKLVPGDPATMALKGQAK
                     SLSPERYQILYQKTRVRLGLDKPLPVQYVKWFGKMLKGDWGYSEIYRKNVTTVIKDPM
                     KNSILINIFSVLLTILIAIPIGIVSAVKKNSKFDNVTQVTTMLGYSLPTFIIGLVMIF
                     IFCVQFTIFPVSGMNTPGFEGTFFQRFLDILYHVSLPVIVMTVGGLGQMIRYVRASMI
                     EALGMDYIRTARAKGLTEKVVIYSHAFRNALIPILTVVIGWFVSVFAGSIVIEQLFSI
                     DGTGKLLISSLQAQDYNVVMALNMFYFLVALVGNLITDLSYCLVDPRVKLN"
     CDS             516373..518178
                     /codon_start=1
                     /locus_tag="lbkm_0489"
                     /product="oligopeptide transport system permease protein
                     OppC"
                     /protein_id="BBF41809.1"
                     /transl_table=11
                     /translation="MSKKKNKRSTFGSVFRRMFLGNRAIEKEDVLAEEQVKTPFQTAV
                     KNYVSNKFAMGCLIVFTLLFVTCFIGSIFINEEPTYQEVTQQNLGPTRSLLDIPSRLV
                     GNVRQISVGSTYGVGIDNEGVVYMWGSLTDKLKQIPNDMGDVVQVAAGQDHCLALNKE
                     GKVFTWGNNRLHLGTIPLEVANANNIKYINAGYQISIAVTEDGKVYAWGNTNVVSFDV
                     HDYQGKIAKAVATGSGIMGLTKDGEVVSLTGTDTGFTKIPTDLGKVKDIEATAQTVAA
                     ITEDGKVRVWGNTTKGLDKIPEIEGKAVSLSSGRYHYVVVTDQNKVYAWGDNNFKESN
                     VPSSIQGKDIDKVYSGYYQNYAVMKDGSVKTWGLKGYWLGTDQYGRDVLTRIINGGRM
                     TMTIGAIAVIISIIIGVTIGGIAGYYGGKVDIILMRFEEVVAGIPFLPFAMILSGIVG
                     NKISETQRIMLIMVILGFLSWPSICYLVRAEILSEREKEYVTAAKALGVKESKIIFRH
                     ILPNIMSVIIVNATLQFAIAMLTESTLSYLGFGVAEPNATWGNMLNGCCNSVVIQSFW
                     WRWVFPSIALGMATICINAIGDGLRDAFDPKANER"
     CDS             518193..519185
                     /codon_start=1
                     /locus_tag="lbkm_0490"
                     /product="oligopeptide transport ATP-binding protein OppD"
                     /protein_id="BBF41810.1"
                     /transl_table=11
                     /translation="MALLEIKDLHTFFDTKKGTVKAVNGVSYSVEAGKTLGVVGESGS
                     GKSVSAMSILKLLDGNGHIDSGSIIFEGQDLADVKAKDMCKIRGNDISVIFQEPMTSL
                     NPIFTIERQLAEPFKIHQGLSKKEAAQKAVEMLRAVQIPNPANVAKQYPHQLSGGMRQ
                     RVMIAMALACQPKLLIADEPTTALDVTIQAQILKLMNELKDERGTSILLITHDLGVIN
                     EMADDVAVMYCGQVVEKAPVEKIFGDTKFSHPYTEGLMSSIPRLDTPAGVRLEAIPGS
                     VPHPLDLPKGCKFAPRCKYATDKCRNEEPQLVDIEDNHTLRCFYPEKGVRSNAK"
     CDS             519175..520584
                     /codon_start=1
                     /locus_tag="lbkm_0491"
                     /product="oligopeptide transport ATP-binding protein OppF"
                     /protein_id="BBF41811.1"
                     /transl_table=11
                     /translation="MQNNQEKKVLMSIRNLKQYFPIKKSSIFQKEQEYVKANDGISLD
                     IYEGETVGLVGESGCGKSTFGRVLLQLYHQTAGRTMYYGHTIDDMAPKYVDHLIKHLP
                     ELKKKLDHLEGQEREEAFLDIVEIIGGLFVADDMHEVSKVLSEKYNVCASIFKMKKEL
                     IDLNACAKKNDNKIAEVQTKIDVEQHKLDKMNAEIDELKKSLSNKPDFKDCEAKKDDG
                     INLKKLEYEEIRFLRKELQLIFQDPYSSLDPRMTVGQIIGEGLLTHKYFEKNGPEMQE
                     YVTDIMEECGLSPYFIHRYPHEFSGGQRQRIGIARSLALKPKFVVCDEAVSALDVSIQ
                     SQVVNLLLDLKEKENLTYIFISHDLSVVKYISDRIGVMYLGNLVELATTEELFSNMKH
                     PYTEALLSVIPTTDLNNKKEVILLEGDIPSPIHPPKGCKFHTRCRYCTDICKEKTPEF
                     EEVAPGHFVACHHKVGENK"
     CDS             520604..520795
                     /codon_start=1
                     /locus_tag="lbkm_0492"
                     /product="hypothetical protein"
                     /protein_id="BBF41812.1"
                     /transl_table=11
                     /translation="MFGNRKIRESMKKKQDIDYRKWSEQLEKNDTLAMVIAGFLVILP
                     IILLAFGIIGLVIWFFFFR"
     CDS             520903..522663
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /locus_tag="lbkm_0493"
                     /product="oligoendopeptidase F"
                     /protein_id="BBF41813.1"
                     /transl_table=11
                     /translation="MNKEWSLDVLYKGYDDPAFIEDFKQLEEVCNEINLFSKDLASAV
                     SAEDNKVIRAIQLYEKMTLKMMNLYFYLELRQTTNTTDSETTNYINKVQKLDCSITKS
                     LAVIDRYFSRITDIGTVVKSHKELSEYQYFLTQKKEDAKYLLSDDVEEAISKMNLSAG
                     SAWSRLQEYLTSTVEVDYDGKKVTLSEIRNLAYSGDKAVRKAAYEAELACYEKIKDSV
                     CFSLNSIKSQVNTISEMRGYGSVLDMTLNQAHMKKSTLDAMFTALKEYLPRFHEYLRR
                     KASLLGYENGLPWFEMFAPMGKENTTFTVEEARDYLLKHFSAFSKDIADIIEEAFANS
                     WIDFYPRKGKVGGAFCENIPQKKQSRVLTNFDGKLTSVVTLAHELGHAYHGSMIQDHA
                     PLNWDYSMPVAETASTFNETVIMNAAINEADGEEKLALIESQLQDITQIMCDIYSRYL
                     FESAVVERAKTDFMSADELSEMMLQAQKEAYGDGLDPEFLHPYMWVNKSHYYSEALSF
                     YNFPYAFGGLFARGLYEKYKEEGDSFMPKYRALLRATTVASVEDAAMEAGVNLEDPEF
                     FRKSLASYDELITEFLELTK"
     CDS             522820..523188
                     /codon_start=1
                     /locus_tag="lbkm_0494"
                     /product="hypothetical protein"
                     /protein_id="BBF41814.1"
                     /transl_table=11
                     /translation="MLTLDKHNIINQLEQGFLIQNHQFHPRYFILQVDDPEFGCEGRP
                     EGETIYGQITLLSLKGTFVLQVEEPFLWKSGIDDRMWIGRLDGTEGIIMKREIRDAYA
                     IMEPKDYEYMNQIYEEMSHR"
     CDS             523251..523622
                     /codon_start=1
                     /locus_tag="lbkm_0495"
                     /product="hypothetical protein"
                     /protein_id="BBF41815.1"
                     /transl_table=11
                     /translation="MFVYGIIVYVIWGILAVTVFISGKTLLENLWKKEYQINYEINDF
                     VYSIGMVGAYSMIYILQKSILDGEQENIILSMLLGLYLIICISVYMKVYTNDPRILLR
                     VLLLMLFPGFLFIVYFIKACL"
     CDS             523641..523970
                     /codon_start=1
                     /locus_tag="lbkm_0496"
                     /product="hypothetical protein"
                     /protein_id="BBF41816.1"
                     /transl_table=11
                     /translation="MIINVSARTDIPNYYGDWLFSRLEEGYVLVRNPYSYHQVTRYEL
                     NTDVVDSIVLWTKNPAPILDRLEQLKPFHPYFFVTITPYDKEIEKQVPPYQEVIESFH
                     SLCDQLY"
     CDS             523996..524130
                     /codon_start=1
                     /locus_tag="lbkm_0497"
                     /product="hypothetical protein"
                     /protein_id="BBF41817.1"
                     /transl_table=11
                     /translation="MKEVKEVSKIEQIELCKIDQSKGSDPSSIFAIFIWRIRTAGQDS
                     "
     CDS             524240..524842
                     /codon_start=1
                     /EC_number="2.7.7.21"
                     /locus_tag="lbkm_0498"
                     /product="tRNA nucleotidyltransferase"
                     /protein_id="BBF41818.1"
                     /transl_table=11
                     /translation="MELFEEMQRHLVDDEKPSEFIKKAAFMESYRRPPFTMIFRLSSI
                     EQSPKYHPEGDALIHTLLVVDEAAKLRDQSTDPVGFMWAALLHDIGKFTTTRMRKGRI
                     TSYDHDREGGKLAAEFMSYFPVSQEMVDYVSGMVRFHMHILYINQNLPFGQPKELVRQ
                     VPVKDVALLGFADRMGRLGADKEKETKEIRQFKDKMKKYH"
     CDS             complement(524839..525282)
                     /codon_start=1
                     /locus_tag="lbkm_0499"
                     /product="transcriptional regulator, AsnC family"
                     /protein_id="BBF41819.1"
                     /transl_table=11
                     /translation="MDNTDFAILNILKDNSRATASEISKKVKLSIPAVSERIHKLEDS
                     HIIEKYTVKVNRNLMNYNLMAIVLISLEDTSKLENFQEAILQYSEVLESYHIAGQYDY
                     LLKLLVKDTTELDTFLTYHLKSIPGVKKTNTLIILSTLKETENRL"
     CDS             525419..527455
                     /codon_start=1
                     /locus_tag="lbkm_0500"
                     /product="glycogen debranching enzyme-related protein"
                     /protein_id="BBF41820.1"
                     /transl_table=11
                     /translation="MEEKYRLGRGFFRDTREGIEREWLVTNGIGGYANQSIIGSNTRN
                     HSGYLNVSFNPPSDRYTVLNKTHEMLERKGYKYNLNTQSYISGEEEGYQYLTRFELDA
                     VPSYIYTVDNVRIKKTIALEQKHNTVFICYEIDNGGEEVTFKITPEFTYKELGSTKHH
                     SEIQFEQELDVKTLTLIPKENREHTIYFQMSDGIFFDRSLLPTSMATPDYIYSENELH
                     TIDIRNGSNESDSSYTPYEVVVSIPEASTKRFFLRCSVEGFEHRDGFAVIEDCRKRRE
                     ALMDQAGYQDSFARMLSFSADSFIVDRKSTGLKTILAGYPWFLDWGRDTMIAFTGLTL
                     CTNRFEDAKDILRSFVRYEKDGLLPNVFPSFDKDKPWYNTMDASLWYFYAVYQYLNYT
                     KSKSEETFVREELYPAMKRIIKAYQEGTHFQIHMDSDGLIQGGSNLDQITWMDVRVGD
                     WVVTPRHGKPVEINALWYNALCIMSKLATMFGEDPCNYDKLAEQVKQSFTLKFWNEEK
                     GCLYDVIEMNDNNEEIPDDKIRPNQLYALSLPFELLDKKKARSIMSIVSEQLYTPYGI
                     RSLSNRDKEYKNKYIGPLSLRDGAYHMGTAWAYLSGAYISALTKTYDHSKEIIARANE
                     MCHYFEDHLQDGCLNGIAEIFDGDYSSTSRGCYSQAWSVGEVLRAYTEDVLPYL"
     CDS             527506..528216
                     /codon_start=1
                     /locus_tag="lbkm_0501"
                     /product="membrane protein"
                     /protein_id="BBF41821.1"
                     /transl_table=11
                     /translation="MNQDYQNYQTQNYQGGQETTANAQKVMSRTFLFMFLVLALSAAS
                     AYITANSDLGFELLMNSGYTVLIVAELVVFFIASYVMRKEMTVLSAIMLVAYSIINGM
                     TLSVIFYIYDMTSIVNIFLMAAALFGGMAVFGMITKKDLTTMGQMGIMALWGVIIFGV
                     ANLFIKSESLDLGLSVIGLALFIGITAYDTQRIKENASYYGADQVNTAAMFGALCLYL
                     DFINIFLKLLRLFGNKRN"
     CDS             complement(528271..528678)
                     /codon_start=1
                     /locus_tag="lbkm_0502"
                     /product="hypothetical protein"
                     /protein_id="BBF41822.1"
                     /transl_table=11
                     /translation="MMNALRRFMYGRYGTDQLSIGLLGLCVLTNIISLFTPYRVDQIL
                     YLVYYFSFVYCIFRILSRNYDKRRKENQKFLGFWNPISYKFKQIFHTNEVKDHNHRYY
                     TCKNCKQRIRVPKGKGQIEITCPRCKYQFIKRT"
     CDS             complement(528839..529042)
                     /codon_start=1
                     /locus_tag="lbkm_0503"
                     /product="cold shock protein CspA"
                     /protein_id="BBF41823.1"
                     /transl_table=11
                     /translation="MNKGTVKWFNKDKGYGFITNEENGQDIFVHYTGIAAEGFKTLEE
                     GQSVTFEVTEGARGAQAVNVTVA"
     CDS             529332..529907
                     /codon_start=1
                     /locus_tag="lbkm_0504"
                     /product="ThiJ/PfpI family protein"
                     /protein_id="BBF41824.1"
                     /transl_table=11
                     /translation="MNVNVLLFEEFDSLDVFGPVEMLQAIEGYEIHFFSMQGGPVCAY
                     SGAVIETDSVDQMDPEGILLIPGGKGTRTLVKDEIFLSFLKEAAVKSSNCLTVCTGSA
                     LLAETGLLDGKRAATNHNAFEWVKSCRKQVEWVYNARWIAEGKYYTSAGVSAGMDLAL
                     AFIEDKFGLEKAMEIAKFMEYHYCGEQYEED"
     CDS             529894..530613
                     /codon_start=1
                     /locus_tag="lbkm_0505"
                     /product="putative cyclase/dehydrase"
                     /protein_id="BBF41825.1"
                     /transl_table=11
                     /translation="MRKINICENHTAYWFDNIKEFQTGIFVIEKPDTYYIIDTYCGSE
                     AIAGVLNTLDGRKMNIVVNTHYHWDHIWGNAEASKYGVIMAHKYCDDLINLNFKKEFE
                     ENKQYKMGEVSIKNPDITFKDRYYFDKDEVEFRYTPGHTMDSISIYDKEQKVLYVGDN
                     VEKPIVSVEQPDIELYIQTLESYLEMEVSYIVGSHTCILTKEDIKQTIQYLNRLQKGE
                     QVEYESEYMRKVHKRNQLMIQ"
     CDS             complement(530599..531318)
                     /codon_start=1
                     /locus_tag="lbkm_0506"
                     /product="hypothetical protein"
                     /protein_id="BBF41826.1"
                     /transl_table=11
                     /translation="MYQNYIFDLYGTLIDIHTNEKKTYLWEKLCEFYRFHGADYETKE
                     LRQTYESLCKKYLSESSSYTYPEIQIEDVFEDLFTQKNVHITKELAMYTGQFFRILST
                     SYVRLYDGVIPLLTSLKEQGGHIYVLSNAQRIFTAYEMKHLGIYDLFDGIVLSSDEGC
                     MKPDPEFFQIVLDRYQLSKKDSIMIGNDAVSDIEGAANAGIDSLYLHSNLSPAITSKL
                     KSTYSIMDLDLEKAKHILLDH"
     CDS             531434..532759
                     /codon_start=1
                     /EC_number="1.6.99.3"
                     /locus_tag="lbkm_0507"
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="BBF41827.1"
                     /transl_table=11
                     /translation="MRIVIIGGVSAGVSAAINARKQDPKAEIIIYEKDSFFSYMTSGM
                     SYYIGGEISAFSELTPHDTKTFEDKYQVKVQLQCEVDRVDPELKEISIKKLSTGESFL
                     DHYDKLILATGSTSFVPAIEGFTKEHVFTFRTLKDSKAIHDYITTNHPCCACIVGSGY
                     TALELAENLTLLDIDVTILEKEHQILPNYDLDMAELVEQELMEEQVRVIKNNSVIEIQ
                     KDHVILEDEALVEAQIVIFCTGIRPNTSIAKELQLELGERDAIVIDEFMQTSREDIYA
                     CGDCALVYSPLLNRLIYHPMETVANKTGLIAGKNAAGGKVAYIGTIMTSIIKCFSYTV
                     GMTGLTEKEAMREGIEIRVVKHVKIDKSLLFQGEGMVIKAVADAKTNQLLGVQIVGKN
                     GVDKRLDIFAVLIQLRADYRVISQLDLSYAPPYATARDPIHYTGLLLEQ"
     CDS             532778..533467
                     /codon_start=1
                     /locus_tag="lbkm_0508"
                     /product="hypothetical protein"
                     /protein_id="BBF41828.1"
                     /transl_table=11
                     /translation="MLGTCVNTATVIIGTVIGLLVNQHLSQKISDSVMKALGLCTIYI
                     GFSGTLKGKNTIIVIVCMAIGAFIGTILDLDSKMNHFGAWIEAKTKKIAKGKQTSSVA
                     EAFVTSSLVFCVGAMTIVGSLQSGLTGDNTMIFTKSALDFVAAIIFSATLGYGVIFAA
                     VVVFIYQGAICLLAGAIAGFLSDAVIAEMTCIGSLLILALGLNMIKVSDIKVMNYIPA
                     IFLPLLIYAFI"
     CDS             complement(533460..534812)
                     /codon_start=1
                     /locus_tag="lbkm_0509"
                     /product="hypothetical protein"
                     /protein_id="BBF41829.1"
                     /transl_table=11
                     /translation="MQRNDNKQLFYKTVFALVIPMALQNLINVGVTSTDVIMLGKVGE
                     KALSGASLGGQVNYIMTLIFFGLTSGAAVLTAQYWGKRDLESIATVFSIALKFAICVS
                     LCFTVAAFCFPSQIMSIFSNDQDVIKEGVSYLRIVCFSYLFISITMVYLNIMRSVEQV
                     LVSTVIYFISLLANIILNAIFIFGMFGLPAMGVRGAAIATVMARILECILVLIYNQKI
                     NQTIPFRLSYFKRKNPLLLKDFFLFSVPVILNELVWGAGTSANTAILGHLGSSVTAAN
                     SVAQVTRQLATVICFGISSAAAIMLGKTIGEHKEELALEYSKRFVKLSVILGLGGAII
                     VLIVRPIAIANLSLTSQAKDYLSMMMYVMSYFVIAQSFNTTMIVGIFRSGGDTRFGLI
                     LDTTTMWLCSILIGYLAAFVFHADVTIIYMILLSDEIIKIPLSLYRYRSKIWLRNVTR
                     "
     CDS             535301..536698
                     /codon_start=1
                     /locus_tag="lbkm_0510"
                     /product="NAD(FAD)-utilizing dehydrogenase"
                     /protein_id="BBF41830.1"
                     /transl_table=11
                     /translation="MNKYDVLIIGAGPAGIFTALEMIKKGSKKKIAIVEKGKPVQKRN
                     CPKQKTQKCVNCKPYCHITTGFSGAGAFSDGKLSLSHEVGGDLPELIGEDFAQRMITY
                     TDSIYLEFGADKEVEGVGQDDKVKEIRRRAIVAGLKLVDCPIRHLGTEKAQQIYYDIQ
                     EYLLANGVDILFSHSCDNLIMEGEKCVGAYVTDVMNDEKNELYAQNVIVAVGRRGAHW
                     FEQLCVEHSIAHQPGTVDIGVRVEVRNEVMEAVNDVLYESKLIGYPAPFKNKVRTFCQ
                     NPGGFVSQENYDNDLAVVNGHSYKELKSSNTNLAILCSHNFTEPFNQPIEYAQKVGEL
                     TNMLGNGQILVQRYGDILDGKRTWQKELNRSNLKPTLPDAVAGDITAAMPYRAMTNII
                     NFIQAVDEVVPGFASTETLLYSPELKFYSNKVKMDDTFKTSIDGLYCLGDSSGWTRGL
                     MMASVMGVLMGRQLV"
     CDS             complement(536775..537731)
                     /codon_start=1
                     /locus_tag="lbkm_0511"
                     /product="bacterial surface protein"
                     /protein_id="BBF41831.1"
                     /transl_table=11
                     /translation="MKKLQGKKIAVLFTILFALSTFLFTGNTADAATIKLSKSNVRFV
                     EGKTTTLKIRGTSKKVSWSSTNNKIVKVNSKGKLTAVKVGSATIRAKVSGVTRTCKVT
                     VVPKFNSNSYKNSLKSSLVGRYIDVMINDNNQSFKLAASDITSYKITKSTMNSNLTQV
                     KVYVTLVTDRTVAKVKTNATCTYTIKSNKWKLTSVTMNSKLNSINLRGSWVGKYKASQ
                     GDTGLRLDIDNVTSDGYATATFNFYALPTTPMIPDGSFAVKGGYDLSTGKVVFAEVDW
                     IVQPEGYSMIGLNGYVNVANRSISGRTDHWNYYTFEVFLANR"
     CDS             537908..539077
                     /codon_start=1
                     /locus_tag="lbkm_0512"
                     /product="transporter"
                     /protein_id="BBF41832.1"
                     /transl_table=11
                     /translation="MKKTPKQALILSICMILLIVGLYDGRVNASTELSKPTLKITQRT
                     ATTVKLSISSVKNADGYQIYRAGSKDGTYQLVKTTKKTSFVDEERSATKKYYYKVRAY
                     KKTKSKRIYSSYSSKKGCTATLKKPANFKVSQSTETKIKISYKSVADATSYKIYRATS
                     KNGTYQLVKTTSKKSYTDSKLTTGKTYYYKVRAYQKKNSIPYYGVFTAKKGITLKKKP
                     IASTPSPAPTKAPTVTPAPTKMPTATKVPTPTKVPVATAVPTKAPTTSNSVVSEMLAS
                     INKERNSQGLSSLTTNDNLNAAATKRAKETVSLFSHTRPDGTSGVTVLKEYGISYQAW
                     GENIAYGQRNVTEVMNSWMNSSGHRANILSSKFSKVGIGCYENNGTLYWTQVFMN"
     CDS             complement(539147..540319)
                     /codon_start=1
                     /EC_number="1.1.1.1"
                     /locus_tag="lbkm_0513"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBF41833.1"
                     /transl_table=11
                     /translation="MMRFTLPRDTYYGKGALEALKDLTGKKAVLVLGGGSMKRFGFVD
                     KALAYLKEAGIETKLFEGVEPDPSVETVMKGAAMMREFEPDWILSMGGGSPIDAAKAM
                     WVFYEYPETSFEDLITPFSFPTLRKKAHFCAISSTSGTATEVTAFSVITDYAKGIKYP
                     LADFNITPDVAIVDPELAETMPPKLTAHTGMDALTHAIEAYVSTLHSPFTDPLAIQAI
                     QMVVEYLPDSYKGNMEARDQMHLAQCLAGQAFSNALLGIVHSLAHKTGAAFSTGHIPH
                     GCANAIYLPYVIKFNAKADESRYAAIAHSIGITGSDHECVMALCDKIDSFNEHLSIPK
                     TLKEFGINEDEFKEKVSHIAELAVSDACTGSNPRPVTPADMEKLLTAIYYGTEVDF"
     CDS             540803..542155
                     /codon_start=1
                     /locus_tag="lbkm_0514"
                     /product="hypothetical protein"
                     /protein_id="BBF41834.1"
                     /transl_table=11
                     /translation="MDLIHLLTIAQENKKAYAKVIEYVISNPVIMYAEFLAYYIRMYI
                     ENEQLDSEELYRIGVVFAMKSKNYEVVKLGIIILGQYDDSVAKNLIRILGLHSEFTQI
                     ALESSKYFVDRNGFAFDLLCSTSGYGKLSALNAFHPVNEHLQRWMMEDGYINEITNEL
                     CACNCLNKTEIIMYSKKIIFSEQTFSKYSRLLLYGLSQGDRVTLKNSMNLITAYLKAV
                     DLYAKKYVDLAAICMICYNLKKYPTKIQGQEKEDDYSQEWMEVLAASCLPLVGKFHAD
                     KLVIAEVKKEKYPLYAMFAVIEVCGLSLPFEVYEKLLQRHPYELVLLDYLLGENADKY
                     WYSVYEAVYPGLPQEVFEYEPMLLYDLRMNKKYWPDLWLYYLLLEMNRRQFGEETLLY
                     ACLKARYQENRRQAMIMLKNHMEYMDDQMRAYLRVREEEETDCHLKDEISQIIRPANG
                     "
     CDS             542194..543354
                     /codon_start=1
                     /locus_tag="lbkm_0515"
                     /product="alanyl-tRNA synthetase family protein"
                     /protein_id="BBF41835.1"
                     /transl_table=11
                     /translation="MTKKLYYENAYEKECRATVVGCEKKESGYEIILDQTIFYPEGGG
                     QPSDIGTLKLENGEVLQVSYVFEKGEDVCHVTDGFVSAGSQVTCLIDWKRRYHNMQQH
                     SGEHILSGLIHERFGYDNVGFHMGTDMVTVDFNGVIPEKDLKELEARANEIIYENSLT
                     KVTYPSKEELDSLEYRSKKELTGQVRIVGFDHADICACCGTHVKRTGEIGVIKVLSSM
                     NYKGGTRFFMLSGEEAYQDYVNKNESLLTLSRKLSAKPELVVEAVDKLQQELKEKKEQ
                     MNTLYQQLFTSKAAAITDKKVILFEEGLNMKQIRDFVNLLMEKCEFAMVVSETAKDTY
                     QFTAAANELDMKVISKQLNEVFSGKGGGNNKMIQGTLYGEMSAIKEKVEELI"
     CDS             complement(543408..544070)
                     /codon_start=1
                     /locus_tag="lbkm_0516"
                     /product="hypothetical protein"
                     /protein_id="BBF41836.1"
                     /transl_table=11
                     /translation="MQNKEIKLYSHFNHKFALRVTEGHFATTHSHINYYIDMTTLKVR
                     QSEARSIAKIISKEYITSTYVDTIVCMDGCDIIGAYLAEELNSVGIMSMNQHQTIYII
                     TPEVKTNGQLIFRDNIQPMVRGKHILLLVASTTTGKTIQKSLECIEYYGGIISGISSI
                     FSAIDSVDGRPIHSVFTTKDLPDYKMYQHDECELCKRGEKIDAIVNSYGFTSYKDHVK
                     ES"
     CDS             544238..545158
                     /codon_start=1
                     /locus_tag="lbkm_0517"
                     /product="oxidoreductase, aldo/keto reductase family"
                     /protein_id="BBF41837.1"
                     /transl_table=11
                     /translation="MKYIQLSNTKEVVSNIVMGCMRINQLSVEEINHLINTALERGVN
                     YFDHADIYGGGECETLFGKAFDLKSVKREKMLIQSKCGIRNGYYDLSKDYIVSSVDGI
                     LNRLNTDYLDVLLLHRPDALMDPEEIADAFSSLKANGKVRYFGVSNFTKDQIELLQNH
                     CSMKIIINQVQFSAAHTYLIDSGMAFNMGNEQSVNRGGSTLDYCRLNNVTMQAWSPFQ
                     KGMFEGVFLNDHDKYAKLNEVIDRLAKKYNVTNSTIAVAFITRHPANMQVVLGTTNAN
                     RFKECVKGSSLALTREEWYEIYRAAGKLIP"
     CDS             complement(545162..545854)
                     /codon_start=1
                     /EC_number="1.1.1.100"
                     /locus_tag="lbkm_0518"
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="BBF41838.1"
                     /transl_table=11
                     /translation="MKTALITGASKGIGEAVARRLIEKGYTCISLARNYENCSITSDN
                     FIPLICDLTDQKQLLAVIHKIKGEYEIDLLINNAGIGYFGLHEELNPAKIHAMVATNL
                     EAPLILVNQFLRMLKEDHGQIINIESITAAQCNPHGCAYGATKAGMLSFSKSLFQEIR
                     KYGVKVTSILPDMTKTNFYDHSNFSEGDSYDSYLLPDEVADAVCYAITSRDGLVLSEI
                     TLQPQKHQIRRK"
     CDS             complement(545851..546879)
                     /codon_start=1
                     /EC_number="4.1.99.-"
                     /locus_tag="lbkm_0519"
                     /product="spore photoproduct lyase"
                     /protein_id="BBF41839.1"
                     /transl_table=11
                     /translation="MNSYLTPSAPSNFTHIYIEKKIANDLQTKQILQKFPHASTIYID
                     HYKDLFNRPHQNYRLQKQHMNLILAKKEGQLLYPGAPVCQSFGETYFYYTSLMMNCIY
                     DCEYCYLQGMYPSANLVLFINLEDYFQEIEQLLLRHPVYLCISYDTDLLALESIHGYV
                     AKWLAFVRSHKDLTVELRTKSANFHFLDQLAPCDRFILAWTLSPDTIQIAHERKTPSL
                     SHRIACINQALAASYPVRLCFDPMIYRSDWKAVYEKFIQDVSVQIDLSRIRDFSIGIF
                     RIASCYLKAMQKAEPNSLIAHYPYENDHGVCHYKLELSKEMTTFLKEKLLTYTNKNNI
                     YIWEEETK"
     CDS             complement(546845..547639)
                     /codon_start=1
                     /EC_number="4.1.99.-"
                     /locus_tag="lbkm_0520"
                     /product="spore photoproduct lyase"
                     /protein_id="BBF41840.1"
                     /transl_table=11
                     /translation="MLYLCLSRKETASLYIQTFHLKKETAHHKFSIYKNDSYTLIISL
                     KGPIQQAIAITYLFDHYPMRSGDHFISIENGTCCDASMDRSVPYIISKITHIDEKITY
                     YPDLLIKHPFTEATLTSSATMLPQTDTSASIFDQLSAAIYESALNFCNVDQIIFIRIL
                     SDSLKIHQPILDFLLSLQQQTYQMDPVTFTISESSKIDEIISELHLTESQRQKLLHSL
                     YYAKLKKQDLLSDLTTFITNYQNHGCHSKKEGKYYLEQLLNSICSL"
     CDS             complement(547665..548894)
                     /codon_start=1
                     /locus_tag="lbkm_0521"
                     /product="transporter"
                     /protein_id="BBF41841.1"
                     /transl_table=11
                     /translation="MNTKKKYLILVSCFLLMMFPYSIVNTIQSLFLAPVITEKGFTNA
                     GFSLIFTIAALTVALCSPLVGILIRKLNLKLIMTISALLVGGGFACYGAADRISTFYF
                     IAILVSIGLTGLTMIPVATMIASYFNHKKGIMMGIAFAGTGFGTIFWMQLVSRFITRY
                     GYHKTYFLLGMSILVVSLPITIFIVDKGPYDSSNQKDTSVIKKKEKWSFGHTGGNYSF
                     YLFTLGLFLMGIAISGTKVHVQPFLNFSGYSTVFSANVGSLLAFMAVVGNIITGMFID
                     KAGLLPALLTYGVLTFISTILLQFIGIIWVPFLFAICFGACLSLPTLLPSYGVNKLFS
                     DRSYSFSLGICNAFFTIGGAIGPSLTGFLADTDYGYESAFLSYSVIIVLYTILLYRII
                     HKRVTIDRKNGTTHNKE"
     CDS             549035..550117
                     /codon_start=1
                     /locus_tag="lbkm_0522"
                     /product="cell wall endopeptidase, family M23/M37"
                     /protein_id="BBF41842.1"
                     /transl_table=11
                     /translation="MKNFIKRYGILIEIVLLAVLIIAFVKSNFKAEHIAMIANSQNAQ
                     TEKKGYIKWVDFKVSYQALQDAYTYDVESYEKENHINWIELLAYLGARYGGDFKNYKS
                     KDMADLVAKLNSNEETMETLTKDMKYYSYYYEAYSAVLGGLVGEYEIQVLKDENGGEK
                     VWKKTYGLKGFLPLAKNFPYADFDDFGVSRSYGYKRQHLGHDMMGQVGTPVIAAESGY
                     VEALGWNQYGGWRLGIRSFDKKRYYYYAHLRKNFPYCKSLKVGSVVTAGDVIGYLGRT
                     GYSKKENTNNIDTSHLHFGLQLIFDESQKEGNNEIWVDCYDLTRFLYANRCETVKDAS
                     TKEWYRIYDMRDPSAEEFKKAQQKKK"
     CDS             550399..551106
                     /codon_start=1
                     /locus_tag="lbkm_0523"
                     /product="sensor histidine kinase"
                     /protein_id="BBF41843.1"
                     /transl_table=11
                     /translation="MISNKRNIVLIDDDAAMRSILSSVLTDADYKVELAATGQEGLSM
                     LTSQCFDMVLLDLGLLDMDGMDLLLEVRKWSEIPVIIVSSRSDENSIVAAFEAGADDY
                     MVKPVGTRELLARLDYAYRQSIRFVSSKNCINYIYHIDELKVDMERRVVSIDNKTVHL
                     TQNEFRIIALLAKNAGKVMNYEKIISSIWGPYAGKENLTLRVNMANIRKKFYKAGASR
                     DYIVTEVGIGYRMLESK"
     CDS             551140..553215
                     /codon_start=1
                     /locus_tag="lbkm_0524"
                     /product="response regulator containing a CheY-like
                     receiver domain and a GGDEF domain"
                     /protein_id="BBF41844.1"
                     /transl_table=11
                     /translation="MKEKVLIIDDSLESIQTLTSILHEDYQVITARDGLSGIRLVNRY
                     NPSLILLDIIMPGMNGFEVLQQLQNENEDFSIPVIFITCLQDEQSEEQGLRMGAVDYI
                     MKPFNERIIKVKVHNHIKRMRYRRNMEDIAMLDGLTGIPNRRSYDVRFQLDWRACKKE
                     NTTFSMAIADIDYFKDYNDNYGHMQGDEVLRRIAGLLQSIVTPYGGIVARYGGEEFVF
                     LFRNKESMEAKKIMEEVRAGVEALKIKHHYSKCANYLTISVGGHSIVPSEEISASEFV
                     ERVDRRLYQAKGQGKNRVVWEGKQLVNGQIECFLLNDFSVLSSAGSVSAKTGMRKKCM
                     ILFLYLIVNRYEKYSKEDLYHCLFQDEEREWNKLTAVFAELKKALEQLEISYARELVV
                     PINGIYHWNNNYMCMVDAEVFTQIINEMEEAADQSQKAALAKHAVELYQTDFMNEITD
                     VTWINELRNRYRIQYRKALHYYLIDRMELKHYHEVIEKCQRDSLVYYNDEELNYYYLL
                     ALIKDGKEQEAIEHYEYLLESCDTNRGAVLSERITRLSREMKGLNPKLKEELLNIKDG
                     LTDSGRKSGPLECNEEMFEQIYQIESRNLIRNEKMCYLCMIKIVCQIQDKVTHQMDRL
                     QSTLKGNLRIGDAYTKKSSNKFCLLLPNVNYKYGNIVLERIRTAFIDGLDDPNVSIQY
                     ELVPIEPIR"
     CDS             complement(553212..554276)
                     /codon_start=1
                     /locus_tag="lbkm_0525"
                     /product="hypothetical similar to thiamin biosynthesis
                     lipoprotein ApbE"
                     /protein_id="BBF41845.1"
                     /transl_table=11
                     /translation="MKQLLTKSRRQVAFVLVILLALSSLAGCSSKKENSSDASNGPLT
                     KTSFLLNTVVTITLYDSTDESILDETLDLCKKYENIFSRTSSTSELYKLNEGLLEKDK
                     DGYIVSDELYNLIKTGVKYGDLSKGKFDIAIEPVSSLWDFTAEDPVVPKASDIKKNLP
                     LVNYKDIVVSKKNRISFKKEGMGIDLGAIAKGYIADQLKAFLLKNNVKSAMINLGGNV
                     LCVGKKVDGSAFNIGIQKPFADRNETIAIMQLEDVSVVSSGIYERYFTVNGKSYHHIL
                     NPATGYSYDNNLVGLTIVSKTSVDGDGLSTSCFALGLKDGMALIDSLDDTYAVFITKD
                     NKVHYSSNFKKHIKITEVSN"
     CDS             554476..554925
                     /codon_start=1
                     /locus_tag="lbkm_0526"
                     /product="electron transport complex protein RnfG"
                     /protein_id="BBF41846.1"
                     /transl_table=11
                     /translation="MKDKKLATIVSLLFVAVITFFALLGSNFFLNSTDGDSMDVAGVE
                     GIKEAYENTADGGYRVVATPKGFGGDLEVTVSFNADRKTITNVEIKAPDETPTLGGKV
                     VESDFTSQFAGKTAPLAVTDIQAISGATISSEAVCTGISTAAEFLQK"
     CDS             555054..555440
                     /codon_start=1
                     /locus_tag="lbkm_0527"
                     /product="hypothetical protein"
                     /protein_id="BBF41847.1"
                     /transl_table=11
                     /translation="MKKRNDIILITAILLIAVAGIVFYTVNKKSATPSDKVKITVDTQ
                     LYKEVSLNEDQVIEVKIDDEVKNIVEIKDNKVFMREADCPDQVCVHQKTIEKDGELII
                     CLPNKVVVTIEGADSTDSEGTDSVAN"
     CDS             555458..555940
                     /codon_start=1
                     /EC_number="2.5.1.30"
                     /locus_tag="lbkm_0528"
                     /product="heptaprenyl diphosphate synthase component I"
                     /protein_id="BBF41848.1"
                     /transl_table=11
                     /translation="MSTKKVATFGVLVALAFIFSYIESLIPFYFGVPGMKLGLANIVV
                     LTALYKLGVKEAYSLCIVRIILVGFTFGNLYSLLYSIAGGLLSCTAMVLLKMTKKFSQ
                     IGVSAVGGIMHNVGQITVAMIVLETSALIYYLPALLISGVLTGALIGVAGGEIIKRLR
                     "
     CDS             555995..557299
                     /codon_start=1
                     /locus_tag="lbkm_0529"
                     /product="proton/glutamate symport protein"
                     /protein_id="BBF41849.1"
                     /transl_table=11
                     /translation="MKKKIGLTSWVLISLLAGAIFGIVLHYLVPAGFVRDTVFVNGIL
                     YVVGKGFVRAMQMLVVPLVLCSLVCGTLAIDDTKQLGKVGIKTVLFYMTSTALAVVVA
                     LGIANLINPGRGLDMSNIQKVETTVGEADSFADVLLNIIPTNPFESIANGNMLQLIFF
                     AVFLGCILAKLGSKTKGIANLFREGNEVCMAMTMTVMKVAPIGVFCLISSTFASTGWD
                     AMLPLFKYTFAVYLALAIQCFGIYMLFLRGFTKLNPMHFIKKYMPVMGFAFSTAASNA
                     TIPLAIETLNKKIGVSKRISSFTIPLGATINMDGTSIMQGVAVVFVAQAFNINLSVSD
                     YVTVIATATLASVGTAGVPGVGLITLSMVLNSVGLPLEGIGLIMGIDRIIDMARTTVN
                     ITGDAVCTTIVANQEGGLNKDVFIADNAKIDLKDLPSCDDLV"
     CDS             557572..558414
                     /codon_start=1
                     /locus_tag="lbkm_0530"
                     /product="patatin-like phospholipase"
                     /protein_id="BBF41850.1"
                     /transl_table=11
                     /translation="MVSLVLEGGSFRCIFSAGVMDALLDSDIYVPYCIGVSGGISMGV
                     SYISKQPKRNLDVFLKYRNDKRYISRRNLLHNRSVFGLDFAYDEVPNKLIPFDWDTYK
                     KYTGKVVIVATDALTGKPKYFNGMKMDKKFKPLRATCALPVAFPTIKIGNTPYYDGGL
                     SDPIPIRKAIEDGCDKHIIILTRPEGYVKECDSRAKVVARVLRRKYPKVEECLLNRHI
                     GYNKTVQFCEQLQKEKKAVIIRPDHPLESFEKDTKVLQESYDLGYQAGMKVMDQIKEL
                     FEEK"
     CDS             558495..558983
                     /codon_start=1
                     /EC_number="4.2.3.3"
                     /locus_tag="lbkm_0531"
                     /product="methylglyoxal synthase"
                     /protein_id="BBF41851.1"
                     /transl_table=11
                     /translation="MFNMLNDDYISFKIGKQKHIALIAHDSKKKELIEWAERNRAILE
                     KHFLCGTGTTARLITEQTGLPVKGYNSGPLGGDQQVGSRIVEGNIDFVVFLWDPLESQ
                     PHDPDVKALLRIAVVYDIPIANNLATADFLLTSKYMNEEYDRQVANYNKIISQRIQDM
                     TK"
     CDS             complement(559055..559660)
                     /codon_start=1
                     /locus_tag="lbkm_0532"
                     /product="hypothetical protein"
                     /protein_id="BBF41852.1"
                     /transl_table=11
                     /translation="MNDWMLLYLICNCCSCNCNCCNNCMPPPCSPCCGCNNPWFPNCC
                     FGPGTPLGGCGPCGPGGPGKFGGPCGPGGPGKFAGPCGPGGPGKFGGPCGPGGPGKFG
                     GPGGPGGPGKFGGPGGPGGPGKFGGPGSPGGPGKFGGLGGPGGPGKFGGPGGPGGPGK
                     FGGPGGPGGNPFNFFNEKGPNSNWGNTLLNMLNLFQGNFSH"
     CDS             559868..560644
                     /codon_start=1
                     /locus_tag="lbkm_0533"
                     /product="amino acid ABC transporter, amino
                     acid-binding/permease protein"
                     /protein_id="BBF41853.1"
                     /transl_table=11
                     /translation="MKKVYVLLLITSLVLGLVGCSSGKEDEIIVATEPGFAPYEYLDG
                     NEVVGIDMDISKEIAKELGKKLVIKQMDFDGALQAAQSGKVDFVAAGVSVTEDRKKVM
                     DFSDNYVDSTEVVVVNKSNTTIKAGKDKDGNETVSLDGMIVGVQQGNVADLWVEDNTK
                     CKEEKRYTQFAQGANDLKNNKIDCLVMDQYPAEELVKKNDNLIILQGEKGNAILFQDQ
                     YAIATKKGNKEMLEKINKVIKKLKDEGKIEEFTKNHVEKK"
     CDS             560675..561388
                     /codon_start=1
                     /locus_tag="lbkm_0534"
                     /product="amino acid transport system permease protein"
                     /protein_id="BBF41854.1"
                     /transl_table=11
                     /translation="MSLIHQIINAIDQALIQDQRYITYLKGIKVTLMISLIAVLIGVT
                     IGVIVAVVKVGYHNTVKPKWYLRRINGICNLYIGVIRGTPVFLQLLIIYNMVFTSRGT
                     NEVLAAALAFGINSGAYVAEIVRAGIMSVDRGQMEAGRSLGLNQLQTMRYIILPQAVK
                     NILPALGNEFVTLIKETSVASVIAVTDTTQAARTIGLRTYDIMTPLFIAAGVYLILVL
                     GLTKLMNIVERRLAKSDTY"
     CDS             561375..562097
                     /codon_start=1
                     /locus_tag="lbkm_0535"
                     /product="amino acid ABC transporter, ATP-binding protein"
                     /protein_id="BBF41855.1"
                     /transl_table=11
                     /translation="MIHINNLVKSFHGNIVLDGISQVINQGDKVVIVGPSGSGKSTFL
                     RCLNLLETPTSGEIIFEGENITESGRDINKIREKMGMVFQQFNLFPHLTVLDNIMLAP
                     VKLGRMTKEEARDKALELLARIGLSDKADCYPKQLSGGQKQRIAIVRSLAMDPDVLLF
                     DEPTSALDPEMVNEVLDLMKELAREGMTMIVVTHEMGFAKEVANRVLFIDGGKVLEEN
                     NPIDFFEHPQNERLKTFLSKVL"
     CDS             562629..563327
                     /codon_start=1
                     /locus_tag="lbkm_0536"
                     /product="putative ADP-ribosylglycohydrolase"
                     /protein_id="BBF41856.1"
                     /transl_table=11
                     /translation="MRSPLLEENKLRAVRSTSPLFTEVLGGIKNQDYGTKESPINDRK
                     EDDVLAFGPPVGLYFMDSPSMAFRVASEIAAMIYGNPTAYLSVGLFAAIISLVASGSS
                     ILEAVPHALSILGGYHGSREVYDTVILALEKGKKKNTLEYADHHSTAATTLARGIYDV
                     LLYEENYEEAIILAIQGKRKNQIGYICGCLLGLKLGLDEIPKDAVESIDCIDIILKMS
                     DKLGISYENKLYIT"
     CDS             563358..563855
                     /codon_start=1
                     /EC_number="2.7.1.69"
                     /locus_tag="lbkm_0537"
                     /product="PTS system, beta-glucoside-specific IIB
                     component"
                     /protein_id="BBF41857.1"
                     /transl_table=11
                     /translation="MGIFQRFRKKVDEPVSEKEVFVPLNGTIIALDQVNDPLFADHVL
                     GDGIAIEPSDGVLVSPVDGEITMLFDSKHAILIKSKDGVKIFIHIGIDTVALGGRYFR
                     SLCKLGDRVTKGDKIMEFDCDMIRKEGYELTTPIIISNYNDYEEIEVVAKEQVSRLDL
                     LMKMK"
     CDS             563986..565155
                     /codon_start=1
                     /EC_number="3.5.2.3"
                     /locus_tag="lbkm_0538"
                     /product="dihydroorotase"
                     /protein_id="BBF41858.1"
                     /transl_table=11
                     /translation="MLLIKNGYLLTMEEKDYENGCILIENGKIIEIGESIQETDEMEV
                     IDAKGNLVMPGIIEAHCHIGITEEKKGMEGDDCNEITEPITPYLRAIDGINPMDQAFH
                     DAIKAGITSVQAGPGSSNVVGGQFAFIKTHGRILSEMLVKEYSSMKVSFGENPKKNYG
                     DKDKMPSTRMATAWMLRKELLNAKQYLEQKENAKKNNEPFAINYEIEPWIPVLLREVP
                     LKAHVHRVDDIMTAIRIAKEFNLKMTLDHCSEGHLIKDSIKEAGYPVIIGPSLASRNK
                     IEIQYASPKTAGVLQNEGILVGITTDHPVILIQYLPMCAGVAAKMGLGVIEALRAITI
                     NAAKICGVEERVGSLKVGKDADIVIFDDNPLEIFTNTLYTIINGIIVYDASKEEK"
     CDS             complement(565203..565700)
                     /codon_start=1
                     /locus_tag="lbkm_0539"
                     /product="hypothetical protein"
                     /protein_id="BBF41859.1"
                     /transl_table=11
                     /translation="MTSIKGYDRKAALIYANRFALTRNPNYLDFTNLGGDCTNFISQC
                     LYAGSNVMNYTKTFGWYYNSANDRSPSWTGVQYLYNFLTTNKTKGVFASVVPIEQIML
                     GDIIQLANDYNEFYHTLIVTMIGDVPSINSIYVNAHDYDAKLRPLNTYQYSSYRCLHI
                     EGVYI"
     CDS             565797..568085
                     /codon_start=1
                     /EC_number="1.17.4.1"
                     /locus_tag="lbkm_0540"
                     /product="ribonucleotide reductase of class Ia (aerobic),
                     alpha subunit"
                     /protein_id="BBF41860.1"
                     /transl_table=11
                     /translation="MKISIIKRNGKQEPLCVEKTKRMVRYACEGIEGCDPIELELDSQ
                     IQFIDGMTTKNIQKVLIQTAIEKVISTARDDYGNTFRKTNTNWQYVAARLYAYDLYKE
                     AAIQRGYTHFGYGDYYTLVKMLTDAECYGSYLLENYSKAEVEELGSYIREERDELFNY
                     EGIKLLSDRYLVRGYNKEVMELPQERFMTIAMHLAIPEGENRVKYAKEFYDLLSQLKM
                     TVATPTLANAGTKFYQLSSCFISTVGDNLWSIYDVNQKFSSVSKHGGALGIYLGKVRA
                     LNSEIRGFKNASGGVIPWIRLYNDTAVAVDQLGRRKGGATVTLDIWHADLYEFLELRT
                     NNGDDRRKAHDIFPALSVPDLFMERLINREEFSLFDPYMVQKVMGYSLEDFYDDKEKE
                     FTKRYLECEANLAIPRVSVPALDIMKRIMKSAVETGTPFIFFRDIVNRANPNKHNGMI
                     YASNLCHEIAQNMSESEFIQEQCQDEDGNTIIVTKVQSGDMVTCNLNSINLGKITKEE
                     LAKNIPLQIRMLDNVITLNQSPVMEAKITSEKYRAIGLGTSGYHHYLVNNGIRWESEE
                     HYQAADELFEEIAYQAIKASMELAKEKGSYPVFEGSEWQTGEYFARRNYTSERFVKLQ
                     EEIKQNGMRNGYIMAVAPTGSTSNIANTTAGIDPIFMKSFIEEKKGSFIPKTAPDLND
                     SNFWLYQEAHHINQFVSIKACGIRQRHVDQAQSFNLYITPNVKAIDILNMYIECWKNG
                     VKTIYYVRNQSLEMDECSSCSS"
     CDS             568100..569128
                     /codon_start=1
                     /EC_number="1.17.4.1"
                     /locus_tag="lbkm_0541"
                     /product="ribonucleotide reductase of class Ia (aerobic),
                     beta subunit"
                     /protein_id="BBF41861.1"
                     /transl_table=11
                     /translation="MNKKKIFNEFGLRGTQSIINGNTTNLREWNRIKYDWARTMYRTM
                     LNNFWIPEEISLSEDVKQFAYLTDGERNAFDRIISFLNFLDSVQSENLPNLSRYVTAS
                     EVSSLLNIQAFQEEIHAQSYSYILDTVTNPVTRDEIYDMWRVDEHLLKRNRFIASIYQ
                     QFNEEATQENFIKVVIANYILEGIYFYSGFSFFYTLARQGKMTATSTIFKYINRDEVT
                     HLVLFQNILRELKTENPDLFTAELEEEIRDMMRTGVEHEIEWGQYVTNNEILGLNNDL
                     IESYIKYLSNLRLRAIGIQELYPEIDKHPMEWIENFSNLNSTKTDFFEAKVTNYTKAA
                     AYDFDDLV"
     CDS             569448..570782
                     /codon_start=1
                     /EC_number="1.4.1.4"
                     /locus_tag="lbkm_0542"
                     /product="NADP-specific glutamate dehydrogenase"
                     /protein_id="BBF41862.1"
                     /transl_table=11
                     /translation="MGYVDEVIALVEKKNPHEPEFLQAVKEVLESLRAVVEANEDKFR
                     REALLERIVEPDRQLKFRVPWVDDKGQVQVNTGYRVQFNNSIGPYKGGLRLHPSVNLS
                     IIKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDREIMAFCQSFMTELCKYIGADV
                     DVPAGDIGTGAREIGYMFGQYKRIRGMYEGVLTGKGLSYGGSLARTEATGYGLLYLTN
                     EMLKFNGVDLKGKTVCVSGAGNVATYAIQKATELGAKVVTCSDSTGWVYDPEGIDVAA
                     LKEIKEVKRARLTEYKNYRPNSEYHEGRGVWTVKCDVALPCATQNELTLEDAKILVAN
                     GVTAVAEGANMPTTLEATEFFLENKVLFAPGKAANAGGVATSALEMSQNSERLSWTFE
                     EVDAKLQHIMVNIFHNIDDASKRYGAEGNYVIGANIAGFEKVADAMLAQGVC"
     CDS             571241..571354
                     /codon_start=1
                     /locus_tag="lbkm_0543"
                     /product="hypothetical protein"
                     /protein_id="BBF41863.1"
                     /transl_table=11
                     /translation="MREYQTDGGCLAARASAWLGEFVCGGMRIVSEVVGTP"
     CDS             complement(571362..571613)
                     /codon_start=1
                     /locus_tag="lbkm_0544"
                     /product="hypothetical protein"
                     /protein_id="BBF41864.1"
                     /transl_table=11
                     /translation="MRSKTVTVRLTFSPGISIHLTNNPHSTTNKLPKSGAGARSKTAA
                     VRLILSHGIPTTSLTILIPPQTNSPNQALARAARQPPSV"
     CDS             571668..571886
                     /codon_start=1
                     /locus_tag="lbkm_0545"
                     /product="hypothetical protein"
                     /protein_id="BBF41865.1"
                     /transl_table=11
                     /translation="MDGNAGRECQTDGGCLAARASAWFGKFVCGGMGIVSEMDGNAGR
                     ECQTDGDCLAARQRLIWGVCLWWNGDCW"
     CDS             572099..572647
                     /codon_start=1
                     /locus_tag="lbkm_0546"
                     /product="hypothetical protein"
                     /protein_id="BBF41866.1"
                     /transl_table=11
                     /translation="MRRSTYIVKCFSVVSVIATVLGLCYWNWLRTFLLLGLCLIGFGI
                     SLLVKGKVCAFFNFLCFVLLAGSLFLGHLNKPSDEVIWNRRNVVVREILDGKLVADDN
                     GVINLPDGERYRDISDSDRVVLLVDGNRRGIYFYIDQGLLESSTGYLYLTDRVSKGKC
                     DDSYRLVNFKHLRGRWYQCATD"
     CDS             572735..573685
                     /codon_start=1
                     /locus_tag="lbkm_0547"
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="BBF41867.1"
                     /transl_table=11
                     /translation="MVLSGIGLIMRKLIELNLDQDKQLNLLGKALSVKTRLDILRILM
                     KEPMNINEIGSALHIPASSCAAHVKVLEEAGLIKTSLQPGIRGSMKLCEVVIDNINID
                     FQTDGRVNENVEVINMPIGNYVDYKVAPTCGLVSEKGPIDEEDEPRCFYNPSRTDAKM
                     LWVGRGYVEYRFPNNCILNKKVSKLELSCEICSEDHEYNLDCPSDLTVWVNGNEVGTF
                     TCPSDFGGRRGKLNPDWWPDKNTQYGLLKTWSIDCNGSYIDGVETKKSAIHSYKLNEN
                     DYISVRIGMKDDAVNMGGMNLFGDCFGDYAQNIVMKLYFS"
     CDS             573804..574970
                     /codon_start=1
                     /EC_number="2.7.1.6"
                     /locus_tag="lbkm_0548"
                     /product="galactokinase"
                     /protein_id="BBF41868.1"
                     /transl_table=11
                     /translation="MKEQLQKRFSDVFGDTSKTEVYFAPGRVNLIGEHTDYNGGHVFP
                     CALTIGTYAVAKKNEDRKLRFYSTNFEDLGVIESSIDDLVYKKEQDWTNYPLGVMWAM
                     KEKGFEMTHGLDILYCGTIPNKSGLSSSASIEVLTAFILKEEFGFDLNMVDVSLICQF
                     AENKFNGVNCGIMDQFAIAMGKKDSAIFLDTATLKYEYAPVVLDGVKIVIANTNKSRG
                     LGDSKYNERRAECEQALEELKTVVDIKELGELSEEQFEEHKAAIKSDIRRKRAKHAVY
                     ENQRTIKAVEALKNNDLALFGKLMIASHDSLRDDYEVTGKELDTLVATALQQDGVIGS
                     RMTGAGFGGCAVSLVKEEAVDAFVENVGKVYKKEIGYAADFYVVEIGDGPRHIK"
     CDS             574996..575985
                     /codon_start=1
                     /EC_number="5.1.3.2"
                     /locus_tag="lbkm_0549"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BBF41869.1"
                     /transl_table=11
                     /translation="MTILVLGGAGYIGSHTVYELIDAGEDVVIVDNLQTGHREAIHPK
                     ARFYEGDIRDRAFLDSVFEKEKIDAVIHFAANSLVGESMVDPLKYYDNNLCGTKILLD
                     SMVAHGIDKIVFSSTAATYGEPESIPILETDRTEPTNTYGETKLSMEKMFKWVGKAHG
                     IRFVSLRYFNACGAHVSGTIGEDHNPESHLIPLILQVPNNKREAISIFGEDYDTKDGT
                     CVRDYIHVTDLAQAHIKAVHYLAEGNESNIFNLGNGVGFTVKEVIETARKVTGHPIPA
                     IVSERRAGDPAKLIASSDKARTILGWNPEHADLEEIISTAWKWHSTHPNGYSK"
     CDS             576202..578544
                     /codon_start=1
                     /locus_tag="lbkm_0550"
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="BBF41870.1"
                     /transl_table=11
                     /translation="MNQKWKVRFAVGAVALAMIPSNTILSYAKAAPDGKTVAQDTKAG
                     KTEGAWDKWVEQWDSIKNDWTQLSINPGKDESEINFAWYSKQNVSQHLKISTSSDMKD
                     ANLYEAKKEEATQSESGEQYYSNQVTVTELAANTTYYYQYEVDGSYSQVAEYKTKSAD
                     QFKFIFVGDPQIGSSNEKKSSSKDNSTPEKLAEFLQAQDEAVRNDSFNWNDTLNKAFQ
                     KTDQNASFILSAGDQIQLTKKKSPKGKGFESEIEYTGFLSPNVLRSLPFAPTVGNHDA
                     DNANYSYHFNLPNRSTYGVNTSNDDTTKVGGDYYFTYGSVLFLMLNTQDTNVAEHKRF
                     IEEAVSANKDCKWRVVTLHQDIYGSAEHSNEPEITNLRYQLVPIFEENKIDVVLTGHD
                     HAYSRTKMLLGGHKTYSSYTDDEFDEQLDKDMDAGENPESLYVAPGNIDSKTADEGGL
                     KYLDYLAQIMDEYAVQNSDQTDGSTVVNPNGILYMTASSASGSKYYDLVPRQQSYIAN
                     RWQEDVPTYSVIDITNDSFTIDTYRTDTDEKIDTTFTIRKESASAGGNEAPTPDTTTP
                     SQNPTQTTTPQTTPQATTPSSTQTTDKDQQTVSSPAAATPAVTKVTKTNITKAKITKI
                     SNKVYTGKAIKPHLTVKIGSKLLKSTKDYTVKYSNNKITGLAKVTIKGKGSYTGTKTI
                     TFKIIPKKAVIKSVRSKKKGTAAVMIKKDSSKVSGYQIAYAKNAKFKSAKVKMTTKTT
                     NTLKSLSSKKGYYVRVRAYKKISGKNVFGKYSKVTKVKVK"
     CDS             578550..579677
                     /codon_start=1
                     /locus_tag="lbkm_0551"
                     /product="integral membrane protein"
                     /protein_id="BBF41871.1"
                     /transl_table=11
                     /translation="MRDKKMILRKGCLLVFGILFLLFLFNINQLKKESFYDTKGRSFV
                     KAEVVKIIKDNKTESGNEIGNQVVTLHVQSGKFKGKKMEANSSNSYLFGAHCTVGKKV
                     IAIVSESKGTIVATVYSVDRAAKIYLIIGIFVLTIILIGGKKGLASVAGLGFTIICIL
                     FLFLPLIYGGTSPILAAIVVTLITTCATMYLIGGWSIKTLTATAGTVLGVIIAGIFAI
                     IFSKLTEITGYNVSDIENLLYVEEKTSIKIDQLLFAGILIAALGAVMDVAMSITSTIL
                     EIREKNPLLTRKELFRSGMNVGKDMMGTMSNTLILAFTGGSINTIVFIYAYNYQYNQI
                     INLHSIAIELIQGVASSMGVILTVPIVSFLAACLGTRNVRE"
     CDS             579767..579907
                     /codon_start=1
                     /locus_tag="lbkm_0552"
                     /product="hypothetical protein"
                     /protein_id="BBF41872.1"
                     /transl_table=11
                     /translation="MITNGSSISDPDQDWEEKLANLNKIVVQYEDTYMIQSLGYLLQT
                     VF"
     CDS             580357..581298
                     /codon_start=1
                     /locus_tag="lbkm_0553"
                     /product="hypothetical protein"
                     /protein_id="BBF41873.1"
                     /transl_table=11
                     /translation="MMIEELSKELLIQQEGMKQYESYQNKITSVENEIEKLNQEVIAL
                     TKALKKEDKDVADLEKGGLHTFYLKIRGTYEKSMNREVLEAAQAKVKLQNKQFELEDA
                     KRQLSLLQEECEKYKDCKEKYQHLYERKLAQLLLEENDAKVEILKLMTSIENSKHCVK
                     ELKEAIQAGKTVYYKLQEVEESLDGASSCGTWDILGGGLMADMMKHSHLDEAQSSLNE
                     VQSLMRRFRTELADVDMNLDIHIDTNGFSKFADFFFDGIFADMNMQSRIHEAQDDVTT
                     SLRKVKEVVGHLKVLLEQEENTIRTNENKIIELVNQA"
     CDS             581483..583504
                     /codon_start=1
                     /locus_tag="lbkm_0554"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41874.1"
                     /transl_table=11
                     /translation="MKKRHSMKTSLNAFFGICILTVFVIILRMTAVSVTNSTEKTRDS
                     DLTQSLETNANLVTEKLERFLSITDVIANESSINDPNQKWEEKLANLNQLVAKYSKTY
                     GIQSLGYITAEGLLRTTDDFQNDISDKQYYKDLMNSKDYVSSPSYNEKTGEQIIFFGK
                     PIMRDGKVVAALTCSFKGDFLSSIVKGIRYRGIGTAYILNAEGTVIGSDDYEEVKSNY
                     NLIADAKEKKELANIAAIQQKMIEGKTGLEQFNDGQEKLVAYRSIPNSSGWSVACEVP
                     VSKLNKDIDSLIRTLTITIIVSMIVLMGLFYYQTVRLSKQLLAVKGYINQFANGDFAI
                     AMDEKKLQTKNEFGDIYRAVDQSAHSLKEAIKSVLVNVDVLSKNAGQLDQAAADIVER
                     TDAIANAMSESASGNTDQASSIMDITGKMEELGENINQVNEKIQEIVTISGNTDKEIK
                     VSNSVLKELNESLEEVTVSYREFNSEVSDMTEQISNIGQITDSIKEIASQTNLLALNA
                     AIESARAGEAGKGFAVVADEIRHLAEASEESVNRIGTIIEQVLVSGKRIADSTDVMNQ
                     KMDVQKENVETTIHAFRNITEAVSSIIPRTTAISMASSDSIKKKNEMAMLVDNVSAVS
                     EELAATTEEVSATAEEFVATSRNVQGVSADLEKSVLELKEETSKFKIEE"
     CDS             583639..585096
                     /codon_start=1
                     /locus_tag="lbkm_0555"
                     /product="transcriptional antiterminator of lichenan
                     operon, BglG family"
                     /protein_id="BBF41875.1"
                     /transl_table=11
                     /translation="MFSPRQEYLVKTLMRKATELEPEYLCKKLSVSGRTLREDVKEIN
                     EFLHDYGVGIYLSSTGKYYISEDDKDKINQIIVMHEIESEWVPESKTQREFYIIMRLL
                     YEEDYLTMDEIGKEIYVSKASISHDVKRIDDYIFEVTKTRMDISKAKGIRLLTNELGK
                     RRLLFSLIYKNYDIDAKYLMKMFIHFQLGSREEFSTLWKIYEEFFEQNELISTHISFA
                     TILLETIACTGRIRQGYVIEDYDREEVEFKLALPFERIEDTFHMVFPKAEKQLLQEVF
                     HTKRMLVNQEEVTPTKFLIRQILVDFVEVIKEKYEIDLEQDYEQMKQLKAHLNAMVSR
                     LLLSYHEDEYIAGKIKSEYPKEYEMAAEITPIIKKYLNLDITEVEQAYIAMHVGAIVE
                     HLKKTVHAIIISNSTAVMIQMLQKKLQQSFYGQLVVDGCFPVNQLEFAIECIPQIDVI
                     LATHSLKKKVDIPVLKLNEFYEKEDWVIINDFINS"
     CDS             585237..587111
                     /codon_start=1
                     /EC_number="2.7.1.69"
                     /locus_tag="lbkm_0556"
                     /product="PTS system, beta-glucoside-specific IIB
                     component"
                     /protein_id="BBF41876.1"
                     /transl_table=11
                     /translation="MKYEQLAKDILSNVGGSENVEGLIHCYTRLRFTLKDQTKANKEA
                     IENLKGVSAVMISGGQFQVVIGNQVSEVYDAVVSVGNIKVAKEDNSEEKAEKKGSFVD
                     VISGIFLPVIGTMCACGMIKGLVALLVFFGAFTDKSTTYTILQGIGDSVFYYLPVFLG
                     FTAAKRFGGNPFTGMVMGASMVYPNILALATAKPIMTLFGGTIFKASATATLAGIPVV
                     AMDYNSTVFPVIIAVFFAVKLEKAINKKTPAVLKSFFAPFITLLIMLPLTFIVIGPIV
                     SILSNLVANGLQSFFGFNVIIASMVFGIVWQILIMFGLHGMIFPLIFMNLGMYGYDFI
                     FPGAFAASFTQVAACVALAMLEKNEEKKSISISSAISALFGITEPAIYGVTLPNKKAF
                     IASVISSGIGGLIIGIFNVKMYVMGGMGIVGIINYINPKTGSIEGTPYAVLAAVVSMV
                     ICFTITYIWNKKQPTKTVTITTEKNTIYAPIKGQVRPLDQCSDATFASGVMGQGVMII
                     PEEGVVKAPSNGRIETIFPTGHAVGMTTEDGIELLIHVGLDTVELNGKHFTALKKDGD
                     TVVAGEPIIQFDIRGIKKDGYRTETPVIITNADDYSKVTPVSFDLLDAMKPLMKVENK
                     "
     CDS             587128..588546
                     /codon_start=1
                     /EC_number="3.2.1.86"
                     /locus_tag="lbkm_0557"
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="BBF41877.1"
                     /transl_table=11
                     /translation="MKRNDEFLWGAAIAANQSEGAFEEGGKGVSIIDRLPSGKERFMV
                     MEHPQKFASQEFGYYPSRKGIDFYHRYKEDLTLLKEMGIKCFRFSISWSRIFPKGEET
                     QPNEEGLRFYDELIDEICKNGMEPLVTINHFDTPFHLAKEYGGWQNRKCVDFYVNYAE
                     TLLRRYRGKVKYWIPFNEINMVLHLPYVGGGLMLEEDCNQEQAKYLAAHHQLIANAMV
                     TKLAHEIDSANQIGCMLAAGNVYPETSNPDDVLLSIQKNRENYFFIDVQARGEYPSYA
                     KRTFKEKEIQITVTEEERKLLKENTVDFISFSYYNSRMCSAKPKKDGFDAAGNVFNTL
                     KNPYLEQTEWGWQIDPVGLRITMNDLYDRYQKPLFIVENGLGAKDTLEEGKVHDSYRI
                     EYLRSHIENMLEAVEDGVELIGYTPWSAIDINSASTGQMSKRYGFIYVDLDDAGNGTM
                     ERVCKDSYYWYQNVIKTNGSEL"
     CDS             588680..589960
                     /codon_start=1
                     /locus_tag="lbkm_0558"
                     /product="S-layer protein"
                     /protein_id="BBF41878.1"
                     /transl_table=11
                     /translation="MRKIRIIIGIILLSCIVSVLPAKASTLKSCKTQTQAALLIREKM
                     KSHSKTITFLYPYNKCKESMLLGLIKEASKPTKNPKEGDYLYYSLDKVGATIKKYGKD
                     QAMITYELKYRTTLKEEALVDQQVNKILGNLKLKNQKEEQKIKKIYDYICSHVSYDST
                     YRKYTAYDALITKKSVCEGYALALQRLLLESGVECRVMPGKAGNEKHMWNIVKVGKKW
                     YNLDATTDARNHSRYCYLCCNDELIGYQRESSYLTKSFNQSYSMSKICYQKSCINKLT
                     YYNKKFTAATYHTVDGKRDTIGKDKKNYKLVVYYPVNDSLSKDIVKSLSNLSILKKSN
                     IRMVAVEVGRASKAKVTSLKKKCGKKHVSFTFDPTYKSYNELCTNFKKVTGTTKASFP
                     IIMIVDPKNKVRYLTMGGDSVRFVNKAMSQLSGK"
     CDS             complement(590012..590785)
                     /codon_start=1
                     /EC_number="1.1.1.100"
                     /locus_tag="lbkm_0559"
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="BBF41879.1"
                     /transl_table=11
                     /translation="MYALITGASSGIGKEFARLLARKKMDLILVARRLDRLETLKEEL
                     ETKYHITVILKQCDLSEEANCQKLFEDCKPYPIGVLINNAGFGKTGRFDRIPLEDELS
                     MIQTNVIALHVLTKLFASHMNKGYILNVSSIAGHVPVPIMATYGATKAYVLSLTQSVN
                     YEMRKLNKPIYLSALCPGPVDTEFNQVAGADFNLSSITPKQCAAEGLRGLFQKKPVIF
                     PAKSTNILSKLSKFTPMKALLPIEYEIQTRKLDKDQYDL"
     CDS             590907..592091
                     /codon_start=1
                     /EC_number="2.1.1.79"
                     /locus_tag="lbkm_0560"
                     /product="cyclopropane-fatty-acyl-phospholipid synthase"
                     /protein_id="BBF41880.1"
                     /transl_table=11
                     /translation="MHIQEGMEKKLLERYLHTLDQVSFTLTLWDGDEIRVGEEPKFHA
                     TIKEAFDMGNLMKSTSLTFGEAYMDGKIEIDGDLFLAMDEMMKALKYFHTKPSYLPHI
                     YHRKHNEKEQKEDISSHYDIGNDFYSLWLDESLSYSCGYFEKDSDTLYDAQMNKIHHL
                     LKKLQLKPGMSLLDIGCGWGQLLIEAAKLYHVTGVGITLSEEQYEAFEKRIKEEKVED
                     YLSVQLLDYEKLDQTGWVFDRVISVGMIEHVGREHYPLFFKQVDHVLKEEGIFVLHYI
                     SAMKETKGDAWIRKYIFPGGVIPSLREIVWQIGEMGYHITDIESLRLHYYKTLLCWYH
                     NFNEHRDEVAKKFDERFLRMWQLYLATCAASFHNGNIDLHQIVMTKGIVNELPLTREY
                     LY"
     CDS             592300..594303
                     /codon_start=1
                     /locus_tag="lbkm_0561"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBF41881.1"
                     /transl_table=11
                     /translation="METKKGKVRSIKVKLLMGILPAIIVTLLAIILVVSNMTHSSLMK
                     KTNSLVKAETESAVNEISGWLQTSTSAMDTIATTINKNGMNEKEMRTYLKNILNTNDS
                     FPDGAYIAVEDGTLIDGTGWDPGDGLTDTDWYKQGQSSDTFVFGTPYVDDLTKEYVVT
                     AVKKLQIYEGKTSTFAADIKLKSMTELIKKITVAGSGDAFIIDATDGSILGAKDKKIV
                     GKTAKKIKDTYYKNVYDSIKAKNTKQRSFTAQNGKSYFTDIELIPGTSWYVVGRVQES
                     VIFKDVTSLQTFLWIFGVIAIILIAVVIERLVHRMIKPIKSMTNSIVAVSSGDFTEDI
                     VIKGNDEIAIMGHSLKDYVLKMREVISALAGIANELNTKAGHTGELSKELHESAGIQS
                     TSMAELSKTVEELVNAINEIAENATSLAQIVADTSADGESVVADMKVTKEAVQQGRSD
                     MGNVNQAMNRIQNSMGVLEQSIGEVGEKAVKIDEITNVISNIADETNLLALNANIEAA
                     RAGEAGKGFAVVANQIKSLADTSADAAAEISELISAVSTSINSTVTQSQNNMEEIKDS
                     VGFVDKASTTFDEIYHSINKTNDTINHMIAKVKEVDEVAVSVAAITEEQSASAEEIEA
                     TSEQITNLAQTVTDNSEAVENNAHEFMNDSDRLAKQIAIFKVK"
     CDS             594528..594845
                     /codon_start=1
                     /locus_tag="lbkm_0562"
                     /product="transcriptional regulator, PadR family"
                     /protein_id="BBF41882.1"
                     /transl_table=11
                     /translation="MVFNTGAALLDAIVLAVVSKDKEGTYGYKITQDVRSAIDISEST
                     LYPVLRRLLKDNCLEVYDMEFGGRNRRYYKVTDKGMAQLRLYHEEWKIYTSKLNEIFA
                     EVR"
     CDS             594847..595581
                     /codon_start=1
                     /locus_tag="lbkm_0563"
                     /product="hypothetical protein"
                     /protein_id="BBF41883.1"
                     /transl_table=11
                     /translation="MTKREYIEELRRLLGDIPKTELDEALLYYENYFEDAGEENEQHV
                     IQSLGSPSHVADMIRSNVFGTADESKEEYTDSGYHNREFQEYYEVSRNDGEESNQEQE
                     RKDYQRKYGPYGSENKNPVKWILIGLICIICFPVIGGVAAGIFGAIFGIIAGVIGIGI
                     GGLAGGVGMVIGGIALLIVGFANVALVPFSALFTIGVGCLLLGGGLLIFALGLLIFRK
                     LVPAAYHWIINIFSRLYHSIRGRVSA"
     CDS             595578..596438
                     /codon_start=1
                     /locus_tag="lbkm_0564"
                     /product="conserved domain protein"
                     /protein_id="BBF41884.1"
                     /transl_table=11
                     /translation="MRLFQKIITILGTLLVIIGIVIVVVAVSCGGHLLEQEEDNKNFT
                     TVSMEDLESTNKISSIRVDGESDKVQFEYGDEFKVVADKVDKDKFKVANENGTLVVED
                     KTRNGHKFLGMDITFFNFHFNNKAAKIVITIPKDFVSDTTEIHLNAGEVSGESLQTNH
                     LILKLNAGSIDLDQLVVKEDGKITVNGGSIDMDDFNGNNMDIALNAGSVEVSGKFSGN
                     NRVECNAGSAELNVNGSYDDYYFKYDVSAGNVEIDGESYHKDGKINSDKKDGFDLDCS
                     VGSIDVDFDH"
     CDS             596459..596650
                     /codon_start=1
                     /locus_tag="lbkm_0565"
                     /product="PspC domain protein"
                     /protein_id="BBF41885.1"
                     /transl_table=11
                     /translation="MEPKKLYKSREDRKISGVCGGIAEYFNVDPTIIRLVAVLFAFCA
                     FSGVIFYIIAAIIMPERTY"
     CDS             complement(596700..597527)
                     /codon_start=1
                     /locus_tag="lbkm_0566"
                     /product="hypothetical protein"
                     /protein_id="BBF41886.1"
                     /transl_table=11
                     /translation="MFEQLFGYFLVEHKILTEQQLVDALSLKQSQKVKLGTIARSLKL
                     LNVQQVEQIYDRQLSVDKRFGDLAKEFGYLKDEEIETLLRLQGDTYMKFIQVLMNQYN
                     LSLEEIERELLAYQIEHNLTNSEMNILKSNDIDQILPLFLNFHSPEYTKLFSLTIHGL
                     LRNISDDIILHPATIATSCPVTDCYIQPINNLTLAIDGTPEAIFHFNKQLQNKFPVED
                     INGFLDSIKAVLLSKPHNDIECHQTDCLKDTCLEGHQFVILPITLDQLPFNIIIYAH"
     CDS             597761..599533
                     /codon_start=1
                     /EC_number="6.1.1.19"
                     /locus_tag="lbkm_0567"
                     /product="arginyl-tRNA synthetase"
                     /protein_id="BBF41887.1"
                     /transl_table=11
                     /translation="MKQIIDLIKEEIVKAFIESGYEEKYGMVTLSNRPDLCQYQCNGA
                     LAAAKQYKKAPAMIANEVVEHLKDRTLLRDVTVVMPGFINLNVSDEFLADYMNQMEAA
                     DNFGCEKTENPKTIVIDYGGPNVAKPLHVGHLRSAIIGESIKRIDKFVGHNVIGDVHL
                     GDWGLQMGLIITELKKRKPELVYFDDNFEGEYPTEAPFTISELEEIYPCANAYAKEHP
                     EFKEEAKHATYLLQSGKKGYTALWNHILNVSVNDLKRNYENLNVSFDLWKKESDAQPY
                     IPEMVQYMKDNGYAHLSDGALVVDVKEETDTKEVPPCMILKSDGSSLYNTTDLATIVE
                     RTKLFNPDAITYVVDKRQELYFDQVFRCAKKTKIVGDDVKLTFLGFGTMNGKDGKPFK
                     TREGGVMRLEFLIKSINDEVYNKIMSNREMSEEEAREIAKKVGLAAIKYGDLSNQASK
                     DYVFDVERFTSFEGNTGPYILYTMVRIKSIMNKYKEVTGKDIVAGANILPAANAFERD
                     LMLQLSKFNTTIYTAFEENAPHKICQYVYDLSNAFNKFYHETKIIAEENEEKRASWIS
                     LITLTLNILDTSINLLGMECPDRM"
     CDS             599661..600974
                     /codon_start=1
                     /locus_tag="lbkm_0568"
                     /product="hypothetical protein"
                     /protein_id="BBF41888.1"
                     /transl_table=11
                     /translation="MYKEVSKLIIYRNLGEDSILRNLSDIFKDFDEQNVSNDVLITRI
                     YREVNHLLDVATRYGFNYNLWHNYLAFILATNENPFSLTMEKAGKREASVNEFAKNDF
                     YIIKKLFDYDFEPIQKALGIRCFDVLLNYTSIQKTERIYNKNVSEKVIALSEQIEKAK
                     NKDEIFDIVTEFYKVYGVGKIGLNKAFRVIHEKEVPVLQPITNTEQVHLDDLIGYEIQ
                     KKKLIDNTEAFVSGRKANNVLLFGDAGTGKSTSVKAIINEYYDKGLRIIEVYKHQFQD
                     LSTIISQIKNRNYKFIIYMDDLSFEEFEIEYKYLKAVIEGGLEIKPDNVLIYATSNRR
                     HLIRETWDDRSDMSKDELHRSDTVQEKLSLVARFGVTINFSKPSPKEFFEIVKGLAKR
                     DPAIQLSDEELVAEANKWELSHGGISGRTAQQFINYLDGQAGKEQ"
     CDS             complement(601045..603168)
                     /codon_start=1
                     /EC_number="2.7.4.1"
                     /locus_tag="lbkm_0569"
                     /product="polyphosphate kinase"
                     /protein_id="BBF41889.1"
                     /transl_table=11
                     /translation="MDKSFKKPAYFRNRELSWIEFNYRVLNEARDKTIPLFERLKFLS
                     ITASNLDEFFMVRVASLKDMVNANYTKTDISGLSPSEQLAKITKKAHQLVQMQYSTYN
                     RSFLPLLRQNELHVVNEFEKLTEEQSNYVDEYFMNQVYPVLTPMAVDSSRPFPLLRNK
                     SLNIAALLKDKKSNKNHDFATVQVPSVLPRIIEIPSVDDVGKTFILLEQIIEKNIHKL
                     FLNYEVTCAFPYRIMRNADLSIDEEEAADLLTEIQKQLKKRQWGEVIRLEIEEGMDKR
                     LLKILTRELNIRNEADIYTINGPIDLTFLMKLSGMEGYDHLRYEKYIPQPVEGLNLEE
                     DLFAQIREKDYLLHHPYDSFDPVVEFIRRSAKDKNVLAIKQTLYRVSSNSPIIASLAE
                     AAGNGKQVTVLVELKARFDEENNINWARKLEQAGCHVIYGLVGLKTHCKITLVVRREE
                     DGIRRYVHLATGNYNDSTAKLYTDMGLLTCSKPFGEDATAVFNMLSGYSEPLSWNKLC
                     LAPLWLRDKFMYLIERETELAKSGKDAHIIAKMNSLCDAKIIAALYEASAAGVKIELI
                     VRGICCLKTGINGISDNITVRSIVGTFLEHSRIFYFYNGGYEEIYMGSADWMPRNLDK
                     RVEILFPIEAEDLKARLKEYLQLQLKDNVKAHILQNDGTYEKVDKRGKVLFNVQKFFC
                     QTAKRRNHKNKDSALDRVFEPLENE"
     CDS             complement(603168..604706)
                     /codon_start=1
                     /EC_number="3.6.1.11"
                     /locus_tag="lbkm_0570"
                     /product="exopolyphosphatase"
                     /protein_id="BBF41890.1"
                     /transl_table=11
                     /translation="MAITTFAAIDVGSNELAMKIYQVSKKDGIRELDHIRYTMELGSE
                     TYTHGKISIDSINELCTVLTKFTKKMKEYDVSDYTACATSGIREAVNHLFILDQIKLR
                     CDMKVKILSNSEQRYLYYKGLSTTELNFDDIIKRETAIVDVGSGSIQISLFKDQALMS
                     TQNILLGSLRVRELLGSMNNQTTNFNSLVSEYMDNDFNTYRSMFLNNFDTKNIIGVGE
                     RLGDLFRYSKKYFGETSLNKERFLKLFQSLTNNSLEDISKELHIAKEQASLLLPTALI
                     YYKMLHFTKAESLYFCNITLCDGIVADYAEKKEKVMPTHNFTNDIISASRNIASRYDC
                     DIMHTNNVEYVCMKLFDSLKKIHGMSKRDRLFLQIAAILHSCGEYVNLNKVPENSYRI
                     IMSTEIIGISHSERELIANIVRFNVSNFPNFEDVAPFLDKEHYLKIAKLTSLLRIANA
                     LDKSHKQKFDHITITRKGRELYITVDTLKDITLEQGLFLSKADFFEEVYGIRPILKQK
                     RSLS"
     CDS             604882..605907
                     /codon_start=1
                     /EC_number="5.-.-.-"
                     /locus_tag="lbkm_0571"
                     /product="S-adenosylmethionine:tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="BBF41891.1"
                     /transl_table=11
                     /translation="MKTSDFYFDLPEELIAQDPLEDRSSSRLLVLDKETGKYEHKVFK
                     DIIDYLEPEDCLVINNTKVIPARLIGEKEGTGAKIELLLLKRKQDDVWETLVKPGKKA
                     KPGAKIIFGGGILTATVLEVVDEGNRLIQFSYEGIFEEILDQLGQMPLPPYITHQLED
                     KNRYQTVYAKYEGSAAAPTAGLHFTKELLEKIQEKGIVIANVTLHVGLGTFRPVKVDD
                     VEKHHMHSEFYRIEPEEARKINEAKKKGKRVICVGTTSCRTVESAANEDGYVIPGCGN
                     TQIFIYPGYKFKVLDNLITNFHLPESTLLMLVSALAGKEYIMAAYEEAVKNRYRFFSF
                     GDAMFIH"
     CDS             605936..606823
                     /codon_start=1
                     /locus_tag="lbkm_0572"
                     /product="transcription regulator with diacylglycerol
                     kinase catalytic domain"
                     /protein_id="BBF41892.1"
                     /transl_table=11
                     /translation="MKKMLFIYNPCAGKGMIRSKLSYIIETFGNADYEVTVYATKGKN
                     DATKIAAEQGSKYDLVVCSGGDGTLNEVTIGLMDCEKRPPCGYIPAGTTNDMASSLGL
                     YKNMIKAAETVVDGEPFPYDLGTLNGDYFIYVAGFGAFTDVSYATSQNIKNILGRLAY
                     LLEGVKRVPSLQSFRYRVEYDDTVIEDDFIYGMVTNSNSIGGFKALNGKDVSLNDGLF
                     EVLLIRMPHNLLDLQGIINSLISGNLNSKFCISFHTSKLKMTSDELIPWTIDGEFGGN
                     LREVEIVNHPSAISYITNK"
     CDS             complement(607129..608406)
                     /codon_start=1
                     /EC_number="2.5.1.19"
                     /locus_tag="lbkm_0573"
                     /product="5-enolpyruvylshikimate-3-phosphate synthase"
                     /protein_id="BBF41893.1"
                     /transl_table=11
                     /translation="MKLNKANHLLGEIIVPGDKSISHRSIMLGAIAKGDTKITHFLQG
                     ADCLSTISCFQKMGISIENNRSEVIIHGKGLHGLKCPNDLLDVGNSGTTTRLMSGILA
                     AQPFTSCVNGDASLQKRPMNRIIKPLSLMGADIESDHGNGCTPLTIHGKPLKAIHYDS
                     PVASAQVKSSILLAGLYAEGNTSVTEPFLSRNHTEIMLNFFGGNVLSEGTTATVYPEP
                     SLEGRSVQVPGDISSAAYFIVAGLITPKSEILIKNVGINPTRDGILRVCNEMGADIKL
                     LNQSDKNGEPSADILVKTSNLKGITIGGSIIPTLIDEIPIIAVLACFANGTTIIKDAA
                     ELKVKESNRIDVVVKHLQKMGAHITATEDGMVIEGGYPLNGAVIESNMDHRIAMSFAI
                     AALNAYTPTTIKHAEIVDVSYPGFFEDIKALQR"
     CDS             complement(608425..609531)
                     /codon_start=1
                     /EC_number="1.3.1.12"
                     /locus_tag="lbkm_0574"
                     /product="prephenate dehydrogenase"
                     /protein_id="BBF41894.1"
                     /transl_table=11
                     /translation="MDDISIGFIGFGLIGGSIAKAIKETHPNARILAYNYHQNTNTSL
                     ELALSEHVIDEIVTELKPSFHDLDLIFLCAPVLTNIEYLKQLKEIINDSCIITDVGSV
                     KGEIHNAVSALQLDHNFIGGHPMTGSEKTGYENSSAVFLENAFYILTPTALTKNKQYQ
                     FLEALVRDMKAIPICLDSTTHDDATAAISHVPHIIAYSLVKMVEQEDNPEHIMKTIAA
                     GGFKDITRIVSSSPVMWQSICLTNKESILKFLHRFQDTLSESIQMIEQQDSEKLYTMF
                     ENGKEYRDSLSDSSNGALHKVYEVYVDIIDEAGAIATIATLLAINGISIKNIGILHNR
                     EFSQGVLRIELYDEKGAGKTVELLKHYHYTIYKR"
     CDS             complement(609544..610575)
                     /codon_start=1
                     /EC_number="2.5.1.54"
                     /locus_tag="lbkm_0575"
                     /product="2-keto-3-deoxy-D-arabino-heptulosonate-7-
                     phosphate synthase I beta"
                     /protein_id="BBF41895.1"
                     /transl_table=11
                     /translation="MIGEIKMIIVMKPNASKDSVNNILNIIKDNGLEAHLSDGKEVTI
                     IGVIGDKSRLETHNLEIAPEVEKIVPITESYKLANRKFHPENSTVKVGNVTIGGDEII
                     IMSGPCAVESKEQVLETARAIKASGAQILRGGAYKPRTSPYSFQGLEEEGLKYMKEAR
                     EATGLSIVCEVTSLAAIEAASKYVDMLQIGARNMQNFYLLKEAGKTGLPILLKRGLSA
                     TIDEWLNASEYIMAEGNPNVVLCERGIRTFETATRNTLDISAVPVIKEKSHLPIIVDP
                     SHATGVRNYVKPLAMSAVAAGADGLMIETHPNPAVALSDGPQSLTFDQFDKLCEELRP
                     LANVVGRKF"
     CDS             610857..612938
                     /codon_start=1
                     /locus_tag="lbkm_0576"
                     /product="translation elongation factor G-related protein"
                     /protein_id="BBF41896.1"
                     /transl_table=11
                     /translation="MVVYSTDKIRNVVLLGHGSCGKTTLVEAMAHTMGITKRQGSIIE
                     GNTISDYDKEESKRKFSISTSVVPIIYEDTKINFLDTPGYFDFIGEVEEAISAADAAV
                     IVISAKAGVEVGTMRAWNLCETYHIPRLFFVTDMDDDHASYREVVEKLTELYGKRVAP
                     FHLPIRENEKFVGFVNVVKMAGRRFTKESEYEECEIPDYSQKNLEKVREALLEAVAET
                     SEELMEQYFAGEEFTREQISEALKTNVIDGTVVPVLMGSGLQTQGTTMLLDAIVKYFP
                     SPEKLKVQAELESDATIKFDADYDSKKPVTLRVFKTIADPFIGKFSLFKVCSGILKSD
                     MILRNSSSDVEEKVSKIYMLRGKEQQEVKQLYPGDIGAIAKLTATKTGDTLTDRKTLV
                     QFPRVKISKPYTYLKFETVNKGDDDKVSQALAKLMDEDLTLRVENDVENRQTLLYGIG
                     EQQIDVVVSKLLNKYKVSIETSKPKVPYRETIRKKVEVRGKYKKQSGGHGQYGDVVME
                     FEPYNDLSIGYVFEEKVFGGSVPKNYFPAVEKGLQESVLKGPMAGYPVVGLKATLTDG
                     SYHPVDSSEMAFKMATIQAFKQAFMKANPILLEPIVTFKVKVPDKYTGDIMGDLNKRR
                     GRVLGMNPIEGYGQEIVADVPLSEIYGYSTDLRSMTGGIGDFSYEFSRYEQAPSEVQA
                     KVIEESVHVEE"
     CDS             613068..613937
                     /codon_start=1
                     /EC_number="3.6.1.27"
                     /locus_tag="lbkm_0577"
                     /product="undecaprenyl-diphosphatase"
                     /protein_id="BBF41897.1"
                     /transl_table=11
                     /translation="MIEILKTLILGIVEGITEWLPISSTGHMILVDEFLKMNQSEAFM
                     KMFQVVIQLGAIMAVVVLYWNKIFPFGIKKNNVDTVYDKKQDITFYKGKFYVDMSMII
                     MWLKIAVACIPSIIIGLPFDDKIDAMFYNFQTVAITLIIYGVLFIVVENWNKGRKPCM
                     TDMEDITFQAAAIIGIFQVLALIPGTSRSGATIIGGLLIGMSRTLAAEFTFFLAIPTM
                     FGASLLKLIKFGFHFSSMEIVILFIGMLSAYLVSVFAIKFLMSYIKKHDFKFFGYYRI
                     VLGIIVIGYWIFK"
     CDS             613983..614480
                     /codon_start=1
                     /locus_tag="lbkm_0578"
                     /product="hydrolase, HAD subfamily IIIA"
                     /protein_id="BBF41898.1"
                     /transl_table=11
                     /translation="MFQRFYPDEIKKSAYEIDYERLYQEGYRGLLFDIDNTLVEHGKD
                     ATEESIELFKRLKKIGFEVCLISNNKVERVERFNKQIQVKYIFDAHKPRRKNYLKAVE
                     LMGTNLKNTIFVGDQLFTDVYGAKRTGLRNILVEPIDPKEEIQIVLKRYLEKIVLHFY
                     RKSKA"
     CDS             614558..614755
                     /codon_start=1
                     /locus_tag="lbkm_0579"
                     /product="hypothetical protein"
                     /protein_id="BBF41899.1"
                     /transl_table=11
                     /translation="MEKLDQVYRILLGLGLLIFGVELVAILFHLSVASGLQIGLIGVI
                     AIASILAIIYTGLEIKENEIK"
     CDS             614781..615293
                     /codon_start=1
                     /EC_number="2.7.1.71"
                     /locus_tag="lbkm_0580"
                     /product="shikimate kinase I"
                     /protein_id="BBF41900.1"
                     /transl_table=11
                     /translation="MKDNIILIGFMGCGKTTVGKQLAKRLGYQFLDTDQYIEDKSKMK
                     ISHIFAEYGEEYFRALETAAVKKLIETTHKTVISSGGGLPLREENARLLQELGQVFFL
                     NVSKEEVYRRLKGDTTRPLLRGKNPEEKIDQMMKYRVPIYKNAAEYEINVDKKNVEEL
                     VNEIELVSKM"
     CDS             615394..615951
                     /codon_start=1
                     /locus_tag="lbkm_0581"
                     /product="translation elongation factor P"
                     /protein_id="BBF41901.1"
                     /transl_table=11
                     /translation="MVSAGDFRNGLTVEIEGNVYQIIEFQHVKPGKGAAFVRTKIKNI
                     KSGGVVEKTFRPTEKFPQAHIDKSDKQYLYSDGDLYHFMDVETFDQFALAEDQIGDSL
                     KFVKENDMVKMLSHNGEVFAIEPPMFAELVIVETEPGFKGDTATGATKPAVVETGATV
                     YVPLFVEQGDKIQIDTRTGDYLKRV"
     CDS             complement(616031..616846)
                     /codon_start=1
                     /EC_number="1.1.1.25"
                     /locus_tag="lbkm_0582"
                     /product="shikimate 5-dehydrogenase I alpha"
                     /protein_id="BBF41902.1"
                     /transl_table=11
                     /translation="MIIAIFGSYENDTKEGLLMRYGLIGEKLGHSYSKVIHEKLADYT
                     YDLIPLAKDELDAFMKAKDFAALNVTIPYKCEIIPYLDELDNNAKRIGAVNTIVNDHG
                     RLIGHNTDFSGFEYMVLHNKIEVKDKKVLVLGIGGASKAIHAVLEHLGAKEIIMVYRR
                     DTDTAISYETCFQHHLDANVIVNTTPVGMYPNCDASPIDLSKFDHLSAVLDIIYNPIE
                     TSLTKQANSLGIKGITGLEMLVAQAKYAVEFFLDKKLDESCIDAIYQDIRKTL"
     CDS             616962..617915
                     /codon_start=1
                     /locus_tag="lbkm_0583"
                     /product="stage III sporulation protein AA"
                     /protein_id="BBF41903.1"
                     /transl_table=11
                     /translation="MDKRDEILKIFSMNIRKVLAAVKINYNYLQEIRLRINGPLMVIY
                     NNQEYFVTKNCVLDRGIDRAYIVSQNELRETMEYISNYSLYAFEDEIKQGFITIQGGH
                     RVGIAGKTILEADKIKNIKHISFINIRLAHQIKGCADKVIPYIVENKEVHHTLIISPP
                     RCGKTTLLRDMIRQLSNGEHGIPGVTVGVVDERSEIGACYMGVPQNELGIRTDILDCC
                     PKANGMMMLIRSMSPHIIAVDEIGSREDVEAIEYVINCGCKLIATVHGSTIDDIKNKP
                     LLGKLVREKVFERYVVLNNHGGIGNIGEIYDARGTLLYRGN"
     CDS             617927..618442
                     /codon_start=1
                     /locus_tag="lbkm_0584"
                     /product="stage III sporulation protein AB"
                     /protein_id="BBF41904.1"
                     /transl_table=11
                     /translation="MKIIGAILVICSSTAIGFYMSAMLLGRIRELRELKKDVFILRGD
                     IQYGNTPLPEAMEAIARRSNGVFSQFFHTVSKQMERLSGKPLSVIWEKAIKEILKDSY
                     LSKLDKEHLMKLGDNLGYLDQQMQIKTIDLYIEQLQLEIDTAVESKKEKTRIYNMLGI
                     LSGIFITIVLI"
     CDS             618467..618661
                     /codon_start=1
                     /locus_tag="lbkm_0585"
                     /product="stage III sporulation protein AC"
                     /protein_id="BBF41905.1"
                     /transl_table=11
                     /translation="MDINLIFKIAAVGILVSVLSQVLKHSGRDEQAFLASLAGLILVL
                     LWLIPYIAELFDTIKSLFAL"
     CDS             618676..619056
                     /codon_start=1
                     /locus_tag="lbkm_0586"
                     /product="stage III sporulation protein AD"
                     /protein_id="BBF41906.1"
                     /transl_table=11
                     /translation="MVKIAIVGIVAVLLAIQLKSTKSEYGTYISLAACIVIVCLGMSR
                     LESIVEGINKIQSYITINKAYLAILLKIVGITYIAEFASNLCKDAGHGAISNQIELVG
                     KLTILSVSMPILLALLDTVNDFLS"
     CDS             619129..620244
                     /codon_start=1
                     /locus_tag="lbkm_0587"
                     /product="stage III sporulation protein AE"
                     /protein_id="BBF41907.1"
                     /transl_table=11
                     /translation="MPVMASSETENTETEKNKYIDETADRVDYDEIQKVIDEVASGSQ
                     PFNFKEYVKGLTQGDDGISFSQILGDVKAAALNELNVNKKTIFQLIAVAIVAAIFTNF
                     SNIFHNNQVADTAFYVTYLFMFSILTVSFVLATNIAINVLNAMFTFMKVLIPTYMVSV
                     AFCAGARTSMVYYESTLLIITLINFLFLKIILPLINIYFVLVLANNLSKEDMLSKLAE
                     LLEMIITWSLKTLLAVVIGMNAIQALIFPSVDRVKNSIFLKSMKAIPGMGNAINMVSE
                     TVIGASVVVKNAIGVGGLIVILIICLIPIIKLVFYVFMYKFGTAIVQPISDKRILNCM
                     GAASQAAKLLLSTVIITVVMFLFSIAIVATATNLRLT"
     CDS             620254..620907
                     /codon_start=1
                     /locus_tag="lbkm_0588"
                     /product="stage III sporulation protein AF"
                     /protein_id="BBF41908.1"
                     /transl_table=11
                     /translation="MEILYNAVKNIILFLILLAIIQNLVGKSGYRQYINIFAGMVLIL
                     IVVMPIMDLFHVTDKLTYYFDLNQFKAGTKGISGKMSEAEASTNQKIIQEYKEQIVDE
                     VKIKLSNHNVTATSIKLELEMDQKKDSYGRVKKLVIYGKQQKSGSKKSSQNDDVSAVD
                     KVAIDHIKLNEVQVDDSESDQTEDDIKYDTVLELNVKEDLAGYLNVSIDCIEVEIKS"
     CDS             620926..621555
                     /codon_start=1
                     /locus_tag="lbkm_0589"
                     /product="stage III sporulation protein AG"
                     /protein_id="BBF41909.1"
                     /transl_table=11
                     /translation="MGIKDLFKQLKERRNTEGKEKKPLSIKDIGLPKLIILLVCGVII
                     LMPMNFNLFNKSKKSSSVSTTTSNTSSNGESKTNEEYTKEMENKLKQGLSLVNGVGKV
                     EVMITLKSSKTSVVLKDTPTEENTTKEKDSTGGTRDNTTKKSEEKTVMSTENGSSIPY
                     EIKKYEPEIEGVVVIAKGAKSPSIQNEIVDAVLALFEVPAHKIKVMSMD"
     CDS             621573..622406
                     /codon_start=1
                     /locus_tag="lbkm_0590"
                     /product="stage III sporulation protein AH"
                     /protein_id="BBF41910.1"
                     /transl_table=11
                     /translation="MKDILKKNQVIIAALAIMICVAGYLNFTQDKIENKDAAVSSKDA
                     ITNTKSDTGISDKDATVIPDASDNSEETTVETDKVLKENETDITDESDSKTEKSANAS
                     DTNEVKKNDNSTKNDTSTKTTDNKDSVGDAVLANSSVSNEFFASAKLKREQTRAKSKE
                     TLLQVINNKNISEDQKQKAIDEMIKITGYTDKETHAETMLEAKGFKDTVVTMSDDSVD
                     VVVNCNNLTEQQMAQIEDIVKRQTEISAEKIVISPAKVTTDQTDNSSKKTESKKAETK
                     E"
     CDS             622577..622966
                     /codon_start=1
                     /locus_tag="lbkm_0591"
                     /product="alkaline shock protein"
                     /protein_id="BBF41911.1"
                     /transl_table=11
                     /translation="MNKELEKDSAYKVLDNSSIGEVQIADEVVAIIAGLAATEVEGVA
                     SMAGNITNEIVGKLGKKNLSKGVKVEVGTEAVTVDVTIILKYGYSIPKTSIQVQDRVK
                     SAIENMTGLTVDEVNVRIAGVDMDQNK"
     CDS             623101..623541
                     /codon_start=1
                     /locus_tag="lbkm_0592"
                     /product="transcription termination protein NusB"
                     /protein_id="BBF41912.1"
                     /transl_table=11
                     /translation="MSRRELREHIFKMLFRKEFHNQEELNEQIQFYFDELEEPATKDV
                     EYLTKKFNNIMEHIEEIDAIIEQASEGWKLNRMGRVDLTLMRVATYEIFFDEEVPTGV
                     AINEAVEISKKYAEDNSPSFINGVLAKVAESFDKNGASVSNEAN"
     CDS             623767..624765
                     /codon_start=1
                     /EC_number="3.1.11.6"
                     /locus_tag="lbkm_0593"
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="BBF41913.1"
                     /transl_table=11
                     /translation="MSEGQSVIVLGSVSVYERDGKYQIYAREIMLDGLGNLYAKYEQL
                     KKELEETGLFDPSHKKRIPYYSSKVGIVTASTGAAIQDIINIATRRNPYVQLILYPAL
                     VQGEGAKASIVKGIKKLDEMELDVIIVGRGGGSIEDLWAFNEEVVAQAIYQCKTPIVS
                     AVGHETDTTIADYVADMRAPTPSAAAEITVRDIREVMQQIESYSSAMNQRLRNKISIY
                     RYELERKRMKLEYASPVNQIQQKRQYLIHTEEKMNQLMEMKVKDKRHKLAIYIEKMKG
                     LSPLDKLNHGYAIAMNEEGNTISSIKQAKTGEKLTIAVKDGDIITTVESKVTRRRK"
     CDS             624765..624962
                     /codon_start=1
                     /EC_number="3.1.11.6"
                     /locus_tag="lbkm_0594"
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="BBF41914.1"
                     /transl_table=11
                     /translation="MAKAATKTLEQSFDALDEILAKLEQEDVTLEDSLKLYNDGMKLL
                     KSCNDAIDKVEKKIIVVEEDK"
     CDS             624989..625879
                     /codon_start=1
                     /EC_number="2.5.1.90"
                     /locus_tag="lbkm_0595"
                     /product="octaprenyl diphosphate synthase"
                     /protein_id="BBF41915.1"
                     /transl_table=11
                     /translation="MEFREALSEKKQEVDQIVKSFMPKEEGYQKIILEAMNYSLNAGG
                     KRLRPMLMQECFYLFQGEKEEVLHPFMAAMEMIHTYSLVHDDLPAMDDDEYRRGRKTT
                     HIVFGEDMGILAGDALLNYAYETVAQAFSVTESLSRSAKAFQVLAKKAGVYGMVGGQV
                     VDVEMTNKPIPKDKLDFIFALKTSALIEASMMIGAILAGASDSEVAKIERIANRIGLA
                     FQIQDDILDVTSTTEVLGKPVLSDEKNNKTTYVTLVGLEKAKEEVEALTKEAVVLLEE
                     MPYENEFLNQLLLALVNRKK"
     CDS             625932..627803
                     /codon_start=1
                     /EC_number="2.2.1.7"
                     /locus_tag="lbkm_0596"
                     /product="1-deoxy-D-xylulose 5-phosphate synthase"
                     /protein_id="BBF41916.1"
                     /transl_table=11
                     /translation="MFEILEQMKHPNDIKKIDPADYRKLAKEIRRFLIGNISKTGGHL
                     ASNLGVVELTMALHLSLDLPEDKIVWDVGHQAYTHKILTGRKEGFKTLRKYEGMSGFP
                     KKSESDCDCFNTGHSSTSISAALGLAKARDIQKKDDTIVAVIGDGALSGGMAFEALNN
                     AARMKSNLIIVLNDNNMSISENVGGMSNYLGKIRTDQKYQGLKDNVEHTLRKVPKVGD
                     AIVERVKRSKDSIKRLVIPGMLFEDMGITYLGPIDGHNIAQMMTAFNNAKKKKGAVLV
                     HVITKKGYGYKPAEDQPSKFHGIDPFDVKTGDVIKKSSTESYTQVFSDTLVRLGKENE
                     KIVAVTAAMPTGTGLVKFQENYPDRFFDVGIAEEHAVTFAAGLADGGLKPFVAIYSTF
                     LQRAYDQIIHDVCIGNYPVVFAIDRAGIVGNDGETHQGIFDLSYLMSIPNLAVIAPKN
                     KCEFAAMLEFCAEYDKPIAIRYPRGAAYEEYDEFQTPIINGKCEILHMEEDILILSVG
                     SMLKIADEVRDELKRKGLRVSIVNVRFVKPFDFETLDWLLENHSTVVTMEENVASGGF
                     GQMIGSYLAQNQEDVTMIPIALPDNFLEHGDPDLLRKKVGFTKENISEIILKKREEA"
     CDS             627800..628612
                     /codon_start=1
                     /locus_tag="lbkm_0597"
                     /product="RNA binding methyltransferase FtsJ like"
                     /protein_id="BBF41917.1"
                     /transl_table=11
                     /translation="MKQRLDVMLVERGLAESREKAKAIIMSGNVFVDGQREDKAGTSF
                     QEKVKIEVKGHTLKYVSRGGLKLEKAIEHHGVSVEGKICMDVGSSTGGFTDCMLQNGA
                     VKVYAVDVGTNQLAWKLRQDERVVSMEKTNIRYLTKDQIADEIEFASIDVAFISLTKV
                     LEPVKNLLNADGEVIALIKPQFEAGREKVGKKGVVRDKAVHIEVIEQVISYANSIGFD
                     LIRLDYSPIKGPEGNIEYLAHLKKTQKDMIEYSLEKEFVKDLVDQSHGSLDK"
     CDS             628631..629503
                     /codon_start=1
                     /EC_number="2.7.1.23"
                     /locus_tag="lbkm_0598"
                     /product="NAD kinase"
                     /protein_id="BBF41918.1"
                     /transl_table=11
                     /translation="MEKFCIITNNDKDKNYVISKEIQTYLKSVGKSCIIAKEADIRVQ
                     EYDPYTDISVIDDDTDCAIVLGGDGTLIQAANDLLDKDIPLLGVNLGTLGFLAEFEKD
                     SIYDMLPYLFEDKCTIENRMMLDGKAYDETNKAIYHGKSLNDIVITKRGLCRLITIHV
                     YVNDELIDTYLCDGVIVATPTGSTGYNLSAGGPVVVPKLQAMMITPICPHTLNNRCIM
                     VTADDKIELEIGKSKETLEDEAMAVYDGRIVCALKTGNRIQINKANEETRLVRVTDKS
                     FFQILRSKIGKGRA"
     CDS             629506..629970
                     /codon_start=1
                     /locus_tag="lbkm_0599"
                     /product="arginine pathway regulatory protein ArgR,
                     repressor of arg regulon"
                     /protein_id="BBF41919.1"
                     /transl_table=11
                     /translation="MKVGRQSKIIELITDHDIETQEELADKLNKAGYNVTQATISRDI
                     RELKLTKIATSEGKQKYIILKNQDSNLYEKYVRVLSDCFVSMDMAMNIVVIKTVSGMA
                     MAVAAAVDNLHINGIVGCIAGDDTIFCAIKSVDSVPAVMDKITKLVNSRSNE"
     CDS             630092..630832
                     /codon_start=1
                     /locus_tag="lbkm_0600"
                     /product="YebC/PmpR family DNA-binding transcriptional
                     regulator"
                     /protein_id="BBF41920.1"
                     /transl_table=11
                     /translation="MSGHSKFANIKHKKDKNDAAKGKIFTKIGREIAVAVKEGGADPN
                     NNSKLRDVIAKAKSNNMPNDTIDRSIKKAAGADSDVNYVTVTYEGYGPNGIAVIVETL
                     TDNKNRTASNVKNAFTKGNGNVGTPGCVSFMFDKKGQIIIDKEECDMEADDLMMIALD
                     AGAEDFNEEEDSFEILTDPDTFSEVREKLEAEGIAMAAAEVTMIPQTWGELTDEHDIK
                     FFRKTLDMLEEDDDVQNVYHNWDEPDEE"
     CDS             631005..631913
                     /codon_start=1
                     /locus_tag="lbkm_0601"
                     /product="site-specific recombinase XerD"
                     /protein_id="BBF41921.1"
                     /transl_table=11
                     /translation="MLLEDCLKEFIFDCKLRKLSERTIKSYRNNNLLMFSYLRKELDI
                     VEVEDVNHKCIQSYIDYLMRKELKESYINGLIKVFRAFFKYAYEEEYINRNPMLRVKW
                     QKEEIPVITTFTNDEVRKMIAYYSGKRFLDIRNKLIMVVLLDTGIRNNELCTIKLDDI
                     KETYIVIHGKGKKIRHVPITHIVNKYLIKYFRIRDEYIKDKFSYQNEYLFLSQKGKQL
                     TIETVERVVKDCGDGAGIRKDIRCSPHTCRHYYAQAQLVNGCDIYTLSKLLGHQNINI
                     TKRYLLSMHNDNFIEMGAKTSPLRNL"
     CDS             632153..632329
                     /codon_start=1
                     /locus_tag="lbkm_0602"
                     /product="hypothetical protein"
                     /protein_id="BBF41922.1"
                     /transl_table=11
                     /translation="MEYKITREDIHKFQDVIVEMLDELEKFKDNSHTAFENKIIRIFS
                     GNMQTVKRSVPIDY"
     CDS             632502..633551
                     /codon_start=1
                     /locus_tag="lbkm_0603"
                     /product="hypothetical protein"
                     /protein_id="BBF41923.1"
                     /transl_table=11
                     /translation="MLLHLLENGESSLKIGLEFYEKYLTQDFTVSEVEYYGKLKFAII
                     GIQNSIELFIKKLLSEVDDLLIYDQDTIDNPDVLNYIGRMYKDKQKINLDYFMATYGE
                     NFTTISYSRCLARLKACFNITDYNIGVLQKVNSYRNVLTHFGLEDIYGQDKMVYTLNE
                     SLVIIRDILIPYINLKREKVDKEWSDLITDFLKSNEDNFYEVWEASNEYNIEWYNGRL
                     DELLTNDTKIESIVGTKEEFVYEENNIILNGKSRKITLEITDIPEKNISVIGYNKKVL
                     AIMDYDLFAGEKDTGFVYCPKKDEEIEQLIRTKKCTWRNSNNCPYNRIPLEINSFIKN
                     IVEKAISINDSSVEN"
     CDS             633815..634417
                     /codon_start=1
                     /locus_tag="lbkm_0604"
                     /product="site-specific recombinase, resolvase family"
                     /protein_id="BBF41924.1"
                     /transl_table=11
                     /translation="MIYGYCRVSTRGQLEGNGIQAQEKEILSKYDNAVIFTEQYTGSK
                     VLERPVLKEVIDKLQQGDLLVVWKLDRLARNTKEGIDIIEKLFAKGVAVHVLNVGLLE
                     DTTMGRFFLQTLLAVAEMERNLIIERTQAGKEIAKTKEGFKEGRPKKYAQGVYKMAVQ
                     MKLDGKTYKEIEQETGLSKATIVRTIQKYRLEQIETESIN"
     CDS             634538..636022
                     /codon_start=1
                     /locus_tag="lbkm_0605"
                     /product="hypothetical protein"
                     /protein_id="BBF41925.1"
                     /transl_table=11
                     /translation="MQKTREYVSDVLSDEIIMKMVSGNNYLIGSEMNSGKNYWVRNVL
                     LPYAFNKNQKTLLLSHRNSIKNQQEEYLKEYQWECIRQFKGGLFDTMTYQSFQNAIKR
                     KEPELLEYDFIICDEAHYFISDNSFNPNTEYSFDFLDKNNKAVKIFMSGTYQCLDYLP
                     FAKPLEVLKEANYYNNNVESLNRYDNAETIGAVILDELEKGKKILAFHGSKNDMVDYN
                     YGNAAMIHSGNKDNSNDFVEIVEECRFSSDVINTTKLMTEGVELKESKVDTVIINNIT
                     DLNAFVQAPARIRDNTIKVYYRVSKRSIMANLRSVEKQLEYYAEFMELGSIEFVKEYG
                     TEVIHRRMKAFYLNTVIDSISGCEYVDLVVSRTGLACLEWQRDCYRAILEQGFENVLR
                     TYFPNVPMYDLEKLKQEEYIRLDVIDNFVDKKIFKDEQLELVKIISNRFGITRSDGKR
                     KLGMKTINSFFEENNINYRLESDKEKSRKSSNYKKMYWMLKQVS"
     CDS             636268..637110
                     /codon_start=1
                     /locus_tag="lbkm_0606"
                     /product="hypothetical protein"
                     /protein_id="BBF41926.1"
                     /transl_table=11
                     /translation="MYIDTRSKLDMTKSVINYLDISSIELNELFDRISRECSEHKYFD
                     GVQADIIIDEYINKHRSEQVIDEILVFHLSYRRPESEDYSGRNLFDLLSNKSELSEFL
                     REKDILFVPDGKKLRLFYKGEYISLDNTYETNVPYLRWRLGYNSRMDFCFNGFAFKDL
                     IYKNDYTKDLIYGPELLNRLATYLNSPQLCQEYVSDRVYYCITYIVSINRICFDDDSS
                     LSDDIKGDFLVREVLRRLYEYSEQEERYISDIDNHVIRTRDNDTIPNSAYLEKEVIPY
                     EMLV"
     CDS             637195..638088
                     /codon_start=1
                     /locus_tag="lbkm_0607"
                     /product="hypothetical protein"
                     /protein_id="BBF41927.1"
                     /transl_table=11
                     /translation="MIKKYYAVYSDAVGKIKHRKYEYTNIDGFMYIFTEGFFNGDIRK
                     AQQIYWKEILLRAHFAAVTSLIRNEKWLTGVIMGISTRNLMVFSSSLRGFLESTADSF
                     FSLESLPTSLALNFKNINLAIKGELNQFFVNDDIESRLIHYQFAKRGKKGVDEKSSIA
                     HTNAEYINDFDINKIGIRDLYAELCEVTHPAANSVKCFTQEKIISERYSYLVTSTEAD
                     YDVISEIITEYSNQIEYLLKGGISLYCICLKILTLFDFEDIHSEYINESIFESILNKN
                     AWNEVLEMIDKGQKYLDEHEC"
     CDS             638267..639763
                     /codon_start=1
                     /locus_tag="lbkm_0608"
                     /product="hypothetical protein"
                     /protein_id="BBF41928.1"
                     /transl_table=11
                     /translation="MDNYNFYYDESEHSRRLTLNTITAENYYDNFVVVIVGCEAKLES
                     TLFKRYEMFEEKYAHRKSKGELKSLTIRQNQLENGFATLNRDNVNLLSDFLSIFDDST
                     LIYFSVASKIEYMVSQLFDNYHSNLFQDAEAMKYSIVKAILTYRPKEILEGIYQNSQE
                     FIELLKSFFKKRIELNQSNMTLKKQENESFNEILLFLDDVSIIKTIDWNYKIAFIGFA
                     KYLDEMNISRNSIIIDREGEHENTVGAARSVGLCNVSDEDSKKSCGVRMADMLVGLIT
                     KLSKALHKALCYDSIEEQTQKKLLSKKWFELNEAQFLLYKKMYTVICKLNNAWYKSYA
                     GIYADDLVVLVSILNYMNHFDSYKELKNSNIDMLGEYFNAYACDNLKDYFVRMRRKLP
                     VEYINDNSEDFFTNQKGAKIFYDINKQPKINFVNGKSIYYVLSVGFKEKVPLVTVMER
                     DEPKCYRLLMELSEWAVNLVAFVNLGMNMFPGKVMFSKVGDMYYADVM"
     CDS             640136..640552
                     /codon_start=1
                     /locus_tag="lbkm_0609"
                     /product="PhnO protein"
                     /protein_id="BBF41929.1"
                     /transl_table=11
                     /translation="MIYRMTDDIKEKEEKQIFEGLLQYNLERIEDKTPKDLGIYLEDE
                     EANIIAGLIGHTHGNWLLVKYLWVSEDLRGQQIGSSILEKAEKAAKERGCKYVFLDTF
                     NFQAPKFYEKHGYEKVFTLSEYPIKGERYYYVKDLL"
     CDS             640579..641088
                     /codon_start=1
                     /locus_tag="lbkm_0610"
                     /product="acetyltransferase, GNAT family"
                     /protein_id="BBF41930.1"
                     /transl_table=11
                     /translation="MLKTKRLKLVGFDVKYADDLYEVWSDFEVIKYTYTPLCANMDEC
                     INLIKHQINRTDKDLIDRFVILLDHKAIGMVGCVCMDKANVVYGLYYQIARVHWGCGY
                     ASEAASAVMHHVLNRYPNAIIQAEAVAENPASAAVLMKLGFKQIEVEANGFKRNNFEL
                     DLIHYKIFS"
     CDS             641174..642466
                     /codon_start=1
                     /locus_tag="lbkm_0611"
                     /product="hypothetical protein"
                     /protein_id="BBF41931.1"
                     /transl_table=11
                     /translation="MKKIHIRVGLALFTCLLFGMGMDKSVLADSKIKLSKQNFPGLYQ
                     SLKDSKADSNKDGYLSKKEIANVRALTVKKNYDPKGLEKLTSLMVLNIKNYNKSYLKV
                     EGAPGIFLDVETTAKSLSVEGQYLEKITIHSKKLTSFDANPSTFVSMINLECPNLKKV
                     NVTELRDLTDLHITDSKLSSIDLTHNIMLNQLFLYNNKLKTLDITQCANLQVLQVYHN
                     KLTELNVTQNPRLEYLEAEHNALTDIQMSNLKNIRDVNLADNPLGSIDLSGIGNVKRL
                     NVAACNLKSIDLSKVKKLQFLNIENNKLSVLDCSKNKQLVNVSIYHNKGLAKVYIKNK
                     KNVAKKVLAKTKVTKIKRVSPTKITIYYKKNPYANGYVVWSADEEKGIADPVGKNATQ
                     ATMWALNKKLKYHVEFSTQFKVNGVYVYGVQYISSKKY"
     CDS             643356..643859
                     /codon_start=1
                     /locus_tag="lbkm_0612"
                     /product="putative CDP-alcohol phosphatidyltransferase"
                     /protein_id="BBF41932.1"
                     /transl_table=11
                     /translation="MLVSTSFSIPFWIFYSCCVLSDCLDGFVARALHQQSSTGAKLDS
                     IADMVFIFSIAMVLILHIKLPMWLLLCALFIALLRFISYEIGFIKYHTYASLHTYANK
                     ATGALLCMAPILYCLVGLSITGIILCVVAFVSSIEEIAIIATSKELNRDCKSLVVNMG
                     KNKHVKK"
     CDS             643900..644721
                     /codon_start=1
                     /locus_tag="lbkm_0613"
                     /product="abortive infection protein"
                     /protein_id="BBF41933.1"
                     /transl_table=11
                     /translation="MEKAHSDQNIRIVIQAIIFTFIGMILISNIINLLSRSGVTIFRN
                     SAISNILLELTILAVQLMILRRYYKRAIIKELGLTIKEMSWSRITLFFAVGTGIVALS
                     FVILMAVSIVHYEGTGFRLIGSKETFQLLFSRLVQMLVVAIAEETCFRGVIANHLDKR
                     SGKTVAILGSTMIFTVFHCMVWQTVTQITDIFVLGLILGILFMRSGSLYDAIIFHFAI
                     DFVTNLFGMEAGEGVIILSLGNGYREADITMYLFGVMTVLGVVACIALSLIRDRK"
     CDS             644846..645454
                     /codon_start=1
                     /locus_tag="lbkm_0614"
                     /product="hypothetical protein"
                     /protein_id="BBF41934.1"
                     /transl_table=11
                     /translation="MKKMISLVILTAMVMSLAACGKNVVDTKTVEKSSQQTETTKKTE
                     ATKKPEEKTAVKSDGYKKFSQVKIGMTESEVNAILGKPKKVDKAYYYYDIVVNGKDME
                     ITVWISKVTGKVTYTNGDFYESDYRDEFVDVKTDLSKAKDLESKKIKTYDECVSAFKT
                     SGHLTSVHEDGRKTYLWVNSNKGYLTVTFNSDGSVNSFSGYC"
     CDS             645543..645665
                     /codon_start=1
                     /locus_tag="lbkm_0615"
                     /product="hypothetical protein"
                     /protein_id="BBF41935.1"
                     /transl_table=11
                     /translation="MLKRMEMMLFATCNDQTESAVAPLVAHYKAPLNNFGWEEG"
     CDS             complement(645843..646385)
                     /codon_start=1
                     /locus_tag="lbkm_0616"
                     /product="hypothetical protein"
                     /protein_id="BBF41936.1"
                     /transl_table=11
                     /translation="MKTMSFLVWIFPIIYMLHDFEEIIMAEVWGSRYHDEINICFPKN
                     QPFGLNYVHTCQTPSFASGVYIFFTIYTIISFFSVFFQNYILWIGAFIPIILHFVIIH
                     ILICLKFKHYVPGLLTSVIFLIPSLLCIIEARQLLPYSSFTWILASISGTILSMFMMK
                     FLHRLLKTISLQLKRYRSTE"
     CDS             646512..647078
                     /codon_start=1
                     /locus_tag="lbkm_0617"
                     /product="transcriptional regulator, TetR family"
                     /protein_id="BBF41937.1"
                     /transl_table=11
                     /translation="MSERNKGNTVSRQSQCWIEDALLQLMQREKYEEITIKEIAANAG
                     LSRRSFYRNFNSKDQVIESYFSKIWKEYVEGIRKQQNLSLPNVAYVFFETMSRHIEFL
                     ELIQQQNLFGILLKATDIMILEPFYEMKGSNLQESKECIDYALAFSTGGFLRIMEKWI
                     QDKPHKKPEAMAEIVAKFLAIASYQEIR"
     CDS             647213..648040
                     /codon_start=1
                     /locus_tag="lbkm_0618"
                     /product="hypothetical protein"
                     /protein_id="BBF41938.1"
                     /transl_table=11
                     /translation="MSVLALKDELVTILASCDKMKGIGQTGSLDARLVPGKSDIDLFV
                     LCSEIPTQEERQACYAMLQSADFTVQMELCNGGQWGYGDVIVTEGIAIMPMYFTITEM
                     QEYLEEVLECKHLEKDGRFYPVGRLASVSTINVLYEENDTWTILKNMVNRKSRSFFQT
                     WFENEMRQALDEEDLGRAELRKEVLFFHQVLENALDHLLQALYAMNECYFPSRKRTKL
                     AIDTFDIKPDQCYKRLMKMILNGASEDTMDKAIEDLHNMTQEIYDLADAKFHKNDFE"
     CDS             648086..648667
                     /codon_start=1
                     /locus_tag="lbkm_0619"
                     /product="hypothetical protein"
                     /protein_id="BBF41939.1"
                     /transl_table=11
                     /translation="MTICYRDYKHSMTATLINAVSRALAILAFLYGCYCIGHTMQVFG
                     VLCLLLIPVFFIGGNKWSDSIGKRADMKFARKESEKYSNLFPVKEVVVEENSQKIPKF
                     VQDKENRALNFPAEITLIRDNSIAGKAASIEYTLNKEQSCKIKCNQNHVFTTTQRINT
                     ITTKHGDPVSFAVEDGERVNLHFLVFDFHGMER"
     CDS             648853..649578
                     /codon_start=1
                     /locus_tag="lbkm_0620"
                     /product="hypothetical protein"
                     /protein_id="BBF41940.1"
                     /transl_table=11
                     /translation="MLSSITLIAFLIGCAGAVVSFAFLALSFLMGSSKKKLAAKLVGG
                     FVGLAILGIVVQAATYEEPEEEKYQYTSSEEANNTEDTETDIEETVDTEEDTEEDTKE
                     VEEETKTEPSPSPEVSKRKESIGTSNKDINEIRLTGPNPVRNDVTGNWKYARLFTTED
                     LNEYAKSYYEEYFEDDDEIHGIVNFSTKTTTKIATLSSNILSVTVHEYVENEEYDAKT
                     MYSGNILKEYFVYLDNGDIEKVR"
     CDS             649799..650140
                     /codon_start=1
                     /locus_tag="lbkm_0621"
                     /product="hypothetical protein"
                     /protein_id="BBF41941.1"
                     /transl_table=11
                     /translation="MACATEKDTTKASTDDEREKMREKMETSIKKWNSLKTADKEKVY
                     KILEEREAADQKLLDQLVTLGVMDQKDVSEIKMHRKEMMDDLKKSGMFPLVGQKRHRG
                     SCDCQKEKREE"
     CDS             650314..650757
                     /codon_start=1
                     /locus_tag="lbkm_0622"
                     /product="flagellar protein"
                     /protein_id="BBF41942.1"
                     /transl_table=11
                     /translation="MDKLSENYIIADKKLFCKKCGAPMEYKYAGIYGCTECEYTFMDD
                     FGKVKNYINLHGPTSGAIISDATGVSLEKINGFLRKGRVEIPEGSEFYIKCERCGTDI
                     RYGRFCPECVRELAGKITVAFTADEIGEKPKHKQGGKMRFFHKYD"
     CDS             complement(650858..651442)
                     /codon_start=1
                     /locus_tag="lbkm_0623"
                     /product="dipicolinate synthase subunit B"
                     /protein_id="BBF41943.1"
                     /transl_table=11
                     /translation="MNLEGTTIGFALTGSFCTFSTVFKEMEVLSQTGAKIIPIFSNSA
                     QTIDSRFGKSKDFVTRAKEITGTDPILTIGQAEPIGPKKLLDLLLIAPCTGNTTAKLA
                     NAITDTPVTMAAKAHMRNERPVVIALSSNDSLAMNMKNIGLLLNCHHIYFVPFGQDNF
                     KSKPASLVAHMDLILPTIENALEGKQIQPIIKDF"
     CDS             complement(651455..652345)
                     /codon_start=1
                     /EC_number="4.2.1.52"
                     /locus_tag="lbkm_0624"
                     /product="dipicolinate synthase subunit A"
                     /protein_id="BBF41944.1"
                     /transl_table=11
                     /translation="MSYLYDFAVIGGDNRQLFLADLLSKKNVKTCYYGLNPCALPSRY
                     IPCFFNQTITASASLEEAIRSSKYIICPTPFSKDQTYVTTATTLGIPVDHLLEYTACD
                     QVIYGGAIPKDVCEKGKDKGITLVDIMKFEHVSMLNAIATAEGAICEAISHSIINLQG
                     SQVLLLGFGKCGQILAKKLSALDAHVTVTVRKEDVVAQAKAYGYDSFLLANLKEKVNQ
                     YEFIFNTIPSLVLTKDVLANVNFETAIIDIASSPGGVDFNYTNDHCYNANLYLGLPGK
                     MSPKSSAKILLDAILNDCKL"
     CDS             652539..656450
                     /codon_start=1
                     /locus_tag="lbkm_0625"
                     /product="protein containing ChW-repeats and
                     cell-adhesion domain"
                     /protein_id="BBF41945.1"
                     /transl_table=11
                     /translation="MKKLRTTKQKLFAALVTISFIALLIGIRSYVNADSTTFKMYYTN
                     SSGGGQTELSDFNVMQEKLHIFVNPQGAIDASKPFYINWKTGNSNIIKVEADATSGGS
                     TNVYGAWLEAVSPGTTAIQAEIHYGTEVYIVGANFTVCVDINNDVSDTTFFKKIYTED
                     TDLDATLVLDKEDPAKSSKQLTLRYGEPNEETVGWNSANEDVVKVDANGKVTAVGAGI
                     TTISAFARKGSSMVDQSSFNDKIKVIVLPKYKAEDTGDFTAYGGNTEFESKKGKDITV
                     YTNAAHANELIWVVKDADGNEIVNTKSGLTSDLVTLDPSDTTGTCIVKAKAGQYKIYS
                     YVKNVLDSTYDTFDSTKLVLTDSTPRKPMIDPATGSMKVYVYFNIDKGGKQIISPSIG
                     DKYDLKINTNVADIDNNFKVTITGTASVGSFTDNVMDFVRKGSIGIDIKQLPTSTLLL
                     DEDAIADGTDIGVNYRVTFNVGSDLVIQAPQVITVGGTTRLYSQSVTTDKSIEYVSKD
                     PSIATVGKYSGIVTGVKVGTTTVIGTYVTDDGVTKIATWEIEVVTSATIKIDPVELEL
                     YSDETEKLFAKYSVSNPSAMNIKWSTTDKDVVDIVESDKTYATIKAGKPGTASIVLTN
                     IENGDQAFCKVKVVTKLESIKLKDNERSVELGDTDEQNRYVMEYTLTPSEDVNPTLEW
                     ESSNTNVATVDENGVVTVVGGGETIITVRDKDTKTFDTCRFIVKQYVKELSLSVTERT
                     ISKDDAFDVIAITTPKDYLSDNEEFTWTELDDNNTVDIKPTDNYATITGKSGGTTTIE
                     VRTKKNLVARLKVTVIENPKSIEVESSDVSIEVGKTTPINVKFTPETATERTLKYMTS
                     DSKIASVSDDGIIKGEKPGSAIITIIPVSGTPTFCRVTVTQPPKGIKLNYSSKTVTKG
                     KTFTLKATISPSDATNHSVTYKSLNSKIATVSKGGVVKGIKGGSTVITATDAAGHVAY
                     CSVTVKEKITSIKLNKTSLRIGVKKTYKLKATVKSNNASNQKLKWSTSNKKIAKVSSS
                     GKVTGVKKGYATITVKATDGTNAKATCKVRIVTAVSSIKLNKYSVKLIEGQTTKLKAT
                     VNPKKATYKGVTWKSSKTSVATVDSKGKVTSHKPGVATITAKAKDDSGKTAKCIVTVI
                     KAVPSTAITLPMTDMTLIVGETDKLEANVQPSNTTDKVKWYSSSSSTVQVNKSTGKIY
                     AKRAGRCTVTGVTNSGKSVTVNINVVGLSRTKLTMEQYDTHTITVIGDAENVVWEVGN
                     IQVARVTNGTVSARKKGVTTVTAIVDGCRLNCKVIVNDIQD"
     CDS             656723..658414
                     /codon_start=1
                     /locus_tag="lbkm_0626"
                     /product="DNA repair protein RecN"
                     /protein_id="BBF41946.1"
                     /transl_table=11
                     /translation="MLLNLHVKNLAIIDEVDVYFTDHLNILTGETGAGKSIIIGSINI
                     ALGGKVNKDIIRKGADYALVELVFQIDDLHTIQKLKELDIEMEDNQLIVSRKIMNGRV
                     VNKINGNIVPTATLRSVASFVIDIHGQHEHQSLLYKTKHLSILDRFAKNEILELKAEI
                     RKYYQQYNNIKRELDSDDMTTDQRLRQMSFLEYEINEIENARLKKGEEEELFAQFKKM
                     SNASEISENINGVYQLTSQSQDSVSENLSRSLRMLAKVDELDESLAGFKDQLIEIESL
                     MNDFNRDLSSYQDEMQFDPSAYQEVDERLNLIHNLKAKYGNSFDEIQEYYAQAKAKLE
                     KYQDYDCYVAKLNKEKERLEEILEEECSKLSEIRQKYALELKNKIVDALLDLNFLDVR
                     FEVNFNRFDHFTENGFDDVEFLIATNIGEDLKPLAKVASGGELSRVMLALKSVLADND
                     AIDTLIFDEIDVGVSGRTAQKVSERLSFIAKDHQVLCITHLPQIAAMADSHYIIEKSA
                     TSDRTSTTIYRLDEEKSVSELARILGGAVITDAVIHNAKEMKELAAKTKLYSFEN"
     CDS             658575..659867
                     /codon_start=1
                     /locus_tag="lbkm_0627"
                     /product="stage IV sporulation protein B"
                     /protein_id="BBF41947.1"
                     /transl_table=11
                     /translation="MKKRVVYRVSLIVLLLIVLCGIVGFGYYKIDSQIPDTIHIVKNK
                     KVKFNFSLPVQADLCEEDVSVIKLNNKKLNQNQVHIDFDSPFTIQSTKTGHYLLQLKL
                     FGIFQYKTINVNVINDIKLIPGGSSIGIYIESKGILVLGTSTITGDDGLNYEPALNIL
                     QSGDYIESMNHVSLKNKEQFISMLQKNNEKPISLGIRRDEERLNVTIKPIKTVDGEYK
                     IGTWIRDNTQGIGTLTYADCNGEFGALGHGITDVDTSQLMEIKDGTIYNSDVLEIVKG
                     QNGAPGEIVGLIKTSEGNDLGEIQTNTNQGIFGRINKQNYDLNRSKALPIGLKQDIKI
                     GKAKILCAVEGTIKEYEIEITDVEMNNKNLSKGLVIKITDKRLLSVTNGIVQGMSGSP
                     IIQQGKIIGAVTHVFIQDSTKGYGTFIENMINTANTND"
     CDS             660364..661164
                     /codon_start=1
                     /locus_tag="lbkm_0628"
                     /product="stage 0 sporulation two-component response
                     regulator"
                     /protein_id="BBF41948.1"
                     /transl_table=11
                     /translation="MAKINVAIVDDNERMVSLLSDIMKEDTDIDVVGTAANGVDALSI
                     IKDKKPDVVLLDLIMPKLDGLGVMEKVRNSNEYKKAPTFIVITAIGQEGVTENAFELG
                     ASYYIMKPFDNNMILTRIKQIKGDLHTKLVEPLKATSFENKAVYMERNLESDVTNIIH
                     EIGVPAHIKGYQYLRDAIMMSVNDSEMLNSITKLLYPSIAKRHKTTPSRVERAIRHAI
                     EVAWSRGKMDTIDDLFGYTVNNGKGKPTNSEFVALIADKIRLEYKMRT"
     CDS             661285..662721
                     /codon_start=1
                     /EC_number="2.4.1.21"
                     /locus_tag="lbkm_0629"
                     /product="glycogen synthase, ADP-glucose transglucosylase"
                     /protein_id="BBF41949.1"
                     /transl_table=11
                     /translation="MKKILFVASECVPFIKTGGLADVVGSLPKYFDKEKYDVRVMIPK
                     YLCIPEEFRNQMTYKTHFYMNLAWRSQYVGVLEMEYEGIKFYFIDNEYYFAGFKPYGN
                     IYEDVEKFAFFSRACLSALPLIDFRPDIIHCHDWQTGLLPVYLHDTFAVGEFYRGIKT
                     IMTIHNLKFQGIWDLKTIQDITGLAKYFFTPDKLEAYGDANYLKGGLVYADYITTVSE
                     TYAEEIKTPFFGEHLDGLIRARSNNLVGIVNGLDYNEYDPSTDPLIYKNYNPITFRKE
                     KPKNKRALQQELGLEVDDKKFMIGIVSRLTDQKGLDLIDCVIEEICSEDTQLVVLGTG
                     EERYENLFRHFAWKYSNRVSANIFYSNERSHKIYAACDAFLMPSLFEPCGLSQLMSLR
                     YGTVPIVRETGGLKDTVLPYNQYESTGTGFSFSNYNAHEMLAAIRYAKYVYYNKKREW
                     NKLIDRGMAMDFSWNHSCKKYEELYDRI"
     repeat_region   662751..662908
                     /rpt_type=dispersed
     CDS             662991..663173
                     /codon_start=1
                     /locus_tag="lbkm_0630"
                     /product="hypothetical protein"
                     /protein_id="BBF41950.1"
                     /transl_table=11
                     /translation="MELTVQELLSIKKIMLETYQEEAKYKSYMEDTKEPYLKEIFLKL
                     SNQAIQNRQLLLQFLN"
     CDS             663183..663434
                     /codon_start=1
                     /locus_tag="lbkm_0631"
                     /product="hypothetical protein"
                     /protein_id="BBF41951.1"
                     /transl_table=11
                     /translation="MEDKIKALDAMKDLCTKCVEMERIQLDTTEEKLKAAMIEIRNTY
                     ESSYEELYSLSVQKKIVLPPMKADKDMISEVKSLIQSEK"
     CDS             663576..665240
                     /codon_start=1
                     /locus_tag="lbkm_0632"
                     /product="sodium-dependent phosphate transporter"
                     /protein_id="BBF41952.1"
                     /transl_table=11
                     /translation="MTIQHVETIFKFFGGLGMFIYGMNVMADGLQKTAGNKMKQLLGF
                     LTNNRFLAVLVGALVTAIIQSSSATTVMVVGFVNAGLVNLGQAVGVIMGANIGTTITS
                     WLVSLNEWQWGQMLKPEFLAPLFIGIGAFTMMFAKKERKKEVGEILVGFGVLFIGLSF
                     MSGAIKPYSSSPVFLNAFRVLGKNPILGIATGAIVTAIIQSSSASVGILQTLALSGMV
                     TWNSAVYITLGQNIGTCITAILSSTGANKTAKRAAAIHLIFNMLGAVIFGVIMFAIFA
                     FNSQFAGARINSVQISIFHTVFNITNTILLFPFANALVKLSGMIIKDSDENVSEDDEV
                     KLALNHLDNRILESPSFAVENVVKEVVHVGEVTLDNAKLAVESMLENDKEKAAKVFET
                     EKTIDKLVKIITEYLVKISNLSITEKQSIVVNHMFYTISNIERVGDHAENMAELAVEK
                     IDHSISFSSDAQKEMKDLCEVAIKSFENAIEARKTENVEYIRNVVKLEDMVDTLEDDL
                     REKHIQRLSQNKCNSESGVIFIDALTNLERISDHSLNIANYVKDEM"
     CDS             665581..666594
                     /codon_start=1
                     /EC_number="1.2.1.12"
                     /locus_tag="lbkm_0633"
                     /product="NAD-dependent glyceraldehyde-3-phosphate
                     dehydrogenase"
                     /protein_id="BBF41953.1"
                     /transl_table=11
                     /translation="MAVKVAINGFGRIGRLAFRQMFGAEGYEVVAINDLTSPKMLAHL
                     LKYDSAQGRYALADKVEAKEDSIVVDGKEIKIYAKANAEELPWGEIGVDVVLECTGFY
                     TSKAKSEAHIKAGAKKVVISAPAGNDLPTIVYSVNENTLKATDTVISAASCTTNCLAP
                     MADTLNKLSKIKKGYMTTIHAYTGDQMTLDGPQRKGDLRRARAAAVNIVPNSTGAAKA
                     IGLVIPELLGVLDGCAQRVPVPTGSLTQLVAMVEGKVTEADVNAAMKAAASESFGYTE
                     EELVSSDIVGIRFGSLFDATQTKCLDMGDGTTMVKVVSWYDNENSYTSQMVRTIKYFA
                     ELA"
     CDS             666759..667952
                     /codon_start=1
                     /EC_number="2.7.2.3"
                     /locus_tag="lbkm_0634"
                     /product="phosphoglycerate kinase"
                     /protein_id="BBF41954.1"
                     /transl_table=11
                     /translation="MLNKKSVDDINVKGKRVLVRCDFNVPLQDGKITDENRLVAALPT
                     IKKLIADGGKVILCSHLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADNEVVGANA
                     KAAVEAMKDGEVVLLENTRYRKEETKNEEAFSKDLASLADVFVNDAFGTAHRAHCSNV
                     GVTKFVDTAVVGYLMQKEIDFLGNAVNKPERPFVAILGGSKVSSKISVINNLLDKVDT
                     LIIGGGMAYTFMKAQGEEVGNSLLEADYLDYAKEMMDKAKAKGVKLLIPVDTVVAKEF
                     SNDAEFKTVARGQIEPGWEGLDIGEETRKLYADAIKDAKTVVWNGPMGVFEMSNFAGG
                     TVAVAKALADIDATTIIGGGDSAAAVNILGFGDKMTHISTGGGASLEFLEGKDLPGVV
                     AANDK"
     CDS             668038..668787
                     /codon_start=1
                     /EC_number="5.3.1.1"
                     /locus_tag="lbkm_0635"
                     /product="triosephosphate isomerase"
                     /protein_id="BBF41955.1"
                     /transl_table=11
                     /translation="MRKKIIAGNWKMNKTPSETVTLLNELKPLVANNDVDVVFCVPAI
                     SLTTAIETVKGTNIKIGAENMHWEESGAYTGEIAPNMLTDIGVEYVIIGHSERREYFA
                     ETNETVNKKVLKAFEHNITPIVCCGETLDQREQGVTIDFIRQQIKVAFLNVTADQAKK
                     AVIAYEPIWAIGTGKVATTEQAQEVCAAIRVCIGEIYDEATAAAIRIQYGGSVSAASA
                     PELFAQADIDGGLVGGASLKADFGKIVNYNK"
     CDS             668917..670464
                     /codon_start=1
                     /EC_number="5.4.2.1"
                     /locus_tag="lbkm_0636"
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="BBF41956.1"
                     /transl_table=11
                     /translation="MSKKPTVLMILDGYGLNDNQKANAVAEAKTPVMDKLMSECPFVK
                     GYASGMAVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKEIQDGDFFKNEALLKAVE
                     NCKKNNSDLHLFGLLSSGGVHSHNTHLYGLLELAKREGLSNVYVHAFLDGRDTAPASG
                     KGFVEELEAKMKEIGVGKVATVMGRYYVMDRDNRWDRVEKAYKAMAEGEGVTANSAIE
                     AVDQSYAKDETDEFVLPTVIMNGDKPVATVKNDDSVIFYNFRPDRAREITRAFCADDF
                     DGFDRKDGRVKTTFVTFTEYDATIPNKTVAFNKVAITNTFGEYLSKSGKTQLRTAETE
                     KYAHVTFFFNGGVEEPYPGEERILVKSPKVATYDLQPEMSANEVCTKLVASIKSDKYD
                     VIIVNFANPDMVGHTGVESAAIKAIEAVDACVGNVVAAIEEVDGQMFICADHGNAEQL
                     VDYNTGDPFTAHTINPVPFILVNYDKDYTLREGGCLADIAPTLLEMMNMEQPKEMTGK
                     SLLVKKN"
     CDS             670530..670769
                     /codon_start=1
                     /locus_tag="lbkm_0637"
                     /product="preprotein translocase subunit SecG"
                     /protein_id="BBF41957.1"
                     /transl_table=11
                     /translation="MDILNVVLTILYVVICVAIVVVVLMQEGKSAGLGVISGAADTYW
                     GKNKGRSAEGFLVKATIALSTAFIVLSVVLSLSIW"
     CDS             670877..673024
                     /codon_start=1
                     /locus_tag="lbkm_0638"
                     /product="3'-5' exoribonuclease RNase R"
                     /protein_id="BBF41958.1"
                     /transl_table=11
                     /translation="MDRILLEHKKELVFSFMNSEEYKPLKFKEMVTILQVPRNEKQDL
                     REVLESLMADGKIQIDVKGKFSIAQGNIKTGRFIGTARGFGFVEIEGEDEDIFVPESK
                     TRGALHNDIVQVSVLEEKTGKRREGEIIAIVERKNDEIVGTFAKSKNFGFVIADNQKF
                     GKDIFIPKEHTKGAVTGHKVVVKLTNYGSKDKKPEGRIIEVLGHINDPGVDIMSIIKG
                     YGLPMEFPKDVMRQVEDIPEEVDPKEFSGRLDLRDLDTVTIDGEDAKDLDDAITISKE
                     GNEYTLGVHIADVSNYVTENSPLDKEALERGTSVYLVDRVIPMLPHKLSNGICSLNAG
                     VDRLALSCIMKIDDKGNVISHKIAETVINVTRRMSYTSVKKIIEDHDEAEMKEYEPLI
                     PMFELMEELAKILREKRRKRGSIDFDFPESKIILDEKGRPLEIKAYERNSATKIIEDF
                     MLIANETVAEDYFWQEIPFLYRSHENPDSEKIQKLGIFINNFGHTIKMTQDEIHPKEL
                     QKLLASIEGTPEEPLISRLTLRSMKQAKYTVADQGHFGLATKYYCHFTSPIRRYPDLQ
                     IHRIIKENLRKGLSEKRFKHYEAILPDVAKQTSTTERRADDAERDVEKLKKVQYMKQF
                     IGHEFEGVISGITTWGMYVELPNTVEGMIKVTDLRDDYYFYDEENYVMIGEHTKKVYK
                     LGQKVVVEVAGVDSLARTIDFELIDAIEEKVGE"
     CDS             673027..673494
                     /codon_start=1
                     /locus_tag="lbkm_0639"
                     /product="tmRNA-binding protein SmpB"
                     /protein_id="BBF41959.1"
                     /transl_table=11
                     /translation="MSKESIKLIANNKKARFDYFIEDTYEAGISLHGTEVKSLRMGRC
                     SVKESFIRVENGEVYVYNMHISPYEKGNIFNKDPLRVKKLLLHKYEINKLTGQMQQKG
                     YTLVPLQVYFKGSLVKVQIGLARGKKLYDKRQDIAKKDQRREAEKNFKVKNLY"
     CDS             complement(673969..675153)
                     /codon_start=1
                     /locus_tag="lbkm_0640"
                     /product="prophage LambdaBa04, site-specific recombinase,
                     phage integrase family"
                     /protein_id="BBF41960.1"
                     /transl_table=11
                     /translation="MAKAKKLPSGQWRALVYDYTDANGKRHYESFTADTKKESEYMAA
                     DFSLNKKRRSKPINLTVRESIDEYIKNSDAVLSPTTIQGYNKIKRNSYQEIMEIPLKN
                     LSQEILQNAINSESKRPSKRNGCNYKTVSPKTVKNSWGLIAAVINRYYPSLDYSIKLP
                     AAENVIKELPPPEVIMNVVKDTEIELPVLLAMWLSFSMSEIRGLKRSSINNGYISIKE
                     VVVDVNCEAVHKKQAKAFTRIRKHEIPDYIQQLINKTNVGSDELISLSGHAIYMRFKR
                     LLEKNGLPHMTFHDLRHVNASVMAMLRIPDKYAMERGGWKTDKVMKKVYTHTFSEERE
                     KVDTIIDNYFETTLGIKKQKIDINKYHAWLTLCGKTDSNDSKSEFIDFMQHEMQHIKK
                     EP"
     CDS             complement(675310..675474)
                     /codon_start=1
                     /locus_tag="lbkm_0641"
                     /product="hypothetical protein"
                     /protein_id="BBF41961.1"
                     /transl_table=11
                     /translation="MIKFDSYETEKYYFNEVRKLGIFHVNISSEHIYSKEDVDNLVIE
                     LARQVKELGL"
     CDS             complement(675929..676342)
                     /codon_start=1
                     /locus_tag="lbkm_0642"
                     /product="phage transcriptional regulator, Cro/CI family"
                     /protein_id="BBF41962.1"
                     /transl_table=11
                     /translation="MYSIFEQLLQKFGITAYKVSKATGVTQASLSKWKSGKSTPSSET
                     LQKIANYFGVTVDYLMTGEEPEEKAPFLTTKDERDISKKLNDTLAQLESTDGLMFDGE
                     ALDEETKELLKISLESAIRTAKITAKKKFTPKKYK"
     CDS             676615..676788
                     /codon_start=1
                     /locus_tag="lbkm_0643"
                     /product="hypothetical protein"
                     /protein_id="BBF41963.1"
                     /transl_table=11
                     /translation="MNNLYSCEEVAKRYGVRINTVWDWIRKKKLTAMKIGKQYKVRED
                     DLKKFEEKSLTTI"
     CDS             676803..677039
                     /codon_start=1
                     /locus_tag="lbkm_0644"
                     /product="hypothetical protein"
                     /protein_id="BBF41964.1"
                     /transl_table=11
                     /translation="MPKLKELESQKKDNIVRAYIAKNMALYNLSDEEVAAKLHCVKRT
                     FQNKKRNPKTFTLFELRALCTALKFTDDEKIMIM"
     CDS             677053..677868
                     /codon_start=1
                     /locus_tag="lbkm_0645"
                     /product="phage antirepressor protein"
                     /protein_id="BBF41965.1"
                     /transl_table=11
                     /translation="MNELQIFKCAEFGTVRTAVINGKPYFCGSDVAKSLGYSNANDAL
                     KRHCKAIVKHDTPISGKLQAINFIPEGDIFRLATHSKLPDADKFESWVFDEVLPSIHR
                     KGGYISRQEELTPEQIMAQAVIVAQNVIAAKEEKILQLNSKNERLMSENTIQKQVIGE
                     LKPKADYTDSILQNKGLVTITQIAKDYGMSGNKMNEKLHELNVQYKQSGQWLLYSQYH
                     DCGYTHSETVNITRSNGLPDIKMNTKWTQKGRLFLYYLLKKNGILPVVEKGDQ"
     CDS             677868..678470
                     /codon_start=1
                     /locus_tag="lbkm_0646"
                     /product="hypothetical protein"
                     /protein_id="BBF41966.1"
                     /transl_table=11
                     /translation="MMSAKRRVKNVFNGPYIKAILKREKVQRPYIILDNLLYNVGMKE
                     YADCAKNRIFDLKCAEELLADDNIILDYLNLSMWLDKKALESCKEIILGYVSEKCYER
                     IVDLLESQIRLVEIENDLISSYQEMKIIKLLVDLFHYAVTRKGKMTVFERKCICICHL
                     LELTSRTLVVKVYWKIDTGIANIKATSILCKLPLYKNNCF"
     CDS             complement(678655..678912)
                     /codon_start=1
                     /locus_tag="lbkm_0647"
                     /product="hypothetical protein"
                     /protein_id="BBF41967.1"
                     /transl_table=11
                     /translation="MQIDAAKITEQGVTFAIVVVKRYVLSSSEKEEIRDSFTQYFGNI
                     PIILMSQDSQGIPTYDGRTDIVDFLVDVPLECIPFSTYTFS"
     CDS             679022..679198
                     /codon_start=1
                     /locus_tag="lbkm_0648"
                     /product="hypothetical protein"
                     /protein_id="BBF41968.1"
                     /transl_table=11
                     /translation="MKEQLDKAIIALAENIEERAKKEVTESGDWNLPELTNSLAKLVY
                     ARESMKISFGHREN"
     CDS             complement(679173..679331)
                     /codon_start=1
                     /locus_tag="lbkm_0649"
                     /product="hypothetical protein"
                     /protein_id="BBF41969.1"
                     /transl_table=11
                     /translation="MNKSNKELTAEIVCTFIQSWNSNPKCNALQLGNIKELIQTTYDA
                     ISSLDDQN"
     CDS             679424..679693
                     /codon_start=1
                     /locus_tag="lbkm_0650"
                     /product="hypothetical protein"
                     /protein_id="BBF41970.1"
                     /transl_table=11
                     /translation="MRQVLKILRAIVIVVSFTIAYLIIGGVESGTIQVEKETYFLIIL
                     GLVTACSLLVMQLIDMLIRYKRAQKRMTWDDYQSAKSFDQSDYDR"
     CDS             679765..680031
                     /codon_start=1
                     /locus_tag="lbkm_0651"
                     /product="hypothetical protein"
                     /protein_id="BBF41971.1"
                     /transl_table=11
                     /translation="MQSEGIVRKLDELGRITIPKEIRDSLNLHEKDPVDIIPTDDGIL
                     LKISKDKEQVLKELVLEAANTDKEALMSLLKDIFNDLGERFEVG"
     CDS             680031..680258
                     /codon_start=1
                     /locus_tag="lbkm_0652"
                     /product="hypothetical protein"
                     /protein_id="BBF41972.1"
                     /transl_table=11
                     /translation="MDVTECVGRVGNDRLKELAKELFQEAERAGLLVENDDPGYSMFM
                     FRYNNNITLDFLNGGDKNYHVKYKLDSPSNT"
     CDS             680379..680606
                     /codon_start=1
                     /locus_tag="lbkm_0653"
                     /product="hypothetical protein"
                     /protein_id="BBF41973.1"
                     /transl_table=11
                     /translation="MNEKYYSDGVTKYSDPFHKNLCMNCGHEYWTAMISDGCTRCGSK
                     NIFHTFDDEELEKAKLQYLTYKKGSKRTEVE"
     CDS             680606..681331
                     /codon_start=1
                     /locus_tag="lbkm_0654"
                     /product="hypothetical protein"
                     /protein_id="BBF41974.1"
                     /transl_table=11
                     /translation="MDKKRSYYAIIPANIRYDNRLNANAKLLYGEITALCNEKGYCWA
                     TNDYFAKLYDVSKQSISSWLSRLENTGYIKRNIVYRDGTKEILNRYISLFDDPIQENL
                     KDNNTLINNTSNNKNNVHSSDQNTPKVSKADINDLFERVWKLYPNKKGKGQVSDSKKS
                     NLYKIGYEELERAISRYKKGLAKETWRRPQNGSTFFNSGYVDYLDANYSEEDSNDVRG
                     KDENVHGRELSENDREINKLLGY"
     CDS             681612..682043
                     /codon_start=1
                     /locus_tag="lbkm_0655"
                     /product="helicase loader DnaI"
                     /protein_id="BBF41975.1"
                     /transl_table=11
                     /translation="MAATISNSLMDKGISVKFATSSSIIEEIKKSWSKTSIYTESNLI
                     DALIQTDVLVIDDFGTESLREWINDKFYYIINERYINERTTIYTSNYKLDELQYDERI
                     INRIRENCYQIPFPEESIREQIEKENTKEMASMIRKNKDVI"
     CDS             682074..682340
                     /codon_start=1
                     /locus_tag="lbkm_0656"
                     /product="hypothetical protein"
                     /protein_id="BBF41976.1"
                     /transl_table=11
                     /translation="MNKLEKLNMLEVVENSSTNGEVDYVLVKNNVYNRAVLVECGATD
                     GDLDKMATTFTNGSPDDGYLDISLFAWEHTEANSWNVNGGFAVR"
     CDS             682360..683049
                     /codon_start=1
                     /locus_tag="lbkm_0657"
                     /product="hypothetical protein"
                     /protein_id="BBF41977.1"
                     /transl_table=11
                     /translation="MNRLKVNIEEIVKEMFPKALIKDLQEDERICPTCKGLGIVIVNN
                     EYGIKGDKSQEARKSRFPYRHQSFTFCPTCYNGVQSVCKYCGEPIPIGWINKCSCSGY
                     KNEQAEKERKKWNETLSKAVQVKEEDVENMLYCVETDDFYMDVDDFLEQWECNHYEDE
                     EKPIRLWVTSKEEMSITASDVIENACDGLHDDAADNCDYKSLQKILDDWCKEQTGTTT
                     YYPCYKEYVLI"
     CDS             683254..683385
                     /codon_start=1
                     /locus_tag="lbkm_0658"
                     /product="hypothetical protein"
                     /protein_id="BBF41978.1"
                     /transl_table=11
                     /translation="MNQDTVNSKSDDSESLKSEITDDRKPISKVNQLDGQTDIFDFI"
     CDS             683397..684188
                     /codon_start=1
                     /EC_number="2.1.1.72"
                     /locus_tag="lbkm_0659"
                     /product="adenine-specific methyltransferase"
                     /protein_id="BBF41979.1"
                     /transl_table=11
                     /translation="MKTELFNDNFQNFKRYGIPKAQLVIADIPYNIGNNFYGSNPMWY
                     VGGDNRNGESKLAKKAAFNTDFNFNIAEYFHFCNRLLKKEPEKSNGRGKSSDAPCMIV
                     FCAFEQIQTVIKYAEEYGFKHNIPLVFCKNYSPQVLKANMRICGATEYALVLYRNKLP
                     KFRNNGHMVFNWFEWKRDSQKEYPKIHPAQKPVSVLKKLIETFTDEGDVVIDPCAGSG
                     TTLRAAMELNRNSYGFEISKEFFKRAKEEMIKYKDDGQMDISQFI"
     CDS             684204..684767
                     /codon_start=1
                     /locus_tag="lbkm_0660"
                     /product="hypothetical protein"
                     /protein_id="BBF41980.1"
                     /transl_table=11
                     /translation="MKISKNYTCDNQMDIFSFIPKSKGMIRDKCLYTDGPCNIKNTHD
                     VANTLDDVDCKYGCCRTCKQKTLCCAACNNRYAEEKKKSFCCDKDINYIVSELNKKSN
                     KLGITPSKTEWSIWSHVPNLGYRMEYWISREVDDSFIDIALELVDWAKEHGIELSVLN
                     AGMGDIFISTLFTDARRNRKSDKNWKD"
     CDS             684810..684983
                     /codon_start=1
                     /locus_tag="lbkm_0661"
                     /product="hypothetical protein"
                     /protein_id="BBF41981.1"
                     /transl_table=11
                     /translation="MNFTFKVKYENTFEIEAVSEDEARDKLDGELFGVDSMDMDIELA
                     GVSGEDEEEDDQQ"
     CDS             684980..685135
                     /codon_start=1
                     /locus_tag="lbkm_0662"
                     /product="hypothetical protein"
                     /protein_id="BBF41982.1"
                     /transl_table=11
                     /translation="MSCKSAKYDPDEGGYYCEVSGDQCMYLIPSSKACAEEFGEGPDA
                     ENDEQDQ"
     CDS             685297..686103
                     /codon_start=1
                     /locus_tag="lbkm_0663"
                     /product="hypothetical protein"
                     /protein_id="BBF41983.1"
                     /transl_table=11
                     /translation="MNYYWVRIYDYKYDDELKAYEDPSCFEKYKGVMLDEYYLKGEEL
                     TRKEVKKAIKKRSSIEKFAKPRKNKDGIYALVLDSNKFFYDRFYKEIDTVCPHCGKRL
                     FGKAADFPKIYANSYDESIKPDEEIYFCSYDGRREFTSKLRGEEGEWQNKDGYENNGG
                     VYGYIYHIYNRSTNMHYIGQTLYMPFFRWQEHVKSRLKGDICDLVFETVTEVRVKSKE
                     YLNNIEAWWINKYISDYGRDRVINITVPKVTINDLIKKYAEIVEGQIIFN"
     CDS             686121..686315
                     /codon_start=1
                     /locus_tag="lbkm_0664"
                     /product="hypothetical protein"
                     /protein_id="BBF41984.1"
                     /transl_table=11
                     /translation="MSSDAVETLGTRNWCSYCEDSVDRNGVLYCNGKKGVFKGLPVKG
                     VICTPCMREKDGVSNEKSND"
     CDS             686296..686790
                     /codon_start=1
                     /locus_tag="lbkm_0665"
                     /product="hypothetical protein"
                     /protein_id="BBF41985.1"
                     /transl_table=11
                     /translation="MKNLMIDGEDGHYVPKRMCTINRFNEIDDMDGCGEACELADSDC
                     NKCPIAEAFDKLAKMEQSESYWEREAKRMAAELGEIKIKQEQNGWIKFTTEYDEERGV
                     QVINCTLPEDGQEVLVTNGRDVWEDTFCNDCDDGCYFDNGYDIISEVIAWMPKPEPYK
                     EEQE"
     CDS             686978..687277
                     /codon_start=1
                     /locus_tag="lbkm_0666"
                     /product="hypothetical protein"
                     /protein_id="BBF41986.1"
                     /transl_table=11
                     /translation="MTKEAVEKAIKRVNRGIVIATENVEKGVQVKESKDGIEDLKVCK
                     EALEKQLPKKPLRKPNENHDYEILTCPVCGSYISGISTGNYCRCGQKLDWSETDE"
     CDS             687270..687521
                     /codon_start=1
                     /locus_tag="lbkm_0667"
                     /product="hypothetical protein"
                     /protein_id="BBF41987.1"
                     /transl_table=11
                     /translation="MNKNRYKINRENDKAIKKYDHNQMETFATSLYISGFEDGKKSVP
                     GIDLKEVEKVIRSIKGIGQAKAGAIMENINKAFGTKGEK"
     CDS             687523..687948
                     /codon_start=1
                     /locus_tag="lbkm_0668"
                     /product="hypothetical protein"
                     /protein_id="BBF41988.1"
                     /transl_table=11
                     /translation="MDTKVENEEKKEYLNRYRIASRKIKSLQEQRESLMIEKRNAKAI
                     QYSDMPHGNKQSDLSDYIAALDSLEERIGESIRERMKARVDIEKGIIYVRDGIESDIL
                     RKRYIELKSWECICNEIGYSWKETHRKHGKALQDFKIMT"
     CDS             688041..688223
                     /codon_start=1
                     /locus_tag="lbkm_0669"
                     /product="hypothetical protein"
                     /protein_id="BBF41989.1"
                     /transl_table=11
                     /translation="MVYLCFGLLPVFFIAEWIKRIDHKALLPMIDHRLSYRAKLSIHP
                     VPFKVLHILSMDHVAP"
     tRNA            688313..688392
                     /locus_tag="lbkm_0670"
                     /product="tRNA-Leu"
     CDS             689168..689434
                     /codon_start=1
                     /locus_tag="lbkm_0671"
                     /product="hypothetical protein"
                     /protein_id="BBF41990.1"
                     /transl_table=11
                     /translation="MKGKYYSRVNVSQKQKKIKKRLEELGNTDVEVWWEKLEHAVEMG
                     GMGGGFFFCSNEYSLEPIGYSFDEAMEYIELFDSKNGDIEKINY"
     CDS             689467..689703
                     /codon_start=1
                     /locus_tag="lbkm_0672"
                     /product="hypothetical protein"
                     /protein_id="BBF41991.1"
                     /transl_table=11
                     /translation="MKFNPQYGIIGLCKKQIKRLSKLDQYYSFDDKKQKDINEIARAT
                     PFSVIEVTQVYISCEYDKEETLRQLTFMLTRGRA"
     tRNA            689726..689798
                     /locus_tag="lbkm_0673"
                     /product="tRNA-Ile"
     CDS             690123..690707
                     /codon_start=1
                     /locus_tag="lbkm_0674"
                     /product="hypothetical protein"
                     /protein_id="BBF41992.1"
                     /transl_table=11
                     /translation="MMANTEKVDDVSQITVSAKVLSKMIGVTERRIRQLAEEGILVKA
                     SQGRYKLNDSIHGYILTLKIANESKSFSNDLDDELDLDKEKALHERVKRHMAELKYAL
                     MKGDVHKSEDVEDVMNNMLSNFKSRCLSLPSKLTPLLLDRSDKAYVLKLLTDNIMQLL
                     NELSEYNANDFFGDEYIDCDEDEEDEVIFNIEEN"
     CDS             690694..692574
                     /codon_start=1
                     /locus_tag="lbkm_0675"
                     /product="phage terminase, large subunit"
                     /protein_id="BBF41993.1"
                     /transl_table=11
                     /translation="MKKIEKSQYKTVLLFHNIAKNLKPRPVLLVSDWADTYRQLSPEA
                     SAEPGRWNTSRAEFQREIMNAVNDPDIQDVVIMSSAQVGKTEIVLNICGYYMDYDPTS
                     ILVLQPTIEMGETFSKDRLAPMIRDTPVLTGKIKEPRAKGSDNTILHKKFPGGHITIA
                     GANSPASLASRPIRVVLCDEVDRYPDSAGTEGDPVKLAEKRTTTYWNRKKIKVSTPTI
                     AGISKIEKEFNSGTKEEWCVKCPCCGKFQPYQWNRIQFKTVSMECLYCKEDIGERDWK
                     ESEHKWIASNEDVKGKRSFHLNELCSPWKSWKEIINDFREANEDYKKTGSIEALKVFR
                     NTSLGEVWEERGDGADEQDLLKRREQYEADIPDGALVLTAGVDVQDDRLEIEICGWAR
                     EYESWGIFKKEIRSNPALESTWDKLEEEIETEYYFNNGHGLLIAATCIDTGGHHTNMV
                     YKFVKRMHKMGKNVFGIKGYSNVTGIPLIYKKTKVDIKNSHGTVVDHTDIYILGVDSG
                     KEDIISRLNIKEPGSGYCHFPKNMDRGYNQMYMKGLTSEEKVTKRDKKNRLKIMWVKK
                     PGIRNEPLDLRNYAYAAVELIRPNWNVLEEKIENGINYMKKDAAKRKKRKHGVVNKGV
                     QI"
     CDS             692584..692820
                     /codon_start=1
                     /locus_tag="lbkm_0676"
                     /product="hypothetical protein"
                     /protein_id="BBF41994.1"
                     /transl_table=11
                     /translation="MANNKQRLESYKRRLDLYYEAEEAALNNQEYTIGSRTLKRADLA
                     EIRKAIQDLESKVTALEERGTTKRKVARIIPLDN"
     CDS             692836..694431
                     /codon_start=1
                     /locus_tag="lbkm_0677"
                     /product="phage portal protein"
                     /protein_id="BBF41995.1"
                     /transl_table=11
                     /translation="MRNVIDSIYEYVNPNKALSREVARLRLGMAKNISNSGYDESGAS
                     KRKHSMRGWKADSRSPQKDIDINLNTLRKRSRSLYMSAPLATSAIKTNRTNVVGSGLI
                     LKPVIDYNYLGMSHEEADELKKSIIREWKIWAESKFCDNNRQNDFYELQQIALISWLM
                     NGDGLGLLRYSSEKRSYMPYQLRIKLIENDKLTSPKQATEDYVDMNLKAENGNRIING
                     IEIDEHGQVIAYWISNNYLSDYDSMTKNDWTRIEAYGEKTGNPNVIHVFDAERCEQYR
                     GVPFLAPVIETIKQLTRYTDAEIMAAVINGMFTVFVKTVDGGDNIDFEGVSDEEEETD
                     NSQEDDNNLQLGNGLINYLKPGESIEVADSKRPNSNFDGFVSSLTKYIGAALEIPPEL
                     LLKSFTASYSASRGALLEAWKGFRMRRVWFANDFCKPIYEVWFSEAVSKGRIKAPGFF
                     DDPLVKKAYCGSEWVGPAPGQLDPVKEVNAAVTRMNNGLSTHETEAAEINGTNFDNNV
                     EQLKIENQKLSDTKVKEDSNEEN"
     CDS             694418..695563
                     /codon_start=1
                     /locus_tag="lbkm_0678"
                     /product="prophage Clp protease-like protein"
                     /protein_id="BBF41996.1"
                     /transl_table=11
                     /translation="MKKINIKGTIVSSDEKWIYNWLGMPAVCPKDVENVLSNANGEDV
                     VTEINSGGGNLFAGIEIFTMLADYKGNVHQKVLSLAGSAASVLLMAGTSEISPAGMVM
                     AHNCSGETQGDYRAMDSSSELLQKANQSIRNAYKHKTNLDDEELTDIMNKETWMTAEE
                     AVEAGFVDSIMPLGKEEKSTTNIYNSISPIIPEEIINKLKQKIIDGKLPELGNNGISV
                     PIITNSASTEDTSGTESTISNKPKENKGGEPMVLEDVLKDHPEIKNEIDALKDTSKQE
                     GKEEGAKAERERLQAIDNIANNISNELVNKAKYEEPISAEALALQAIQNNVAKASNYM
                     KDAMNDSSKSGVDDVPANPTDADPQDEDDALIEAATKTANAKRKKVK"
     CDS             695565..695912
                     /codon_start=1
                     /locus_tag="lbkm_0679"
                     /product="hypothetical protein"
                     /protein_id="BBF41997.1"
                     /transl_table=11
                     /translation="MSKLLNNEAYKVVDDNLVFDSKHPIDVKNVTLKADQGALARGTV
                     LSFDETTKTYEKLSSTATNANCIVADAVAEGETVVTVYTSGSFNSNAINTNDVTLDEV
                     TKNKLRELGIYLK"
     CDS             695931..697004
                     /codon_start=1
                     /locus_tag="lbkm_0680"
                     /product="putative capsid protein of prophage"
                     /protein_id="BBF41998.1"
                     /transl_table=11
                     /translation="MSLYETPTLIKTAKKIFPVSLWFRNRYFPTTDQDMFPGKQVLIE
                     YKEGSRKMAPFVIPRQGGITMERSAYTATAYEPPYIAPQRPLTIDTLNQKGFGEELYE
                     NKTPEQRQAEVLGEDLADLSEMIDRREEWMCSELLQSGEVIMKHYAEEYGKGTPVEKV
                     LRFYDKAKGFQNKYTPDTTWDMETATIYDDLDAMVSMFTKHGCPVADINMSAGVYSRF
                     IGNEKIQKLLDNRSMHIGDITPIETPEGVAHVGYIIVRGKKLDIFVYDENYEDEAGTI
                     VSFVKEGNIILTAPGMGRTLYGAISQIEESDHLFHTYRGMKIPKYLCDSKHETREIRV
                     ASAPVPVPNDRNGWVVAHVLGDD"
     CDS             697007..697366
                     /codon_start=1
                     /locus_tag="lbkm_0681"
                     /product="hypothetical protein"
                     /protein_id="BBF41999.1"
                     /transl_table=11
                     /translation="MIEIVSGFFGPKLLGPGKILNLSEKEEERLVKTGTAVYVQKETH
                     NDDKANDQHENKQTDQEEESDDFYLSEDEIKKMKKEELVSYGTKIGVQDLDSSMRKDE
                     LEAAIINFIDENSEDEE"
     CDS             697366..697692
                     /codon_start=1
                     /locus_tag="lbkm_0682"
                     /product="hypothetical protein"
                     /protein_id="BBF42000.1"
                     /transl_table=11
                     /translation="MTFKESLQKDIKNTFMNLDEFGEKHIVNGKEMTISIDNNELIKR
                     GLKNNVYDGSDLHVKQVMFFVDKESYGALPLIGRIVTLDAKRYTVTDAINEGGIYSIT
                     LEAVSS"
     CDS             697689..698285
                     /codon_start=1
                     /locus_tag="lbkm_0683"
                     /product="hypothetical protein"
                     /protein_id="BBF42001.1"
                     /transl_table=11
                     /translation="MIVVKIDQSELSKIEKDLGNFSKKSKYVLKKAINQTAKETRKDL
                     LNAARTKYAVKVGRFNSAAKIKNASIGSLIATIYATGSPLEIKDFRVSPGSYGKKVKV
                     AKGKVYRVGSLVPLQKGTLKAFVAKFKSGHVSVVERVPGKKMKSNQTKDALKKLFSPS
                     VPTMLGNEKMLVGVVEPTIQEQLDKNISLIILEVLGGN"
     CDS             698287..698754
                     /codon_start=1
                     /locus_tag="lbkm_0684"
                     /product="hypothetical protein"
                     /protein_id="BBF42002.1"
                     /transl_table=11
                     /translation="MTPLQLQDDIAKEIQNLTKDMVFKDPKGKDATLKGFKQELPKIL
                     DTSGEEEDEYYPFPFAVVKLLQGDTEDYEQVNTAIVIGIYDDSTEHQGHMAVMNVIQK
                     FKERFMKNPLLTSFTSNNDFKWQLNDEDKFPYYFGAIYVSWTLPTIRREDKFI"
     CDS             698751..699047
                     /codon_start=1
                     /locus_tag="lbkm_0685"
                     /product="hypothetical protein"
                     /protein_id="BBF42003.1"
                     /transl_table=11
                     /translation="MTTKSETKTVVKQKSVVKEVETKVYVGPTIPGVVTEGTIYNNGI
                     PEVLDAVAKEEPAINSLIVKISYLAKARNELKNNGPMSIFYAKALEYKEKKGDK"
     CDS             699050..700504
                     /codon_start=1
                     /locus_tag="lbkm_0686"
                     /product="phage tail sheath monomer"
                     /protein_id="BBF42004.1"
                     /transl_table=11
                     /translation="MAYNHGIRVKENATSLSKPVTGMAALQVVFGTAPVNLAADPYGV
                     TNVLVKVETFEDAYKKLGYSDDFSKYTLCQSMDACFRVLNVAPVIFCNVLDPKKHVKD
                     NEESEVTVASKQAVIKVDGILLDTIVVKSGESTLQANTDYVTSFDDNGYAVITLVTGG
                     AGDAATTLKVTSKSIDPSKVTESDIIGGYDTVTGKETGCELVRHVYPMFNMTPGLLLA
                     PGWTQNQNVAAALELKTDNINGYFKASCIVDLDTHTATKYTDCEAQKKSKALTSPNTI
                     VVWPMAKVGDKKYYYSALYAALIAYVDASNDDVPNLSPSNKLIGVTAAVLEDGTEVTL
                     DTQQANVLNSVGIVTLLNDAGWRTWGNNTACYPENTDPKDRWICCRRFFSWWGNSFIL
                     TYKEKVDDPANFRLIESVVDAENIRGNSYVQQGKMAGAKIEYSEQDNPIEDVLNGKIQ
                     FYQHIAPYTPAEDIINVLEFDPTMIKNALSGGAE"
     CDS             700504..701025
                     /codon_start=1
                     /locus_tag="lbkm_0687"
                     /product="phage major tail tube protein"
                     /protein_id="BBF42005.1"
                     /transl_table=11
                     /translation="MNGQVPELINDFNVYKGGTQLIGLTGEVKLPDLKQISETISGGG
                     ILGEYESSIIGAYQSSEIEIPFRVLNEDIFSLMNPTDTLDLTMRASQQYMVQATGQQD
                     YKGMRIVVRGKMKGFTPGTVKRGTNMNASVTFEQFYLLIEVDGKKLFELDKLNNVFIV
                     NEVDVLAKIKKLC"
     CDS             701046..701390
                     /codon_start=1
                     /locus_tag="lbkm_0688"
                     /product="hypothetical protein"
                     /protein_id="BBF42006.1"
                     /transl_table=11
                     /translation="MDPLKDKTEETVTEKEVENELIISLTKPYQFEGKAYKEIDLTGL
                     KTLTAADMIRCNHLCDETGNVSINQEMTLEYACNMASIVSDKPINFFMGLPPIPAMQV
                     KRCVMGFFYGMD"
     CDS             701411..701530
                     /codon_start=1
                     /locus_tag="lbkm_0689"
                     /product="hypothetical protein"
                     /protein_id="BBF42007.1"
                     /transl_table=11
                     /translation="MRKIVTRLTLQLKTGMDYFMSVPVFELREIVEEVVEIGK"
     CDS             701520..705029
                     /codon_start=1
                     /locus_tag="lbkm_0690"
                     /product="phage tail length tape-measure protein"
                     /protein_id="BBF42008.1"
                     /transl_table=11
                     /translation="MASNGKEYKMAIKIAGEIEKSFMTSMNISKKELRSIAKTAAKSN
                     MSVREQFNAGFDQVGKGYSKIASVGKKAFIATAKAAKVASVAAIGVGTAATLVGSKFE
                     AQMSTVKSISQSSASDMQKLSDKAKELGIKTQFSATDAGKAMEYQAMAGWKVNDMLHG
                     TEGIMNLAASSGEDLATTSDIVTDALTAFGLKAKDSNHFADILAKTASNANTNVGLMG
                     ETFKYVAPVAGALKYKVQDTALGIGLMANSGIKASIAGTAMRSWITRMAKPTDESAAA
                     MKKLGISLTDSKGNMKSFLQVMNDTRAGFSNVKSEGEKAKLAAQLAGKTGMSGLLAVV
                     NSSQSDYEKLYKSIVNCSGAAKDMANTRLDNLKGDVTLLKSSMEGMGIQIYEGVKKPM
                     RGTTQFIRKNVDSLTSSLKTNNTIGKWTKDIENSLPTAKRYFDDFTGSLLNFSKPLLS
                     TGKWLLKNPKVIVSTVAGIGSSLLAYKTASGVRSLATSFIKLKGVLTNPFAAAITGVG
                     IAIGGAAGIASYIKMANAELKRQNLADHFGNISLSLSDLQEVANHIVQSQSLTNLSKA
                     VSNMSKISEFRNKINDSVEDLSKLNWKVSIGMKLSDSDKTAYKNDITSFIQNTNSMLQ
                     QQQYTLNLSFNSLLDNSPESKTMEDSFSTFFSGMYGKAQKAAKKLQDKVNEAFEDGLL
                     DIDEVKEISKLQQQLSNLTNQLGKYKIDAKFDSLKQETLGKKLTANSFMNLQNETQKI
                     VKDQTANYQKSREYALQNIMYRRDNDKSYSKKQYDADYKKLQKGYLDNVSELQQKAVE
                     FQTDTIYSAYGGEIKKANKSFNTSVNASLKEKKGFGQDVNWRTKSVLMYTDMMDQVQN
                     TGLSGSTKDAVGQLYTKIGPMLVNLENIKKQYSKMGVSAPSKLNKTLNKANTLGALTG
                     EQGSIWKTIGSKMSKDSYYTKMTADLKKSGSYIPEELSKSMTENKDQFTSAATQLHDQ
                     LRTAIRNKFSTGIDVNIPINLKQTVSTNTTNGGKTDSKGKTSAANQKNFPFANPKKEL
                     HKLGVPGFAKGGIIKNPTLATFAEKSPEAAIPLNGSKRSVSLWEKTGHMLGVYKAKKN
                     STFSNYASDKSSFSNLYSSMKGQDSAETSEQTPSIQFSPVLNFYGDSPSKKDIVDAGR
                     ISQREFEKMMDQYMRNNRRLKFS"
     CDS             705045..705263
                     /codon_start=1
                     /locus_tag="lbkm_0691"
                     /product="hypothetical protein"
                     /protein_id="BBF42009.1"
                     /transl_table=11
                     /translation="MDEYITVQGDTWDIIAREQLGDEKYIGQLIDCNLKYIDMVIFSA
                     GVSLAIPEIDSEEEEDTDLPPWRVDDDE"
     CDS             705250..706254
                     /codon_start=1
                     /locus_tag="lbkm_0692"
                     /product="putative bacteriophage regulatory protein"
                     /protein_id="BBF42010.1"
                     /transl_table=11
                     /translation="MTMSDGRHVSVDAKYKGKNIKTKLAAYLESFVFNDVASGESDSI
                     SITLCDKNKKWMGNWFPEKGDDIVPSIILHNWSASGTKKTIKCGKFTIDDLSYSGPPT
                     VCNIGAVSVPSKQGFQNTKHHKVWKNHSIKQIAADIAKKYGLKLSFEDNRNIVIKTIE
                     QSGESDSSFFSSLCSKYGLALKVFNNKICVFNEEIYEKKKPIVTIHPSDFIGQWNYNT
                     TIAGTYTGAKISYTSGKESKDIEVKIGSGSRILEVNEKAESRKDAEYIARGMMKSENR
                     KTTTMSFTIMANAKIYATCCIYVKGLRKLSGKYYVEKVSQNISASEHTMSLTLHKVVS
                     "
     CDS             706264..706641
                     /codon_start=1
                     /locus_tag="lbkm_0693"
                     /product="hypothetical protein"
                     /protein_id="BBF42011.1"
                     /transl_table=11
                     /translation="MDNVRIGYVSSIDYKSGTVQILYKDRDNSVTDDIPVLTMNGEYS
                     MPAINDMVLVLHLSNGGEMGVVMGTFWNDSNKPSESGKEIYRKDFSKDGAAFMKYDKD
                     KKTLYLHADKIILENDSKKVNAL"
     CDS             706655..707194
                     /codon_start=1
                     /locus_tag="lbkm_0694"
                     /product="hypothetical protein"
                     /protein_id="BBF42012.1"
                     /transl_table=11
                     /translation="MVHSVNKLSKKKPKIKGIAVKHELAGVMAIDLDIVKHKKKKKKK
                     SSSKSRIGNWGKDIVFETSDKKILTFNDFNQKVSARWSNHERIGKKPLSEFMGPDLRS
                     ITFNIVLSATLGVKPRKTMDKIEKCVQKGKVNSLVIGGKKIGKNKWKITSVNEKWDFV
                     YARGLLAKATLSLTMEEYV"
     CDS             707204..707518
                     /codon_start=1
                     /locus_tag="lbkm_0695"
                     /product="hypothetical protein"
                     /protein_id="BBF42013.1"
                     /transl_table=11
                     /translation="MISFNEVTLEYDFDSEEIEDILNCLYTLYTTKEGTVPLMRDFGL
                     STECVDMPIDVAQNLYSLDVIEKTEKFEPRVQVEDVDFTYGGDGQLIPHITITKGDEY
                     DV"
     CDS             707511..708659
                     /codon_start=1
                     /locus_tag="lbkm_0696"
                     /product="phage-related baseplate assembly protein"
                     /protein_id="BBF42014.1"
                     /transl_table=11
                     /translation="MSDFTLDNYPEISFIDNKTIDDVKNELVADYSEEYERTTGESVN
                     LSQADPTRILLYSIAMLFYQGLKYVDNAGKQNLLKYSFGDNLDNLGLFKNVERNQPKA
                     AQTTIRFSLQDVREISTIIPQGTRAFVSDDILFETTKEAEIPVGSLYVDVICQCTQTG
                     LVGNGFLPGEIKQLSDTVPYIASISNLTKTEGGCDLQDDDDYKECINLGPASFSTAGS
                     EPAYKYWVKKFNSSISDVKITSPSACVVDIRIILDGGELPTDTLITELITYLSDDSKR
                     PLTDKVQVAAPDTVDYSLSLTYYIAADQKSSEAIIKSNVEAAISQYVTWQSSRIGRDI
                     NPDMLNHLIIAAGAKRVAITTPIYTVVSEKSLPKLTDKSIVYGGLEDD"
     CDS             708652..709209
                     /codon_start=1
                     /locus_tag="lbkm_0697"
                     /product="probable phage tail protein"
                     /protein_id="BBF42015.1"
                     /transl_table=11
                     /translation="MIKLKDSYITDILPDSIKSIPEVQAISYAVHNQLVKLLEYAETT
                     KVYACIDKMPDSILDALAIDLSTLYYDDSLDITIKRKLIKNTIKWYYLSGTTRAVKEL
                     ITNVFGSGEVIEWFNSSGMQPGEFDIVTDTSLTDQNIEMIKKMIMNIKNVRSHLRNVS
                     ILRDSESVGYINSVTVSHKGISISE"
     CDS             709222..710607
                     /codon_start=1
                     /locus_tag="lbkm_0698"
                     /product="hypothetical protein"
                     /protein_id="BBF42016.1"
                     /transl_table=11
                     /translation="MYEKTIVTDKGKSLINKLLNTTNKIIFSKLETGDGTYDTGTEFE
                     KLSNLKSKKQEFLISSAVIEADKVRLRTVITNKDLSEGYTIKEIGLYATDPDDGDILF
                     SITIAKDDEKDVLPAYDGNYEVTVTLDSYVLIDTLKKCIPTIVTGAYASVEDLTEHID
                     NNDVHITKVEREKWNKIANKNLLVNGDFQVWQRGNLFKNASFGSYCADRWTTGASIEN
                     CNVLEAEANVGGAKVEWPADTTGAINLCYRMTEREKNKIIGKNVTITLRVNYLTISKT
                     ITIPDGSFYIYCGVTMNSSFSMETSIILKKDDNISSFDSRAVYIDISNSGSHGALTYA
                     TVKFVKLEYGDHYSGFEPRDYHDELRDCSLYYQKHYFRFRELVSTNGKLWTRPFTIPL
                     LGNKTHEIKVVEFIDEDSGGTLTGSLNIYLDQESTTNSVALLFMNASSSAYLTEAHQY
                     RAVFAIDASIY"
     CDS             710686..711132
                     /codon_start=1
                     /locus_tag="lbkm_0699"
                     /product="phage holin"
                     /protein_id="BBF42017.1"
                     /transl_table=11
                     /translation="MDKLRQIKDFVCFLCGVLGGFVVQLLGGWTKDLRTLVLFMIIDF
                     AMGLIVAAVFKNSTKTESGALNSTAGLKGICKKIVMLLMVVIATQADGLMGTNYIRSA
                     SIIAFIVNELISIGENAGLMGVKFPTAITNAIDVLSQKAEEKRSDQ"
     CDS             711132..711812
                     /codon_start=1
                     /locus_tag="lbkm_0700"
                     /product="phage lysin"
                     /protein_id="BBF42018.1"
                     /transl_table=11
                     /translation="MGLTDKQKLFIKKIGDASVSLYKNNRILPSLTIAQAILESAWGT
                     KVTGNFNYFGMKWHQGSQYGYKECPTHEVYNGKRVSISAKFLSFKTVEQGIGARFQFL
                     NTKRYANLKGITDYKKACRTIKADGYATDPNYANSLIKLIEAYDLNSYDKKALEKKVT
                     SAPTSSKTTSKTGSSKKDDKVYYTVKKGDNLTAIAKKYKTSVNKLVSLNKIKDPNKIS
                     IGQKIRVK"
     CDS             712147..712791
                     /codon_start=1
                     /locus_tag="lbkm_0701"
                     /product="Rha protein, phage phi-80"
                     /protein_id="BBF42019.1"
                     /transl_table=11
                     /translation="MLVELARINKKELVVCSSLDVADTFGKEHRRVMQDIRELGCSDQ
                     FNKHNFVLISYIDSMNRKKPMYQMTRDGFTLLVMGYTGDKAMKFKEAYIKQFNAMEKT
                     LQGKLIEREKGIAVRQSLTKALQVVEEDRMHGHAYSTYTNSIYKVLFGKSAKQLKTKY
                     GLSQKDSLRDYFGAEELKAIESMERMVSGLVDCGWGYDKIKSFIENTNTKQLVG"
     CDS             complement(712831..713361)
                     /codon_start=1
                     /locus_tag="lbkm_0702"
                     /product="hypothetical protein"
                     /protein_id="BBF42020.1"
                     /transl_table=11
                     /translation="MREKKHGKLKIVIVVFLVLFIFYSIGNNESENNKKETVSKSASA
                     GAVKKDSKEETISATAKKKGSQKKDVKKAKKKETKKQKAKKKEVPLEDLAVSDVKGTS
                     DNYTSYATGKVKNNTDRTYSYVQVEINLYDKSGNQVGSTLDNVTNLEAGSTWKFKAPI
                     LEQNVDNFKVKNVTGY"
     CDS             714163..714474
                     /codon_start=1
                     /locus_tag="lbkm_0703"
                     /product="hypothetical protein"
                     /protein_id="BBF42021.1"
                     /transl_table=11
                     /translation="MEKRTKGKEGHIDSYEIRNQTTVKRIRKILHEADWSTCKAKPKT
                     SPDYQFCFQFVSKNYEAKAVLYEVWILKNGDQLYIESGGYESTIIKQDLAADLIDLLN
                     H"
     CDS             714515..714838
                     /codon_start=1
                     /locus_tag="lbkm_0704"
                     /product="hypothetical protein"
                     /protein_id="BBF42022.1"
                     /transl_table=11
                     /translation="MKLYCCSSCNHWFSGEEKEKFCSECRGILIPIDYDYDSYNAMSN
                     EEKERFRNEYTENNHLNDAINSPTNIILNEIYKEMNTIKTAVLVLLVMCFFVILYIML
                     RYLGF"
     CDS             complement(714881..715432)
                     /codon_start=1
                     /locus_tag="lbkm_0705"
                     /product="hypothetical protein"
                     /protein_id="BBF42023.1"
                     /transl_table=11
                     /translation="MNNLNDFMTILTGHFDNSAQIEELKQKGINDFPFSEHINTICND
                     KINNLPSDFKGIFVVEESYYTTKGETHASPHLFLFTEEENGILLTSYEVPDGYDKNTF
                     TYDIITQIDFNGLKRSEKFTPALYIYKEGVWEGGSVSMFSPVLKFTLFERFSADCLEV
                     SESMEVNGKRTFGYDEPIIYRRK"
     CDS             715751..717211
                     /codon_start=1
                     /locus_tag="lbkm_0706"
                     /product="hypothetical protein"
                     /protein_id="BBF42024.1"
                     /transl_table=11
                     /translation="MDKSSVIFGNKMSKKVIRKANKSKAKYVKKFGDDSAKNYPLYIE
                     KNAYIGDPLGVENILIGEKAGSKAFDQEKGLIVGNIRMGFGHYRISMAIASAAHSMGY
                     TPYWMDLNSYTDTTCGKVINAQNKLYSLGSRISGKSKLFNRFVWEPMNYEGFRKISYN
                     AADQKNAELMAAVYKNVPKDIPVVATHVWPSQAAIHAGMKNVVNAIPDNWPMALHLSE
                     GSLHTVQTHSSYLGYRVLNGMNKDEVLNPIPKEDIAYTGHYIDHELVSNIEKDCELRV
                     KRVEEGKPMRFLLTIGGAGAQKEIFAAIIKELIPQVKAKKAALYVNVGDYKNVWDELV
                     AEISELKALSTEHFDEWDKTVAFCEEAIEGDVEGIHGFYHPNIFEAVYATNLLMRSTD
                     ILVTKPSELAFYPIPKLFIKRVGGHEQWGAIHSAEIGDGTLECRDIPHTLQMIGLFLE
                     DPALLKDMCNNIVRNKQMGIYDGAYKVVELAMNMKK"
     CDS             717229..718167
                     /codon_start=1
                     /EC_number="3.1.1.5"
                     /locus_tag="lbkm_0707"
                     /product="lysophospholipase"
                     /protein_id="BBF42025.1"
                     /transl_table=11
                     /translation="MINKQEYYLPSTNGVNKLHVVKWEPVGEVTAILQISHGMVEFIN
                     RYDRFANYLAERGILVIGNDHLGHGFTAANDDELGFFPAEDGSKTVVSDLYQITKHAK
                     GEHPGVPYYLLGHSMGSFMARRYLMTYGKELDGAIIMGTGNQPKAVIAAGKMVAGLIS
                     VFKGKRHRSKLMNTLSFGAYNKQFKPVRTSYDWLTKDETIVDAYAANKYCTYLFTLNG
                     YQTLFNTFSFIMNKKNIQSIPKELPLFFVAGAKDPVGVNGKEVRKIYEQYKKMGIRDC
                     KIKLYDNCRHEILNELEYETVYEDLYKWIIDKIATK"
     CDS             718302..719324
                     /codon_start=1
                     /locus_tag="lbkm_0708"
                     /product="putative oxidoreductase"
                     /protein_id="BBF42026.1"
                     /transl_table=11
                     /translation="MKQVNWGILGDGDVCEHFAAALDDIPEGELVAVASGSLEKAAGL
                     LKGKNQVKVYHNYEQLIKDSNVDVIFIDIPIVYHKRVIELCIRYGKHVLCDKALTMNA
                     KEAREIKKLAEGKDIMIVQADWFQFLPTTDRVMEWIKTERIGQLKYVTINYGNQMELD
                     VNKLDFSIELGGGALLNMGGAAFSFVLKMMRMMPHTIQSSAYMGFTNVDETNTTILSF
                     IDGTMVNVSTSISIDFSQEAEFIGTKGKIVIPNFFLSSRAYLCDLDGVQLERVHESNA
                     INGYEYEIRELSNRIMSAKFDDVKWNTLDEIIDVLEVMDAVRGQWGLKYPSEENEVVY
                     GGNINE"
     CDS             719317..719898
                     /codon_start=1
                     /locus_tag="lbkm_0709"
                     /product="hypothetical protein"
                     /protein_id="BBF42027.1"
                     /transl_table=11
                     /translation="MSSESEKTVQGFLFETQSDYENAKKEYEVVTYLKANTDFSNVKV
                     IYKLYEKLLEKDTFQTVIGYKFLSEIREQILESNEEFERILKPVPVKKSNVVSKKKKK
                     KRVNPEVEGKYKLLYENMKEKRTRTKIVNFFLIGIILAMIVITFTSNHASTEKLETAL
                     QNKYSTWQDELNQKEKQLDQREAQLNKQSSEKN"
     CDS             720019..720690
                     /codon_start=1
                     /locus_tag="lbkm_0710"
                     /product="chemotaxis regulator - transmits chemoreceptor
                     signals to flagelllar motor components CheY"
                     /protein_id="BBF42028.1"
                     /transl_table=11
                     /translation="MDKLKVLVVDDESRMRKLVKDFLIRDGYDVLEAENGEEAVDIFF
                     STKDISLIILDVMMPKLDGWGVCREIRQYSKVPIIMLTAKSDERDELLGFELGIDEYI
                     SKPFSPKILVARVGAVLRRTNQADTEVIDIGGIHLDKAAHEVVIDGEKIDLSFKEFEL
                     LTYFITNQGVALSREKILNNVWNYDYFGDARTIDTHVKKLRNKMGEKGAYIKTIWGMG
                     YKFEP"
     CDS             720711..722279
                     /codon_start=1
                     /locus_tag="lbkm_0711"
                     /product="sensor histidine kinase"
                     /protein_id="BBF42029.1"
                     /transl_table=11
                     /translation="MKFKDSIRFKFVSTLAVLILFTIFLCWFMNKTFFTGYYEKTKIN
                     TLGQMYEDTCDIFNDFMNSAEPLEEDKDSEKLEKLQREFEVNLERMSADKNVSLNVFT
                     LVYTSLLGSPKIATFFPYEKMTDQQQKILYERTMKYFNSSIDGDPLVRTQRYSIYKVK
                     DERTKSFYLELWGNTAENGKGSYVYLRSSFEAMKESVDISNKFLAYIGIVTTLIGMTI
                     MFFISRSFTRPIMQLSNVAKSMTDLNFNVKYQGNSKDEVGVLGNSINILSEKLETTIS
                     ELKSANNELQRDIENKIQIDEMRKEFLSNVTHELKTPIALIQGYAEGLQVNINDDQES
                     RDFYCEVIMDEAAKMNNMVKKLLSLNHIESGTSIVEFERFDMVAVIKSVLDSTEILFQ
                     QKNVICDFKYEDPIYVWADEYMIEEVVTNYISNALNHVNYANIIEIKLIEMDGKLRVA
                     VYNTGDLIPEEDIDKVWIKFFKVDKARTREYGGSGIGLSIVKAIMEAHNQRYGVQNRV
                     NGVEFWFECDRKNE"
     CDS