LOCUS       AP013070             6156701 bp    DNA     circular BCT 07-OCT-2016
DEFINITION  Pseudomonas putida NBRC 14164 DNA, complete genome.
ACCESSION   AP013070
VERSION     AP013070.1
DBLINK      BioProject:PRJDB191
            BioSample:SAMD00061028
KEYWORDS    .
SOURCE      Pseudomonas putida NBRC 14164
  ORGANISM  Pseudomonas putida NBRC 14164
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 6156701)
  AUTHORS   Hosoyama,A., Ohji,S., Yamazoe,A. and Fujita,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JUN-2013) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Biological Resource Center
            National Institute of Technology and Evaluation, NITE Biological
            Resource Center; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
            Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Ohji,S., Yamazoe,A., Hosoyama,A., Tsuchikane,K., Ezaki,T. and
            Fujita,N.
  TITLE     The Complete Genome Sequence of Pseudomonas putida NBRC 14164T
            Confirms High Intraspecies Variation
  JOURNAL   Genome Announc 2, e00029-14 (2014)
  REMARK    Publication Status: Online-Only
            DOI:10.1128/genomeA.00029-14
COMMENT     Strain NBRC 14164 is available from the NBRC culture collection
            (http://www.nbrc.nite.go.jp/e/).
            
            Please visit our website.
            URL:http://www.bio.nite.go.jp/ngac/e/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Newbler v. 2.6
            Genome Coverage       :: 0.6x ABI3730; 17.6x GS-FLX Titanium;
                                     94.3x Illumina HiSeq 1000
            Sequencing Technology :: ABI3730; GS-FLX Titanium; Illumina HiSeq
                                     1000 paired-end
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..6156701
                     /db_xref="NBRC:14164"
                     /db_xref="taxon:1211579"
                     /mol_type="genomic DNA"
                     /note="type strain of Pseudomonas putida"
                     /organism="Pseudomonas putida NBRC 14164"
                     /strain="NBRC 14164"
     CDS             385..1929
                     /codon_start=1
                     /gene="dnaA"
                     /locus_tag="PP4_00010"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BAN51854.1"
                     /transl_table=11
                     /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPN
                     RFVLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAVAASL
                     AQTRAQTQAQRPLPVAAAAEPAAVAAVEPVLVNELAEPSSRDSFDAMAEPVSPPASNN
                     RTEQRTVQVEGALKHTSYLNRTFTFDTFVEGKSNQLARAAAWQVADNPKHGYNPLFLY
                     GGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSV
                     DALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFG
                     WGLTVAVEPPELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIA
                     HSHFMGRDITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSV
                     ARPRQVAMALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNL
                     LRTLTT"
     CDS             1970..3073
                     /codon_start=1
                     /gene="dnaN"
                     /locus_tag="PP4_00020"
                     /product="DNA polymerase III beta subunit"
                     /protein_id="BAN51855.1"
                     /transl_table=11
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSL
                     TGTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAG
                     RSRFTLSTLPANDFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLL
                     EVSRNTLRAVSTDGHRLALCSMTAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSN
                     EKYRGIRLQLAAGQLKIQANNPEQEEAEEEISVDYEGSSLEIGFNVSYLLDVLGVMTT
                     EQVRLILSDSNSSALLQEAGNDDSSYVVMPMRL"
     CDS             3089..4192
                     /codon_start=1
                     /gene="recF"
                     /locus_tag="PP4_00030"
                     /product="DNA replication and repair protein RecF"
                     /protein_id="BAN51856.1"
                     /transl_table=11
                     /translation="MSLRRIMVTAVRNLHPVTLSPSPRINILYGANGSGKTSVLEAVH
                     LLGLARSFRSTRLNPVIQYEQSACTVFGEVQLAEGGTSNLGVSRERQGEFTIRIDGQN
                     ARSAAQLAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALR
                     QRNSWLRHGTLDAASQAAWDRELCLASAEIDEYRRNYIKALKPVFERTLSELVELDGL
                     TLSYYRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAANNAADILSRGQQ
                     KLVVCALRIAQGHLVSQARRGNCIYLVDDLPSELDDKHRRALCRLLEELRCQVFITCV
                     DHELLREGWQTETPVALFHVEQGRITQTHDHRE"
     CDS             4197..6617
                     /codon_start=1
                     /EC_number="5.99.1.3"
                     /gene="gyrB"
                     /locus_tag="PP4_00040"
                     /product="DNA gyrase subunit B"
                     /protein_id="BAN51857.1"
                     /transl_table=11
                     /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFE
                     VVDNSIDEALAGHCDDITVIIHTDESISVRDNGRGIPVDVHKEEGVSAAEVIMTVLHA
                     GGKFDDNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWEQTYVHGVPQAPMAVVG
                     ESETTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSGKEEFFK
                     YEGGLRAFVEYLNTNKTPVNSQVFHFSVQREDGVGVEVALQWNDSFNENLLCFTNNIP
                     QRDGGTHLVGFRSSLTRSLNSYIEQEGLAKKNKVATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMNKYFSDFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKG
                     KILNVEKARFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQLPELVERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDA
                     SLHLDESAPAVSGVQLESLVNEFRSVMKTLKRLSRLYPEELTEHFVYLPEVTLEQLGD
                     HAVMQAWLAKLQERLNSSQKSGLAYNASLREDKERNVWLPEVEITSHGLASYITFNRD
                     FFGSNDYRTVVNIGAKLSSLLGEGAYVQRGERRKAIVEFKEGLDWLMNETTKRHTIQR
                     YKGLGEMNPDQLWETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVEPRREFIESNA
                     LSVSNLDF"
     CDS             7454..8092
                     /codon_start=1
                     /locus_tag="PP4_00050"
                     /product="hypothetical protein"
                     /protein_id="BAN51858.1"
                     /transl_table=11
                     /translation="MTVRKVVTRRSNHYRGYFPSLKNKKPVPWESQLEGALFRLLELS
                     PAVIGYVPQPSEERVPSLQGYFKYYPDVQVFLADGREWWFEVKPHDRLKIASVRQRLD
                     AAERYFNATARNFSVITEKLIEAEPLATNLRRLMYHRRGPELSHQALEEVMATFNEWP
                     PMTVADLLYVVGEGKAWRLLGLGVVGIDLDRSIDTDSPVFLQGGHRHANLFP"
     CDS             8073..10031
                     /codon_start=1
                     /locus_tag="PP4_00060"
                     /product="putative transposase"
                     /protein_id="BAN51859.1"
                     /transl_table=11
                     /translation="MQTFSLRVKLVVIVRGVLMVLEKRLIDRKLLFFDELGEPTKLSE
                     KEFYEAYEKREIEISADQPYLGKVPYVRNVPPDISCFPKKHGDEALRRRKYLDDLTKR
                     GKYKLPGDEDMIKKLRDIAKKIGDACAPSVSTIRRWAAKYIGQNVVKLIPQHAKKGRA
                     AAIQGELEVILEGVINKTYLQDTIPAVSVVVSEFEDQIKERNKSRLPSDQLKIPSGMT
                     VRRYIAKLDPYLVDKERLGKHAADKKHRVAAGVLRVHEILERWEIDHTLLDVQLVDET
                     SGLCIGRPYLTIVLDRFSRMVMGYLLHLSAPNTETVLRVIERSIRPKAELLKRFPKVR
                     NEWWARGLPARIVPDNAAEFHAGDLIMGFNELGIEIMYPASRAPQRKGAVERFFSTQN
                     LGLIHNLPGTTFSNIQQRGDYDSEKNACFTLPQLEAVVVKWIVDGYHQTPHRGLDNRT
                     PAQVWGTSEANHVISLPVDLDSLECILAKRASVKVHHYGIEVAKVGYHSTELAELRMR
                     LADGEKVNVRYRDEAGHVWVHDRFRNLFFKVPAKDERMAGKSREVWKAAEKALREKYN
                     EQPSFEATHRCYQEIMEDADEARRSQTLRKRRAAAIAKIDKEGRVTESTPPPKVLAEV
                     EWTGDSIPNIPPAAFKVSVRRPAGSSKP"
     CDS             10028..10987
                     /codon_start=1
                     /locus_tag="PP4_00070"
                     /product="putative ATPase"
                     /protein_id="BAN51860.1"
                     /transl_table=11
                     /translation="MNAINLYECYEHGEYSFTLRDRFIHSPQVERALTRLGDIHGDSR
                     RTRASKGLLIQGPSGVGKSTLVKEYIRSLEELESHDPQKRTVLFVEMPSSPTKKNLAA
                     AILAELKDPFAEARGHSAEVKFARVVLLLKNLGVEMLVLDEAQHLVDYRRNGAYEAAD
                     WIKSLMNETSIAFVLIGLKRTENLLLANEQLRRRFSATVAYDRFTFSANTSLHFVMLL
                     QAIEGELPVQTISFVEPAMIKRFYLASYGLIDYLIKIVDRAVWLVQVQDLVGIELPVL
                     AQAFEDEVWSYATEDRNPFSASFNFQPLFGKREPFETFEESST"
     CDS             12113..12979
                     /codon_start=1
                     /locus_tag="PP4_00080"
                     /product="hypothetical protein"
                     /protein_id="BAN51861.1"
                     /transl_table=11
                     /translation="MDLDHLKAISQHLQGVADMKETSTLLSLCRNRVRQLLAGGTLQF
                     FGGEPRPGERWLIDCRSINELIDEKLPTSSDQSLVSINYLAKHSLPKGGGLVELVQAI
                     RAGELRAYGPAENGSVAVGAWLLKPQDFAAWQQARAENKSPVFPGLSVVKAAALLGVK
                     EQCAYAFVRLGLLWSTAVERGRRTQLMVKPQAIDRFRRGYILGPEIAVYLGKSTREAF
                     KHLWEARFRPVAGPSIPNAACRQYVWVRSKKLIDYLASEAAQIDDPEAITFLSTPIAQ
                     PRDCRFRHVGSR"
     CDS             13036..13395
                     /codon_start=1
                     /gene="turC"
                     /locus_tag="PP4_00090"
                     /product="transcriptional regulator TurC"
                     /protein_id="BAN51862.1"
                     /transl_table=11
                     /translation="MSRLAEFRLLEQQLAAQLAELEALKNDSALKQEMEFETKLRSLL
                     NEYGYGLRQVVLILDPQAVASTDMAPKTSRKPREVKVYKNPHSGEVVETKGGNQRTLK
                     AWKNEYGAEVVESWLAN"
     CDS             14041..14883
                     /codon_start=1
                     /locus_tag="PP4_00100"
                     /product="hypothetical protein"
                     /protein_id="BAN51863.1"
                     /transl_table=11
                     /translation="MSEREGVLARAPLIYALSVIRFAPILKLPKLIPDIQHTIRQSLP
                     GFFQMVKGVPPGVMHSGEPNSWAFLNRDADYACVLAMDHMILQSTNYLHFDNHLALFR
                     ECIEALVGQAGALDITAIGMRYVDKIEPAEGETLADYLPEAMLPLKCDELAAHGKVPK
                     EQLGISTTTYHLDPEYLHIRCWRQTGMWIPEDLVEPAMVFEIAKQSRNSSKHGAPLQG
                     AFVPVSENGALLDTDAHWPLQLAERLGTEEICTRLDGLHKTANFAFRTVAKDHAFEVW
                     GKAK"
     CDS             14892..15563
                     /codon_start=1
                     /locus_tag="PP4_00110"
                     /product="hypothetical protein"
                     /protein_id="BAN51864.1"
                     /transl_table=11
                     /translation="MNGQWIDPTGAAVSRSSTWENPEIAPRVGSTTANPVLAIAFTAM
                     LAVSVVVAPGTASLPYPQLIGSAGMSFHGVHAGAWTEVDTSQDANVTEDVAPALIEEL
                     RSDFKLSDSSIAQIFNVSRQTVYNWRTGKTATGFPERLAALTEALRQVNAEEAQYLHR
                     VLFYPTADGRLIQDALSDEAWNRNGAKGVYGMVAELAGKAQQLRDRDLKTIARLEKSG
                     GSNLV"
     CDS             15566..16435
                     /codon_start=1
                     /locus_tag="PP4_00120"
                     /product="hypothetical protein"
                     /protein_id="BAN51865.1"
                     /transl_table=11
                     /translation="MADTPEQEIVSAISAAGWLQGDTVSGDALIEHISEEVLKGQFEG
                     VAPAYWMLASHSCTVHARNLCDAPWIEWIAVKVKKKAFDKQLHALNPRTLHLQHAEKQ
                     VLELKIHKRVWTKRAVLPTLHRNPVITLSEENGQYFSYWMSHHYNRIAMPDELVNRLK
                     ADQGDDGMKGIAVLVDDFLHQNNQFFASAWVSFNPKGEIRDPAEPYEVVFRFLTKREH
                     ARRANELHDQLNELLGVARNLNDGLYFGGADVTVLQDFTMLDAEDFVRYNLHDWLSVG
                     DTDEDEEGADDAD"
     CDS             16746..17669
                     /codon_start=1
                     /locus_tag="PP4_00130"
                     /product="hypothetical protein"
                     /protein_id="BAN51866.1"
                     /transl_table=11
                     /translation="MDVYKVRIEDTESKIIDKEGFEAETFRRDPWYQPGSAGKLAQFA
                     VCPACDNPVQLVGLYELPPNVKNPFGKHATKSIRGIAPFDSEARNDCPYFQPRQHKKT
                     ERKTRFDGVPRKILKLLIEQFDRVVYILEKETQLVLSENALRGMLQRYKGERGYLYTG
                     ATLRNVPWIFAYMSDATRLFGQKVIGNAELVKAIAAEVPGAEISSTGRLESKKVPGSK
                     AAYFDLKMSFIRHRIVKDSEASGLVESMEFVVSQPRGGELEHIHKEVIKFDSAWFESL
                     IRMPVDHPYRRMDRVKMAREELGDLLELTQA"
     CDS             17890..18099
                     /codon_start=1
                     /locus_tag="PP4_00140"
                     /product="hypothetical protein"
                     /protein_id="BAN51867.1"
                     /transl_table=11
                     /translation="MKRTFIGMVEAGEPLMRQALEAIRQAHEAEAAGLPDLEVQRLHP
                     LADSLYQAVIDFQLLKAGKPPSTIQ"
     CDS             18114..18320
                     /codon_start=1
                     /locus_tag="PP4_00150"
                     /product="hypothetical protein"
                     /protein_id="BAN51868.1"
                     /transl_table=11
                     /translation="MTKKMPALLPDHPMYTDAVDAMKQYHEAQASGSSAEEVERLRQI
                     AESQFRAVSEYQLNALGYQSRRPH"
     CDS             complement(18464..18592)
                     /codon_start=1
                     /locus_tag="PP4_00160"
                     /product="hypothetical protein"
                     /protein_id="BAN51869.1"
                     /transl_table=11
                     /translation="MSIKPGPKRTNEDGTPDKRQRVTPEKQKDHPDLKPHKHKKGE"
     CDS             complement(18715..20412)
                     /codon_start=1
                     /gene="eptA"
                     /locus_tag="PP4_00170"
                     /product="putative lipid A phosphoethanolamine
                     transferase"
                     /protein_id="BAN51870.1"
                     /transl_table=11
                     /translation="MTPSKSIVHTLLSKWIFAIRNARQKGISTNLLIGLVTFWLLLFA
                     NAELWNVLWKLVFKTDEVNWQLAASLPVIVFAWVFTVLSLLSWGRLAKPILCLVLISA
                     SFASYFMNAYGIVIDYTMFTNVVETDVAEATELLNWKLGLWVAMVGVLPVYLIARVPL
                     RRKPWAKALVSRFIALSLALLTLSGIALSQYQSYASLLRNNREIRLILVPTNLFAAGH
                     GYLKRQLASPKTLTAIGTDAVVNRQGAARKPRLLVLAVGETARSANFSLNGYSRETNP
                     ELEKRNVISFTNVSSCGTATAVSLPCMFLDVGKAQYKDGLAKSREGLLDVLQRAGISV
                     MWTDNNSGCKGVCDRVPNHKAASHADSQLCTSEECKDGVLLTEMQDFIKRQEGDAVLV
                     LHYKGSHGPAYYKRYPSQFKKFAPVCETNELDKCKQEEVVNAYDNSILYTDYVTANLI
                     DILAANTKFDTALMYVSDHGESLGEGGLYLHGLPYAMAPDEQTKVPLVLWMSDSLAKS
                     EKVNVGCLKAQTTSPLSHDNLFHTVLGMMNVQTSSYRSALDFTAPCKPFVGGSYSGL"
     CDS             21296..22201
                     /codon_start=1
                     /locus_tag="PP4_00180"
                     /product="putative cobalt/cadmium/zinc transporter"
                     /protein_id="BAN51871.1"
                     /transl_table=11
                     /translation="MGSNHDHGSAAVREGHQKKLIMALGLTGSFMIAEVIGAWITGSL
                     ALLSDASHMFTDTAALAISLIALQIAKRPADQKRTFGYARLEILASTFNAVLLFLVAM
                     YILYEAYQRFFMPAEIATGAMMWIAIAGLIINLISMRLLASASNESLNVKGAYLEVWS
                     DMLGSLGVIIAALIIRFTGWTWVDTIVAVAIGLWVLPRTWQLLRESLGILMEGVPRGL
                     DVTAIEATILGVDGVTDVHDLHVWAVSSGSNVMTSHVVVRDSADGDAVLAAVVDAVSD
                     AFEIHHCTIQIERAAFHESVPSPSH"
     CDS             22359..22709
                     /codon_start=1
                     /locus_tag="PP4_00190"
                     /product="hypothetical protein"
                     /protein_id="BAN51872.1"
                     /transl_table=11
                     /translation="MAWIITKYLLTAGIVILVSELAKRSDKLGGLVAALPLVTVVTLV
                     WLYLENQSMEKISNHAWYTFWYVLPTLPMFIAFPLLLPKLGFWPTLISSILITMASFG
                     GFAILLRRFGIELL"
     CDS             complement(22742..23068)
                     /codon_start=1
                     /locus_tag="PP4_00200"
                     /product="hypothetical protein"
                     /protein_id="BAN51873.1"
                     /transl_table=11
                     /translation="MNTTVSAIAVFMLFTSLTANAQSGMEINKHIERTAREATADYAQ
                     RVKKPMPQLEDYAYGMDLDVGKLVYVSPNVRYCGNVRSMMTYEDSKGELHMVRYLVKG
                     ECVNSR"
     CDS             23758..24432
                     /codon_start=1
                     /gene="czrR"
                     /locus_tag="PP4_00210"
                     /product="two-component response regulator CzrR"
                     /protein_id="BAN51874.1"
                     /transl_table=11
                     /translation="MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNV
                     YSLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTARGRINDKLKGLDGGADDYLVKPF
                     EFPELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHL
                     LMSRTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGY
                     VFEERA"
     CDS             24429..25847
                     /codon_start=1
                     /gene="czrS"
                     /locus_tag="PP4_00220"
                     /product="two-component histidine kinase CzrS"
                     /protein_id="BAN51875.1"
                     /transl_table=11
                     /translation="MRPFSLAAKLGLKVGLMSAALLLLFATFGYLMVGKALERNARAD
                     LEVKMAGMAHNLSTIPDISGVNADAHQLVDLVMGHNNLYVSIFDTSQNQTPLLSIGSK
                     QVNLEVHKFQPAAQPKEHEWRDTQDRPLLSASRIMRLGDGTEVSVYMTMDQSSSEALL
                     DALLTWALMMSPVILALILAIGWWTVRRGLLPLTKFLKIASKISTESLDHRLPTDGMP
                     AELKMLADGINIMLARLDDGVQQLSQFSDDLAHELRAPLSNLMGKAQVALTRERSLSE
                     YREVLESCTEELDRMSRMVSDMLFLAQVSHPASMVEFESVSLVDEVQRVCDLFSISAE
                     EGEIQLQISGSDDVVRGNRLMVQRAVSNLVSNAIRYCPRGRTVYVKVQHSASGTTLSV
                     GNPGRGIAKEHHAHLFERFYRVDKSRARSEGGTGLGLAIVQSIMSLHQGSASVEVTEE
                     NFTWFHLHFPEAQQMQPAMTAA"
     CDS             complement(25905..26492)
                     /codon_start=1
                     /locus_tag="PP4_00230"
                     /product="hypothetical protein"
                     /protein_id="BAN51876.1"
                     /transl_table=11
                     /translation="MNDIEPWAVAIGDFRRCTEKLTVQLDELTSQTRTSSAVLERSNE
                     LVEQVDAVGRQIQEEVRKAEKAWSNAEEVALRAAASAYSAACRGVDTAIQPLISELTA
                     ATKAADASIQELKRAPVLAKRYVMVVATAFFILALICVYSTMRLIDAAGSVSAQEKVN
                     AQYFSHLWKNANPDEQKIIKSVILRSPMDPVVLRH"
     CDS             26759..26980
                     /codon_start=1
                     /locus_tag="PP4_00240"
                     /product="hypothetical protein"
                     /protein_id="BAN51877.1"
                     /transl_table=11
                     /translation="MKFVKSIAIGSLLLGLMGTAYAEGGFERTKQFNENFRTEQARLW
                     SDDSSDQNKQQVAQEQKKESKDGKEQADN"
     CDS             complement(27063..28517)
                     /codon_start=1
                     /locus_tag="PP4_00250"
                     /product="putative glycosyltransferase"
                     /protein_id="BAN51878.1"
                     /transl_table=11
                     /translation="MLNLKNERTLWWVLGSILLLRLVGLGIYPLMDTSEARYAEMARK
                     MVELNDWITPMFDYGVPFWGKPPLSFWTQAASMTVFGVNEFAARFPAWLLHLASCFII
                     IKLGTQQISRNAGIWAAIIFSSTTLGLVSSGVVLTDPVLSFSILLASYGFWRWMKCAS
                     KADAYLMFAGLGLGLLAKGPLTLVLMGAPAFAWFVIYKEWGRVLRLPWISGLVLMFGI
                     SVPWYVAAEMKTPGFMEYFFVGEHWSRYVVSNWAGDLYGSAHAKPYGSIWIQLGLSLL
                     PWALFLPLLIRKRGSMQRFKAYLWLWALATPVFFTFAGNILWTYLLPALPAWALLLSA
                     RVSEVGPKTTWAAAASALVLPIIGAGIIYAGVLEERPQNQRDVVQAWLNVQSAHSAPL
                     IYPGRRSYSSEFYSSGKSENIKDPAKWPRDGSFYLSRRLRDSKDGLPADLACTSITEA
                     NASQLLLCHWKRPAQGAEGLAGESNAETPRKNEG"
     CDS             complement(28511..29494)
                     /codon_start=1
                     /locus_tag="PP4_00260"
                     /product="putative glycosyltransferase"
                     /protein_id="BAN51879.1"
                     /transl_table=11
                     /translation="MQTLHRFPERPDPLLTIVVPCFQEEETIPEFHQRITRVVKRLPV
                     SCEILYVDDGSNDRTADILRHYQDGSSVRCLSLSRNFGKEAALSAGIDHARGSALIFI
                     DVDLQDPPELIAAMVDYWQRGYDVVNMQRNLRIGDSWFKRMSARAYYWVMQRLVEKVD
                     MPADVSDFRLIGPAPLAALRALDERSRILKGMIGWVGFRTIELPYNRTVRHAGSTKWN
                     AAGLFNLAIESIVSFSRKPLRIFSLISFGLFVSSICYMLASLVAGSFDIHHLIVGMAS
                     FMCVGVAMVGEYLGVTLAEVKRRPLYFLKHSNKADPVSLHPSMASIEGKKC"
     CDS             complement(29460..29879)
                     /codon_start=1
                     /locus_tag="PP4_00270"
                     /product="GtrA family protein"
                     /protein_id="BAN51880.1"
                     /transl_table=11
                     /translation="MENQTPPLTTLLIRYLGIGFIATGVHYAVFLLLVTTEFVTPLLA
                     SICGGMVGAIASFIGNRALCFVADGSRKFQPVRFALVALTTNFGNGVGMWFLIKSNLS
                     PLISQVVVTLSLTALGFIAHRFWTFNHADITSLSRAP"
     CDS             30137..31105
                     /codon_start=1
                     /locus_tag="PP4_00280"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAN51881.1"
                     /transl_table=11
                     /translation="MVTQNETYTSTVVPYSPDILDDLPIDDQLAVEFFATARCASFKQ
                     AARGLNVPVVGLRKRLEKLEEHIGAPVFVYKHNKLALTRTGERVSHYLCQLFGPDGLG
                     KSGEKEVPRLTIAITEPVLNDIVNRDLVAYVRDHAEMQLEIHSECTTQMLSECEVDVG
                     IALVSPDDKGALDRHPTYRFERLGRIGHALFISSRYSRSVTLPVESLDLHNFMLVVPW
                     DEEILAGSRKWASIMAEHQGGTTRVKSYNLSRGLVVGGACIGVLPDYSRKLERNILPV
                     PGFLDDLEEKDVYLVIKTKLVRNPQVLEIRRLIKKSFFDKKDWLVR"
     CDS             31316..32623
                     /codon_start=1
                     /gene="oprP"
                     /locus_tag="PP4_00290"
                     /product="phosphate-specific porin OprP"
                     /protein_id="BAN51882.1"
                     /transl_table=11
                     /translation="MIRSSNMREKLLAAAIIGTFSSQAFSGTVTTDGADIVLKTKGGL
                     EVSTSDKEFSFKLGGRVQADYGRFDGVFTKNGDTADAGYFRRAYLELGGVLYRDWKYQ
                     LNYDLSRNTGNDSDGYFDEASLTYTGFKPVQLRFGRFYTDFGLEKATSSKWTTAMERN
                     LSYDLADWINDNAGMGVQATSTIADMAYVSGSVFSETNNNSDGDSTKRYNVRGVFAPL
                     HSDGNVLHVGAQYAYRDLKNSAVDTRIRSRLGVRGVDTNGGGDAGTNGNRMLFGGAAA
                     QDGLWKDDSVWGLEGAWATGPFSVQAEYLRRKLKADQANNDMKASGYYAQMAYTLTGE
                     PRIYKLDGAKFDTIKPENKELGAWEVFYRFDDIKVEDGNLVTAADQSNERKAKSHTVG
                     VNWYVNEAVKVSANYINVRTDNNENTVGDDSGNAIVTRLQYVF"
     CDS             32922..33947
                     /codon_start=1
                     /locus_tag="PP4_00300"
                     /product="hypothetical protein"
                     /protein_id="BAN51883.1"
                     /transl_table=11
                     /translation="MSAKKLLQPLAAQLHASFSASGRPYSHLHLHQLFHAAIGSVAPQ
                     VAIQDKLPIQVCRDNETRQYNLYAAVERAKTCLGLTDLQAVGVAEEVIEVLRTAGIGV
                     NQVRLLLDPSFSSKTRKKAFKALCKNLDLNELGDRFVPKTATLAIAAGIAPPPKMSWK
                     DRFALAANSPMRGPSELISMVNRDECYLWVFPPTDHHATAPATHDRFFGEKTHPSAEM
                     GMGFSIIDSGWTRPKYPLSRQSQETFIQYSLSAPMWSWRAQSDTWRLGNILRSRILDG
                     APWHNEPLSDVLPSGLKSLPRIYGCETCRTLFIENHSDYPDVPTQCQCGEASSTGDQN
                     ESSALNS"
     CDS             34075..34299
                     /codon_start=1
                     /locus_tag="PP4_00310"
                     /product="hypothetical protein"
                     /protein_id="BAN51884.1"
                     /transl_table=11
                     /translation="MQKSKNKQDTLAAINALVEIAYDQGFADGHGVGNQVGFVAGVMS
                     LKAALACGLRHGSPECGKALESLKRIGIDE"
     CDS             complement(34392..36389)
                     /codon_start=1
                     /gene="cadA1"
                     /locus_tag="PP4_00320"
                     /product="cadmium-transporting P-type ATPase CadA1"
                     /protein_id="BAN51885.1"
                     /transl_table=11
                     /translation="MKSLLERPDDQAGHEGHSHEHGGIFGMNTELIFALICGALLGAG
                     ALAGKLGLIDRLPLILYVSAYVFGGWFTTKEAVTNIRQKRFEIDSLMLLAAVGAASIS
                     AWAEGALLLFLFSLGHSLESYAMGRAKKAIEALSKLAPATAIVRRANGTVEMPVELLV
                     PGDVVIVRPNDRLPADGFVVVGSSSINQAPVTGESVPVDKQPVPDAELARSKPDAVDA
                     ASKVFAGTINGETLIEVEVTRRSTESTLARVIKMVSEAEVRKSPTQRFTDRFQRIFVP
                     LVLLLVVGLLFAGIFLDEPFRDSFYRAMAVLVAASPCALAIATPSAILSGIARAARGG
                     VLIKGGAPLEELGSLNAMAFDKTGTLTEGRPRITDVIPIGGTQIEDLLNVAIAVESMS
                     DHPLAAAIVRDGEEMIGTRRRFQAKNMSNMIGRGVRAELDGQFVWIGKVEMFGTNGIP
                     ALSKAALEAAERLRQSGRTTMVVRRADKDLGAIGLLDTPREGAKEALQKLREMGIERM
                     VMISGDHNRVAEAVAKQVGLDEAWGDLMPEDKVKAIKNLRLSAKVAMVGDGVNDAPAM
                     ASSSVGIAMGAAGSDVALETADIALMADDIRQLPFAVGLSRHTRSIIHQNLFVSLGIV
                     AILVPSTIMGLSIGAAVAIHEGSTLLVVFNALRLLAYRRST"
     CDS             complement(36592..36915)
                     /codon_start=1
                     /locus_tag="PP4_00330"
                     /product="hypothetical protein"
                     /protein_id="BAN51886.1"
                     /transl_table=11
                     /translation="MKKLIIAAALVVFSVASQANTFSESKQLQYTKEHQTAVAKYAEK
                     NGKPMPEIQDYKYGMKIDVAKFVRQSQDPRTCQVYPRLMTFEDSQGTLKTVRYSMYSQ
                     CINNK"
     CDS             complement(37078..40239)
                     /codon_start=1
                     /gene="czcA"
                     /locus_tag="PP4_00340"
                     /product="heavy metal resistance protein CzcA"
                     /protein_id="BAN51887.1"
                     /transl_table=11
                     /translation="MFERIIRFAIEQRIVVMIAVLIMAGIGIYSYQKLPIDAVPDITN
                     VQVQINTAAPGYSPLETEQRITFPVETAMAGLPGLQQTRSLSRSGLSQVTVIFKDGTD
                     IFFARQLINERLQVAKEQLPEGVEAVMGPVSTGLGEIFLWTVEAEDGAVKEDGTPYTP
                     TDLRVIQDWIIKPQLRNVPGVAEINTIGGYAKQFLVAPDPKRLATYKLTLNDLVAALE
                     SNNANVGAGYIERNGEQLLIRAPGQVGNIEDIANIVITSVDGAPIRISSVADVSIGKE
                     LRTGAATENGREVVLGTVFMLIGENSRTVSQAVAAKLADINRTLPKGVVAVTVYDRTN
                     LVEKAIATVKKNLVEGAILVIAILFLFLGNIRAALITAMVIPLSMLFTFTGMFNNKVS
                     ANLMSLGALDFGIIVDGAVVIVENAIRRLAHAQHKHGRMLTKTERFHEVFAAAREARR
                     PLIFGQLIIMVVYLPIFALTGVEGKMFHPMAFTVVMALLGAMVLSVTFVPAAIAMFVT
                     GKVKEEEGVVMRTARLRYEPVLQWVLGHRNIAFSAAVALVVLSGLLASRMGSEFIPSL
                     SEGDFAMQAMRVPGTSLTQSVEMQQRLEKAVIAQVPEVERMFARSGTAEIASDPMPPN
                     ASDAYIMLKPQDQWPNPKKPRDELIAEVQKAAAGVPGSNYELSQPIQLRFNELISGVR
                     SDVAVKVFGDDMDVLNNTANKIAAALKAVPGSSEVKVEQTSGLPVLTINIDREKAARY
                     GLNIADVQNSIAIAVGGRQAGTLYEGDRRFDMVVRLPETVRTDVAGMSSLLIPVPANA
                     AQGANQIGFIPLSQVANLDLQLGPNQISRENGKRLVIVSANVRGRDLGSFVEEATASL
                     DKKVQIPAGYWTTWGGQFEQLQSAAKRLQIVVPVALLLVMTLLFLMFNNLKDGMLVFT
                     GIPFALTGGVVALWLRDIPLSISAGVGFIALSGVAVLNGLVMIAFIRGLREEGRTLRQ
                     AVDEGALTRLRPVLMTALVASLGFIPMALATGTGAEVQRPLATVVIGGILSSTALTLL
                     VLPALYHWAHRKDEDGDEAEVVS"
     CDS             complement(40264..41514)
                     /codon_start=1
                     /gene="czcB"
                     /locus_tag="PP4_00350"
                     /product="heavy metal resistance protein CzcB"
                     /protein_id="BAN51888.1"
                     /transl_table=11
                     /translation="MDNKRKIALAVAAVAALGFGSLAWNNSSGQQAASTAEHGANDGH
                     GDEKKAASAAKEEGDEGHGEEGHSEEGGEEEGKLTLSAEQIKAAGVALEAAAPRDLGT
                     VVSFPGEIRFDEDRTAHVVPRVPGVVEAVQANLGETVKKGQVLAVIASQQISDLRSEQ
                     QAAQRRVELARVTFEREKQLWQDKISAEQDYLQARQALQEAEISLANAKQKVGAIGAS
                     VNSVGGNRYELRAPFDAVVVEKHLTVGEVVSEATNAFILSDLNQVWATFAVPPTDLGK
                     VTTGRAVKVSSPDMNVEVEGKVGYVGSLLGEQNRAATVRVTLTNPNGAWRPGLFVNIA
                     VTSQTDRVAVAVPEHAVQTVEDKPSVFVRTPDGFDTRPVKLGRRDNGYVEIIDGIEAG
                     AQVATSGSFTLKSELGKASAEHGH"
     CDS             complement(41583..42854)
                     /codon_start=1
                     /gene="czcC"
                     /locus_tag="PP4_00360"
                     /product="heavy metal resistance protein CzcC"
                     /protein_id="BAN51889.1"
                     /transl_table=11
                     /translation="MPRYNRNVLPKTPVSPWKIAALCAVISGLMAPAALAQSISLPQA
                     LSTAMDANPDLAAARQEIGIADGARKQAGLIPNPTISYDVEDTRRNTSQTTVSLSQTL
                     ELGGKRGARVDVATYGQTAAQLELDRRVNGLRADVVQAFYAALRAQTGLDLAKQSLEL
                     TERGLRIVDGRVRAGKSSPVEATRAQVQLAEAQLQVRRAETEKATAYQQLAQITGSSV
                     TVFDRLESPTLSPGLPPRTEDLLAKLDQTAEMRQAVVQIDKSDASLGSEKAQRIPNLT
                     VSVGSQYDRSVRERVNTVGLSMPLPLFDRNQGNILSASRRADQARDQRNAVELRLRTE
                     TQTALNQWSTAMQEVESYDKTILPSAQQAVETATRGFEMGKFGFIEVLDAQRTLIVAR
                     GQYLESLAAATNARAQVERVYGEVGSTAGTR"
     CDS             43259..44602
                     /codon_start=1
                     /gene="opdT"
                     /locus_tag="PP4_00370"
                     /product="putative tyrosine-specific porin OpdT"
                     /protein_id="BAN51890.1"
                     /transl_table=11
                     /translation="MKIKVPLYLAAVSALSGSYAISAQAEDKPEGFIEGSSLTVLNRN
                     FYFNRDNRDSTAPTYNSGKGNTNGYSEAWAHAIISKFNSGFTQGTVGFGVDAFAMIGL
                     KLDTGDGRNGGRSSFDVLPVDNKGEARDEYTKVGGAAKVRLFDTIVKVGDVFPSTPVV
                     ASGDSRLLPESFRGVTVENTSIQGLTLQGGRLHAMSQPVSSNLNDNFVTFYGGPVNSP
                     WIGYGGGDYSINDNWTVSVYASQLKDVWNQYYAGTSVVYPLSDDLALIGGFNYYKAVD
                     EGKKRLGEFDNNIWSAKVGVRYGAHTLALSHQRNNGDDDFDYLRQSDSIFVDNSIQYS
                     DFNSPKERSWMLRYDLNFTSYGIPGLTFMTRYARGSGADYSNANQFYMRTDDNGNPLD
                     NQKRWERDVEVKYVVQTGPAKDLSFRLRQATTRATAFESDLDETRVIIEYPLSIL"
     CDS             45092..45766
                     /codon_start=1
                     /locus_tag="PP4_00380"
                     /product="putative two-component response regulator"
                     /protein_id="BAN51891.1"
                     /transl_table=11
                     /translation="MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHE
                     YELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTARSRLADKVRGLENGADDYLIKP
                     FEFPELLARVRALMRRSDHPASVEVIRVADLELDQSRHRAFRDGQRIDLTTKEFALLH
                     YLMRNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVG
                     YVLEKR"
     CDS             45884..46207
                     /codon_start=1
                     /locus_tag="PP4_00390"
                     /product="hypothetical protein"
                     /protein_id="BAN51892.1"
                     /transl_table=11
                     /translation="MRYSIDYQQVSQGQSDASIDACPADIVFNSDHGLALIPCVGDVI
                     NLPSTAVKEGVCGIVRSRIFNYLRGPEELYCHVNILVEEADINFESLISEYMRNQSRA
                     RSPSS"
     CDS             complement(46309..46836)
                     /codon_start=1
                     /locus_tag="PP4_00400"
                     /product="hypothetical protein"
                     /protein_id="BAN51893.1"
                     /transl_table=11
                     /translation="MSIQGLKRYFGNKIHAVIMMAPLKREMIRLGICTLMAIILNIIL
                     YTGVEVDGTIKPWAETPIKLFASSMLFAFMIKAFLPVLGWTILKAMLLSANNAFSGIL
                     SFLGNQFTGVMYCTGIIMGSITIKLYMVSGVLDSEFAYLSAIVFASGVLYFYVLQCAI
                     QKTMSPALRTPAVPR"
     CDS             complement(48505..48954)
                     /codon_start=1
                     /locus_tag="PP4_00410"
                     /product="hypothetical protein"
                     /protein_id="BAN51894.1"
                     /transl_table=11
                     /translation="MDYADQLLSNLIVRSSMANPNLLALFRDEVLLTGPESSLPSNLS
                     QFWLEELQNHLERYFDGLNSESDAEEKDLDISLPLAAIIHILFAKNGGEEISESSEKL
                     YEYFQDYRLELALEEITRKTHVAAEAATIETIFTNRDVLVEQSPLLQ"
     CDS             complement(49643..50050)
                     /codon_start=1
                     /locus_tag="PP4_00420"
                     /product="hypothetical protein"
                     /protein_id="BAN51895.1"
                     /transl_table=11
                     /translation="MKKTLTVICAALMFSAPLASFAQPGPPDRHDGGPSHQGNSPHGQ
                     PQQQGRHDNGRGPAYRDPNFRPQQGMPVPHQQWQRGHAVDPHYRGDRYWVTDWKARHL
                     YAPPRDHRWLYVNGDYVLVAIASGVIVNILTGY"
     CDS             complement(50214..51506)
                     /codon_start=1
                     /locus_tag="PP4_00430"
                     /product="putative transcriptional regulator"
                     /protein_id="BAN51896.1"
                     /transl_table=11
                     /translation="MSEAHPLILALVSYLEHDALPAIVLDTDYNILAANAAYRRQFGR
                     DDQAPLGEKCHKVSHHYAVPCDQAGEHCPLRKAWDSKVPERVLHVHHTPRGPEHVDVE
                     LRPILDEQGRVVAFVERLTTITLASAQPQEQGLVGRAPAFKAALASLQRAAPAQIPVL
                     LQGESGSGKELFARAVHIGSPRANGPLVVVDCTGLTESLFESELFGYEKGAFTGANQR
                     KIGLAEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLVSATH
                     KPLKQMVADGTFREDLYYRISGFPIRLPALRERVEDLPLLAQSLLQRMSGKPTPRLSD
                     DALQQLGLHAFPGNIRELRNILERARLFADDGLIRPEHLPEDIGPVGALKGSGRRNDL
                     GELAQALDQFKGSRSELASHLGMSERTLYRRLKALGLN"
     CDS             51728..52612
                     /codon_start=1
                     /locus_tag="PP4_00440"
                     /product="hypothetical protein"
                     /protein_id="BAN51897.1"
                     /transl_table=11
                     /translation="MIIGNNLHVDAFYDEATSTISYLVMDRETRQCALIDSVLDYDPK
                     SGRTCSASADRLIERVTELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQ
                     VQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLHARALHTPGHTPACMSFMIED
                     AGEIAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTRLFMCHDYLPGG
                     RDMQYVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLDMPVLILPSVQVNMRSGQL
                     PTPEENGVSYLKIPLNKL"
     CDS             52652..53920
                     /codon_start=1
                     /locus_tag="PP4_00450"
                     /product="hypothetical protein"
                     /protein_id="BAN51898.1"
                     /transl_table=11
                     /translation="MPAMLSPANTDHHKVVIVGAGAAGIATASSLVSRDPSLDVALID
                     PADVHYYQPGWTMVGAGVFTAPSTARTMASTIPRGVRWVKARVQGFDPLGQLVILEDG
                     RAISYEQLVVCPGLTLDWAAIDGLSETLGRNGVTSNYRYDLAPYTWELVQKLKQGRAV
                     FSQPPMPIKCAGAPQKALYLSCDHWLRNGHLGAVKASFFNAGAVLFGVADYVPALMKY
                     IEKYAVDLNFSHRLVAVDGPNKRVTFVRTPPDGSSETRIEAFDMLHVVPPQVAPAFIR
                     ESPLADNGGWVDVDPHTLRHRKYTNIHALGDVANTSNAKTAAAARKQAPVVANNVLVA
                     LGRLPTLAQYDGYGSCPLTVERGKIVLAEFTYGGKLAPSFPSWLLDGRKPTRLAWLLK
                     AQALPPLYWQGMLKGREWLARPQLVAEGGQ"
     CDS             53917..54735
                     /codon_start=1
                     /locus_tag="PP4_00460"
                     /product="hypothetical protein"
                     /protein_id="BAN51899.1"
                     /transl_table=11
                     /translation="MIEHQLLGAGLGAIIGAVLALTGAGGGILAVPLLVFGLGLSMVE
                     AAPVGLLAVGMAAAVGAVLGLRQGLVRYRAALFIALIGVAAAPFGLMLAHRLPNTPLQ
                     LVFAGVLVYACLRIWRKAARELRGEANDAHRYIEPCVLNPLQGRLRWTLPCARALAFT
                     GALSGLLSGLLGVGGGFVIIPALNRYTNLRMASIVSTSLAVIALVSTGSVVSASLAGV
                     MHWQVGAPFASGAVLGLLLARPLAAKLAGPRLQQMFAVAGWTAALLLAGKALLG"
     CDS             complement(54724..55611)
                     /codon_start=1
                     /locus_tag="PP4_00470"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAN51900.1"
                     /transl_table=11
                     /translation="MFDWNDLRFFLELQRSGRLLTAAKRLNTTHSTVARHIESIEQSL
                     GTALFVQHAQGYELTPSGQALLKHAEAMENVALLAQEEITQAITPLGKIRLGVTEGIG
                     IMFFTPRMNALFERYPGLEVELVAVPRFVSILNREAEISIHLERPNADLLITRKLTDY
                     RLALYASQGYLDQAPPLRNREDLARHNWIGYVDDLLFSQELLFLNSFCRAPTVVFRST
                     SVIAQQAAARAGLGIAVLPNYMAHDDPTLVRVLPGETIQRSYWICTRRELHKSVRLRV
                     VWDYLLALCAAEQDALLAQ"
     CDS             55852..57498
                     /codon_start=1
                     /locus_tag="PP4_00480"
                     /product="putative oxidoreductase"
                     /protein_id="BAN51901.1"
                     /transl_table=11
                     /translation="MPSADSVFDYVVVGAGPAGCLLANRLSADPSCRVLLLEAGGRDN
                     YPWIHIPVGYLYCIGNPRTDWCFKTEAQPGLGGRALGYPRGKVLGGCSSINGMIYMRG
                     QAADYERWAEQGNDGWAWKDVLPLFKASENHFAGASEHHGGDGEWRVERQRYSWPILD
                     AFRDAAEQSGIGKVDDFNTGDNQGCGYFQVNQRSGVRWNASKAFLRPIKGRANLTVLT
                     GVQVDQVLLNNTRARAVKAFWQGAWHEFASRREIILCAGAVGSPGILQRSGIGPRQLL
                     ESLGIGVRHDMPGVGGNLQDHLQLRLIYQIRNTRTLNQMANSLWGKMGMGLRYIYDRS
                     GPLAMAPSQLGAFVRSGPEQATANLQYHVQPLSLERFGEPLHPFPAFTASVCNLRPVS
                     RGRIDISSTDMNSTPLIDPNYLSDPQDLRVAADAIRLTRRIVQAPALAAFDPKEYLPG
                     PALQTEQELFEAAGKIGTTIFHPVGTCRMGSGALDVVDNQLRVHGIPGLRVADASIMP
                     QITSGNTCSPTLMIAEKAAQLILKGAATQTYLNEDAIPTP"
     CDS             57596..59215
                     /codon_start=1
                     /locus_tag="PP4_00490"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAN51902.1"
                     /transl_table=11
                     /translation="MSDYIQEQDAVASSPSRREERKIIFASSLGTVFEWYDFFLYGAL
                     AAVISKQFFAGVNDTTAFIFALMAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTIVL
                     MGLSTFAVGLLPTYASIGIAAPIILVILRMLQGLALGGEYGGAATYVAEHAPQGKRGF
                     YTGFIQSTATLGLLLSLLVVLGSRYISGDQFETWGWRLPFLLSIVLLAISTWIRMSMH
                     ESPAFVKMKAQGKVSKSPIRESFTSWPNLKVVLTALFSINAGQAVTFYTAQFYVLFFM
                     TQMLKMDPAQANTLLIISVVIGAPFFVFFGWLSDRIGRKPILMLGLLLATVLYFPLFK
                     ALSHYANPQIDAASRQAPIVVTADPQSCTFQFDPVGKARFDSPCDKVKTFLVKQGLPY
                     SSVSVAGSDVVVNIGEKTINGYDEAAMRSAVEQAGYPAKADPGQVNQVMVVVLIVAMI
                     LIATMTYGPLAAVMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFY
                     GLWYPVLVTGISLVVGIFCLKETKDVDLDKV"
     CDS             complement(59393..60163)
                     /codon_start=1
                     /gene="hdtS"
                     /locus_tag="PP4_00500"
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase
                     HdtS"
                     /protein_id="BAN51903.1"
                     /transl_table=11
                     /translation="MSILQAIRIFLFYLLLGTSSLLWCSLSFFIAPFLSFPKRYRFIN
                     VYWCRCALFLVRTILGIDYKVTGAENVPNEPCVILSNHQSTWETFFLSQYFSPLSQVL
                     KRELLYVPFFGWAMAMLRPIAINRDNPKEALRQVASKGDELLKQKTWVLIFPEGTRVP
                     YGTVGKFSRGGTALAVNAGLPVLPIAHNAGKFWPKTGWGKRAGTIEVVIGEPMYANGT
                     GPRAIAELNDRAAAWNEATQRALGSLPPADEKTQQQTA"
     CDS             complement(60225..60752)
                     /codon_start=1
                     /locus_tag="PP4_00510"
                     /product="putative D,D-heptose 1,7-bisphosphate
                     phosphatase"
                     /protein_id="BAN51904.1"
                     /transl_table=11
                     /translation="MKLLILDRDGVINHDSDAYIKTLEEWVPIPGSVEAIAQLSKAGW
                     TVAVATNQSGIARGYYTLATLEAMHARLRELVAEQGGEVGHIVYCPHGPDEGCDCRKP
                     KPGMLVAIAEHYRVALQGVWFVGDSKGDLEAALAVGAQPVLVKTGKGERTLEKGVPET
                     TLIFDDLAAIARELI"
     CDS             complement(60756..62807)
                     /codon_start=1
                     /EC_number="6.1.1.14"
                     /gene="glyS"
                     /locus_tag="PP4_00520"
                     /product="glycyl-tRNA synthetase beta subunit"
                     /protein_id="BAN51905.1"
                     /transl_table=11
                     /translation="MSAQDFLVELGTEELPPKALATLGDAFLAGIEKGLQAAGLNYTG
                     KQVYAAPRRLAVLIRQLDVQQPDRSINIDGPPLQAAFKDGEPTQAALGFAKKCGVDLS
                     EIDQSGAKLRFSQHIPGKSTVGLLPTIVEDSLNDLPIPKRMRWAASREEFVRPTQWLV
                     MLLGDQVVDCTILSQKAGRESRGHRFHHPENVVITTPANYVEDLRKAYVLADFAERRE
                     LISKRTAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQ
                     DNQKYFCLLDSEGKLLPRFITVANVESRDPKQIVQGNEKVVRPRLTDAEFFFKQDKKQ
                     PLETFNERLKNVVFQAQLGTVYDKAERVSRLAAFIAPLIGGDAQRAGRAGLLSKCDLA
                     TEMVGEFPEMQGVAGYYYALNDGEPQDVALALNEQYMPRGAGAELPQTLTGAAVAIAD
                     KLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLNLTGAVEFAVKQFGAK
                     VKAAGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAVQAFRK
                     LPEAEALAAVNKRVSNLLSKAEGAIAEQVEPKYFDNANEFSLYSAIQQADQAVQPMAA
                     ARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVADISLL
                     G"
     CDS             complement(62804..63751)
                     /codon_start=1
                     /EC_number="6.1.1.14"
                     /gene="glyQ"
                     /locus_tag="PP4_00530"
                     /product="glycyl-tRNA synthetase alpha subunit"
                     /protein_id="BAN51906.1"
                     /transl_table=11
                     /translation="MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHT
                     ATFLRAVGPETWNAAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLG
                     SLKAIGLDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYIQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANV
                     DKLFELFDFYESEANRLIKLDLPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARDVAQSYLQARARLGFPMATPELRDEVLAKLEAAQ"
     CDS             63835..64386
                     /codon_start=1
                     /gene="tag"
                     /locus_tag="PP4_00540"
                     /product="3-methyladenine-DNA glycosylase I"
                     /protein_id="BAN51907.1"
                     /transl_table=11
                     /translation="MPRCFWCTDDPLYQAYHDQEWGTPQRDPALLFEMLLLEGFQAGL
                     SWITVLRKRERYRQVMYGFDPVKLAAMSDERIEELMQDAGIIRNRLKLKAARRNAQAW
                     LAVDNPAEWLWSFVDGAPKVNHFTGRSDVPAVTDEAKAMSKALQKAGFTFVGPTICYA
                     FMQATGMVMDHTTDCDRYAALLR"
     CDS             64428..65315
                     /codon_start=1
                     /locus_tag="PP4_00550"
                     /product="putative acyltransferase"
                     /protein_id="BAN51908.1"
                     /transl_table=11
                     /translation="MEKFKGALMVGVLRLFAKLPWGAVQRVGAGIGWLMWKVPNGSRN
                     VVRINLAKCFPEMDPVAREQLVGQALRDIGKSFVESACAWIWPPQRSLELVKEVHGLE
                     VLEQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDDLLREQRVQM
                     GNRVAPSTKEGILSVIKEVRRGGQVGIPADPEPAESAGVFVPFLGTQALTSKFVPNML
                     AGGKAVGVFLHALRLPDGSGFRVILEAAPEAMYSTDVTESAAAMSKVVERYVREYPSQ
                     YMWSMKRFKKRPAGEPRWY"
     CDS             complement(65496..65804)
                     /codon_start=1
                     /locus_tag="PP4_00560"
                     /product="hypothetical protein"
                     /protein_id="BAN51909.1"
                     /transl_table=11
                     /translation="MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGAEAAVHLARCVE
                     QDPKYSAAWKLLGKAHQLQGDLAAARKAWEDGIVAAQAHGDKQAEKEMTVFLKKLNKA
                     "
     CDS             complement(65816..67189)
                     /codon_start=1
                     /gene="trkA"
                     /locus_tag="PP4_00570"
                     /product="Trk system potassium uptake protein TrkA"
                     /protein_id="BAN51910.1"
                     /transl_table=11
                     /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGERLRDLGDRLD
                     IRTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAYSLFHTPTKIARVRES
                     AYLTREELFDNDHIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAEGKAQLVAVKAY
                     YGGPLVGQQLRQIRAHMPNVDTRVAAIFRRDRPITPRGDTVIEADDEVFFIAAKKDIR
                     AVMGELRRIDETNKRIVIAGGGQIGERLAEAIESRYQVKIIEMNPARCRHLSDTLEST
                     VVLQGSASDKDLMLEENIADADIFLALTNDDEANIMSSLLAKRLGAGKVMTIINNPAY
                     VDLVQGGDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSK
                     VVGKAIEDIALPPGTTIGAIIRDEEVMIAHDATVIESGDHVILFVVDKKQIRDVEKLF
                     HVGLSFF"
     CDS             complement(67213..68523)
                     /codon_start=1
                     /gene="rsmB"
                     /locus_tag="PP4_00580"
                     /product="16S rRNA methyltransferase RsmB"
                     /protein_id="BAN51911.1"
                     /transl_table=11
                     /translation="MNPRLAAARALAAVLSGKASLNSSLPAQLDKVDERDRGLTQDLA
                     FGTARWQPRLDLLAAQLLQKPFKAADADVQALLLVGLYQLFYTRIPAHAAIGETVGCA
                     DKLKKPWAKGLLNAVLRRAQREGEELLAGMERDPVVRTAHPRWLQKALKAFWPEQWEA
                     ICAANNAHPPMILRVNRRHHSRDAYLALLAEAGIGASACQYSRDGIVLAEACDVRGLP
                     GFAEGWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLEAEAGLAQMVAIDL
                     EAKRLTRVRENLDRLQLDAELIACDARDTASWWDGKPFQRILLDAPCSATGVIRRHPD
                     IKLTRQADDIPALAALQGELLDALWPTLEVGGMLLYATCSSLPTENTEVVGAFLARTP
                     GARELDLATEAGLRQPHGRQLLAQEGGHDGFYYAKLIKIAASRG"
     CDS             complement(68520..69452)
                     /codon_start=1
                     /EC_number="2.1.2.9"
                     /gene="fmt"
                     /locus_tag="PP4_00590"
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="BAN51912.1"
                     /transl_table=11
                     /translation="MRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLM
                     PSAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQAVLDIPRLG
                     CINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPINADDT
                     GGTLHDRLAEMGPPAVVQAIAGLADGSLHGEVQDDALATYAHKLNKDEARIDWSRPAV
                     ELERLIRAFNPWPVCHSTLDGESVKVLAANLSTGQGAPGEILSASKDGLVVACGDQAL
                     SLTRLQLPGGKALNFSDLFNSRREKFAVGKVLGQ"
     CDS             complement(69513..70019)
                     /codon_start=1
                     /EC_number="3.5.1.88"
                     /gene="def"
                     /locus_tag="PP4_00600"
                     /product="peptide deformylase"
                     /protein_id="BAN51913.1"
                     /transl_table=11
                     /translation="MAILNILEFPDPRLRTIAKPVTEFDDALRQLIDDMFETMYEAPG
                     IGLAATQVNVHLQVVVMDLSEDRSEPRVFINPTVEELTHDMGQYQEGCLSVPGFYENV
                     DRPLRVRVKAQDRDGKPYELECEGLLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKL
                     EKQHRQQA"
     CDS             70226..71323
                     /codon_start=1
                     /gene="dprA"
                     /locus_tag="PP4_00610"
                     /product="DNA protecting protein DprA"
                     /protein_id="BAN51914.1"
                     /transl_table=11
                     /translation="MPSYHSSLCPPAELEARLRLHRLPETGLRRFRTLLDAFGSASSA
                     LSAPGSAWRALGIPQATIDARRSAEVREGALAAMAWLERPGQHLLMWDGPGYPALLAE
                     IDDAPPLLFVAGDRALLDRPQLAIVGSRRATPPALDTARAFSRYLAQAGFTITSGLAV
                     GVDGAAHRAALQAGGCTIAVLGTGLQKLYPQRHQELAQAMIDNGSALVSEYPLDAGPL
                     PGNFPRRNRIISGLSLGVLVVEASLASGSLITARLAAEQGREVYAIPGSIHHPGAKGC
                     HQLIRDGALLVESVEQILESLKGWQNLPPAVVDRFDHPLLALLHAAPQTSESLAHCSE
                     LPLAEVLAQLTELELEGRVSNEAGRWFARAG"
     CDS             71366..71923
                     /codon_start=1
                     /gene="rimN"
                     /locus_tag="PP4_00620"
                     /product="tRNA threonylcarbamoyladenosine biosynthesis
                     protein RimN"
                     /protein_id="BAN51915.1"
                     /transl_table=11
                     /translation="MVSSFRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLL
                     ALKSRPVDKGLILIADNIRQFDFLFEDFPEDWIDRMGSTWPGPNTWLVPHQDLLPEWV
                     TGKHDTVALRVSDHPVVRELCALVGPLISTSCNPGGRPAAKTRLRVEQYFHGQLDLVL
                     GGALGGRKNPSVIRNLATGEVVRPG"
     CDS             72329..72643
                     /codon_start=1
                     /locus_tag="PP4_00630"
                     /product="hypothetical protein"
                     /protein_id="BAN51916.1"
                     /transl_table=11
                     /translation="MKKLVPDPPLPRTSARPFGRCDAGHDPLFTVNPNISAEDALVHV
                     ALYLRSAYETGYKALDYMREEGRGMFWSNLHAIEMAEGVIEAILDGIESTPPPTNRPS
                     QA"
     CDS             complement(72771..73748)
                     /codon_start=1
                     /gene="qor"
                     /locus_tag="PP4_00640"
                     /product="quinone oxidoreductase"
                     /protein_id="BAN51917.1"
                     /transl_table=11
                     /translation="MAKRIQFTQHGGPEVMQLVEFAPTPLGPQQVRVRNHAIGLNFID
                     TYFRSGLYAPPSLPSGLGTEAAGVVEAVGEGVTRLKVGDRVAHAGGPLGAYSEVHTLP
                     EANLVKLPDNISFEQAAAVMLKGLTVQYLLKQTYEVKPGDVILFHAAAGGVGSLACQW
                     AKALGAKLIGTVSSAEKAERAKALGAWATIDYSHEDVAKRVLELTDGKKCPVVYDGVG
                     ADTWLTSLDCLQPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATYANNAENT
                     QAMADDLFAMIDSGKLVVDIQQRYPLSEAAKAQAELSARRTVGSTVLIP"
     CDS             73909..74142
                     /codon_start=1
                     /locus_tag="PP4_00650"
                     /product="hypothetical protein"
                     /protein_id="BAN51918.1"
                     /transl_table=11
                     /translation="MDIEYTMSMILENGEPERVYLPQEQLKYIFEHMEIGTHVWTTNN
                     YDKTGKLIYKDFRGETAHLLISVPDQDSKKSYF"
     CDS             74576..75487
                     /codon_start=1
                     /EC_number="1.3.3.3"
                     /gene="hemF"
                     /locus_tag="PP4_00660"
                     /product="coproporphyrinogen-III oxidase"
                     /protein_id="BAN51919.1"
                     /transl_table=11
                     /translation="MTSRTEAVKAYLLDLQDRICSALETEDGGARFVEDAWVREAGGG
                     GRTRVIGEGKVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPH
                     VPTSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCIHWHRVAEQACAPFGADV
                     YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEWDFDTCFAFIRAIGDAFVNAYLPIV
                     QRRKDTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKAAPGSEEARLTEYFLQDRDWLGQ"
     CDS             75513..76337
                     /codon_start=1
                     /EC_number="1.1.1.25"
                     /gene="aroE"
                     /locus_tag="PP4_00670"
                     /product="shikimate dehydrogenase"
                     /protein_id="BAN51920.1"
                     /transl_table=11
                     /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFS
                     DCARGFFKQGSGGNVTVPFKEEAYRLCDSLTPRAQRAGAVNTLSKLADGTLQGDNTDG
                     AGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVVANRTVEKAEQLA
                     REFDELGPVVASGFAWLQEPVDVIINATSASLAGEMPPIADSLVEAGRTVCYDMMYGK
                     EPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG"
     CDS             complement(76477..78042)
                     /codon_start=1
                     /locus_tag="PP4_00680"
                     /product="putative SulP family transporter"
                     /protein_id="BAN51921.1"
                     /transl_table=11
                     /translation="MHRIIHLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYA
                     LIAGLPAEYGLYAAIVPVLIACLWGSSWHLICGPTAAISIVLYASISPLAVAGSADYI
                     TLVLLLTFLGGIFQLLLGLLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMDL
                     PSQATALKTVQDLASHAGEVDLPSLLLGLATVVIGVAFKLWRPRWPSLLISLMLVSLL
                     AWLLPGLFGHVPRVAAFTGQLPPFSPLPLLDVELMLRLLPSAVAVGMLGLVTSLSIAR
                     SLSARSEQLIDPDQEIRAQGLSNIAGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFS
                     ALWVALFAVTGAGLIAHLPIPAMAGSILLICWGLVDHRGIRALFRVSRSEFLVMTLTA
                     AATLLLELQTAIYAGVLASLFFYLKRTSRPRVQQSREGDADVLRVGGSIFFGAAHYLQ
                     VRLQRCQGPHVVIDARQVNFIDYSGVDMLHREARRLRRLGGSLTLHRARPQVIEELQK
                     LEGVELCPIRFEE"
     CDS             complement(78170..79093)
                     /codon_start=1
                     /locus_tag="PP4_00690"
                     /product="putative amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="BAN51922.1"
                     /transl_table=11
                     /translation="MHKFSAAVFALALGTATAHAADSDAQCSTVKMADPGWSDIASTN
                     AVARLLLESLGYKVKIDSLAVPIIYGGLKDGRVDVFLGNWMPAQQGFHDKFIANGDVQ
                     QLSRNLEGTEFTLAVPDYVWNAGVKDFADLQKHADQFDKKLYGIGSGAPANLSLKAII
                     DKNEFNLGQWKLVESSEQAMLAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLTGGEK
                     WFGSKGEVYTLTRKGYPQACPNAAKLLGNLKFTLDMENAIMAEVVDKKISFDDAARAW
                     VKTYPEVLEGWLAGVTTKADGNALEAVKAKL"
     CDS             complement(79108..80625)
                     /codon_start=1
                     /gene="betC"
                     /locus_tag="PP4_00700"
                     /product="choline sulfatase"
                     /protein_id="BAN51923.1"
                     /transl_table=11
                     /translation="MTRPNILFIMADQMAAPLLPIYAPSPIQMPHLSRLAEQAVVFDS
                     AYCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMH
                     FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCIRTNQLD
                     FDEEVVFKARQYLYDHVRENDGRPFCLTVSMTHPHDPYTIPKRYWDRYEGVDIPMPRA
                     EFNQAELDPHSQRLLKVYDLWNKPLPVDKIHDARRAYFGACSYIDDNIGQLLQTLEEC
                     NLADDTLIVFSGDHGDMLGERGLWYKMHWFEMSARVPLLIHAPKHFAAARVSASVSTC
                     DLLPTLVELAGGTVDNNLHLDGRSLLGHLQGQGGHDEVIGEYMAEGTVGPLMMIRRGP
                     YKFVYSEDDPWLLYDLSRDPHERENLAGSPDHQALLQAFADEARQRWDIPSLRQQVLA
                     SQRRRRLVAEALAIGTLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPAPLD"
     CDS             80734..81633
                     /codon_start=1
                     /locus_tag="PP4_00710"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAN51924.1"
                     /transl_table=11
                     /translation="MFEHLAELSLDTLRVFEAAARLRGFTAAALELGTTQPAVSQQVK
                     RLEAQLGTRLFDRIYRGIELTEAGQLLFEQVHQGLQAMDDGISQASGRGQREVLQVAT
                     DFAFAAFWLMPRLQRFHEAYPQVDVSLVTGERSQGMLRPDIDVAVLFGDGRFHQGESR
                     WLFDEEVFPVCSPRLTDGKPLSAVALQRLPLLHLKGEQASRWFDWAGVFRGFGVASPP
                     PAGQLRFDNYTLLIQAAIAGQGVAIGWRHLVDGLVEQGLLCRPLAGSLRSQRGYYAVL
                     PPRKRRGALIERFVGWLEDERSL"
     CDS             complement(82589..83143)
                     /codon_start=1
                     /locus_tag="PP4_00720"
                     /product="hypothetical protein"
                     /protein_id="BAN51925.1"
                     /transl_table=11
                     /translation="MKNAETPVFKLVLFGPESSLGNALMAELLSRQHEVTAVVDDLNR
                     HTARPGLHFKIGGLDDADQAEQGAAGGSAVIALLSALAPGDLPGQARLSEALVAGLER
                     TTIRRLLLVGDFAVLDEPAKYSEVERECVDHVVDGLQRSALHWTLINTPQALPDEGWA
                     RVAAGMADMLELDLHRGEHLNFVV"
     CDS             83196..83528
                     /codon_start=1
                     /locus_tag="PP4_00730"
                     /product="hypothetical protein"
                     /protein_id="BAN51926.1"
                     /transl_table=11
                     /translation="MQRIKGYHAHVYYDAATMEQARELCEEAARLFPVTMGRMHQKPV
                     GPHPDWSCQLAFGPEVVGVVLPWLALYRKGLVVFMHPETGDELADHRDHAIWMGAVRP
                     LKLSIFGG"
     CDS             complement(83647..84456)
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /gene="trpA"
                     /locus_tag="PP4_00740"
                     /product="tryptophan synthase alpha chain"
                     /protein_id="BAN51927.1"
                     /transl_table=11
                     /translation="MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAG
                     ADVIELGMPFTDPMADGVAIQLATLRALEAGQTLARTLQMVREFRVDNHTTPIVLMGY
                     YNPIHRFGVDAFVAEAKEAGVDGLIIVDLPPEHDAELASPAQAAGIDFIRLTTPTTDD
                     ARLPRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPE
                     QAANIARLADGVVVGSALVDKIAQAKSADQAVSDVLSLCSALAEGVRGARR"
     CDS             complement(84453..85670)
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /gene="trpB"
                     /locus_tag="PP4_00750"
                     /product="tryptophan synthase beta chain"
                     /protein_id="BAN51928.1"
                     /transl_table=11
                     /translation="MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKA
                     DPKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQ
                     VLLAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLL
                     GAEIVPVTAGTGTLKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGK
                     ETRAQLQEKEGRLPDSLVACVGGGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHA
                     ASLNGGVPGVLHGNRTYLLQDADGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVS
                     ITDDEALDAFHASCRLEGIIPALESSHALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQ
                     TVMNHMAAQEKQA"
     CDS             85781..86677
                     /codon_start=1
                     /gene="trpI"
                     /locus_tag="PP4_00760"
                     /product="LysR family transcriptional regulator TrpI"
                     /protein_id="BAN51929.1"
                     /transl_table=11
                     /translation="MAHDLPPLNALRAFEATARLNSVSQAAEALHVTHGAVSRQIKVL
                     EEHLGVALFVKDGRGIKLTDAGVRLRDASGEAFDRLRSVCTELSRDVSEAPFVLGCSG
                     SLLARWFIPRLGRLKADLPELRLHLSAGEGDLDPRRPGLDALLVYAEPPWPADMQVHV
                     LAEERIGPVLSPHFAGFDRLRDAPAKALLEEALLHTTSRPQAWPTWAGQQGLDPAGLQ
                     YGQAFEHLYYLLEAAVAGLGVAIAPQPLVADDLRAGRLSAPWGFSPTRAALALWVPRR
                     AADGRAEQLAQWLRRELERQAG"
     CDS             complement(86674..86997)
                     /codon_start=1
                     /locus_tag="PP4_00770"
                     /product="hypothetical protein"
                     /protein_id="BAN51930.1"
                     /transl_table=11
                     /translation="MHRNSLRKTSLESMEAEIESLLKSLENLKHDASEESQKSVKAIR
                     SNAESALKHSRSLLSDAYEEVKTRTRQTGIATRDYAQEHPVTTAGVALGALGLLAAYL
                     LTRRN"
     CDS             87147..87362
                     /codon_start=1
                     /locus_tag="PP4_00780"
                     /product="hypothetical protein"
                     /protein_id="BAN51931.1"
                     /transl_table=11
                     /translation="MTDHHTYKKIELVGSSPTSIEDAINNALAEAGKSIKHLEWFEVV
                     DTRGHIEGNKAAHFQVTLKVGFRIANS"
     CDS             87464..87685
                     /codon_start=1
                     /locus_tag="PP4_00790"
                     /product="hypothetical protein"
                     /protein_id="BAN51932.1"
                     /transl_table=11
                     /translation="MKKLILALGLMTLAGGALAAGKPCEELKAEIAAKLDAKGVTGYK
                     LEVVNKGEPAGKVIGSCEAGTKEIVYRRG"
     CDS             complement(87784..88788)
                     /codon_start=1
                     /locus_tag="PP4_00800"
                     /product="hypothetical protein"
                     /protein_id="BAN51933.1"
                     /transl_table=11
                     /translation="MTQLRDLKISTLDLVPVRADAGPAQSLRNSLDLAQHVERFGYNR
                     FWVAEHHNMDGIASSATSVLIGYLAGGTSTIRVGSGGVMLPNHAPLVIAEQFGTLASL
                     YPGRIDLGLGRAPGSDQMTAYALRRDRAGGPDDFPDDVEELSRYLGPRTDDQKVIAVP
                     GHDTDVPMWLLGSSLFSAQLAGMRGMPYAFASHFAPRFMHEAIRVYRNHFKPSTTLDK
                     PYVMLGIPMVVAETDEKAEYLATSVYQRILALIRGQSLMQRPPVESMDGLWLPHERDT
                     VGSFLGLAMIGSPQKVKAKVEVLLEQTGADELIFTCDLYEHADRIRSYELLAQALKTA
                     "
     CDS             88943..89368
                     /codon_start=1
                     /gene="osmC"
                     /locus_tag="PP4_00810"
                     /product="osmotically-inducible protein OsmC"
                     /protein_id="BAN51934.1"
                     /transl_table=11
                     /translation="MKKTASAIWQGGLKDGKGLLSTESGALKQNPYGFNTRFEGTPGT
                     NPEELIGAAHAGCFSMALSMMLGEAGLTADRIDTAAEVTLDKLPDGFAITAVHLVLRA
                     KVPGAREAQFLEIANKAKEGCPVSKVLNAKISLDAALVG"
     CDS             89442..89675
                     /codon_start=1
                     /locus_tag="PP4_00820"
                     /product="hypothetical protein"
                     /protein_id="BAN51935.1"
                     /transl_table=11
                     /translation="MIRVAIAVLASLVATSTLAAVKPCEELKAEIEAKIQAQGVPSYT
                     LEIVPNSEVKDQNMVVGTCDGGTKKIIYQKNDR"
     CDS             complement(89785..90198)
                     /codon_start=1
                     /locus_tag="PP4_00830"
                     /product="hypothetical protein"
                     /protein_id="BAN51936.1"
                     /transl_table=11
                     /translation="MRQPMMLIALSALGACASPLPPVDPKQAWVDLYTMTPGRVIMAD
                     RLDGKRLEDGRYFQVTPGKHELVVRFDYEIYSGGIMSEPRDRTCYLTVRFDDFKAGER
                     YRLEARAPVMEPQVLLYDASRKVLVNEPSNVFCIP"
     CDS             complement(90254..90667)
                     /codon_start=1
                     /locus_tag="PP4_00840"
                     /product="hypothetical protein"
                     /protein_id="BAN51937.1"
                     /transl_table=11
                     /translation="MRALLVAGSLLLISACSTLPAPDPNQAWIDLTPYDNTSLDAVQV
                     DERDWADSRYFEVQPGSHELTVRYQFPVTPSNIGPVDEPLWRDCQVKLSFKDFAAGQR
                     YQLHAGSIGFRPWIKLYDDQQKMVGQGLPAGCQRT"
     CDS             90753..91826
                     /codon_start=1
                     /locus_tag="PP4_00850"
                     /product="hypothetical protein"
                     /protein_id="BAN51938.1"
                     /transl_table=11
                     /translation="MQRSGPGALDRVFTRLVPLLGALLLNGCSSVAYYGQLAEGQLQL
                     LRARQPVAQVLADPTTSPQLRSRLAHAEQARVFASQQLKLPDNRSYRVYADIGRPYVV
                     WNVFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAALMRQDGLDVYLGGVEAYS
                     TLGWFDDPILSSMVGWGDERLATLIFHELAHQRFYVQDDTEFNESFASFVEQEGTRQW
                     RAARGLAAVGEEQGQQRDQFIRLVLASRERLQAIYGGPLDDAHKRRAKQAEFERLRRE
                     YRQVRDGQWGGDKRYDAWMYGPMSNAKLLPFGLYDQWVPAFAAVFREVGGDWLRFYQR
                     VEQLGRLPIEERKAALQRLVVSL"
     CDS             complement(91959..92609)
                     /codon_start=1
                     /locus_tag="PP4_00860"
                     /product="putative hydrolase"
                     /protein_id="BAN51939.1"
                     /transl_table=11
                     /translation="MQQQNILFDLDGTLTDPRLGITRSIQYALAKLGIDEPDLARLEH
                     FIGPPLLQAFMQFYSFDEAKAWEAVNFYRERFRVTGLYENLVFQGVPELLEALNGQGR
                     TLYIATSKPWEFAREIARHFAFDQHFKVIYGSELDGTRTNKVELIRHLLDEEGLDPAQ
                     TLMIGDRKHDLIGARSNGLQAVAVGYGFGSQEELMAEEPAYHFATLAEMHQAFIKA"
     CDS             complement(92731..93279)
                     /codon_start=1
                     /locus_tag="PP4_00870"
                     /product="hypothetical protein"
                     /protein_id="BAN51940.1"
                     /transl_table=11
                     /translation="MAIRSFQQHTPKVGLRAFVDRSAVVLGDVEIGEDSSIWPMTVVR
                     GDMHRIRIGARTSVQDASVLHITHAGPFNPDGFPLIIGDEVTIGHKVMLHGCTLGNRI
                     LVGMGSTIMDGAIVEDEVIIGAGSLVPPGKRLVSGYLYMGSPVKQARLLNDKERAFFS
                     YSAGNYVKLKDQHLAEGYDQPE"
     CDS             93346..95433
                     /codon_start=1
                     /gene="prlC"
                     /locus_tag="PP4_00880"
                     /product="oligopeptidase A"
                     /protein_id="BAN51941.1"
                     /transl_table=11
                     /translation="MGQCFFCQGIQTVTANNPLLQSHDLPPFSQIRAEHVLPAIEAIL
                     ADNRKAIAEILEKQGKAPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYE
                     SCLPALSAYSTELGQNRALFEAYQALINSPEAAGFDVAQKTILEHALRDFRLSGIDLP
                     ADKQQRYAEVQSKLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQ
                     AKGLDGWLITLEFPSYYAVMTYASDRALREEVYAAYCTRASDQGPNAGQFDNGPVMQE
                     ILDLRQELAALLGYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLEQLKAY
                     AAEQGCPELASWDAGYFGEKLREQRYSVSQEALRAYFPIDKVLGGLFSIVQRLYGIEI
                     AELKVFDSWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGEL
                     QSPVANLVCNFTPAAPGKPALLTHDEVTTLFHEFGHGLHHLLTRIEHAGVSGINGVAW
                     DAVELPSQFMENWCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLE
                     FSLFDFELHASHGDGRSVLQVLEGVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYS
                     YKWAEVLSADAFSRFEEEGVLNAETGRAFREAILARGGSREPMVLFVDFRGREPSIDA
                     LLRHSGLTEGAAA"
     CDS             95430..95711
                     /codon_start=1
                     /locus_tag="PP4_00890"
                     /product="hypothetical protein"
                     /protein_id="BAN51942.1"
                     /transl_table=11
                     /translation="MSEVVVNKTKKRFIAGAVCPACSEPDKLMMWSEDDVPHRECVAC
                     GFTDTLNEQGLSVPKELGTRVNHLAPKAAPAKVQTVQFFPNPKLKKPTE"
     CDS             95792..96850
                     /codon_start=1
                     /locus_tag="PP4_00900"
                     /product="hypothetical protein"
                     /protein_id="BAN51943.1"
                     /transl_table=11
                     /translation="MNPPAPLKGRGTAHNPHNRFAPNHSVVEDDGWYQEVPQTQGTEV
                     RSETAKSVISRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLI
                     AKTNAAEVLAQQLSKPGYVCAPINLGSNTDPYQPIEREQLLTRRLLEVLLRFRHPVTI
                     VTKGSLVLRDLDLLAEMARQRLARVMISLTTLDDDLKRVLEPRAASPSARLRAIRVLR
                     EAGVPVGVLCSPMIPMINDSELERLLEAAREAGAQSAAYMMLRLPLEVAPLFEQWLQD
                     HYPQRAAHVLSLIRQSRGGELYDSRFGARMRGEGVFAELLAQRFAKAMKRLDFEGREA
                     QTLDCSAFCPPNGQMALF"
     CDS             97272..97991
                     /codon_start=1
                     /gene="cynT"
                     /locus_tag="PP4_00910"
                     /product="carbonic anhydrase"
                     /protein_id="BAN51944.1"
                     /transl_table=11
                     /translation="MPVKDPSKVVPEVPAEGADAALKHIVDGFLRFHHDVFPEQQELF
                     KKLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAI
                     EYAVLALKVHHIIVCGHSDCGAMRAVLNPQSLTKMPTVSAWLRHAEVARTVVENNCSC
                     GTEHETMQVLTKENVIAQLHHLRTHPSVASRLAAGELFIHGWVYDIETSKIEAYDAIS
                     DSFLPLAAGEPVPCATPRGRY"
     CDS             98182..99714
                     /codon_start=1
                     /locus_tag="PP4_00920"
                     /product="putative SulP family transporter"
                     /protein_id="BAN51945.1"
                     /transl_table=11
                     /translation="MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLI
                     TGIIGGIVVGFLAGSPLQVSGPAAGLAVLVFELVRQHGMAMLGPILLLAGLLQLLAGR
                     LRLGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLLEFPSTVAAAL
                     PQENAGSGWMAGALGLGTIAIMWGWERLRPQRLRFVPGALLGVAAMTAISMWLALPVN
                     RVQVPADLSEAIDWLRPADLMQLADPTLLVAAFALAFIASAETLLSAAAVDRMHSGQR
                     SDFDRELSAQGIGNMLCGVLGALPMTGVIVRSSANVQAGAQTRASAIFHGLWLLAFVV
                     VLSSVLQQIPVASLAGVLVFTGVKLVDFKAFRGLGRYGRMPMFTYAATALAIIFTDLL
                     TGVLLGFALTLLKLAFKAARLKINLVSLAKDGHMELRLSGAATFLKVPALTQVLDTVP
                     AGTTLHVPLGNLSYIDHSCLELLEDWNRSNAANGSRLLIEQRRLKRRIEGRLRTTAGV
                     GA"
     CDS             complement(99841..100482)
                     /codon_start=1
                     /locus_tag="PP4_00930"
                     /product="hypothetical protein"
                     /protein_id="BAN51946.1"
                     /transl_table=11
                     /translation="MNIAAVREQVSQAHQHEGQTGQLKQRLELQLPHLHPSIQLPEQD
                     AQGTLARFVSAYIDQVPELLEAAHAVAREAGIESQIKPVLKIAEAYFLQPPSVMQGHV
                     GLDCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPVDTTVANLIAHQLIGESFANQLDEV
                     VHHSVDEMLNDESFAVESVEAYREKLSSPATGEAWKRWPCLSRQLGVELGQPA"
     CDS             100851..101978
                     /codon_start=1
                     /gene="coxB"
                     /locus_tag="PP4_00940"
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="BAN51947.1"
                     /transl_table=11
                     /translation="MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHM
                     TIFWICVIIGVVVFGAMFWSMVVHRRSTGQQAAHFHEHTWVEIMWTVVPFLILVVMAI
                     PATKTLIDIYDASESDIDIQVTGYQWKWHYKYLGQDVEFFSNLATPTDQIHNKAPKDE
                     HYLLEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWTRIEKPG
                     IYRGQCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVE
                     RGDKVYHTTCVACHQAEGQGLPPMFPALKGSKIATGPKEGHLSIVFHGKPGTAMAAFG
                     KQLSEVDIAAVVTYERNAWGNNKGDMVTPKDVLALKQAEAK"
     CDS             102022..103611
                     /codon_start=1
                     /gene="coxA"
                     /locus_tag="PP4_00950"
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="BAN51948.1"
                     /transl_table=11
                     /translation="MSTVIDDHAHGHEHAHGPAKGLMRWVLTTNHKDIGTMYLWFSFI
                     MFLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIP
                     LMIGAPDMALPRMNNFSFWLLPAAFLLLVSTLFSPGGGPNFGWTFYAPLSTTYAPASV
                     TFFIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPV
                     LAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIP
                     AFSRKPLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGV
                     KVFNWVSTMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAH
                     FHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFIGMNMAFFPMHFVGLA
                     GMPRRIPDYNLQFADFNMVSSIGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEG
                     LEWSIPSPAPYHTFQTPPEVK"
     CDS             103622..104188
                     /codon_start=1
                     /gene="coxG"
                     /locus_tag="PP4_00960"
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="BAN51949.1"
                     /transl_table=11
                     /translation="MNGLSLKRLVTRLLMLTVVMFAFGFALVPIYDVMCKAFGINGKT
                     GGQYEGSQVSDPSRSVRVQFMSTNASDMVWDFYSTADQLEVNPGAVNQMIFVAHNPTD
                     RPMSAQAIPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPASVKHL
                     TLAYTLFDITARHPPVAHVAAQDVQGAR"
     CDS             104205..105092
                     /codon_start=1
                     /gene="coxC"
                     /locus_tag="PP4_00970"
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="BAN51950.1"
                     /transl_table=11
                     /translation="MASHQHYYVPAQSKWPIIATIGMFITVFGLGTWFNDMKAGHPES
                     HGPLIFFVGALFLAYMLFGWFGAVVKESRAGLYSPQLDRSFRWGMSWFIFSEVMFFLA
                     FFGALFYVRVLAGPWLGGDGAKGVAHMLWPTFEFTWPLLHTPDPKLFPPPKEVIDPWH
                     LPLINTILLVSSSVTITIAHHALRRDHRGPLKFWMALTILLGLSFIALQAFEYHEAYT
                     KLGLTLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPEKHFGFEAASW
                     YWHFVDVVWVGLFIFVYVL"
     CDS             complement(105204..105407)
                     /codon_start=1
                     /locus_tag="PP4_00980"
                     /product="hypothetical protein"
                     /protein_id="BAN51951.1"
                     /transl_table=11
                     /translation="MLKAAIVLMLLATIASLFSGLVFLVKDDENSTRLLKALTVRVTL
                     AALTIALVAWGLLSGQLVSHAPF"
     CDS             105495..106196
                     /codon_start=1
                     /locus_tag="PP4_00990"
                     /product="hypothetical protein"
                     /protein_id="BAN51952.1"
                     /transl_table=11
                     /translation="MVLALLPGLVALGCWQLGRAEEKRALLATYAERRIEAPITTAQL
                     ASRDDNAFRRVHLYGRFDAEHSVLLDNRMRDGQAGVELLQPFHDQASGQWLLINRGWL
                     PWPDRRVPVHFDTPAHALALDASVYVSPGSTFQLHPDPEGGQWPHLLTAVDAAQLWPA
                     LGREGFAHELRLEPGPAAYRLDWPVVAMGPEKHLGYAVQWFALAGALVLLYLYFGWHH
                     NKEKRHGHRHSTGRA"
     CDS             106165..106746
                     /codon_start=1
                     /locus_tag="PP4_01000"
                     /product="hypothetical protein"
                     /protein_id="BAN51953.1"
                     /transl_table=11
                     /translation="MATATPLDVPERSKPRARGRLQLLLILLVVLGPMILATSMYKLK
                     FWVPEGRSYHGDMIGNGESRTDIGVSGEDERWQLLVSAPEACAEDCQRLVYLARQIQV
                     GLGRDTSRASHALATAQPLSADYQALLGREYPQLQRYPLDAPRYLQKVGEPGPQLWIV
                     DPHGNLVLRYDGKANGKHVLDDLRHLLKLSNIG"
     CDS             106756..107835
                     /codon_start=1
                     /locus_tag="PP4_01010"
                     /product="hypothetical protein"
                     /protein_id="BAN51954.1"
                     /transl_table=11
                     /translation="MARPGFRIAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGF
                     ISVPKSEAQLAHAELHFPDHPVEEAKGWAEMVHRYFAGTLAMVIALLAFQALRRHARD
                     GQPYRLPVLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRA
                     FAPLPKLPLSLRRIAALALLVVVGQIALGGWVSANYAAVACIDLPTCHGQWWPAADFS
                     NGFHLTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTCVLLMLSWKLYRCGLPGLAR
                     LVLLALALQVGLGISNVVFHLPLAVAVAHNAGGALLLLSMVLVNYRIRVVDKVRVGVG
                     QGWRLRPVAGVGISHHMRNDSWRRF"
     CDS             107820..108713
                     /codon_start=1
                     /EC_number="2.5.1.-"
                     /gene="cyoE"
                     /locus_tag="PP4_01020"
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="BAN51955.1"
                     /transl_table=11
                     /translation="MATLLSARRANWRDYLELTKPKVVVLMLITSLAGMFLATRAGVG
                     WSVLLFGNLGIGLCAGAAAVVNHVVDRRIDALMARTHKRPLAQGRVEPLPALLFALAL
                     ALLGMALLLAFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGW
                     VAVSGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHI
                     LLYTLILLAVSLLPYAIHMSGPLYLACALALGLRFLQWAWVLYRGSRPHAAIGTFKYS
                     IGYLFALFIALLLDHYLLLNL"
     CDS             108710..109342
                     /codon_start=1
                     /locus_tag="PP4_01030"
                     /product="hypothetical protein"
                     /protein_id="BAN51956.1"
                     /transl_table=11
                     /translation="MTRTQKTVFILVALVALILGLTVNKVLNGRDQPNPAELIDAGII
                     LLPQSRTVADVTMTNQDGQPVQLDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSEL
                     PKEAVDRLQVVLVSVDPNRDTPNQLKQYLGYFDKDFVGVAGSIEDTQKLANTLSIPFI
                     PADTSKPGYTVDHSGNLAVVGPDGRQRGFIRAPFNNQKLVAQLPGLVKRD"
     CDS             complement(109465..110235)
                     /codon_start=1
                     /locus_tag="PP4_01040"
                     /product="putative D-methionine ABC transporter
                     substrate-binding protein"
                     /protein_id="BAN51957.1"
                     /transl_table=11
                     /translation="MKKLLAVAAAVAAFSAHADTLTVAATPVPHAEILNFVKPQLAKE
                     GVELKVKEFTDYIQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTNLVSVAGVHIEPLG
                     VYSTKIKKLDELSSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKNILSTVKDVAEN
                     PKNVKFRELEAATIPRVLTQVDAALINTNYALEAKLNPEKDALAIEGSDSPYVNILVA
                     RPDNKDSEDMKKLAAALHSPEVKQFIIEKYKGAVVPAF"
     CDS             complement(110300..110971)
                     /codon_start=1
                     /locus_tag="PP4_01050"
                     /product="putative D-methionine ABC transporter permease
                     protein"
                     /protein_id="BAN51958.1"
                     /transl_table=11
                     /translation="MDALNFFANVDWAEIWLATIDTMIMLFGSLFFTVLLGLPLGVLL
                     FLCGPKQMFEQKGVYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPL
                     VVGATPFFARLVETALREVDRGIIEATQSMGATTRQIITSALLPEARPGIFAAITVTA
                     ITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQSVGDKLVV
                     HFSRK"
     CDS             complement(110971..111978)
                     /codon_start=1
                     /locus_tag="PP4_01060"
                     /product="putative D-methionine ABC transporter
                     ATP-binding protein"
                     /protein_id="BAN51959.1"
                     /transl_table=11
                     /translation="MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGK
                     STMLRLINRLEEPSGGKIIVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADN
                     VALPLTLAGELSRSEIDKRVTELLARVGLQDHAKKYPAQLSGGQKQRVGIARALSTNP
                     KILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDCVAVMDAG
                     QIVEQGSVADVFLHPQHPTTKRFVQEDEQVDEGEQRDDFAHVPGRIVRLTFQGDATYA
                     PLLGTVARETGVDYSILAGRIDRIKDVPYGQLTLALIGGDMEAAFARFKAADVHMEVL
                     R"
     CDS             112206..114350
                     /codon_start=1
                     /gene="katE"
                     /locus_tag="PP4_01070"
                     /product="catalase HPII"
                     /protein_id="BAN51960.1"
                     /transl_table=11
                     /translation="MPSKKTDAPKQGEAAGTQTPDRANTNAKLQSLEADRSDATGHAL
                     RTNQGVRIADNQNTLKAGDRGPSLLEDFIMREKITHFDHERIPERIVHARGTGAHGFF
                     QSYGNHAELTKAGFLQDPEKITPVFVRFSTVQGPRGSGDTVRDVRGFAVKFYTDEGNF
                     DLVGNNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVM
                     WAMSDRAIPRSLRMMEGFGVHTFRLINAEGVASFVKFHWKPSQGVHSLLWDEAQKLAG
                     KDTDFQRRDLWEAIETGDYPEWELGVQIVPEADEHKFDFDLLDPTKIIPEELVPVTPL
                     GKMVLNRNPDNFFAEVEQVAFCPGHIVPGIDFTNDPLLQGRLFSYTDTQLSRLGGPNF
                     HQIPINRPVAPNHNNQRDALHQHTVHRGRASYEPNSIDGGWPKETPPAAQDGGFESFQ
                     ERIDAHKIRQRSDSFGDHFSQARLFFQSMSPTEQQHIIKAYSFELGKVEREAIRAREV
                     NEILANIDLKLAAAVAANLGLPAPKAGTVQVKGSKLAESPALSQMNHPGVVGIKGRKI
                     AVLLADGVDAGSVDRLVKALEAHSARIMLLGPTSAPVKAAGGKALPVDASMEGMPSIM
                     FDGVLVPAGKAALDALGASGLAKHFLLEAYKHLKAIGFAKEGKVLVDALGLKEDKGLL
                     LGDDQKTLDAFVKAVEGHRVWEREAAAEAVPA"
     CDS             complement(114461..115168)
                     /codon_start=1
                     /locus_tag="PP4_01080"
                     /product="hypothetical protein"
                     /protein_id="BAN51961.1"
                     /transl_table=11
                     /translation="MKPFASRYLLVAAFSLLLAACSSAPVEQAPAPAQADAWQQLQQN
                     IASNELATAEDQLAALQAQSPDDARLEQYQRQLAEAYLQRSQIVLQKGDVNAAATALA
                     RARALMPQAPAVTGGDPLSQARKAELEKAEAALKAAEAKPTARIIDPTAPSTVVALKT
                     TDSRAMRRQLDDIAADVVSYDCEVVFQVPRTDDAPWLKTLLEKRVRKIDSGFQLKQKH
                     EIQRSLPAQVVLVPHQR"
     CDS             complement(115296..116078)
                     /codon_start=1
                     /gene="znuB"
                     /locus_tag="PP4_01090"
                     /product="zinc ABC transporter permease protein"
                     /protein_id="BAN51962.1"
                     /transl_table=11
                     /translation="MADFLLYALLAGLSLALVAGPLGSFVVWRRMAYFGDTLSHAALL
                     GVAMGFALDVSPALAVTIGCLLLAILLVTLQQRQPLASDTLLGILAPSTLSLGLVVLS
                     FMHDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLVLLAALWRPLLAVTVHEELATV
                     EGLPVAGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAVGAS
                     LLGVTAVCCGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPKR"
     CDS             complement(116071..116844)
                     /codon_start=1
                     /gene="znuC"
                     /locus_tag="PP4_01100"
                     /product="zinc ABC transporter ATP-binding protein"
                     /protein_id="BAN51963.1"
                     /transl_table=11
                     /translation="MSDALIRLEQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGK
                     TTLVRAVLGLLKPHRGKVWRKPKLRIGYMPQKIQVDATLPLSVLRFLRLVPGVDRAAA
                     LSALQEVGAEQVIDSPIQTISGGEMQRVLLARALLREPQLLVLDEPVQGVDVVGQTEL
                     YNLITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELF
                     GQTAPSLAIYHHHHDHSHDLHGSVVAPGTHVHGEHCKHG"
     CDS             complement(116841..117326)
                     /codon_start=1
                     /gene="np20"
                     /locus_tag="PP4_01110"
                     /product="transcriptional regulator np20"
                     /protein_id="BAN51964.1"
                     /transl_table=11
                     /translation="MSITPLANRPHDHSHCVHSALAEADALCTRQGLRLTALRRRVLE
                     LVWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFIGCSH
                     PEHVHQGQFLICRACHVAIELEQSSISDAIINSAKDVGFTVETQTVEVVGLCGSCRSA
                     A"
     CDS             117345..118301
                     /codon_start=1
                     /gene="znuA"
                     /locus_tag="PP4_01120"
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="BAN51965.1"
                     /transl_table=11
                     /translation="METLLCYLFLTTRVSTVSRFLALFVAFIAFSAQADVRVLTSIKP
                     LQQIAAAVQDGVGSPDVLLPPGASPHHYALRPSDVRRVGDADLLYWIGPDMESFLPRV
                     LGSRSKPTVAVQSLTGMKLRHFGEDSHSHEEEDHDDHDHDHRPGSLDAHLWLSSVNAR
                     VIAAKMAADLAQVDPANAARYQSNLKAFDERLDALDGRIKARVEGIADRPYFVFHEAF
                     DYFEAEYGLKHTGVFSVASEVQPGAQHVAAMRKRLQEVGKTCVFSEPPLRPRLAETLT
                     AGLPVRLAELDALGGTDPVDGKGYERLLEKLGGDLAGCLEQL"
     CDS             complement(118475..119425)
                     /codon_start=1
                     /EC_number="2.7.1.39"
                     /gene="thrB"
                     /locus_tag="PP4_01130"
                     /product="homoserine kinase"
                     /protein_id="BAN51966.1"
                     /transl_table=11
                     /translation="MSVFTPVTRPELETFLAPYELGRLLDFQGIAAGTENSNFFVSLE
                     QGEFVLTLIERGPSEDMPFFIELLDTLHDADMPVPYAIRDRDGNGLRELCGKPALLQP
                     RLSGKHIKAPNNQHCAQVGELLAHIHLATREHIIERRTDRGLDWMLASGAELLPRLTA
                     EQAALLQPALDEITAHKAQILALPRANLHADLFRDNVMFEGTHLTGVIDFYNACSGPM
                     LYDIAITVNDWCLDEKGAVDVPRAQALLAAYAALRPFTAAEAGLWPEMLRVGCVRFWL
                     SRLIAAESFAGMDVMIHDPSEFEVRLAQRQQVALHLPFAL"
     CDS             complement(119495..119782)
                     /codon_start=1
                     /locus_tag="PP4_01140"
                     /product="hypothetical protein"
                     /protein_id="BAN51967.1"
                     /transl_table=11
                     /translation="MRTLNRLLLLGLLATTPVVTLAADDAPSADPEVTIRTEGDKTIQ
                     EYRQNGFLYAIKITPKNGKPYFLVRADGTDANFIRSDQPDMLIPSWKIFEW"
     CDS             119858..122605
                     /codon_start=1
                     /gene="polA"
                     /locus_tag="PP4_01150"
                     /product="DNA polymerase I"
                     /protein_id="BAN51968.1"
                     /transl_table=11
                     /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLK
                     SLRKQYPDSLFAVVFDAKGGTFRDAMFAEYKANRPSMPDDLRVQVEPLHASVRALGYP
                     LLCVEGVEADDVIGTLARSSAAQGRPVIISTGDKDMAQLVDGHITLVNTMTGSVLDVA
                     GVHEKFGVGPEHIIDFLALMGDKVDNIPGVPGVGEKTAVGLLTGIGGGLSDLYANLDK
                     VPALAIRGAKTLPAKLEEHRDAAFLSYELATIKVDVPLDVEVEALVCGEPDRDALLAL
                     YTEMEFKSWVAEVQRDAARAGTEVAPVAEPTAKVEPQYETVLDQARFDAWLEKLRQAP
                     LFAFDTETTGLDAQKAQLVGLSFAVAPHEAAYVPLAHDYEGAPAQLDREAVLLALKPL
                     LEDPAKAKVGQNAKYDINILANGSPAIEMRGVAYDTMLESYVLNSTATRHDMDSLAQK
                     YLDHTTIAFEDIAGKGAKQLTFNQIHLDKAGPYAAEDADITLRLHQALQTRLAQTPGV
                     LPVLMDIEMPLVPVLAKIERQGALVDAALLHVQSGELGVKMAELELRAYELAGEEFNL
                     GSPKQLGSILYDKLGMPVLSKTAKGQPSTAEAVLDELALLGYPLPEVLMQYRSLSKLK
                     STYTDKLPGQINPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFIA
                     SPGYKLLAADYSQIELRIMAHLAKDEGLLHAFRNDLDVHRATAAEVFGVALEDVTTDQ
                     RRKAKAINFGLIYGMSAFGLAKQIGVDRKQSQDYIDRYFARYPGVLAYMERTRAQAAE
                     QGFVETLFGRRLYLPDINAKNPALRKGAERTAINAPMQGTAADIIKRAMVNVDNWLSE
                     SGLDARVILQVHDELVLEVREDLVQQVKDEIRQHMSQAAQLDVPLLVEAGIGANWDEA
                     H"
     CDS             complement(123031..123663)
                     /codon_start=1
                     /gene="engB"
                     /locus_tag="PP4_01160"
                     /product="putative GTP-binding protein EngB"
                     /protein_id="BAN51969.1"
                     /transl_table=11
                     /translation="MQVKNPILGLCQKATFALSAAKVEQCPEDQGYEVAFAGRSNAGK
                     SSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKH
                     LEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASRMPMHILLTKADKLTHGAGK
                     NTLLKVQSEIRKGWGDGVTIQLFSAPKRLGVEDAYRVLAGWMELEDKPVA"
     CDS             123865..124167
                     /codon_start=1
                     /locus_tag="PP4_01170"
                     /product="putative cytochrome c"
                     /protein_id="BAN51970.1"
                     /transl_table=11
                     /translation="MAKWLLAVGMFLPVFSAQATQDPEVLYNRTCAACHTGQLPQAPR
                     QGDRAAWEPRLAQGMDVLVKHVTQGFKAMPPRGLCMDCSAEDYRLVILWMSGSPDT"
     CDS             124199..124816
                     /codon_start=1
                     /locus_tag="PP4_01180"
                     /product="cytochrome c4"
                     /protein_id="BAN51971.1"
                     /transl_table=11
                     /translation="MNKLVVSLLLTLGVAGAATAAQTVKGDAAAGQAKTAVCGACHNP
                     DGNSLAPNFPKLAGQGQRYLEKQLHDIKSGKRTVLEMTGMLTAFSDQDLADIAAYFSS
                     QKGSVGAADPKLVERGRSLFNGGDLEKGMPACTGCHSPNGAGIALAGFPHLSGQHSQY
                     VTKQLTDFREGNRTNDGDAMTMRTIAGKLSNHDIEALASYIQGLH"
     CDS             124968..125600
                     /codon_start=1
                     /gene="dsbA"
                     /locus_tag="PP4_01190"
                     /product="thiol--disulfide interchange protein DsbA"
                     /protein_id="BAN51972.1"
                     /transl_table=11
                     /translation="MRKLILSAALVAASVFGMTAVQAAEPVAGKEYLELSNPVPVSVP
                     GKIEVVELFWYGCPHCYHFEPTINPWAEKLPADVNFKRVPAMFGGPWDAHGQMFLTLE
                     AMGVEHKVHAAVFDAIQNQKKRLTDPQDMADFLATQGVDKDKFLATFNSFAIKGQVNQ
                     AKELAKKYEITGVPSLVVNGKYRFDLGTAGGPEGVLNVADQLIAKERAAK"
     CDS             125613..126467
                     /codon_start=1
                     /locus_tag="PP4_01200"
                     /product="hypothetical protein"
                     /protein_id="BAN51973.1"
                     /transl_table=11
                     /translation="MPRFRTTRGIGLHQPQVNEHHLQASGLPEDGRLRLLSFNIQVGI
                     STERYRHYLTRSWQHLLPHNGRAGNLQKIGDLLGDFDLVALQEADGGSLRSGYVNQVE
                     HLAHLGAFPYWYQQLNRNLGRFAQHSNGVLSRLKPQALEDHPLPGPAGRGAILVRFGE
                     GEDALIVVMMHLALGAKTRALQLGYIRELIGGYRHQVLMGDMNTHATDLLEHSPLRDL
                     GLIAPQVEATFPSWRPQRCLDHILLSPSLTLERVEVLARPISDHLPVAVEIRLPDALT
                     VDTLPVLS"
     CDS             126495..128420
                     /codon_start=1
                     /locus_tag="PP4_01210"
                     /product="putative GGDEF domain protein"
                     /protein_id="BAN51974.1"
                     /transl_table=11
                     /translation="MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAA
                     EGSDKVVDACMKEMREVIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTV
                     LVGQLQGLPLPSDISRPLKKLAKKLDGGVAQSRDLPPLLGELSGLQGLALSALGKPGD
                     ETRPGFLQRLFGSREDEPQGEPAPAPAAVPAADAPPAAQHSIYAPQPDDVDALQPLSA
                     SSAEATVTPEPELEVSGPALIETIDAPAAQPLPQEEAPEPEAAVSEPLAEVQPAQPLE
                     ETFGEDGPYALPYAVEPPYSQVAAHIEKTLIGLLDDLSLPERHKAQALDMRERVARGL
                     NWYELIPVLDDLAVLMLAITDSGQHEFETYLQQLNERLEGFQSHLHEASAGHADNSSA
                     ARELDTQLREHVDGLQSSVQGAADVDSLKHILENRLEGLLVTMDEHKHERDRREQELA
                     GRLQGLSERVANMEHEALGYREHLEEQRQKALLDPLTGLPNRAAWSERVEREIIEWQE
                     NGGHLAMAILDLDHFKRINDSYGHLAGDKVLKIVADQLRKRLRGRDFIARFGGEEFVL
                     LLPQTSPAAAAQMAETMRATVEACPFHFKGERVVITTSIGLGAFRSGERGDQVLKRAD
                     AALYRAKEQGRNRVEQN"
     CDS             128500..129288
                     /codon_start=1
                     /locus_tag="PP4_01220"
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="BAN51975.1"
                     /transl_table=11
                     /translation="MLSTLKKTLISFLLLSVAGCSTGLRIDRSHPSANQDNRIQFVVL
                     HYTNASLERSLALLTHGEVSSHYLIGDGPATVYQLVDENRRAWHAGDSQWQGRTWLNS
                     SSIGIEIVNPGFTDTPNGRVWHPYSEAQVQSLIALLKDIVKRNNIEPRHIIGHSDIAP
                     SRKLDPGPLFPWKRLADAGLGIWPDANAVARQQAYFSVNPPSIGWYQQELARFGYQIE
                     QTGVLDVATRHVITAFQMRFRPQRFDGMPDAQTAAMLQVLNRMR"
     CDS             129577..131181
                     /codon_start=1
                     /locus_tag="PP4_01230"
                     /product="hypothetical protein"
                     /protein_id="BAN51976.1"
                     /transl_table=11
                     /translation="MSAIITLLRQIFYRPWMLATLAALASAALLLSASIGIALQQMKQ
                     SESEQMNAQGERFLDRLEQVFGQLREGVDLLQAQPLRGCSPAMLAALQQVGLSSRFIY
                     EAAYVDGDIACSNRGDERAFEPLRAPDIQGPTYSYWLNTTTEPNENLAALMLGRGQFV
                     VSTSRGHLTDVVDLPPGGSLVVVLDNGARAIPVLGPPQVWPPPSAWSTSHKSLLELSD
                     RLIYRMPTKSPDYQLVLIAPRASLPLRMNGMLWLLFPGSVLAACCIGWLVLQLILQRR
                     SMSSELQHALRRGELQVLYQPIFELDSRRCVGAEALVRWRRPDGTLTSPDLFIPLAEN
                     TGQIRQITDFVLQRVLEQLGQLLRSHPKLYISVNLAACDVMVPRIGRVAARLLALHRV
                     APSQIAFEVTERGLVDVVVARDNLQSLRASGHQVLIDDFGTGYCSLAYLQTLPVDCLK
                     IDKAFIDALGHDAASSGVAPHIIRMAHDLHLRVIAEGIECEDQAVLLNSEGVNYGQGW
                     LFARPLNARQFAELVTRGQLPRRAEH"
     CDS             complement(131220..133001)
                     /codon_start=1
                     /gene="kinB"
                     /locus_tag="PP4_01240"
                     /product="two-component histidine kinase KinB"
                     /protein_id="BAN51977.1"
                     /transl_table=11
                     /translation="MKWPPMKLRTRLFLSISALVTVALLGLLLGLVSVLQMATVQQQL
                     VRETTHALEVGLKLRQNLGEQLTLILDEDTAPESLRLLQENFQALLNQGLEQGGERTG
                     FSKASSNYQTFLQAYRDSAAPARSMGVDQPLGAAFNQVRSDLIDSHRQALDLITRSEE
                     RTRDRALLVSGVLGLMGLVVLVLGFITAHNIARRFGQPIEALAIAADQLGKGNFDVTL
                     PVTQATELNQLTRRFGLMADALRKHQATNVDELLAGQQRLQAVLDSIDDGLLIIDRQG
                     RLEHLNPVAQRQLGWNHSRVGSSLAEALQRPELEQQLRQVLRGGSLDRPPDDLNMEVD
                     EEARLLTYSLTPVSHPQGPILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGM
                     HMAFGLLRERVKFPAEARENDLLETIGEEMQRLTQLINDLLNFSRYQSGLQKLDLAPC
                     ALDELLERAQLRFAEQAAHKQIELTKELEPPLPRLRADAAQLDRVLDNLLHNAIRHTA
                     NGGRIRLHARRHAERVIISVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKE
                     IVQLHGGRMGVFSRPGQGTQFYMALPV"
     CDS             complement(132998..134344)
                     /codon_start=1
                     /gene="algB"
                     /locus_tag="PP4_01250"
                     /product="alginate biosynthesis transcriptional regulator
                     AlgB"
                     /protein_id="BAN51978.1"
                     /transl_table=11
                     /translation="MESAQDNQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQA
                     ETLLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAIDTAVDAIQAG
                     AADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEVRKPKDGLDSHTPAMMAVLET
                     ARQVATTDANILILGESGTGKGELARAIHGWSKRARKACVTINCPSLNAELMESELFG
                     HTRGAFTGASESTLGRVSQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVT
                     RRADVRILAATNLNLEEMVRESRFREDLLYRLNVITLHLPPLRERSEDILTLADRFLA
                     RFVKEYSRPARGFSDEARSALLNYRWPGNIRELRNVVERASIICPQERVEISHLGMGE
                     QPAGNAPRVGAALSLDELERAHIGAVLAASDTLDQAAKTLGIDASTLYRKRKQYNL"
     CDS             134555..135376
                     /codon_start=1
                     /locus_tag="PP4_01260"
                     /product="hypothetical protein"
                     /protein_id="BAN51979.1"
                     /transl_table=11
                     /translation="MPFYLRTAVLAATLLPIFTPAFADPVQDARLEGALQTALSLNRM
                     LNPFRIKVEVDGKQARLSGEVENEVERQLAEDVARATRGIEQVENQLQVNAQLVERPL
                     ELRAYAQRLEDATLAAVIRARLLWSRTTEKAPIEVQSSDGVVTLRGRVDSAEAKELAG
                     VVARTTDGVHLVNNLVSLDTAAMAKAREMPVGAPTGPQPSDSWIIDKIQNSYRFSRNL
                     DGLNLKVASEAGMVRLSGEVVSAEQKTIAVEIARQIIGVRGVDADLLKVATKVEG"
     CDS             135551..135871
                     /codon_start=1
                     /locus_tag="PP4_01270"
                     /product="hypothetical protein"
                     /protein_id="BAN51980.1"
                     /transl_table=11
                     /translation="MNRQSVNRSQIAALPLRQMLTLGMALLLTLAAGLFYYSWQTARL
                     AEQVAAQTALLTQIQATRANTLVKAADPLPADPLPADPLPAGQATASPATLENVVPQD
                     RWVF"
     CDS             135915..136076
                     /codon_start=1
                     /gene="ytjA"
                     /locus_tag="PP4_01280"
                     /product="putative membrane protein"
                     /protein_id="BAN51981.1"
                     /transl_table=11
                     /translation="MLSWAITFLIIAIVAAVLGFGGIAGAATGIAKILFIVFLVLFVA
                     SFFFGRGRG"
     CDS             136088..136549
                     /codon_start=1
                     /locus_tag="PP4_01290"
                     /product="hypothetical protein"
                     /protein_id="BAN51982.1"
                     /transl_table=11
                     /translation="MLSTALAAALLMGGSAAAMAANDGQVRVDQLLGSDPEYRETWQD
                     TIKGEERLPDWVVNLTGSAQQQMSAVTEDGDKYLVGPLCESQDNCTYKRLIVAFSWDK
                     DDAYGMLVEVPEGLPSDKSPTRHAQYRWLGEPDDGMKAMLQEQLKRDPNWY"
     CDS             137294..138622
                     /codon_start=1
                     /gene="gltP"
                     /locus_tag="PP4_01300"
                     /product="proton/glutamate symporter"
                     /protein_id="BAN51983.1"
                     /transl_table=11
                     /translation="MKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAWWISNVLQPA
                     GDIFIRLIKMIVVPIVISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTTIAIVVGLVL
                     ANLFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETLLNLIPSNIFAALMRGEML
                     PIIFFSVMFGLGLSSLQAELRDPLVRTFQAVSETMFKVTHMIMNYAPIGVFALIAVTV
                     ANFGFSSLLPLAKLVLLVYFAIAFFAFMVLGLVARVFGFSVIKIMRIMKDELILAYST
                     SSSETVLPRVIEKMEKYGAPKSICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDL
                     SWSQQLLLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRIMDMAR
                     TALNVVGNALAALVIARWEGMYDAAKGEKYYASLMADKKEAVVAGETAKR"
     CDS             138860..140089
                     /codon_start=1
                     /locus_tag="PP4_01310"
                     /product="hypothetical protein"
                     /protein_id="BAN51984.1"
                     /transl_table=11
                     /translation="MLNGLWLGFFLVAAVSALAQWLVGGNAGIFAAMVESIFAMAKLS
                     VEVMVLLFGTLTLWLGFLKIAEKAGIVEWLAKVLGPLFARLMPEVPPGHPALGLITMN
                     FAANGLGLDNAATPIGLKAMRALQELNPSSTTASNAQILFLVLNASSLTLLPVTIFMY
                     RAQQGAPDPTMVFLPILLATSVSTLVGLLSVAVMQRLRLWDPVVLAYFIPGALLLGGF
                     MAFLGTLSAAALASLSSILGNLTLFGVIMLFLVIGAMRRVKVYEAFVEGAKEGFDVAK
                     NLLPYLVAMLVAVGVLRASGALELALDGIRHAVNWMGLDTRFVEGLPTALVKPFSGSA
                     ARAMLIETMQTQGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRVRHAVGCALLA
                     EFSGVIAAIFICYWFFA"
     CDS             complement(140071..140706)
                     /codon_start=1
                     /locus_tag="PP4_01320"
                     /product="hypothetical protein"
                     /protein_id="BAN51985.1"
                     /transl_table=11
                     /translation="MKPSMRLLALAAALSLASACSILPKTEPFDLYRLPVNQPSRTAA
                     PLDWSLRLNKPLASEVLAGPRIAVIPQGDVVSSYKGARWSDAAPVLLRNRLLDGFQRD
                     GQVQRLSADDSNLQADYELAGELQAFQSEYRPGGAVEVVIRYDARLVQGRTQRILASK
                     RFEIRQPLADKQVSAVVAGFGQASDQLVGQVVGWTIGKANQAQLKVQAKNQ"
     CDS             complement(140703..141641)
                     /codon_start=1
                     /locus_tag="PP4_01330"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN51986.1"
                     /transl_table=11
                     /translation="METRAHHVLIGLVTVLVVAGAMLFGLWLTKSSVDDAFKDYEVVF
                     NEAVSGLSRGSPVQYNGIKVGDVSTLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTL
                     AGVTGNSFIQLSGGTPQSPELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINLLLHN
                     ANQMFSEDNIGHLSSTLANLDKTTGAFAGQHGSIAQAIEQLVQVGKQASATLAETQAL
                     MRNANGLLASDGKQAIGSAEQAMQSLAESTATINNLLKNNSEAIGDGAQGLNQLTPAI
                     RELRETLNALKGISRQLEADPSGYLLGRDNNKEFQP"
     CDS             complement(141645..142436)
                     /codon_start=1
                     /locus_tag="PP4_01340"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAN51987.1"
                     /transl_table=11
                     /translation="MSDREKVIEARGICNRFGSQVVHENLDLDLYRGEILAVVGGSGS
                     GKSVLLRSIIGLRRPNEGLIKVFGQDLAGLGEEQRSLVERRFGVLFQKGALFSSLTVT
                     ENVALPLIEHAGLSRADAEHLAGVKLALAGLPISAADKYPSSLSGGMIKRAALARALA
                     LDPDILFLDEPTAGLDPIGAAAFDQLILTLRDALGLSVFLITHDLDTLYTITDRIAVL
                     SQKKVLVAGPLAEVEQTNDAWIQEYFHGPRGRAAEQAATRAGQER"
     CDS             complement(142433..143557)
                     /codon_start=1
                     /locus_tag="PP4_01350"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAN51988.1"
                     /transl_table=11
                     /translation="MTTPSATLDASSQPACLRITGDWTLAHYASLRRESEQLRAQYPA
                     DTVADLSQLGRLDTAGASLLAELLGSERLSHCTEDLPEASRALLKNVYCSVQDYCIPV
                     KEPERNVLLMLLERIGRAVGTLWQDSMQLLGFIGVILETLLRRALTPHRWRLTPVVAH
                     IEQTGLDAAPIVALLTFLVGAVVAFLGATVLAAFGATIFTVDLVAFSFLREFAVLLTA
                     ILMAGRTASAFTAQIGSMKANEEIDAIRTLGLNPMELLVVPRVLALLITLPLLTFIAM
                     ICGIVGGAVVCALSLDISPAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGF
                     KVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFFMEMGW"
     CDS             complement(143681..144703)
                     /codon_start=1
                     /locus_tag="PP4_01360"
                     /product="hypothetical protein"
                     /protein_id="BAN51989.1"
                     /transl_table=11
                     /translation="MPQIPHIVQRIIELLKRYPGIIALGGFLSGIGSFILVDRQAGLA
                     SWVAVLMLVSWVWLMLENTLTGLFARTFNREIPQPLLRYATQMIHQETLFFVLPFFFI
                     TTTWNSGQLVFTGLLGAAGLISIIDPLYYKWLAPRRWLFLALHTLTLFAALLTALPII
                     LHLTTAQSFKLALIAAMALSFPSLASSFPINNWRRAVALVLVTLSVGAGGWLLRSWVP
                     PATLWMTEVAVSTEVLNRQPGESLDEIAASRIRSSGLYAYTAINAPRGLNERIYHVWQ
                     KDGKEVDRIALDIHGGRKEGYRAWTHKQNFPPNPVGKWQVRVLTEDGQVIGVLRFKVV
                     DDTPAQ"
     CDS             complement(144825..146231)
                     /codon_start=1
                     /locus_tag="PP4_01370"
                     /product="peptidase M16 family protein"
                     /protein_id="BAN51990.1"
                     /transl_table=11
                     /translation="MRCLMFVCLLICSLSSLALDRSRVEGYLLPNGLQVILKDGYERD
                     HVAIRLVVGVGLDDFDCEQKELPHLLEHLLFSGIDETGEGGLEERLQTLGGEWNAYTS
                     SADTTFVIEAPARNQRKVLDLLLAVIRDTPIDAKALVTAKRIIEREDGGHYGHLQRWL
                     DRQDIGHPASDQLATELGLKCPERSNIDDMTLEQVQALRDRWYAANNMTLIMVGGLDR
                     LLPAYLERTFGELPATEPEERRNLESITHQAEQRRHLTRGWLGDSVKLHWLFIEPVLD
                     NDHQATLDLLSRYLDWALYDQLRLRNGLSYGPSVQRESFGDTGLLSLNADLERDDIDK
                     AVKVMQALFEHLRKEGLDPDTFARIKDASVAKESWSTQGNSALADYYWGALNDYTDGR
                     FANPVRKLRQVSLEQANAALKELLREEGYLRIEKPLLGYDELYGLAALLVGLILAAGL
                     LRWRRHGPERPSGATRER"
     CDS             complement(146262..147920)
                     /codon_start=1
                     /locus_tag="PP4_01380"
                     /product="putative inorganic phosphate transporter"
                     /protein_id="BAN51991.1"
                     /transl_table=11
                     /translation="MLTLLNLLSAVTLLVWGTHIVRTGILRVFGSNLRRIISQNMDKR
                     PLAFIAGILVTAMVQSSNATAMLVTSFVGQGLMAMTPALAIMLGADVGTALMARVLTF
                     DLSWLSPLLIFLGVIFFLSRKQTRAGQLGRVGIGLGLIILALELIVQAAAPITHAQGV
                     KVLFASLTGDIMLDALVGAMFAMVSYSSLAAVLLTATLAGAEVISLPVAIGLVVGANI
                     GSGLLAFISTSMQNTAGRRVALGSLLYKLLGLLLIIPVLHPLVEWMDSLSFSPQELVI
                     GFHLLYNTLRCLLMLPTVKLMGRLCNTLLPEREAGNGQVRPRHLDASALETPSLALAN
                     ACRETLRLGDIVDSLLEAVLGALRGTQTALPQQVRVLGEDAEALYSAIKLYLAQMSRE
                     DLSEPDNRRWAEIIELAINLKLACDLIERMLRKVQQQKTSQRREFSQTGLEELTGLQE
                     QLLANLRLGLSVFLSADPESARLLLREKRRFRAQERRLAHAHVSRLQRKVVQSIETSS
                     LHLELIADMKRLNSLFCSSAYVVLGGSDTGGLMLDSVPDEARLP"
     CDS             complement(148120..148890)
                     /codon_start=1
                     /locus_tag="PP4_01390"
                     /product="hypothetical protein"
                     /protein_id="BAN51992.1"
                     /transl_table=11
                     /translation="MEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQP
                     RTRIFGLALAMVTRILLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSS
                     QEIYHGLEGEDENPDEPKGAGGKFFYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMIA
                     AIVVAVLVMMLCAGAISNFIDKHPSLKMLALSFLIVVGTVLIAESFDVHVPKGYVYFA
                     MAFSLAVEAINIRMRTASARKEGKEQDPVKLRKDIPGQ"
     CDS             complement(148960..150267)
                     /codon_start=1
                     /locus_tag="PP4_01400"
                     /product="citrate transporter"
                     /protein_id="BAN51993.1"
                     /transl_table=11
                     /translation="MLTFLGFAMVITFMYLIMTKRLSALIALILVPILFALFGGFSAK
                     IGPMMLEGISKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTA
                     VLALVVSLDGDGATTYMICCAAMLPMYSRLGMSPRIMAGLIILAGGVMNMTPWGGPTA
                     RAASALHVDPSDIFVPMIPAMLFGVVAILAIAYMYGKRERARLGELHLPTDDIDHSEI
                     TVSQFPEARRPKLLYFNGALTAALMVALIAGVLPLPVLFMIAFSIAMIVNYPCLQQQK
                     DRIAAHAGSVLAVTGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPEALGPYLAVITAI
                     VSMPFTFFMSNDAFYYGVLPVLAEAASHYGITPVEMARASIVGQPVHLLSPLVPSTYL
                     LVALAGIEFGDHQRFTLKWAVLVCLCIMLAALLMGIFPLFSSL"
     CDS             150535..150936
                     /codon_start=1
                     /locus_tag="PP4_01410"
                     /product="hypothetical protein"
                     /protein_id="BAN51994.1"
                     /transl_table=11
                     /translation="MQNVTEGGCHCGALRYRLEGDLTDIAHCHCTICRRVSGGLVVTW
                     VTLPRSGFVWLAGEPNCYVAPASCSRYFCGQCGAHVALVTTHSPETIDVTVATLDHPE
                     RVRASRHIWVGSRLPWLHLDEDLPEEEGESQ"
     CDS             complement(151064..153019)
                     /codon_start=1
                     /locus_tag="PP4_01420"
                     /product="hypothetical protein"
                     /protein_id="BAN51995.1"
                     /transl_table=11
                     /translation="MNRIRAWLLGCVLTLLGTPALADLQLELQASGLDPQQTQATQAL
                     LDEAMGKLPPRFKQQLDRRVRVSWSDNMPADAYGQASLVSTLELNRRLLPGLTDGSAA
                     TERTNRPHGTVREELLATVLHELTHIYDRARLWTGAENSLIARCKRQQGTLGKIGLPE
                     ECRGQAERRFTLSDDPRLLDLAGWQQYVGRRGEREQHNGQFVRSPDSYELSSPKEYIA
                     VNMEYFLLDPSYGCRRPALNQYLREHFGWAPQQDTCAKGLPFINAGSDFARQPLGEID
                     PERVYEVDYLLAEANQNLVSRWGHSMLRLVICKPGRPRGPDCRLDLDQSLVLSYRAFV
                     NDVQLSSWDGLIGVYPSRLFVLPLGQVIDEYTKTELRSLASVPLKLSRDEVENLVRQA
                     AEMHWSYDGNYWFLSNNCAVESLKLLRSGTANPRLNDLDSIMPNGLLAVLKGRGLADT
                     SVLDDPREALRLGYRFDSYRDRYQAMFEVLRKQLPIKQALVEDWLAQDAEQRRPWFAK
                     ADLRTSAALLLLEQASLRRQLLLAQDEVKQRYLNAAALKDGSINKADATLKQMLANSG
                     FLSRPAELLDAKGYGLPQPEERKHLEQVSSERQAQLLRLSTSLDKEVRALLEPSRAKE
                     IAAVEANVKQIGEHLRALHKAAGGLQL"
     CDS             complement(153016..153336)
                     /codon_start=1
                     /locus_tag="PP4_01430"
                     /product="hypothetical protein"
                     /protein_id="BAN51996.1"
                     /transl_table=11
                     /translation="MRKPLIAATLGMLLLADLAHAQTLVATSNIIVRAFGRSIDFTSD
                     TTTSIRDSKVVREAHDDAASFVASNGDIRGVQLEAAFSTLRERVPEARSASDQVLAEA
                     ILAL"
     CDS             complement(153374..153667)
                     /codon_start=1
                     /locus_tag="PP4_01440"
                     /product="hypothetical protein"
                     /protein_id="BAN51997.1"
                     /transl_table=11
                     /translation="MRYLLPLLFSVAGMASAHAMDTTTQSLVITGYVTSQVTTAPFDR
                     KLVRQARDDAAAFVASDGQIRGVRLEAALESLRHNCSQHAVGDLELAQAILVQ"
     CDS             complement(153756..154073)
                     /codon_start=1
                     /locus_tag="PP4_01450"
                     /product="hypothetical protein"
                     /protein_id="BAN51998.1"
                     /transl_table=11
                     /translation="MSRKYLSGTALMLSLAGTAHATSFVVTTDAVVGAVAASTDATSD
                     ISSSFKDDKIVQAARDDAASFVGSQGDIRGAKLESAFLHIRSQMPALQASDAQLAQAI
                     LAL"
     CDS             complement(154377..154592)
                     /codon_start=1
                     /locus_tag="PP4_01460"
                     /product="hypothetical protein"
                     /protein_id="BAN51999.1"
                     /transl_table=11
                     /translation="MERTLSSGLVFESNAQQSNASLPLRALSTLLLWQRRMASRRQLA
                     RLDGRLLADAGISESQRYEELSKPFWR"
     CDS             complement(154976..156469)
                     /codon_start=1
                     /locus_tag="PP4_01470"
                     /product="putative propionyl-CoA--succinate
                     CoA-transferase"
                     /protein_id="BAN52000.1"
                     /transl_table=11
                     /translation="MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKA
                     VPHALAERAKQSPLKISLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQ
                     VMFIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQV
                     IVEINLSHNPNLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISN
                     QPDSPSTVLPPDDETQGIADHLINFLKNEVEAGRMTNRLGPLQAGIGSIANAVMCGLI
                     ESPFEDLTMYSEVLQDSTFDLIDAGKLSFASGSSITLSGRRNADVFGNLERYKDKLVL
                     RPQEISNHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHL
                     AVFVTKSIAKGGAISSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARAIIDN
                     CVHPDYRAALNDYFDRACQRGGHTPHILREALSWHENLEETGRMLAS"
     CDS             complement(156656..158092)
                     /codon_start=1
                     /gene="pntB"
                     /locus_tag="PP4_01480"
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="BAN52001.1"
                     /transl_table=11
                     /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGIA
                     MLTTVGLIYKLGAELATAGIGYVIVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVLEPQSMGIVAAISDPIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGAPVQFPGQHKLNLILGLTTIALGLLFTFTGHYSAFTLMLALAFVMGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGGDTDAGAAQGSKEQRPVKSGSADDATFLLSNADSVIIVPGYGLAV
                     ARAQHALKELTEKLTHNGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMDDINA
                     EFGQADVVLVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLD
                     NELFYLDKTMMVFGDAKKVIEDMVKAVE"
     CDS             complement(158095..158409)
                     /codon_start=1
                     /gene="pntAB"
                     /locus_tag="PP4_01490"
                     /product="NAD(P) transhydrogenase subunit alpha part 2
                     PntAB"
                     /protein_id="BAN52002.1"
                     /transl_table=11
                     /translation="MEDMLISHGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNA
                     ISAIVIVGAMLAAALTVTPAGKLMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAKNEG
                     QK"
     CDS             complement(158421..159542)
                     /codon_start=1
                     /gene="pntA"
                     /locus_tag="PP4_01500"
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="BAN52003.1"
                     /transl_table=11
                     /translation="MHIGVPLETQTGETRVAATPETIKKLIGQGHQVTVQRGAGLNAS
                     IPDSAYEAVGASLGSAADAYGAQLVLKVVAPNDQELALINSGSLLAGMLNPFNSELIG
                     KMAERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHYYPRFMPMLMTAAG
                     TVKAARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFIDVPYETD
                     EERECAEGVGGYARPMPASWMQRQAQAVHERARQADIVITTALIPGRKAPTLLSAETV
                     AQMKPGSVVIDLAAAQGGNCPLTVADQVVKENGVTIVGPTNLPAQLGADASALYARNL
                     LDFMKLLFDKDGALVINLEDDIVAACLMCRDGQVVRKNG"
     CDS             complement(159979..160878)
                     /codon_start=1
                     /locus_tag="PP4_01510"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAN52004.1"
                     /transl_table=11
                     /translation="MRRKIPSTAALVCFEAAARHESFTKAAQELALTQGAVCRQIGGL
                     EAFLNVELFRRSRRGVKLTEAGLSYSRQVAAQLDAVERDTLSVMGQQGASVVELAVVP
                     TFGTQWLLPRLKDFQQRHPEVTINLTNRTRPFLFADTPFDAAIYFGDADWSGTQSHRL
                     MGENPVPVCSPALLAGQGMLEAQRIAQLPLLQQSTRPYAWRQWFGSLGMNVERDMTGP
                     RYELFSMLAQAAIHEMGIALIPPFLIQRELGEGRLVVANRHALSSNKAYYLMIPERKV
                     ESASLRAFRDWLVSQARAYTATN"
     CDS             161040..162221
                     /codon_start=1
                     /gene="gcdH"
                     /locus_tag="PP4_01520"
                     /product="glutaryl-CoA dehydrogenase"
                     /protein_id="BAN52005.1"
                     /transl_table=11
                     /translation="MAGKASFHWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLE
                     AFRHEQTDPAIFREMGEIGLLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMS
                     VQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDG
                     GYRLTGSKMWITNSPIADVFVVWAKDDAGDIRGFVLEKGWQGLSAPAIHGKVGLRASI
                     TGEVVMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGALGAAEACWHTARQYTLD
                     RQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCG
                     KALDIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAF
                     Y"
     CDS             162236..163456
                     /codon_start=1
                     /locus_tag="PP4_01530"
                     /product="putative CoA-transferase"
                     /protein_id="BAN52006.1"
                     /transl_table=11
                     /translation="MGALSHLRVLDLSRVLAGPWSGQILADLGADVIKVERPGSGDDT
                     RAWGPPFLKDAGGENTSEAAYYLSANRNKRSVTIDFTRPEGQRLVRELAAKSDIVIEN
                     FKVGGLAAYGLDYQSLKAINPQLVYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTG
                     RPEGEEGAGPVKVGVALTDILTGLYSTVAMLAALAHREQTGVGQHVDMALLDVQVACL
                     ANQAMNYLTTGNPPRRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFRKFAEVAGQPQ
                     WADDPRFLTNKQRVANRVELIPLIRQATVFKTTAEWVAQLEAAGVPCGPINDLAQMFQ
                     DPQVLARGLAVNIPHPLAGSVPQVASPIRLSETPVEYRRAPPLLGEHTEAVLGEVLGL
                     EAGEVQRLREAGVL"
     rRNA            164022..165561
                     /locus_tag="PP4_r0010"
                     /product="16S ribosomal RNA"
     rRNA            165881..168770
                     /locus_tag="PP4_r0020"
                     /product="23S ribosomal RNA"
     rRNA            168907..169022
                     /locus_tag="PP4_r0030"
                     /product="5S ribosomal RNA"
     rRNA            169467..171006
                     /locus_tag="PP4_r0040"
                     /product="16S ribosomal RNA"
     tRNA            171094..171167
                     /locus_tag="PP4_t0010"
                     /product="tRNA-Ile"
     tRNA            171195..171267
                     /locus_tag="PP4_t0020"
                     /product="tRNA-Ala"
     rRNA            171517..174406
                     /locus_tag="PP4_r0050"
                     /product="23S ribosomal RNA"
     rRNA            174543..174658
                     /locus_tag="PP4_r0060"
                     /product="5S ribosomal RNA"
     rRNA            174768..174883
                     /locus_tag="PP4_r0070"
                     /product="5S ribosomal RNA"
     CDS             complement(175007..177421)
                     /codon_start=1
                     /locus_tag="PP4_01540"
                     /product="putative ferrioxamine receptor"
                     /protein_id="BAN52007.1"
                     /transl_table=11
                     /translation="MRHAIRAALFGTALSLAAVPQMCAAAETAQVSHRYAIPAGQLAD
                     VLNQFARQAGITLSSTPQLTDGLQSNGLQGQYATDQALRQLLNGSGLEAVSQDGRSYV
                     LQTQPQEAALSLPDTDIRGFTLGNALGSMEGYNATHSQVATKTSTPLVETSQSVSVVT
                     RQQMDDQGSQTVAQAMRYTPGVLTNPYGATHRYDYVAMRGFNDGSVDNIYVDGLKSMG
                     DNGTYSTMQVDPYFLERIDILKGPSSVLYGRSSPGGLVALTTKKPLFTPFHQIQATVG
                     TQGQRGMGFDFSGPVDDDKRIAYRLTGLADASDTQFDHNKEERYTIAPAMSVDFTEDT
                     SLTLQAYLQHDPNGGYHGGNPAEGMLHKRNGLRLSDHFFEGEPGIDNYERTQQSFSYQ
                     FEHRFNDVFTARQNFRYQDSDVSMDQVYSAGWADADSNVLNRAYTGGDERLHSYIIDN
                     MLQAEFFTGAAKHTLLLGADYQRRKADVAWRYGSVDPLDAGNPQYGNGNLQVLGENRY
                     QRRLQQTGVYLQDLVELDQWRFSLGLRQDWVKVSEENRDSDTKVSDQRSKFTTRAGVL
                     YLFENGIAPYVSYSESFNPNTVSDQEGRPLAPTEGTQWEAGIKYQPPGSDNLFTASVF
                     RIEQENLASKQPDENFYRPVGEVRSQGLELEAHVQLTDSLKLLGGYTFTEIEYSRSMP
                     SLTSGSLDNKGNSPTQAPKQMFSLWADYNFRQGPLDGLRLGGGVRYVGYSWVDAENSM
                     KVPSYTLFDASLGYDLGKVGLKGVDVRLNANNLTNESYITSCASLNYCYMGEERNVSA
                     TVSYQF"
     CDS             complement(177587..178543)
                     /codon_start=1
                     /locus_tag="PP4_01550"
                     /product="putative transmembrane sensor"
                     /protein_id="BAN52008.1"
                     /transl_table=11
                     /translation="MTAARPDAKAVKQAIQWLLRLRESGHEPTLQQQCAQWRSAHHEH
                     EQAWQRVMHLHQDLDLRSVPGAGLALQTLEASQQRLHRRQALKLLGGVVMVGSATWLA
                     KDLDAISAWASDYATGTGEQRVFTLPDGSLMQLNTRTVVDLAFNDQQRLVRLKQGELM
                     MTCNSGHPVLVQTRDALLEGFAGRFVAYQENDCTRVSVNHGKVAIHRPGNGHLLWIEG
                     GQHWRLDAQGAHQLTHLDMDAMAWTEGLIVTQDIRLSDFLAQVSRYRHGYLGCSDEIA
                     DLRLSGVFRLADPEQLLQLLPQTLPVRLRQRTRWWVRVESMA"
     CDS             complement(178548..179051)
                     /codon_start=1
                     /locus_tag="PP4_01560"
                     /product="putative RNA polymerase ECF-type sigma factor"
                     /protein_id="BAN52009.1"
                     /transl_table=11
                     /translation="MPSNDSVQTLYSDHHGWLHAWLRSKLGNAADAADLAHDTFVRLL
                     QRREHLQLNTPRAFLRTVARGLVIDHWRREELHRAYLEALARVPEAQYPSAETRELLL
                     ELLERIARMLDGLKPKVRRAFLLAQCEGLKHQAIAEQMGISVRTVERYIADALFHCYV
                     LRYEDEC"
     CDS             complement(179163..179852)
                     /codon_start=1
                     /locus_tag="PP4_01570"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAN52010.1"
                     /transl_table=11
                     /translation="MAEKIKLSNVLVSEQLSPHQARAVIEERLRSAILDGRLPPGTAV
                     RQQELATLFGVSRMPVREALRQLEAQSLLKVEMHKGAVVAPLIGEDAVDTYALRVLLE
                     SEALRQSIPLLDASDIASARGYIQQLENETRHAEIGRLNRLFHMALYSKASNRKLLRL
                     IENELNEEERFLRFHLSSMGLGKLTQDDHNALVDAASDKLVDEAVAVLARHLNSGALV
                     IRNYLDAQRAR"
     CDS             180142..180327
                     /codon_start=1
                     /locus_tag="PP4_01580"
                     /product="hypothetical protein"
                     /protein_id="BAN52011.1"
                     /transl_table=11
                     /translation="MFKTVVRRVAFAGLLGSLLLGGLHADWDFSQISRKSQALYGPLG
                     AGQGRIDAWQNLMTTQK"
     CDS             180352..180819
                     /codon_start=1
                     /locus_tag="PP4_01590"
                     /product="hypothetical protein"
                     /protein_id="BAN52012.1"
                     /transl_table=11
                     /translation="MVNRFFNQQLRYVEDIDLWHEVDYWATPVQALIKGAGDCEDYAI
                     AKYFSLRRMGIPSEKLRITYVKALRQNRAHMVLTYYSNPQAQPLVLDSLMDAIKPASQ
                     RTDLLPVYAFNGEGLWLTGAAGNKKVGDTKRLSRWQDLLKKMQAEGFPAEPVY"
     CDS             180830..182776
                     /codon_start=1
                     /gene="lapD"
                     /locus_tag="PP4_01600"
                     /product="LapD protein"
                     /protein_id="BAN52013.1"
                     /transl_table=11
                     /translation="MSLFKQLLLAICLFLVVAFSGSFMVSLESSRSQYVNQLRSHAQD
                     AATALALSLTPNIDDPAMVELMVSSIFDSGYYASIKVVDLGSNAVLVERHAEPDPGGV
                     PRWFVHLIGLEAAGGDAIVSRGWQQAARVEVISHPMFAIAKLWQSALGSLGWLLLCGA
                     ASAVLGALLLRRQLRPLDYMVEQSHAIARREFLSLPELPRTPELRRVVQAMNQMVEKL
                     KALFTEQAERSERLRAESYQDSLTGLSNRRYFEMQLNTRVSNLEDARAGYLLLLRVQG
                     LAGLNARLGGQRTDQLLQAVGEQLRRTCASFPETNDLISRSRGGEFAVLAPGMVHEEA
                     VHLAQALEATLQSLHETGASDIDPVACIGLAPFSPGDSPQALLKLADEALARAENQPT
                     PGWVCLEQGVAAVAADSQHAWHERLDQAFKNGHFELFFQPVVDCTSVQRVLHHKVISR
                     LQDGQGDALPAGRFLPWLERFGWMPRLDVLVLEKVLAHLRGHDQVLALNLSAATLADP
                     KALHRIFELLGQNAALGPRLVFEIGEEQLPEQTALEQLTRRLHGLGFGLALQRFGGRF
                     SMIGNLAHLGLAYLKIDGSYIRNIDHEQHKRLFIEAIQRAAHSIDLPLIAERVETEGE
                     RRVLQEMGVGGIQGQLVGEPAPWR"
     CDS             complement(182924..184300)
                     /codon_start=1
                     /gene="lapC"
                     /locus_tag="PP4_01610"
                     /product="adhesin LapA exporter membrane protein
                     component"
                     /protein_id="BAN52014.1"
                     /transl_table=11
                     /translation="MLHKLDMGQFKDGLRRYFKGSDSLGGQPLPEVNKALIEDAPRVV
                     RLTIWGVILFFVFLIVWASVAPIDEVTRGEGKAIPSSKVQKIQNLEGGIVAEIFAKEG
                     QIVEIGQPLLRLDETRFASNVGETEADRQSMALRVERLSAEVEDRPLKIDEELRKAAP
                     SQAASEESLYQSRRQQLQDEIGGLQQQLVQRQQELREYSSKRAQYANSLELLRKEIGM
                     SEPLVATGAISQVEVLRLRRAEVENRGQLDSTALAIPRAEAAIREVQSKIEETRGKFR
                     SEALTQLNEARTELNKATATSKALDDRVHRTMVTSPVRGIVKQMLVNTIGGVIQPGSD
                     IIEVVPLDDTLVIEAKILPKDIAFLHPGQEATVKFTVYDYTIYGGLKAKLEQIGADTI
                     TDEDKKTTYYLIKLRTDRSHLGTDEKPLLIIPGMVATVDIMTGKKTIMSYLLKPIMKA
                     RSEALRER"
     CDS             complement(184290..186326)
                     /codon_start=1
                     /gene="lapB"
                     /locus_tag="PP4_01620"
                     /product="adhesin LapA exporter ATPase component"
                     /protein_id="BAN52015.1"
                     /transl_table=11
                     /translation="MLTTGLPLPAQRLSPELLPRAAARAGLQGRLLQRKLEQIPSIAM
                     PAMLLLKEGRSAVLLGWENEDTARLLLSESDGGEVHVSREALQSDYSGRVFFAQPQHK
                     FDVNHGNLIPRAKSWFRDTLLRSKWLYIDAIAASLVINLIALAAPLFVMNVYDRVVPN
                     QATSTLWVLAIGIAGAYIFDLILKGLRGLCLDLAGKKTDLIISATLFERIVGMSMKYR
                     PARVGSFAQNIHEFQGLRDFLASLTLTSLIDLPFTILILIVIAIIGGHLVWIPIIAFP
                     LALGIGYALQRPLMATMERTMALASERQSSLIETLAGLDAVKVNNAESERQYMWEQTL
                     GTLSRLELRVKVLSSLAMNITMLIQQLAGVAMICVGVYLIIDGNLSMGGLVACYMLSG
                     RALGPLASLNGLLARYQQAKVTMVATDHMMELPQERNFEERPLSRKVLQGSVEFRGVD
                     FTYPNQQNLALKNINLTIRPGEKVGIIGRSGSGKSSLAKLIVGLYEADGGSLLVDGVD
                     IRQIDVSELRHNIGYVPQDIQLLAGTLRDNLVSGARYIEDELILQAAELAGVHEFARL
                     HPDGYELQVGERGQNLSGGQRQNVALGRALLLNPQILLLDEPTSAMDNTGEERLKQRL
                     QAVVEGKTVLLVTHRASLLSLVDRLIVIDRGQIVADGPKAAVMDALKKGQISVA"
     CDS             186243..186497
                     /codon_start=1
                     /locus_tag="PP4_01630"
                     /product="hypothetical protein"
                     /protein_id="BAN52016.1"
                     /transl_table=11
                     /translation="MQAGPGGGAGQQLGAQALCGQRQAGGQHDPAGGFLVQDTQAQQA
                     IQQGIVMLTAWIMAELDSTDFRFHAALSSSLWWVGWVCRR"
     CDS             187450..202224
                     /codon_start=1
                     /gene="lapA"
                     /locus_tag="PP4_01640"
                     /product="adhesin LapA"
                     /protein_id="BAN52017.1"
                     /transl_table=11
                     /translation="MSSVVAIVKSIVGQVIAVSPEGIRRVLIEGDRLLAGEEVLTGPG
                     GAVTLELADGRLLDLGRDSQWSADAPDSSTDLSQATAQAAPSVEELQQAIAAGVDPTT
                     ELEATAAGPSAAGGGGALGGGHSFVMLEETAGRVDATVGFPTEGLGFATGLDSEEVGL
                     LDTTSNNQVTTPTIDTNVATDLILGATPSISEAGGVIVYTATVGQAPTTNLVVTLSNG
                     AVIVIPAGQTSGSVNVVVPANDTPYIDGGQISATVTGTTGGNGLTVTVPQTPAVTQVT
                     DTIDTTTATLTANPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQVITIEAGKTQGSVD
                     FQTPANDVYNNGSTVSTTITGATGGNFEQLTPNPAPAETVISDSVDNTTATLTASPSV
                     TEGGVITYTVTLSNPAQTPVTVTLSNGQIITVEAGKTQGSVDFQTPPNDVYNNGSTVS
                     VTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPA
                     QTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTP
                     NPTPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITV
                     EAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTT
                     TATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPAN
                     DVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGGEI
                     TYTITLTNKDGLPINNHAELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNQPVV
                     NAIDAVSGADAWKFENLNLDKTPVSTQVTDEPGTPGNEGDLVKVTITADQTSVAENVK
                     PTFTVHVNQPLDHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYKDSGEISLGINS
                     AVDATGATFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLP
                     INNHGALTFTLSDGKTVITVPANGTSGSITVTAPDNVYVGSNTPVVQSIATVAGADVG
                     KFEQLTLDKTPVSTTVTDEPGSGTPGTGNQGDLVQVTITADQTSVAENVKPTFTVHIN
                     QPLDHDLVVTLSNNAQVTIKAGDTSAPYTHDAQGDDVYNDAGEISVGIKSAVDATGAT
                     FENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHGALT
                     FTLSDGKTVITVPANGTTGSITVTAPDNVYVGSNPAVVNSIATVAGADVGKFEQLTLD
                     KTPVSTTVTDEPGTPGNPGGNNEGDLVKVTITADQTSVAENVKPTFTVHINQPLDHDL
                     VVTLSNNAQVTIKAGDTSAPYTHDAQGDDVYNDAGEISVGIKSAVDVDGRTFENLELG
                     GAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHGALTFTLSDGK
                     TVITVPANGTSGAISVTAPDNVYVGSNPAVVNSIATVAGADVGKFEQLTLDKTPVSTT
                     VTDEPGSGTPGTGNQGDLVQVTITADQTSVAENVKPTFTVHINQPLDHDLVVTLSNNA
                     QVTIKAGDTSAPYEHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGAATVQVT
                     DTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHGALTFTLSDGKTVITVPAN
                     GTSGSVTVTAPDNVYVGSNPAVVNSIATVAGADVGKFEQLTLDKTPVSTTVTDEPGTP
                     GNPGTPGGNNEGDLVKVTITADQTSVAENVKPTFTVHINQPLDHDLVVTLSNNAQVTI
                     KAGDTSAPYTHDAQGDDVYNDAGEISVGIKSAVDVDGRTFENLELGGAAKVDVTDTTD
                     EVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHGALTFTLSDGKTVITVPANGTSG
                     AISVTAPDNVYVGSNPAVVNSIATVAGADVGKFEQLTLDKTPVSTTVTDEPGSGTPGT
                     GNQGDLVQVTITADQTSVAENVKPTFTVHINQPLDHDLVVTLSNNAQVTIKAGDTSAP
                     YEHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGAATVQVTDTTDEVVAKLTA
                     TPSVTEGGEITYTITLTNKDGLPINNHGALTFTLSDGKTVITVPANGTSGSVTVTAPD
                     NVYVGSNPAVVNSIATVAGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGTPGGNNEG
                     DLVKVTITADQTSVAENVKPTFTVHINQPLDHDLVVTLSNNAQVTIKAGDTSAPYEHA
                     AQGDDVYNDAGEISVGIKSAVDVDGRTFENLELGGAAKVDVTDTTDEVVAKLTATPSV
                     TEGGEITYTITLTNKDGLPINNHGALTFTLSDGKTVITVPANGTSGAISVTAPDNVYV
                     GSNPAVVNSIATVAGADVGKFEQLTLDKTPVSTQVTDEPGTPGNPGTPGGNNEGDLVK
                     VTITADQTSVAENVKPTFTVHINQPLDHDLVVTLSNNAQVTIKAGDTSAPYEHAAQGD
                     DVYNDAGEISVGIKSAVDVDGRTFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGG
                     EITYTITLTNKDGLPINNHGALTFTLSDGKTVITVPANGTSGSITVTAPDNVYVGSNT
                     PVVQSIATVAGADVGKFEQLTLDKTPVSTAVTDEPGSGTPGTGNQGDLVLVTITADQT
                     SVAENVKPTFTVHINTALANDLVVTLSNNAQVTIKAGQTSAPYEHAAQGDDVYNDAGE
                     ISVGIKSAVDVDGRTFENLQLGDAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITL
                     TNKDGLPINNHGALTFTLSDGKTVITVPANGTSGSITVTAPDNVYVGTNPAVVNSIAT
                     VAGADVGKFEQLTLDKTPVSTQVTDEPGTPGTPGGNNEGDLVKVTITADQTSVAENVK
                     PTFTVHINQPLDHDLVVTLSNNAQVTIKAGQTSAPYEHAAQGDDVYKDAGEISLGIKS
                     AADIGGRTFENLQLGDAAKVNVTDTNDEVIAKLTATSSVTEGGVITYTVTLTNKDGLP
                     IDKHGALTFTLDDGKTTITIPANGTTGTATVTAPDNVYTGTNAPVVKAIQSVTGADVG
                     KFEQLTLDKTPVSTAVTDEPGSGTPGTGNQGDLVLVTITADQTSVAENVKPTFTVHIN
                     TALANDLVVTLSNNAQVTIKAGQTSAPYEHAAQGDDVYKDAGEISLGIKSAADIGGRT
                     FENLQLGDAAKVNVTDTNDEVIAKLTATSSVTEGGVITYTVTLTNKDGLPIDKHGALT
                     FTLDDGKTTITIPANGTTGTATVTAPDNVYTGTNAPVVKAIQSVTGADVGKFEQLTLD
                     KTPVSTAVTDEPGSGTPGTGNQGDLVLVTITADQTSVAENVKPTFTVHINTALANDLV
                     VTLSNNAQVTIKAGQTSAPYEHAAQGDDVYKDAGEISLGIKSAADIGGRTFENLQLGD
                     AAKVNVTDTNDEVIAKLTATSSVTEGGVITYTVTLTNKDGLPIDKHGALTFTLDDGKT
                     TITIPANGTTGTATVTAPDNVYTGTNAPVVKAIQSVTGADVGKFEQLTLDKTPVSTAV
                     TDEPGSGTPGTGNQGDLVLVTITADQTSVAENVKPTFTVHINTALANDLVVTLSNNAQ
                     VTIKAGQTSAPYEHAAQGDDVYKDAGEISLGIKSAADIGGRTFENLQLGDAAKVNVTD
                     TNDEVIAKLTATSSVTEGGVITYTVTLTNKDGLPINNHSALTFTLNDGKTTITVPANG
                     TVGTATVTAPDNVYVGANDPVIKSIASVSGTDVGKFEQLTLDKTSVSTTVTDEPGSGT
                     PGTGNQGDVTTVGITGTGSLTEGETGQYTLTLSNASKAEVTITLSYSGTAKNGEDFTG
                     VTTVKIPANSTGTTFNIATIDDKLVEGTENFVVKIETATGGNFENLQVDSSKSSVTTT
                     ILDNDHLPVSPGGAVFGVEDTDYVFAWSDFKVTDADGNTGLSVTITSIPGAGSLQFFN
                     GTAWVNVTVGQVVSQADIIAKNLKFVPLLNQSGSDNYGGNGVGNQKADYAQFKYKPND
                     GTNLGTEVTMKVDISPVADKPTLSFGSADIESKGLTKEVWTSLKGLGTGGNGITGEDL
                     KTVFANSGNANSSSTTTNVQSDGSVTAGTGSKTSGLIYLEAGKTYTFSGTADDSFVVT
                     IGGKTVVTATWGAGGQVSGTFTPNTSGYYPIEVYHANQSGPGSYDLNIQVGSGTPTDL
                     SSSSIKMYQNVTEMANAGLGVSDLHTVNGQSYYDGYKLNEGPEGGSVKLVGINTALTD
                     TDGSETLNVSLSGIPKGTVLSDGAGHTVTVGSAPVDVTGWKLSGLTLTPPAYYKGSFD
                     ITVTSTATESLGGSAITTGNIPVTVYGATYKASVGTSGNDTMTGSEGNDIIVADVSGL
                     NVVQGKNYNIAFMVDSSGSMSDQSVATAKAQLASVFQTLKASLGSDSSGTVNIFLVDF
                     DTQVNKNVTVNLNDTDALSKLQTVLDSMVGGSRYGGGTNYEDAFKTTSNFFKSTVALS
                     NSGAENLTYFITDGKPTYYQNGESTNPRLWTNGKYLDDVVSVNNYKIGDTFSAWADST
                     HKVEISSNGLITVSTYKSNGRLDSIKEIGTIHAQGDGTYETSDLAGTGYADYWNYYYS
                     AAGSTASFAVLGGKDTGLSKVQAIGLNSDVSLSDLTAYDTAGKPQANIDPSDLAKAIL
                     GHSEAILPGADTIDGGNGNDIIFGDLITLNGVVSEGYQALQTYVAQKSGVEASAVTTS
                     NVHQYITEHYTEFDISGANDGKDFLSGGNGNDILFGQGGNDTLDGGRGNDILLGGTGN
                     DTLIGGHGDDILIGGSGADTFVWKAGDYGNDVIKDFKVGEKDKIDLSDLLQGEKGSTI
                     DNYLKLTTVEGTTTLQVSSEGKLNDAGGLANADVTIKLEGVNWSNTTVNSLISGADPT
                     IIIHNKDS"
     CDS             202492..202851
                     /codon_start=1
                     /locus_tag="PP4_01650"
                     /product="hypothetical protein"
                     /protein_id="BAN52018.1"
                     /transl_table=11
                     /translation="MTRDTAMFYVQRDATGQLLRVEAAAFDQFTEMLPADHADIQEWF
                     ADDVVENSLNQLKQSDLDMIRVLEDLIDVLTAKGVFKITDLPAGAQAKLLNRSTARKA
                     LSSLNNLIDEEEQGGLI"
     CDS             203051..203950
                     /codon_start=1
                     /locus_tag="PP4_01660"
                     /product="putative dioxygenase"
                     /protein_id="BAN52019.1"
                     /transl_table=11
                     /translation="MSAASNALSTIDSAQPQVFEIRPFSGAVGAEIIGLDLAKPVNAE
                     DFARIHRAHLDHHVLVFRDQRISPEQQIAFSRRFGELQIHVLKQFLLTGHPEILIVSN
                     IIENGQNIGLGDAGKFWHSDLSYKALPSLGSMLHAQELPREGGDTLFADMHKAWDAVP
                     DALRKVVEGRSAAHSYTARYAETKFEGNWRPNLTAEQLAQVQEVIHPVVRTHPENGRK
                     ALFVSEGFTTRIVGLPDDESRDVLQQLYALSVLEQNIYRHQWQPHDLVFWDNRSLIHL
                     AAGCPAHLRRKLYRTTIQGDAPF"
     CDS             203968..204987
                     /codon_start=1
                     /locus_tag="PP4_01670"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN52020.1"
                     /transl_table=11
                     /translation="MRKSISRLAASIGLGASLVVGSLAAPAVAQAEGKIRIAEQFGIV
                     YLLLNVVRDQHLIEKHGKEQGIDIDVDWAQLSGGSAINDALLSGSVDIAGAGVGPLLT
                     VWDRTKGRQNVKAVASLGNFPYYLVSSNPNVKTIADITSKDRIAVPAVGVSVQSRFLQ
                     YAAAQQWGDKEYNRLDKYTLAVPHPDATAALLAGGTELNGHFSNPPFQDQVLANKDVH
                     VVLNSYDLLGPNSPTLLFATEKFRTDNPKTYKAFVDALAEAADFAQKDKAAAADTYIR
                     VTKAKIDRDALIKLIDNPQYEFTVTPKNTYKLADFLYRVGAIKHKPESWKDYFFQDER
                     PLQGS"
     CDS             204994..205857
                     /codon_start=1
                     /locus_tag="PP4_01680"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAN52021.1"
                     /transl_table=11
                     /translation="MTAPLPGHTASNLSRVATPPLLQVDNLSLEYRTAQRVVRATHQV
                     SFEVDRADRFVLLGPSGCGKSTLLKAVAGFIQPQEGQILLQGQAVRGPGPDRIVVFQE
                     FDQLPPWKTVKQNVMFPLLVSGQLKRAEAEERALHYLEKVGLAAFADAYPHTLSGGMK
                     ARVAIARALATQPKILLMDEPFAALDALTRRKMQEELLLLWEEVRFTLLFVTHSIEEA
                     LVVGNRILLLSPHPGRVRAEVHSHQYDLGSLGGSDFQASARRIHRLLFDEADTPQQPD
                     ELGFNDIRIAY"
     CDS             205872..206735
                     /codon_start=1
                     /locus_tag="PP4_01690"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAN52022.1"
                     /transl_table=11
                     /translation="MTTTPVRQEYEVQLEPLLSVPLERQLPLAQRLWQQGWLRKAVIL
                     LVIAVLWEAVARYQDNDLLLPGFLQTAAALWDGMISGELPAKVGVSLVILLKGYVLGI
                     VLAFGLTSLAVSTQLGRDLLGTLTSMFNPLPAIALLPLALLWFGLGDNSLIFVLVHSV
                     LWALALNTYAGFLGVSETLRMAGRNYGLKGLRLVLHILVPAALPSILSGLKIGWAFAW
                     RTLIAAELVFGASSGKGGLGWYIFQNRNELYTDKVFAGLAVVILIGLLVEGLVFNTLE
                     RLTVRRWGMQR"
     CDS             complement(206851..207411)
                     /codon_start=1
                     /locus_tag="PP4_01700"
                     /product="hypothetical protein"
                     /protein_id="BAN52023.1"
                     /transl_table=11
                     /translation="MPFATTRATLSRQWALLRQLPNRSPGITSAELVWGLRDVGFTVS
                     KRTVERDLNELSLIFPLERNDKSIPFGWHWSASAVGELRGNFDLLTHLRGDALQPAKG
                     EGVELVARISDALARQLRVAPLSSDMQLTALEHGHRLRATVSDGWPLRWWLLSHGDGL
                     VVEQPVVLREEIGKILSNAAAQYQNL"
     CDS             207619..208413
                     /codon_start=1
                     /locus_tag="PP4_01710"
                     /product="hypothetical protein"
                     /protein_id="BAN52024.1"
                     /transl_table=11
                     /translation="MSAASNIHSLLARLLPERVIAPPAPVGRRQWLFAGVGLPSQRSM
                     LVNRLDEASDLQAVYADLRRQALLGNVAALNDLGWIWLNGKYWRADTVLAGHLLRMAA
                     LQGNAAAWFNLGQQHYFGKGIDPSYMQAAECYRQAFERGMLHAAAALGDLYEEEVCDG
                     DLDWQVDLVQAYQWFMRGAERGEARCRFEVGYRLMHGLYVEADLKAALYWLELAAAAG
                     VVQAAEELAVHFSSRDAARYQEWRDRAVQMGSTLALTMKLEDQIQP"
     CDS             208626..209078
                     /codon_start=1
                     /locus_tag="PP4_01720"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAN52025.1"
                     /transl_table=11
                     /translation="MSLDLLRLQVSSGMVVAARHWRRICHTALTGYGISEACAAPLLM
                     IVRLGDGVHQVAVAQAAGLESPSLVRLLDQLCKAGLVCRSEDPLDRRAKALSLTTEGR
                     ALAEAIEAELVRLRRDVLNGIDQADLEATLRVLRAFEAAGLGGVGGVA"
     CDS             209075..211162
                     /codon_start=1
                     /locus_tag="PP4_01730"
                     /product="putative ArAE family transporter"
                     /protein_id="BAN52026.1"
                     /transl_table=11
                     /translation="MNGFFSSVPPARDWFYGARTFAASMIALYIALLMQLPRPYWAMA
                     TVYIVSSPFVGPTSSKALYRAVGTLLGAGGAIFLVPPLVQSPLLLSIAIALWTGTLLF
                     LSLNLRTANNYVLMLAGYTLPMIALAVVDNPLAVFDVASSRAQEICLGIVCAAVVGAI
                     FWPRRLAPVVVGATGNWFTEAIRYSDTYLAREASADKVGGMRGAMVATFNSLELMIGQ
                     LGHEGAGPHTLKNARELRGRMIHLLPVIDALDDALVALEGRAPAQFAQLQPLLEAARE
                     WLKGTAHSASVTRWTALHEQIDRLQPGAAALDQRAELLLSNALYRLTEWADLWQDCCT
                     LQHALRTDDAKPWRAVYRHWRLGRLTAFFDRGLMLYSVASTVLAIVVACGLWIGLGWN
                     DGASAVILAAVSCSFFAAMDDPAPQIYRFFFWTLMSVIFSSLYLFLVLPNLHDFPMLV
                     LAFAVPFICIGTLTVQPRFYLGTLLTIVNTSTFISIQGAYDADFFTFLNANLAGPVGL
                     LFAFIWTLVMRPFGVELAAKRMTRFAWRDIVEMTEPATLAEQRQVGVQMLDRLMQHLP
                     RLSQTGQDSGVALRDLRVGLNLLDLLAYMPRAGQQARERLRTVVEEVGAHYAACLRAG
                     ERLHAPAALLRNMERARLALNLDELYERGDARTHLLHALSGLRLALLPGVEVMLEPAE
                     QPQLPPGLDGAPL"
     CDS             211159..211371
                     /codon_start=1
                     /locus_tag="PP4_01740"
                     /product="hypothetical protein"
                     /protein_id="BAN52027.1"
                     /transl_table=11
                     /translation="MIGELDISGVFLPTLLVMMFGTYLVFLGVHAVLVRLHFYRLVWH
                     RALFNVALYAVLLGAVDHFCRNLMLP"
     CDS             211368..212243
                     /codon_start=1
                     /locus_tag="PP4_01750"
                     /product="putative membrane fusion protein"
                     /protein_id="BAN52028.1"
                     /transl_table=11
                     /translation="MKKPLLTLGRVVLTLLVVTFAAVLVWQMVVYYMFAPWTRDGHIR
                     ADVIQIAPDVSGLIQKVEVRDNQTVKRGDVLFTIDQDRFTLALRQAKATLGERQETLA
                     QASREAQRNRKLGNLVAAEQLEESQSREARARSAVSEAQVAVDTAQLNLDRSVVRSPV
                     DGYLNDRAPRNHEFVTAGRPVLSVVDSTSYHVDGYFEETKLGGIHIGDAVDIRVMGDN
                     TRLRGHVQSFAAGIEDRDRSSGANLLPNVNPAFSWVRLAQRIPVRIAFDEVPQDFRMI
                     AGRTATVSIIEGERP"
     CDS             212240..213670
                     /codon_start=1
                     /locus_tag="PP4_01760"
                     /product="putative outer membrane protein"
                     /protein_id="BAN52029.1"
                     /transl_table=11
                     /translation="MKQLILAGLCLSLGACMMVGPDYEVPKDAAVQRSDLSGPLRQDA
                     DSVVSAPVPEDWWQLYQDQRLNALVRQALSANTELRVAAANIAKARAQVEVAESQGGF
                     NGGVKLGAQRLQESGEAFLQPEKVPVANIGEAIISASYQFDLWGTFKRGTEAAKANAD
                     AVQAAADTARITLVADVVKAYTQVCSANEELHIARESLDLQEQSVTLNQRLRDAGRGD
                     ETQVTRSQTQFKSLRAELPRFKAERETGMYTLAALLAKPVDQLPAGTADCAELPHLNQ
                     LVPVGDGAALLKRRPDVRQAERQLAAATAYIGVATGALYPDISIGAQVGTIGILENLG
                     EPSTNRWGFGPQVSWTIPTNGTRARIRMAEASTQAALANFDGVVLNAIRETQTRLAQY
                     SALLDRRDALAEAEKSAKEAADQTHRYYQAGRESFLADLQATRTYTDMRAQLAAANSQ
                     VAMGQIGVFLALGGGWKAGTAEPPRP"
     CDS             213738..214403
                     /codon_start=1
                     /locus_tag="PP4_01770"
                     /product="hypothetical protein"
                     /protein_id="BAN52030.1"
                     /transl_table=11
                     /translation="MEKVTCGMPDGTVKGRAERSCEKFSYAPYGFDVAPLAGALGFDG
                     QPRDGVTGCYLLGAGYRAYNPALMRFNSADSWSPFGKGGWHAYAYVSCDPVNFFDPTG
                     HMRRVKPLKLDVKRANRQGQFNASSSITSPVSPPKVKRLRDRDMKDLSPAAEHNYSIF
                     VDAIEKEGLSFTEAAKKMGDPNLKITNKKLGLWQVRLDGSQRMTFRVGEDEVEIRQVG
                     GHM"
     CDS             214960..216903
                     /codon_start=1
                     /locus_tag="PP4_01780"
                     /product="hypothetical protein"
                     /protein_id="BAN52031.1"
                     /transl_table=11
                     /translation="MFSFAFPSRLAMKTRSCLLAWLPAILLGPVLALCSTLAQAESPA
                     EAGKALHLLDYIGADYPPTVQGGKVIDEGEYREQQEFSAVLADLVKALPTNTEQKALE
                     QGVQALRQAIDQRQEGTAVARQARQLGARLAVAYEVSQAPVITPDPARGASLYAQNCS
                     ICHGDTGAGDGPAGVGLEPAPANLRDVVRLDQLSLFDLYNTLALGIDGTEMPSFADQL
                     DDRQRWDVAAYIASFTAKPEAGKGDKTWNIADLARQTPAEVAANEGSAVVEAFRAQRA
                     QPPQVKRGPAQLLEYTANTLDKSLAAYRAGDHDQAYDLSVAAYLEGFELVESSLDNID
                     TQARKDTEKSLMAYRQSLQDGLPVAQAEQRLAEAKSRLDQAAKLLGSDGLSWSLSYIS
                     GLLILLREGLEAILVLAAILAFLRNTGQQSAVRSVNIGWGLALVAGFATWAVAAYVID
                     VGGAQRELLEGCTALFAAVMVLWLGVWMHDRRHAAAWKDYIKSSLVSGGGRFGFAMLA
                     FFSVYRELFEVILFYETLWLQAGPAGHQAVLAGGATALVLLVGLAWVILRGSAKLPLT
                     LFFSINAALLCALSVVFAGHGVKALQEAGVLGTRPVAFFEFDWLGIHADAYSLSAQAV
                     ALLAIVFLYGRSWLVEKRRATAN"
     CDS             complement(216939..217184)
                     /codon_start=1
                     /locus_tag="PP4_01790"
                     /product="hypothetical protein"
                     /protein_id="BAN52032.1"
                     /transl_table=11
                     /translation="MSFTPDLIAELEVLALFKHDSSQEGIKINSNAAPALVAAAQRLH
                     EKGLTDQPDGGYLTSLGHDAVDSVQLLQNILKAPQPA"
     CDS             complement(217254..217553)
                     /codon_start=1
                     /locus_tag="PP4_01800"
                     /product="hypothetical protein"
                     /protein_id="BAN52033.1"
                     /transl_table=11
                     /translation="MSEPTDIDNDDEAFAEATLTQAIENQIESGEPPAAKATFNKLTL
                     VGYEREDILNLMAHVLAFEIDNMLVEDRAFNGEWYENALRALPELPPEMDQGEDE"
     CDS             217701..218363
                     /codon_start=1
                     /locus_tag="PP4_01810"
                     /product="glutathione S-transferase family protein"
                     /protein_id="BAN52034.1"
                     /transl_table=11
                     /translation="MLKLHGFSVSNYYNMVKLALLEKGLPFEEVTFYGGQAPQALEVS
                     PRGKVPVLQTEHGFLSETSVILDYIEQTQGGKALLPADPFGQAKVRELLKEIELYIEL
                     PARTCYAESFFGMSVEPLVKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCF
                     SVDLAYAVGKKVLNIDFLADFPQAKALLQLMGENPHMARIVADKEASMPAFMEMIRSG
                     KR"
     CDS             complement(218487..219881)
                     /codon_start=1
                     /EC_number="4.3.2.1"
                     /gene="argH"
                     /locus_tag="PP4_01820"
                     /product="argininosuccinate lyase"
                     /protein_id="BAN52035.1"
                     /transl_table=11
                     /translation="MSTDKTNQSWGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSI
                     AHATMLAQVGVLSDAERDTIIDGLKTIQGEIEADNFDWRVDLEDVHMNIEARLTDRIG
                     ITGKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITRLQQGLLEQAEREAETIMPGFT
                     HLQTAQPVTFGHHLLAWFEMLSRDYERLVDCRKRTNRMPLGSAALAGTTYPIDRELTC
                     KLLGFEAVAGNSLDGVSDRDFAIEFCAAASVAMMHLSRFSEELVLWTSAQFQFIDLPD
                     RFCTGSSIMPQKKNPDVPELVRGKSGRVFGALTGLLTLMKGQPLAYNKDNQEDKEPLF
                     DAADTLRDSLRAFADMIPAIKPKHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEI
                     VGHAVKYGVDTGKDLAEMSLDELRQFSDQIEQDVFAVLTLEGSVNARDHIGGTAPAQV
                     RAAVVRGKALLASR"
     CDS             220178..220921
                     /codon_start=1
                     /gene="algR"
                     /locus_tag="PP4_01830"
                     /product="two-component response regulator AlgR"
                     /protein_id="BAN52036.1"
                     /transl_table=11
                     /translation="MNVLIVDDEPQGRERLSRLLGELEGYTVLEPSATNGEEALALIE
                     SLKPDVVLLDIGMPGLDGLQVAARLCEREAPPAVVFCTGDDEYGAEAFKDSTLSHVTK
                     PFQAQALRDALRKAEKPNRAQLAALTRPANEGGGPRSHISARTRKGIELIPLPQVIYF
                     IADHKYVTLRHEAGEVLLDEPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHF
                     QLYLKGLDGDALTVSRRHVAGVRKMMQTL"
     CDS             221121..222062
                     /codon_start=1
                     /EC_number="2.5.1.61"
                     /gene="hemC"
                     /locus_tag="PP4_01840"
                     /product="porphobilinogen deaminase"
                     /protein_id="BAN52037.1"
                     /transl_table=11
                     /translation="MSTREIRIATRKSALALWQAEYVKARLEQAHPGLLVTLVPMVSR
                     GDKLLDAPLAKIGGKGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICERE
                     DPRDAFVSNTFDSLEALPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLD
                     AGEYDAIILAAAGLIRLGFEDRITATISVDDSLPAGGQGAVGIECRSADLEIHALLAP
                     LHHADTADRVVAERALNKHLNGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVAEA
                     RAPRAGAETLGVQVAEDLLGQGAEAILKEVYGEAGHP"
     CDS             222059..222826
                     /codon_start=1
                     /gene="hemD"
                     /locus_tag="PP4_01850"
                     /product="uroporphyrinogen-III synthetase"
                     /protein_id="BAN52038.1"
                     /transl_table=11
                     /translation="MSQWRLLLTRPAEDCAALAQSLAAAGVGSSCLPLLAIEPVTVEP
                     RQRLLLEGLHGFQAIIVVSKPAARLLLEQLAEASLQPPRQGWFTVGEATAAVLQGAGL
                     EVNTPPRGDDSEALLALPALLQAVAVPAARVLVVRGVGGRELLAERLAEQGASVEYLE
                     LYRRCLPDYPAGTLKRRIEAERLNGLVVSSGQGFEHLQQLAGADWPQLARLPLFVPSP
                     RVAEQARAAGAQQVVDCRGASATALLVAVQRSAAPAS"
     CDS             222872..223972
                     /codon_start=1
                     /gene="hemX"
                     /locus_tag="PP4_01860"
                     /product="putative uroporphyrin-III C-methyltransferase
                     HemX"
                     /protein_id="BAN52039.1"
                     /transl_table=11
                     /translation="MSETVLSNNDQPSAQAPAEPVTAPPAKRSGSGLAALALLLGAAG
                     VAVGGWGVWQVRQLQGSEFNQGQHIEALTQRAEALQQREQQISAQLASLPAASELEDR
                     RRLVAQLQGDQQRLSQRLETVLGESRKEWRLAEAEHLLRLATLRLSALQDITSAKALV
                     EGADEILREQSDPGAFAAREQLARSLATLNSTQQPDRTGLFLKLAAQRELVQQLSAQS
                     PEFDSNADALGALTADGDGASRLSQWWAEISKYFQIDFNADENVRPLLAGQQLNQLRL
                     ALSLTIEQAQWAALNGDAKVYTQALDDARSVLLANFNADNPQSKAMLESLNALADQPV
                     SVVTPDLSESLAAVQAYIQRRHLPAEAEGGKP"
     CDS             223969..225207
                     /codon_start=1
                     /gene="hemY"
                     /locus_tag="PP4_01870"
                     /product="putative HemY protein"
                     /protein_id="BAN52040.1"
                     /transl_table=11
                     /translation="MKRVYLLAVLAIVIAAALGIAVAKHSGYVLLSYGSFRYQSGLWA
                     ALAGLLAVVALLWLLRYLVGLVLTSSGVVNPWSRRNRSRRIRLAIEQGQLDLAEGRWA
                     SAQRHLHRAAEAERQPLLYYLGAARAANEQGRTEDSDNLLERALERQPQAELAIALTH
                     AQLQMDRGESDGALETLLAMQERHPHNGQVLRLLQRLYLQRGDWSALIRLLPDLRKGK
                     VLPAAELAALEQRAWGQNLSLATTRGEDAQSARQALERAWQQLTAAQRQEPQLVLAYA
                     EQLRQVGAQNEAEQVLRTALKRGYESHLARLYGLVRGDDPARQLQTAEGWLKDHPQDA
                     SLLLTLGRLSLQNRLWGKARDYLESSLRMERNPEACAELARLLAGLGETERSNQLFQE
                     GLGLLDERLLALPLPEGVRA"
     CDS             complement(225393..225617)
                     /codon_start=1
                     /locus_tag="PP4_01880"
                     /product="hypothetical protein"
                     /protein_id="BAN52041.1"
                     /transl_table=11
                     /translation="MPGACSTAAMLSSAYTASSSRWLKHNGHGTNPRMFSRWYDATST
                     ANAARQAGRKKVRKRAGSMGGESPGEDVVV"
     CDS             225541..225936
                     /codon_start=1
                     /locus_tag="PP4_01890"
                     /product="putative disulfide bond formation protein"
                     /protein_id="BAN52042.1"
                     /transl_table=11
                     /translation="MCFSQRLLLAVYALLSMAAVLQAPGTQGTLHYARATLGCTLAGA
                     LLAARHVWLQGASGAIPVCPVPIGRVFEQSWSEAARQLLLGGPECSSLTWSFLDLTLP
                     EWSLLAFLLLAVPPLSCLLAYRFRTLARS"
     CDS             226168..226638
                     /codon_start=1
                     /gene="algQ"
                     /locus_tag="PP4_01900"
                     /product="putative alginate regulatory protein AlgQ"
                     /protein_id="BAN52043.1"
                     /transl_table=11
                     /translation="MLDSCQNAQERWGGVHKLIDRWLDERQELVQAFRALRDVKPAFA
                     DKDTHGDFCALLVDYVSAWHFEVSEQLVSEAKEFGDTRGLELATQINPRIDDSTQIAL
                     AFNDHCTKGECSDPARFAEKLTKLGALLHERFELEDCLIEVLHNAHKEEGTVEA"
     CDS             complement(226648..227238)
                     /codon_start=1
                     /locus_tag="PP4_01910"
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BAN52044.1"
                     /transl_table=11
                     /translation="MADSNDHDLAYSLGASLGERLRQDMPGLQLDALVEGLKQSYQGQ
                     PLKLDKARMQAVLQQHEAQEGDAATQKLQAAETRFMANERGRYGVRELPEGVLYSELQ
                     PGTGAQPKVGGKVQVRYVGRLPDGSVFDQNQAPQWFSLDSVIEGWQVALPRMHAGAKW
                     RLVIPSAQAYGAEGAGDLIAPYTPLVFEIELLAVGD"
     CDS             227466..228650
                     /codon_start=1
                     /gene="algP"
                     /locus_tag="PP4_01920"
                     /product="putative alginate regulatory protein AlgP"
                     /protein_id="BAN52045.1"
                     /transl_table=11
                     /translation="MSAKKKPVSTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKL
                     EKQRGKAQEKLHNGRLKLQDAAKAGKAKAQSKAQKAVGELEGLLDALKERQTQTRSYI
                     QQLKRDAQDSLKLAQGVGKVREAAAKALDQRAVKTTKPAAAKPAARTTAAKPAAKPAA
                     KATAAAKPAAKPAAKTAAAAKPAAKPAAKPAAKPAAKPAAKPAAKATAAAKPAAKPAA
                     KTTAAVKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKPAAKTTAAAKPAAKPAAKA
                     AAAAKPAAKPAAKASAAAKPAAKPAAAAKPAAKPAPAKAAAAKPAAKPAAKPAAAKAP
                     ARPAAKPSAAKPVASKPADAKPATPAVSTPAAATNSATPAASAAPSAPASTPAQAPSS
                     AS"
     CDS             complement(228626..229108)
                     /codon_start=1
                     /locus_tag="PP4_01930"
                     /product="hypothetical protein"
                     /protein_id="BAN52046.1"
                     /transl_table=11
                     /translation="MHTDLWNYALALYARPGVEAACLELQAQGGDVCLLLCATWLQAR
                     GVALLDARAQALHDIAEPWQREVVGPLRSLRQQWRESASGDTQLAALREQLKGLELQA
                     EKALLARMQECSRQWPADSLEPTDDWLARLAPEPARHHDALDLLRVAAAALQDAEDGA
                     "
     CDS             229159..231069
                     /codon_start=1
                     /locus_tag="PP4_01940"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAN52047.1"
                     /transl_table=11
                     /translation="MIRLTNLTLQRGPQRLLDGADMTLHAGHKAGLIGANGAGKSSLF
                     ALLRGELSPDGGDCQLPGDWRIAHMRQEVDTLDRLAVDYVLDGDLRLRKVQAELAAAE
                     QTHDGTALARLHSELEGADGYTADARARKLLAGLGFTNEQMDRRVGDFSGGWRMRLNL
                     AQALMCPSDLLLLDEPTNHLDLDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVLH
                     VEHRKLNLYKGGYSAFERTRAERLAQQQQAYEKQQAQRAHMEKYIARFKAQATKARQA
                     QSRIKALERMEELSAAHVDSPFDFVFRESQKISSPLLSLSEGRLGYGDKAILDKVKLQ
                     LTPGARIGLLGPNGAGKSTLIKNLAGELEPLSGRLVRGENLAVGYFAQHQLDSLDDKA
                     SPLLHLQRIAPTEREQTLRDFLGGFDFHGARTDEPVVNFSGGEKARLALALIAWERPN
                     LLLLDEPTNHLDLEMRLALTMALQEFAGAVVVVSHDRHLLKSTTDDFLLVADGKVETF
                     DGDLDDYSRWLVEYRQRSAPASTAPVNPDKTDKKAQRQAAAALRQQLAPHKKAADKLE
                     TELNQVHVQLAEIETALGDGGLYEAARKDELRDLLARQTKLKQREGELEEAWMEALET
                     LESMQAELEALS"
     CDS             231069..231656
                     /codon_start=1
                     /locus_tag="PP4_01950"
                     /product="hypothetical protein"
                     /protein_id="BAN52048.1"
                     /transl_table=11
                     /translation="MEELRSLLPGQWMDTFWLGLQILLILVAAFVLQRIVARGLSRLG
                     QRYPLPPELLVPVRGGLRWLIMGSALLFVLERLGVSATVLWTALSGFVAVAAVAFFAM
                     WSVLSNLLCAVLIFTVGPFRIGDVVELVDTLDKPGVKGRVIAINLLFTTLLEMPEAGG
                     ALVQVPNSQFFQKSVRRWRGAEVQALHKETAAEAD"
     CDS             231857..232489
                     /codon_start=1
                     /locus_tag="PP4_01960"
                     /product="putative homoserine/homoserine lactone efflux
                     protein"
                     /protein_id="BAN52049.1"
                     /transl_table=11
                     /translation="MSMEVWLGFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNAL
                     GLQLGLIVQIAIIAAGVGAILAASATAFQVIKWFGVAYLVYLAYKQWRALPMDMSDES
                     SVRPIGKPLSLVFRGFLVNVSNPKALVFMLAVLPQFINPHAPLLPQYVAITVTMITVD
                     MLVMAGYTGLASRVLRLLRTPKQQKRLNRTFAGLFIGAATFLATLRRAPL"
     CDS             complement(232521..233273)
                     /codon_start=1
                     /locus_tag="PP4_01970"
                     /product="hypothetical protein"
                     /protein_id="BAN52050.1"
                     /transl_table=11
                     /translation="MFMQLGFGAVLIVLAMLLLSAFRILREYERGVVFQLGRFWQVKG
                     PGLILLIPVIQQMVRVDLRTVVLDVPPQDVITRDNVSVKVNAVLYFRVLDPQKAIIQV
                     EDFLVATSQLAQTTLRAVLGKHELDELLAEREQLNADIRQVLDAQTDAWGIKVANVEI
                     KHVDLNESMIRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGKEPGAMQLRY
                     MQTLGAIAGDRTSTIVFPMPVDLLTGLVDKQK"
     CDS             complement(233276..234622)
                     /codon_start=1
                     /locus_tag="PP4_01980"
                     /product="putative S49 family peptidase"
                     /protein_id="BAN52051.1"
                     /transl_table=11
                     /translation="MIARCWRWLLLLLLLGITPGGQAAPAAVWVLGIDDAIGPASADY
                     LVRSLDQAQAQGAQLVVIRLDTPGGLDSAMRQMIKAILASPVPVATYVAPSGARAASA
                     GTYILYASHVAAMAPGTNLGAATPVQIGGPPGAPKDDKAKGSDDETLSRKQVNDAAAY
                     IRGLAQLRGRNADWAEKAVREAVSLPASEALRLNVIDQVADDLPALLRKLDGKTLEAA
                     GQPHQLQTAGASLVEHLPDWRTRVLAVITNPSVALILIMVGVYGLLFEFMSPGSTVGG
                     VVGGICLLLALYALQLLPVSFAGVALILLGIAFMIAEAFLPSFGVVGFGGIVAFVVGA
                     LILIDTDAPGFGIPLALIGTLAVLSALFIGGVLGMALKARQRALVSGDAGLVGSLVTV
                     TQVMAGNPFRGVVLAQGEQWQVQCATPLQAGQNVRVTARHGVMLDVSAAAPAAQGD"
     CDS             234721..235179
                     /codon_start=1
                     /locus_tag="PP4_01990"
                     /product="hypothetical protein"
                     /protein_id="BAN52052.1"
                     /transl_table=11
                     /translation="MRMAKTLQARLDKANCDYDIIPHPHSATSLESARTAGVPAERVA
                     KSVMLDDRHGNYIMAVLPANRHLDMTKVRMSGAWQLTRESGLPSLFGDCERGAVPALG
                     DAYQIKMLLDPSLTRQGDVYLEAGDHDHLIHMSMEQYMKLVPHAEVRELC"
     CDS             235241..235483
                     /codon_start=1
                     /locus_tag="PP4_02000"
                     /product="hypothetical protein"
                     /protein_id="BAN52053.1"
                     /transl_table=11
                     /translation="MEAPTHPFADLFKQLGLPDDPESIDQFITSHSPLKNEIKLVDAP
                     FWTDSQRAFLKESIIEDSDWAVPFDQLNEALRRPRK"
     CDS             235553..236191
                     /codon_start=1
                     /locus_tag="PP4_02010"
                     /product="hypothetical protein"
                     /protein_id="BAN52054.1"
                     /transl_table=11
                     /translation="MKDPYAPGFWCSVTILGTLTASYFYGIRQTQQMNQAVHFLYAAA
                     AVTVAVVLVALTWIAWQQLHLNKREVIQGRTLLTIWNTKVALRRVETVFDRYFWGSYW
                     HSGRTFEEVMGELKGTPLEQSLDALKRQCRALDREIHDHHHHWLANARDLSSVAQAMA
                     RERYQLDLGEPTCSGNGNTAVLNRDLEVLVYTWSARLRSFDHQLDELERAYH"
     CDS             complement(236198..236635)
                     /codon_start=1
                     /locus_tag="PP4_02020"
                     /product="hypothetical protein"
                     /protein_id="BAN52055.1"
                     /transl_table=11
                     /translation="MKTVEQLLKTKSQHQTVYTIGPDDSVLDALKVLAEKNVGALPVV
                     EGDQVVGIVSERDYARKLVLKGRSSAATPVREIMSAPVVTVEPKRKLDFCMNLMTDRH
                     LRHLPVVDNGKLLGLLSIGDLVKETITEQASLIQQLEQYIRGE"
     CDS             complement(236761..238053)
                     /codon_start=1
                     /locus_tag="PP4_02030"
                     /product="hypothetical protein"
                     /protein_id="BAN52056.1"
                     /transl_table=11
                     /translation="MQRVNRDTHASQDAASALELRVALIRQHFPPGIAHLYAIPRQGR
                     DGVLEWWSELEGQPHLYATLGREQQAALLKRYEERQAAVSQLADELQRRGQAPAAEAL
                     RTLIGRPDLANLYSINDEPLVIRWGQPAPVAAPPVVSPPPAPRQPAPAKPKPAPTPKP
                     TRTRTVVMTERRRLRLWPWLLFGLLLLLLYWLYSSWPVLYQRWQGYTQTAICTPGGAF
                     QASEFAVVLDTSGSMDQRIRVKKEDDPWYIGLLARIPYVDELLANNQPQRLTRMDVAK
                     SSLTAVIGDLDKAVDMRLVTFDGCRSPVDHGVFGPGQREDLVKRVADLNARGGTGLGI
                     SLQAAASKMNGRDRDGVIVMFVDGRDSCGTSVCSVSEQIAKNQPRLRINVVNISASTG
                     SNCAASNTGGRVYTANDAAAVAAALKEASQEVAATGCP"
     CDS             complement(238062..239297)
                     /codon_start=1
                     /locus_tag="PP4_02040"
                     /product="hypothetical protein"
                     /protein_id="BAN52057.1"
                     /transl_table=11
                     /translation="MQRVTRDTSPAKDDLRVLEQAMAIIVRHFPPSIAHLFATPRNGK
                     DGLREWWSELQGQPHRYHDLGAEQQAALLRLYDERQEAVHQLVSKLESLGQANDAALL
                     RKLIGPADLNNLYSINGQPLVVRWAEPAPVKPSPAPLPPRPAPVVRRRWVWLPWFLLP
                     LLGLLLLALALWFGWPYLQHWLGNRPATPFACVKDSRIQPPEFSVVLDTSGSMLLNVA
                     TTLEDEQWFFQHINDDPNIDQQRVAQLTRAPVRMDVAKSSLTHLINDLHPAVDMRVVT
                     FDGCRAPLDHGVFTLAQRPALIKGIQALVPNDGTALAASLDVAAKTMNGRDRDGVILM
                     FIDGADGCEQDVCAVAQRIAREQPRLRVNLVDISNSNLASCVAESTGGSIYSASDAGQ
                     VAAAIKLASQEVSSTADCD"
     CDS             complement(239344..239847)
                     /codon_start=1
                     /locus_tag="PP4_02050"
                     /product="hypothetical protein"
                     /protein_id="BAN52058.1"
                     /transl_table=11
                     /translation="MFLRNCLCLALLASLAGCATTASQCNASDSSASLIGKLNCDYGG
                     GYAEGVRNSEQELLSAKEQNRQFNEVYAQLSALQASTRQDLQSQQRQQASLEKSLNDL
                     LGTLKARHGNKSDVQKQIAGLEQQLKANQAAPSQNASNAQIEARKQKLAALQQQVSRL
                     QLSLGYE"
     CDS             complement(239861..240595)
                     /codon_start=1
                     /locus_tag="PP4_02060"
                     /product="hypothetical protein"
                     /protein_id="BAN52059.1"
                     /transl_table=11
                     /translation="MNFPTSTRINPWLGLLMAACLAVTGCANTGSSMTGSQGTVDPRL
                     TSGNDAKFFTTSGFQACAIAASAGILACMLSNSGNKAACSIIAGVGACGVAMGANYYL
                     DQRRAKYADTTERLNAMTTEVQGETAKVAQRSDTLQRVINDDKQQIASIQQSMKAKTL
                     DKAKAQQDIANIDQNIGLMRKDLTNMKKRVTEYQQVAKLERDGGASQAEVQKVEAEIT
                     KMNTKVASLQQEVDGLYSQRSAITLG"
     CDS             complement(240619..242169)
                     /codon_start=1
                     /locus_tag="PP4_02070"
                     /product="hypothetical protein"
                     /protein_id="BAN52060.1"
                     /transl_table=11
                     /translation="MNSKAYSRLLLAPLALGFALQATAATWEEKYYNPMADADDVVLP
                     MPCDGAMVFRKVMIPVAGPLDDYPINIGQDSAEWGYVEQTRPAFIAGSFTSAKGEKSR
                     YYLLAKYEMSQLQYKALMDETCPTASNKQRLPIVSVSWLDALQAADKYNRWLRANAPD
                     KLPREDGAQGFLRLPTEVEWEFAARGGLQVSTAEFRDGRYPMPEGLNAYEWFAGAQSA
                     NGQLQLSGLLKPNPLGLHDMLGNASEMMFEPFRLNKLDRQHGQAGGYVVRGGNYLTSE
                     SDLRTSLRQEEPYYNAEGAVAKKTNGLRLAMVSPTLTSRDRVKNIEKSWSNLGSDQPA
                     AESKQKGTVKALEELASNVEDEALKNQLKTVENQLRASNQQQQEARDQAIRASLNLGA
                     FLCTKMLDDGQYLDFLQKNYASNCKAGEEDPTCGVRKVKLEEQQERLHKLSRYYASSL
                     VESGSLYGKDLLEAQVPVLDGSFKANKNLKDLSPYLRTHWANQMSFLKTQKIDANAWL
                     NSCKTVAH"
     CDS             complement(242159..243382)
                     /codon_start=1
                     /locus_tag="PP4_02080"
                     /product="hypothetical protein"
                     /protein_id="BAN52061.1"
                     /transl_table=11
                     /translation="MNPWHKRLLLLARLSLADLWHDRNVSLCMAASLVAVIAPLLLLF
                     GLKHGVVSQLQQELLSDPRNLEVKMLSSGHFDQAWLQRLQARPEVGFAIGQTRSLNTQ
                     ADLLGAHGRFADNVEVIPTRAGDPLLATDLSELAPDQVILSERAAERLDAKAGDTLRL
                     RVARRLNEVNERGERTLQVRAIVSSVRFARPAAFVSPELLMELEHYRDGYLVASLGAS
                     SGQALDALNVGYARARVYARDIDSVAPLERWLNEQRIETASRLAEINSVKAINHVLGL
                     IFSVIAGAALIGCIASLVGAFLANIDRKRRHLAVLRLLGFSSPAVSAYVVLQALVLSL
                     VGYLGGLGSYYLGSLLFDRLLVSSQATGAFICHITVWHGLVALLLAFLVAGLVALIGA
                     LRAIRIQPAESLREL"
     CDS             complement(243366..244064)
                     /codon_start=1
                     /locus_tag="PP4_02090"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAN52062.1"
                     /transl_table=11
                     /translation="MLDIKGLLVVRGEGSQAHRVRLDALCLQPGEVRAITGESGCGKS
                     TLLEAIGLLLKPEQLTHYRLGPQRQDVASLLASDQQPALAALRSRELGFVLQNGGLLP
                     FLSVRDNILLPRRLLGLPPASTAVDKAVEALRLAPLLGKLPQALSIGERQRVACVRAI
                     AHEPRVLLADEPTAALDPHNAERLFELLLQLVAELGLSALIVSHDWALVERFGLPRLG
                     AINGQGETRFEPMA"
     CDS             complement(244071..246023)
                     /codon_start=1
                     /locus_tag="PP4_02100"
                     /product="hypothetical protein"
                     /protein_id="BAN52063.1"
                     /transl_table=11
                     /translation="MKMRSIGAALLALSLSPALQAADKPLLQDGKKTLFQRVLTTPGC
                     KLSDNAGAAPGAAQPTFSRFYVYERAQADAREWLRVGPDTQGKSIGWLPADCTVEWKM
                     QLTLAFTNPANRDRLMFFKERNQLEGILNAPDPVSHVAPLRAKLKHGTEAPGVLAEEP
                     EYFVDLQKNFYLLPVLSGEEVMTEEGFRTRILNVASVSKADSAAAATPAPAQGAANQQ
                     LKAFSAAVVFVIDSTISMDPYIDRTREAIKRVYGQIEKENLGKQVKFGLVAYRSSTKA
                     VPGLEYVSKMYADPNTVKDGADFMAKVADLKQAKVSSSEFNEDAYAGVMSAVDQIDWS
                     QFGARYVVLITDAGAIDGGDKLSSTGLGAEQVKIEASNPGVALYTLHLKTPSGAKNHS
                     SAEAQYRTLSNYPGTNTSLYYPVNAGDVEAFGRKVDGLAAAITQQVRAAYMGEAAIGS
                     ANNAKADPAEKKMLEDAALIGHAMQLAYLGKANGTQAPPVFQAWISDRDLIKQNVPTT
                     DVRVLLTKAQLSDLSDVLKQILDAANEGMISPDEMFTRLRSVAATMGADPNQLKQGST
                     TRVADLGVLGEYLQDLPYQSEVLNLDEETWKGWDGLAQEKFIRSLSTKLRHYQRYNAD
                     VDRWVALAPGSDSRDNVYPVPLEMMP"
     CDS             complement(246020..247060)
                     /codon_start=1
                     /locus_tag="PP4_02110"
                     /product="hypothetical protein"
                     /protein_id="BAN52064.1"
                     /transl_table=11
                     /translation="MGIRVDVLPLDVNTPGQGLLRITGWEGTSEGLQCSLQSSQSHEF
                     LHDGGHWAKVAHWFRLDGMNAVAGAPAIETRIGPNLINPLLQASGTATFRIEVSNPQT
                     GRSDLGMVRINSAIIASVESGPALEKSPPPAPLPSATVIVEPPAVTTFEPVPVVTAEP
                     VPEAAPAPQPAPVAPPPKAPAKQGQKWLLPLLALILLALAAGGGWWWFNRSAGEATAA
                     VPPEDKPVAQADAAKPCSLGSMQGQTSLAFLQSCIQSKPDSAALLEVISLAKANDQCD
                     VAQRLYANRANAGDIQIATAYAHEYDPKYHQPSNCFKAPEAATAASWYETILSFDENN
                     AEAKQRYEELKP"
     CDS             complement(247066..249777)
                     /codon_start=1
                     /locus_tag="PP4_02120"
                     /product="hypothetical protein"
                     /protein_id="BAN52065.1"
                     /transl_table=11
                     /translation="MSDLTPKQQQLMGAWGAIHKGAGEALEWIEQVRGNAASVEAEAD
                     GLGLRLRRARNKAKNLQRSAGNPMTVGFFGLSQAGKSYLISALASDDHGKLESDFGGQ
                     VLDFIRHVNPPGGGGEATGVVTRFSHIAKPCLDVNYPVEITLFREIELVKILCNSWFE
                     DFDLERVDHSYREQDIQTALSEFEGQDAGQVQPGVSSDDVVALWDYLKSNYEKSTRVL
                     DDQYWPRAVKIAPRLALRERAKLFSVLWGGQAPITDLYLLLAGVLQKLDHVETLHAPI
                     SVFKQENISVTATPYNIMGVDLLSRLGTRHDVQVNVLPGRDGKVHTSVSISVAQLAAL
                     AVEVNFCLRTKPTASVAHGVDILDFPGYRTRNKYLSVDEAALKESADEVHPYWNLILR
                     GKVAYLFERYSEAQEMNALVICTSSVKQSDVISVGPVLTRWIHNTQGATPKERGQRAP
                     GLIWALTMCDGWANLELGKDDAHKFKAAERLMKITIIERFGSQEWMKEWSIGKPFDNT
                     YMVRKPRLKETAFIERDEQDQELRVIERYVDDIKQLRQYVVDLPAANRHIANTGAAFD
                     AMMTLNDGGISRFSTSFSSINDLDFKLARIEEQLEQCRTDLLEHGLNTWREEDFEQLL
                     NKKREKTQYLLDNLGADPDAISELIHALQVPVEQLRELYLGGVYDIDGIDGEAGEEPE
                     PAVRAPANKAPALNFGNVFGNTASATPAVAPKPVAKRLNSEQRFVRAALKAWIKHMRE
                     LGTQPLRLSSLRMSREVVEALVEELVSAVRRPAFIEQLDAAVMRRIFNGVRRDQIVQR
                     QVLTVQLAMRDFLSWFDLLGKPVSERPTALLGESQPVFGAYQTFAQGELPVLPKEPSN
                     QEQSFQIDWLSSLAWLTQENAKSGADPEITTEQRRQLAVLLNTFQAS"
     CDS             complement(249774..252851)
                     /codon_start=1
                     /locus_tag="PP4_02130"
                     /product="hypothetical protein"
                     /protein_id="BAN52066.1"
                     /transl_table=11
                     /translation="MLPEITQFEETVTLVSDTGIQFMDFALRLGPDGEQTGKFVQLNN
                     GMVPTRLLWSKEYKDFYEPEPDKVVQVEFDTSEESHFRLPMEDSLKLLDGVWLPIPVL
                     RFTPPYRFDEGPNNWARMRLVKLAEPDVDGNTHRLTLGFDSRTMPVVTGAPYLAPNED
                     DVRSGVAFKLACSAREYGWFLTHTWIRDWLVEVYTEARAEWTRERLDRDLQGNRHLGH
                     YLNLLSLLRRPVPAEQSNEKPKVEIPEIKVIANEANGIVKPIPVDLVLDVGNSRTCGI
                     LIEDHGQAGSGMRHNYVLALRDLSEPEKVYNQAFESRVEFTHAAFGKDHLSIKSGRHN
                     AFQWPTIARVGGEASRLASRNRGTEGSTGLSSPKRYLWDEKAYGHGWRFNTAYVKTDK
                     EPMAVAAPFANLINDRGQPLYLKPFDMPVFNPRYSRSNLMTFMLAEVVTQALTQINSP
                     AQRSRQGHARVPRLLNSITLTVPPGMPQAERSLLSNRLYEAIGLVWKSLGWHQDESNP
                     FKGKDVATRTPFPSVRVEWDEASCGQLVYLYNEVNENFAGHPEEFFATLARPDKLEHE
                     QITLATIDIGGGTTDLVITDYRLDRGTGGGAGANAHIVPNQRFRDGFKIAGDDILLDV
                     IQEFILPSFASALRNAGVPAPDALMSSLCGNGGATVQERLLRQQLNLQVFVPLGLALL
                     KAYEQFDPALPPAAVEQTWQQALGEAVVSDKVLAYVNAAVRREVGRDGTLDLLQTPIT
                     FDLEQVHAAFIGGQINVTRALAELCEVVAKYPCDMLLLTGRPSRLPGIQAFIRQRLPL
                     PPGRILPMQNYRTGGWYPFHRNGLIDDPKSTASVGAMICLLCSNHSVPNFYFRTAALK
                     PYSIIKHFGQIDAAGTIKYHDVLYHDLKSDKGLIELPIVGEGDERGTPWLEMRGDLHL
                     GYRQLATERWSASPLYTLRFTPSGKAAFSRAIGKNGEAPVLRIRLEVEQFEQEERDQG
                     LISDKLVIQKLESNIQDADFDFDRDLELSLNTMPTMSLSDSDYWLDSGNVKGK"
     CDS             complement(252872..254344)
                     /codon_start=1
                     /locus_tag="PP4_02140"
                     /product="hypothetical protein"
                     /protein_id="BAN52067.1"
                     /transl_table=11
                     /translation="MGETGQPVYRAALQIREAIRRKYPEHPELIEHLAIPQSDEQGRT
                     IDWYSDRPGDVIPWSSATEEERAPARAQLEVLQTKINALSNTLLGLDANGQPSATARK
                     AAEGDNAVFGKLLTCVVPFPDENFVYLVDGRPVLTFWGFIHAGAERSRQPLHCLYPRT
                     APIAEAVATPPVPPAAPIAPAAAAVAPAAAVARLPWWRNWRWLLPLLLLLALLLLLLF
                     GLRGCIPGVNLSGPGIPDFGRDTSASNNYQAQVPTQSSGIAGAANGATGVAGPDVAVS
                     TGNPASLPGGAADAGGAAPQGDSQAPSDNADTPAQGKPETPPAPEQPPAPEPEQASDT
                     PPPGGPEASTPGNTPPAPPQLADEQAQTSAQPPQPDDLSIPPDAADGNADFLNGNWAG
                     AGIQEAGTGKPLRLKYDFQNGKGQATVTRPDNVQCHAPVAAAMQDGLLSINSSGQAAC
                     ADGSSYDLPQVGCKANANGAADCNANYGAKGFDIQMKKAG"
     CDS             254603..255508
                     /codon_start=1
                     /locus_tag="PP4_02150"
                     /product="hypothetical protein"
                     /protein_id="BAN52068.1"
                     /transl_table=11
                     /translation="MSLWDDLKKKAYDANPELAAKAAQALEKAKDLAVEAGQKAAPLI
                     KEASDKAAGYAQEKTPLLKAQALKAIDDAKQRRAQLQEQAKRDKAARAEMIRTMYDIT
                     LTPEDVNFVEEPFNHFERQLMFFVRNGEVLESEKRNQTHLDAYHSHRSTGGHMWQGTG
                     HTGSSSSTMQVTAHNVQEHEFWVRLENGTEACFQLNNNGVRLRPGQYVSMAFVRNANQ
                     DMGQMVALYNHNAGQNFVTLSPRQINQQFQLYLKEPGIFNANEVNGTRDRLLQALDKR
                     LGELARYMALHGDRRAGQLIEGHAE"
     tRNA            complement(255552..255625)
                     /locus_tag="PP4_t0030"
                     /product="tRNA-Arg"
     CDS             255840..256589
                     /codon_start=1
                     /locus_tag="PP4_02160"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAN52069.1"
                     /transl_table=11
                     /translation="MAELLPLSPVPLYTQLKELLRERILDGTYPPHSRMPSESELGKA
                     FDVSRITVRQALGDLQKEGLIFKIHGKGTFVAKPKAFQNVSTLQGLGESMTQMGYEVI
                     NRLRSFRHVPANALVAARLQVEEGSLVTEIRRVRLINREPVSLELTWLPKAVGEKLEK
                     ADLVTRDIFLLLENDCAIALGHADLAIDAVLADSDLTQALDVEEGSPIMRIERLTHAA
                     DGTPLDFEHLYYRGDAFQYRLRIDRQKGGKA"
     CDS             256586..258310
                     /codon_start=1
                     /locus_tag="PP4_02170"
                     /product="putative oxidoreductase"
                     /protein_id="BAN52070.1"
                     /transl_table=11
                     /translation="MSIHTQDYDIIIIGGGTAGPMAAIKAKEQDKSLRVLLLDKANVK
                     RSGAISMGMDGLNNAIIPGHATPEQYTKEITVANDGIVNQATVHAYATHSFETIEQLD
                     RWGVKFEKDETGDYAVKKVHHMGAYVLPMPEGHDIKKVLYRQLKRARVEISNRMVCTR
                     VLLDGEGAAAGVLGFDCRSGEFRVVRAKAVILACGAAGRLGLPSSGYLMGTYENPTNA
                     GDGYAMAYHAGAELANLECFQINPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDY
                     WSGQMMWEFHQELEGGNGPVFLKLDHLAEETIQNIEEILHSNERPSRGQFHAGRGTDY
                     RQHMVEMHISEIGFCSGHSASGVWVNEKAETSVKGLYAAGDMAAVPHNYMLGAFTYGW
                     FAGVNAAHYVAGRELAEVDAEQVERERARVFAPLQREHGLPPAQVEYKLRRMVNDYLQ
                     PPKVTKKMQIGLARFAEIERDLEQMKASNPHELMRAMEVSVIRDCAEMAARASLFREE
                     SRWGLYHHRVDFPERNDSEWFCHCHLKKGEHGEMTSFRKAVEPYLIALDADEQTAYDR
                     LRVKADAA"
     CDS             258473..258718
                     /codon_start=1
                     /locus_tag="PP4_02180"
                     /product="putative 4Fe-4S ferredoxin"
                     /protein_id="BAN52071.1"
                     /transl_table=11
                     /translation="MAYQPQEIFFRSSAPVTIDEDKCIAEKGCTVCVEVCPMDLLAIN
                     PATQKAYMAFDECWYCMPCEKDCPTGAVKVDIPYLLR"
     CDS             258838..260244
                     /codon_start=1
                     /locus_tag="PP4_02190"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN52072.1"
                     /transl_table=11
                     /translation="MRLVATVAGLALALTGLSASAENIRIAIGTQDTTINCATGGLLI
                     RELGLLDKYLPHDGKYKDATYQVEWKNFTSGAPLTNEMVAGKLDFGAMADFPGSFNGV
                     AHLDAGKRSLFISVLSGSVHGSGNGIVVPAASSVQSLAELKGKTISVPFASTAHGMLL
                     RAVAAQGWDPQKDVRIIAQAPEIAGSALRSNRIEAHADFVPFAELFPNRGFARKIYDG
                     AQANAPTFHGALVDADYAKKYPEVVTAYLRASLEADRLIAAQPEKYSELIEKVTGIEA
                     EVNYLFHGPLGLQTRDLTWKPEYRQAVATSIDTLKLLKKTDRGLDTDRFIDDQYIRAA
                     FKEAGLDYDKALKDYDAQPLKANDALTGKPITDFSRLAQIWVRGEDKVRHYASPEAAL
                     GALAQLEQEGKDIRAIYAQAADSGIKLLANQAWFVRNGKGELAAFLLKDQAEQYAKAH
                     GGEALDFVSANQKLVAQR"
     CDS             260260..261042
                     /codon_start=1
                     /locus_tag="PP4_02200"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAN52073.1"
                     /transl_table=11
                     /translation="MTRNLKRWPLRLASLLACLLFWQVAANVKLDLGLLTFTYVPTPR
                     AVLDAAWQLLTSSTLLAHLGSSLSRVFAGYATAALVGVALGLLIGRLKWAEDTLLPPL
                     EVLRPIPAVAWIPLAILMFPSSELSMVFITFTGALFPILLNTVHGVEAVDPRLVASAR
                     SLGAGRWAILREVVLPGALPSIVTGLAIGMGTSWFCLVTAEMISGQFGIGYYTWESYT
                     LQNYPDIIVGMLLIGVLGMGSSALVKRLGALATPWYRTRRAS"
     CDS             261042..261893
                     /codon_start=1
                     /locus_tag="PP4_02210"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAN52074.1"
                     /transl_table=11
                     /translation="MNSYQQAQGRIDGRGLSIRLGQGSEAFEAVQRLDFAVEPGEFVC
                     ILGPSGCGKSTLLGALAGHLVPSSGQLNVDSQPVAGPSPQRGMVFQHHTLLPWRSVLD
                     NVAFGLKMQGLGRAERHRQAREMLQLVGLADFAGRWPNQLSGGMQQRAEIARVLINRP
                     RLLLMDEPFGALDAQTRARMQELLLDIWASIRTTVVFVTHDIDEALFLADRILVMSPR
                     PGRFIEDLRLDFARPRRASLLTSPEFTHLKRHCLALLRHEEGRELPRLTPLGLPDTDH
                     PPLRIAL"
     CDS             261890..262858
                     /codon_start=1
                     /locus_tag="PP4_02220"
                     /product="hypothetical protein"
                     /protein_id="BAN52075.1"
                     /transl_table=11
                     /translation="MTDRTTANPEIVALLPRLDATDAGVRRIALIELADLEDPDGLPW
                     LTDALLVDAADEVRAEAARLLEAWEEPEVVQALCAALADAAEPVRLAAAQSLSELKSL
                     EAGQLILPWVKHADAFVRASALRALRELRLEDAADPALLALADDDAAVRREAVGILGW
                     LKHQPALLALAALAEAEPDTEVRRAAIGALGLARDNSVLPALVAALTDQAWQVREEAA
                     TTLGKVGQGQAGPALVDALADDFWQVRLRAARSLGRLRYAAALDALGGLLGHGIANLR
                     KEAALALGELGQARALPVLQAAEADSDPEVRKAVRIALAQLRGAAR"
     CDS             262855..263178
                     /codon_start=1
                     /locus_tag="PP4_02230"
                     /product="hypothetical protein"
                     /protein_id="BAN52076.1"
                     /transl_table=11
                     /translation="MNAPQAIRNLRGPGQLVLQWEDCEHSLSHTRLRGACPCSQCRAA
                     RLSGAISLVRDDVRVVQIESQGYGVQLVFSDGHERGIYPWAYLRDLVSTEIVAGHSQC
                     NQLRP"
     CDS             complement(263152..264015)
                     /codon_start=1
                     /gene="atsC"
                     /locus_tag="PP4_02240"
                     /product="sulfate ester ABC transporter ATP-binding
                     protein"
                     /protein_id="BAN52077.1"
                     /transl_table=11
                     /translation="MNAFNTSHLQAANQPDTTPPLVSFEGVGKVFSVDGQPLEAIRNF
                     NLSINEGEFIAIVGASGCGKSTLLRLLVGLDTEYSGSIRVDGRAVSGIDGERGIVFQE
                     HRLFPWLNVEQNIALGLVNESLTQGERARRVHEFVQLVGLVGFESAYPHQLSGGMAQR
                     VAIARGLVASPRILLLDEPFGALDALTRQQLQDELLAIRERAGITTLLVTHDAEEATY
                     LADRVVVLEPRPGRIKSVVEIDLPHPRLRTGVALHGLREKVLHQITGDGGYLPPPVRR
                     VEGLRPELIAL"
     CDS             complement(264012..265451)
                     /codon_start=1
                     /gene="atsB"
                     /locus_tag="PP4_02250"
                     /product="sulfate ester ABC transporter permease protein"
                     /protein_id="BAN52078.1"
                     /transl_table=11
                     /translation="MSEQILPAPALVWQSALEFGSGELWGHLWISLQRLFWGLAAGIA
                     SGLLLGVWLGASRRAQTLVLPTFVALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVV
                     VPVTLHTLVGVRDAQPKLREAAAALRLPRHLLFLRLLLPAALPAFLTGVRLALATGWT
                     SLLAVELLASSEGIGYLMVWGRQLFMLDLVMLCILVIGLVGAVLERSFSALEKRLLYW
                     PQPATGEQQRGPVPRGWQSLLLPLGLLALWQASNSFGWVDPNILTSPLEVLRTLLVGL
                     ADGSLPQALLLSLERTLSGLLLGGAAGLLAGLLLGLSSAAERVFGPSLSALRQVALFA
                     WVPLLTAWFGLGEGAKLVFVGLAAFFPLLIATQRGIASLSPQLGEAARTLRLNLWQRL
                     RLLVLPGAAPAIFAGLRLSLIYAWLGTIGAEYFMPSDGGIASLMIGAQQLFRMDQVMA
                     AMVLIGLVGALLGTLGQRLESRATRWRTA"
     CDS             265914..266951
                     /codon_start=1
                     /gene="atsR"
                     /locus_tag="PP4_02260"
                     /product="sulfate ester ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN52079.1"
                     /transl_table=11
                     /translation="MKTPLRHLITALGLAFSLGAHAAEPAKPDSIRIAVPDLSAGSKP
                     SAGGVVDVLRDQQLLEKEFAKDGIRIDWHFFKGAGPVVNEALANGQADFAYLGDLAAI
                     VGKANGLDTRVLSAGVRGVKSYLGVVPGSGIKTLHDLKGKRVAVFRGTANQLSFASAL
                     ASQGLTERELKVINLDFNAANAALAAKQIDATWGLSNLLSLRERGLVELPVNSRDLEG
                     AGSTQAVLLGTGDFIRKYPELVQRLVNAQEQASTWLRDEHNRAAYIDLVASNANWPRS
                     ILSDDLAKEDLAHYFDPRLDAGFVGQLQQGVDLAAKERLIRRGFQVADWIEPRFLDAA
                     LKQEQAVQAAR"
     CDS             266991..267896
                     /codon_start=1
                     /gene="atsK"
                     /locus_tag="PP4_02270"
                     /product="alkylsulfatase AtsK"
                     /protein_id="BAN52080.1"
                     /transl_table=11
                     /translation="MSNAALATAPQPLELDIHPVAGRIGAEIRGVQLSADLDAATIEA
                     IQAALVQHKVIFFRDQTHLDDQSQEGFAKLLGEPVAHPTVPVVDGTSYLLQLDGAEGQ
                     RANSWHTDVTFVDAYPKASILRSVVAPASGGDTVWANTAAAYQELPEPLRELADKLWA
                     VHSNEYDYASIKPDVDPAKLERYRKVFTSTVYETEHPVVRVHPISGERALQLGHFVKR
                     IKGYSLADSQHLFAVLQGHVTRLENTVRWRWQAGDVAIWDNRATQHYAVDDYGTQPRV
                     VRRVTLAGEVPVGVNGQLSRTTRKG"
     CDS             complement(268037..268951)
                     /codon_start=1
                     /gene="abgR"
                     /locus_tag="PP4_02280"
                     /product="abg operon transcriptional regulator"
                     /protein_id="BAN52081.1"
                     /transl_table=11
                     /translation="MHIDLRQLRHYIALVEHRSFVAAAAAVNLSQSAFSRSIQTLEHN
                     IGCRLVDRASKELAPTRQGLLVLEHSRRLVHGAHNLVNEIHQFNGATTGVVRFGSGPA
                     PAGGLVPRAVARFVAEYPAARTCFQVDNWQALNRKLVAEEIEFFVADTRQFESDPDYQ
                     VHKLTPQRWHFCCRAGHPLTEQEAVQARDLFDYPMATTFRPPNIRKILSDLSGRQDFL
                     PAVECEHGYALLNVVMHSDTIGIACNANLRPYQREGGLVQLKLADLTPEQEEACHTRY
                     GVVSRVGYGLSPLAQGLVRQLIACDTGL"
     CDS             269144..271480
                     /codon_start=1
                     /locus_tag="PP4_02290"
                     /product="putative TonB-dependent receptor"
                     /protein_id="BAN52082.1"
                     /transl_table=11
                     /translation="MSGLSSWPARASRFTLQPLAAGVLLAVSSGSFAEEPVSATPAVE
                     QEAKLGTVTVNARRREETAQSVPTPISVLDSETLETQRIYRVQDLQQLVPSTNVAYVH
                     ARQSSISIRGLGNNPASDGLEGSVGIYLDNVYLGRPGMAVFDLLDVEQLEVLRGPQGT
                     LFGKNTTAGVLNINTRKPTFHREGSIQQSIGEDGYLQTQGSFSGPISETLAGRISAYR
                     TEDDGYVKNIHNGDDLNGGKRQGFRTQLLFKPSDTFNLRWIGEYNEEDSNNGILSLYS
                     TGPTINGVNRYESLAAQAGATLVSGKDRKVNFDADQQVTVFQGGTSVEANWNLPNDFT
                     LTSITAYRWWDFTPRNDDGLDVPVFYSAGVSVRDKQYSQEIRLASPTGGAFDYVLGAY
                     YFKQDLDNKSFTYYGPQADVWNLTPAGALNNVNTIGDGHIDTDSYALFAQGTWHVTDR
                     LDFTAGIRGTYEEKSAWVTRDAPEGGAAVTGAAATARQARIGAYDSGDLNQYSFSPSG
                     LLGLSYRFNEQLLGYATLTHGEKSGGVNLTVGAAPRLGTDSLLVGTERVNNAELGLKS
                     TLFDGRLQLNSNLFWAEVHGYQANVYDQINRVQYLANAGSVRSRGLEFEATALPIRGL
                     TVNFNGSWNDVRYTEYKDAPCPPEVSLANATATCDLSGHQVVGASKYIANLNTQYKWQ
                     ATQHVEPYVTASYAFRSKAVGTIDDSDFGQIPSYALVNLSAGVRLDQGDGVVDLSLWV
                     KNAGDKTYFTSLWNSANGGYAGVLGTPRTFGATARYDF"
     CDS             271498..273174
                     /codon_start=1
                     /locus_tag="PP4_02300"
                     /product="hypothetical protein"
                     /protein_id="BAN52083.1"
                     /transl_table=11
                     /translation="MNAKTETPALPEGACLTAKVPERDQALLGDVVVNPYRLAPLTAI
                     IRDGGRSLSDAHVRVQGRGERGVDIVYDVSDRSLWTYGGIPVFGLYPDYVNQVEVTYK
                     LDGERIREQYQIYAPAVRLPVVARQTAALPEVQPVKVAPGFEKRLYLFNHLQGDIPGG
                     RAFKWNALGGAAEWDQVGNNWIADSNGDVRWYLDIEQIHDSNRRDGLGGTMGFQQTRD
                     GKLIWGQGQTYSKYDLLGRRIWQRSLPDKFADFSHEIRETANGTYLLRVGTSDYRRPD
                     GKRVRSIRDHIIEVSEAGDVLDFWDLNQILDPYRGDLLETLGKAAIQLPEGVQKQDDR
                     LANELAEGNLPFGDTPGVGTGRNWAHVNAIDYDADDDSIIVSARHQGVVKIGRDKQVK
                     WILASPQGWPERLRDKVLTPVASENFDWSWTQHTAWLTGKGTLTVFDNGWGRDFAPTK
                     LAGNYSRAVEYRIDEAKGTVEQVWEYGKERGDEWYSPVTSVVAYRPETDTQFIYSASV
                     NFLTPEKLTTTVLNEVRRGTQEVLVELKVHSRQPGSVGYRALVIDLAKAF"
     CDS             273513..274955
                     /codon_start=1
                     /locus_tag="PP4_02310"
                     /product="putative glutarate-semialdehyde dehydrogenase"
                     /protein_id="BAN52084.1"
                     /transl_table=11
                     /translation="MQLKDAQLFRQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPK
                     MGTAETRRAIEAADKALPAWRALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPL
                     AEAKGEIAYAASFIEWFAEEAKRVYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPA
                     AMITRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAGIPAGVLSVVTGSAGEVGG
                     ELTGNSLVRKLSFTGSTEIGRQLMQECAKDIKKVSLELGGNAPFIVFDDADLDKAVEG
                     AIISKYRNNGQTCVCANRIYVQDGVYDAFAQKLAAAVAKLKIGNGLEDGTTTGPLIDG
                     KAVAKVQEHIEDAVSKGAKVLSGGKLIEGNFFEPTILVDVPKTAAVAKEETFGPLAPL
                     FRFKDEAEVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGINTGLISNEVAPF
                     GGIKASGLGREGSKYGIEDYLEIKYLCISV"
     CDS             275138..276415
                     /codon_start=1
                     /locus_tag="PP4_02320"
                     /product="putative 5-aminovalerate aminotransferase"
                     /protein_id="BAN52085.1"
                     /transl_table=11
                     /translation="MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGREL
                     IDFAGGIAVLNTGHLHPKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDF
                     DKKTLLVTTGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGM
                     GLMPGGVFRALFPNELHGVSVDEAIASVERIFKNDAEPKDIAAIILEPVQGEGGFLPA
                     PKELMKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFP
                     LAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALAVIEVFEEEKLLDRSKAVGERLTT
                     GLREIQKKYPIIGDVRGLGSMIAVEVFEKGTHTPNAAAVGQVVAKARDKGLILLSCGT
                     YGNVLRILVPLTAEDALLDKGLAIIEECFAELA"
     CDS             276554..277813
                     /codon_start=1
                     /locus_tag="PP4_02330"
                     /product="putative two-component response regulator"
                     /protein_id="BAN52086.1"
                     /transl_table=11
                     /translation="MSAVDPTPPSVLIVEGDPWVRDMLSEMLLSVRCDARLQVCADGA
                     QALSALSSKPDLIIAARELAGVDGLDLLRKVRAKGPGLPFILMSNRSDSASVHEVLPL
                     HPTAYLSKPLNLDNLRKRLEELLVAVGEEIACPVPALQAGASLPAYLEQRRATADGGP
                     LLADVQVAIKRALNPQGLNLKVLEEEVRSDPQVTAVLIAAANSAALHREAPVQTLLQA
                     LNKLGSTQSMNLILGMTLKRSARLSDPLLAQHAAGYWDLSLHTAEYGRTLARMLELDE
                     GRCYCAGLLHCLGDLAVLRCLQEWRLAGGELDERNVQQSLDEFGAAFGSALRTRWRLP
                     LALRELIAAIYQLGGGVYSREILAMNLAGQLSRLPAEQGLEKVASGKTARLLKLGLPE
                     LKRLRKVDNPEVKPREEPPAAEAEVPS"
     CDS             complement(277956..278984)
                     /codon_start=1
                     /locus_tag="PP4_02340"
                     /product="putative sensory box protein"
                     /protein_id="BAN52087.1"
                     /transl_table=11
                     /translation="MLAARFYVETRFVHMAKNIPTILPGTSPPEAAQTLLALLHAQGE
                     VARLSERDQLFSSLLDSVNAVLWAFDWETRQVLYVSPAYERIFGRPVSLVLADYNEWR
                     DSIYPDDLEFAERSLAQVLIKGAVEDREYRILNADGQVRWLSDKCYINQQREDDRVII
                     VGIAEDITEKKQLESELQRLATTDVLTQSSNRRHFFECAQQAFDTAREDGTPLAFLLL
                     DIDDFKVINDSYGHQEGDQVLQRIADSGKAVLRRGDLFGRIGGEEFAAIFPGCDAQMA
                     EQVADRLQREIQRLSFNHGEQTYGVTVSQGLTGLTEEDVALDSLYARADAAMYQAKRQ
                     GKNQIVRG"
     CDS             complement(279084..280268)
                     /codon_start=1
                     /gene="desA"
                     /locus_tag="PP4_02350"
                     /product="fatty acid desaturase"
                     /protein_id="BAN52088.1"
                     /transl_table=11
                     /translation="MWYYGLLDLSAWQLVGITLLMTHVTIVSVTVYLHRYSAHRALEL
                     NGALKHFFRFWLWLTTAQNTREWTAIHRKHHAKCETPDDPHSPVHKGLGTVLRKGAEL
                     YREEARNPETLRIYGKNCPDDWIERNLYSRYKLGGIALMAVIDLLLFGTIGITIWAVQ
                     MMWIPFWAAGVVNGLGHALGYRNFECRDAATNLVPWGIVIGGEELHNNHHTYPNSAKL
                     SVKRWEFDMGWAWIRLFCLLRLAKVQRVAPIAHRVAGKASLDMDTAMAILNNRFQIMA
                     QYRKLVIGPLVKQELARVDASVRHHFRRAKRLLSRETSLLEDRHHVRIESMLAHSQAL
                     KTIYEKRLALQQIWARTSANGHDMLSAMKDWIHEAETSGIHALRDFAAQLKTYSLRPT
                     GA"
     CDS             complement(280307..280510)
                     /codon_start=1
                     /locus_tag="PP4_02360"
                     /product="hypothetical protein"
                     /protein_id="BAN52089.1"
                     /transl_table=11
                     /translation="MSGGIAHQKRMAIIKVLLLCGSGHAREDGNSAHGTGVAGVRGHA
                     RSHMDGLKYRVVSFDWFYFPAKG"
     CDS             280509..282404
                     /codon_start=1
                     /locus_tag="PP4_02370"
                     /product="putative sensory box protein"
                     /protein_id="BAN52090.1"
                     /transl_table=11
                     /translation="MSVSVRDALRMAALYVVLSILWLALAEVMLHGMTDDPLALTVGR
                     QINVVLWVLFSAVLIYVSRVRLLNFIGVGARLRCEDRERLRMAAAVFDSTLEGVLVTD
                     RQGLIVHVNRAFMRITGYQQDEVIGHRPSKFKSGRHGQAFYQQIFATLAEQGEWSGEI
                     WNRRKSGEIYPQWQTICAIRDDDGELSHYVAVFSDISAIKHSEQELAYLAHHDPLTGL
                     PNRLLFTDRVEQALAAAQANKRGCALLLLDLDHFQSINDGLGHTIGDQLLKLVGERLG
                     EVLGNGVTLARLGGDEFGVLAENCQQVGQAGKLAQCIIERMREPFVFEDNRLFISASV
                     GISLFPSDALSAEQLLRNADAALYKAKSNGRACYALYTEELTAHAQHRVETAGELRRA
                     LEQNELRAYFQPVHDLATGRQVGVETLVRWQHPQRGLVPPGEFIPIAERTGLIAEIDT
                     WVLRQACRQMVQWQAEGRQLAFVAVNISSRLFGQHELYRQVAEVLHETGLAPALLELE
                     VTESAVMEDPEVALEQLHRLRELGVTLAIDDFGTGCSSLLRLKRLPVQKLKIDQGFVA
                     GLPLDEDDIAIVRVIIALARSMGMQVHAEGIEQAEQASFLLLEQCQLGQGYWFGRPVP
                     AEDLRWD"
     CDS             complement(282432..283076)
                     /codon_start=1
                     /locus_tag="PP4_02380"
                     /product="putative D-methionine ABC transporter permease
                     protein"
                     /protein_id="BAN52091.1"
                     /transl_table=11
                     /translation="MWFDRLLEGLLDTLLMVGVSSLIALLVGVPMAVLLVTSDKGGIF
                     EAPLLNRVLGAFVNLFRSIPFLILMVALIPFTRLVVGTTYGVWAAVVPLTIAATPFFA
                     RIAEVSLREVDHGLVEAAQAMGCRRWHIVWHVLLPEALPGIVGGFTITLVTLINSSAM
                     AGAIGAGGLGDIAYRYGYQRFDSQIMLTVIAMLVALVALIQLGGDRLAKGLNKR"
     CDS             complement(283066..284175)
                     /codon_start=1
                     /locus_tag="PP4_02390"
                     /product="putative D-methionine ABC transporter
                     ATP-binding protein"
                     /protein_id="BAN52092.1"
                     /transl_table=11
                     /translation="MSQASALRAPTPQPLPPTVKEQALRPEVNEAHVRFIGLGKTYPG
                     QTQPALQGIDLNIRHGEIFGIIGRSGAGKSSLLRTINRLEQPSQGRVLIDQVDIAPFD
                     EDHLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVAKAERQRKVRELLELVGLQ
                     EKHHVYPAQLSGGQKQRVGIARALVHDPEILLCDEATSALDPETTASILELLRDINQR
                     LGLTIVLITHEMAVIRDICHRVVVLERGEVVEQGEVWRVFGAPRHEVTRTLLAPLQAR
                     LPAALQASLRASPVSRDGALVLKLTLLGEPELSALFNDLGGRVRLLQGGVETIGEHAL
                     GQLILSVQHSPHDTHQLLERARRWAEDVEVLGHVV"
     CDS             complement(284177..284977)
                     /codon_start=1
                     /locus_tag="PP4_02400"
                     /product="putative D-methionine ABC transporter
                     substrate-binding protein"
                     /protein_id="BAN52093.1"
                     /transl_table=11
                     /translation="MLEKLFRPVAAFALTLGLTASALAAEPLKIGTTSAFAIPLEAAV
                     EEAHKQGLEVKLIEFSDWIAPNVSLNSGDIDVNYFQHIPFLENAKAAAGFNLVPYASG
                     IINNVGLYSKKYKSFAELPEGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATE
                     DDIVANPKKLRILQVEAVQLVRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKE
                     YVIQFVIRPQSKDDPRLARFVDIYQHSPVVRAALDKAHGKLYQAGWEG"
     CDS             complement(284970..286361)
                     /codon_start=1
                     /locus_tag="PP4_02410"
                     /product="putative monooxygenase"
                     /protein_id="BAN52094.1"
                     /transl_table=11
                     /translation="MARQILLNAFNMNCIGHINHGLWTHPRDTSTQYKSLEYWTNLAR
                     LLERGLFDGLFIADIVGTYDIYGQSLDVTLKESIQLPVNDPLLLVSAMAAVTRHLGFG
                     LTANLTYEAPYLFARRLSTLDHLSNGRVGWNIVTGYLDSAARAMGLAQQPEHDRRYDQ
                     ADEYLQVLYKLLEGSWADDAVVADREQRVYAQPDKVRKVSHHGEFYNVEGYHLSEPSP
                     QRTPVLFQAGSSQRGLAFAGNHAECVFISGQDKAATRAQVDKVRAAAQAAGRDPQAVK
                     VFMGITVIVAATEQAAQARHAEYLGHASPEAGVAHFAASTGIDFAAYGLDEPIGFSQG
                     NAIQSATRQLQDNAWTRRRLLEQHALGGRYVTLVGSPEQVAEQLIAWIDETGLDGFNL
                     TRTVTPESFEDFIDLVIPQLQQRGRYKTAYAEGTLREKLFQADHPHLPADHPGSTYRF
                     TPTPAPTGALHHA"
     CDS             complement(286361..287542)
                     /codon_start=1
                     /locus_tag="PP4_02420"
                     /product="putative oxidoreductase"
                     /protein_id="BAN52095.1"
                     /transl_table=11
                     /translation="MTIAIITSDAQALAVAEDIAQQLRRDSALRDRERRLPHAELELF
                     TRSGLWAISVPKAFGGAGVSNVTLAKVIARIAQADGSLGQIPQNHFYGLEVLRVNGSP
                     EQQQRLYAEVLAGRRFGNALAELGTKTANERTTRLSRDGEGFRINGRKFYSTGAIYAQ
                     RIPTSVVDDQGVQQLAFVPADSQGLQVIDDWSGFGQRTTGSGSVVFDNVYVSAADVVP
                     FQSAFERPTPVGPLAQILHAAIDTGIARAAYEDALHFVRTRSRPWVDSGLDKATDDPL
                     TLKSFGHLAIRLHAAEALLERAGEYLDRARDDSTADNVAAASIAVAEARAISTEISLA
                     AGTALFELGGSQATLAEHNLDRHWRNARVHTLHDPVRWKYHAIGNYYLNDANPPRRGT
                     I"
     CDS             complement(287684..288925)
                     /codon_start=1
                     /locus_tag="PP4_02430"
                     /product="putative oxidoreductase"
                     /protein_id="BAN52096.1"
                     /transl_table=11
                     /translation="MSSQPNTQFHSDLDSSPLLLPAKVLRNDAEALQAARELAEVARE
                     QAARRDQQRKLPWAEIELFTRSGLGSISVPKAHGGPDVSFETVAEVFRLISAADPALG
                     QIPQNQFGMLQLIRLTATEAQQALIFRSVLDGWRIGNAGPERGTKDTLTLKARITRAG
                     DSYRISGEKFYSTGALFAHWVAVKALDDEGRQRLAFVRRGTPGLRIVDDWSGFGQRTT
                     ASGTVLLDQVPVDAELVIDNWRQRDIPNIQGAASQLIQAAIDAGIAEAAIDDAITFVR
                     EKSRPWIEANVDRASDDPYVIADIGRLKLELHAAEALLRRAARVLDEVNAAPIDAASA
                     ARASIAVAEAKVLTTEIALQASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRW
                     KYHAVGAYHLNGTLPARHSWI"
     CDS             complement(289252..290010)
                     /codon_start=1
                     /locus_tag="PP4_02440"
                     /product="cystine ABC transporter ATP-binding protein"
                     /protein_id="BAN52097.1"
                     /transl_table=11
                     /translation="MIEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFL
                     RCLNLLETPDAGQIKIGAISIDANRPLGGQQSAIRRLRQQAGFVFQNFNLFPHRTALE
                     NVIEGPVIVKKTPREQAIELGRRLMAKVGLAGKEDAYPRRLSGGQQQRVAIARALAME
                     PEVILFDEPTSALDPELVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKG
                     VIVEQGEAKALFAAPKEERTRQFLRKFLGTAASE"
     CDS             complement(290013..290681)
                     /codon_start=1
                     /locus_tag="PP4_02450"
                     /product="cystine ABC transporter permease protein"
                     /protein_id="BAN52098.1"
                     /transl_table=11
                     /translation="MIAESLQLVVDSAPFLLKGAGYTVLLSVGGMFFGLLLGFALALM
                     RLSKILPLNWLARIYVSFFRGTPLLVQLFVIYFGMPQIGIELDPIPASLIGLSLNMAA
                     YICEILRAAISSIDRGQWEAAASIGMTRVQAMRRAILPQALRTALPPLGNSFISLVKD
                     TALAATIQVPELFRQAQLITARTFEVFTMYVAVAVIYWVLCSILAHFQNRMEARVNQH
                     DQEQ"
     CDS             complement(290678..291472)
                     /codon_start=1
                     /locus_tag="PP4_02460"
                     /product="cystine ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN52099.1"
                     /transl_table=11
                     /translation="MSKFAKPLLNASLAILLGAGLLGQAFAGEQLKTIQEKGVINVGL
                     EGTYPPFSFQDENGKLAGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVV
                     NQVTISEERKKKYDFSEPYTVSGIQALILKKKAEQLNIKSAQDLAGKKVGVGLGTNYE
                     QWVKQDVPKAEVRTYEDDPSKFADLRNGRIDAILIDRLAALEYAQKAKDTELAGDAFS
                     RLESGVALRKGEPELLAAINKAIDKLKADGTLAKLSEKYFGADVTK"
     CDS             291863..292795
                     /codon_start=1
                     /locus_tag="PP4_02470"
                     /product="putative serine acetyltransferase"
                     /protein_id="BAN52100.1"
                     /transl_table=11
                     /translation="MSEQPSSAHWQLHNIVSGLRGAREQWRTRNGRSIGEQGGRELPS
                     REAMRQILEQLCGALFPMRLGPVDLREESEDFYVGHTLDAALTALLTQARLELRYAAR
                     QSKAELASVDGHALKLIQGFAAALPELRVLLDTDVLAAYHGDPAARSVDEVLLCYPGI
                     LAIIHHRLAHHLYKAGLPLLARISSELAHSATGIDIHPGAQIGPSFFIDHGTGVVIGE
                     TAIIGERVRIYQAVTLGAKRFPSDESGTLHKGLPRHPIVEDDVVIYAGATVLGRITIG
                     KGSTIGGNVWLTRSVPAESNITQANLQLDCQDKN"
     CDS             293087..295090
                     /codon_start=1
                     /locus_tag="PP4_02480"
                     /product="putative choline transporter"
                     /protein_id="BAN52101.1"
                     /transl_table=11
                     /translation="MSAPNPSAANGKIRMNPPVFYFAASFILIFGLVVISNPQAAGDW
                     LLAAQNWAANTVGWYYMLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGML
                     FAAGISITLFFFCVSEPLTHMLQPPQGEAGTAEAGRQAMQILFLHWGLHGWGVFAFVG
                     MALAYFAYRHNLPLALRSALYPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLH
                     LNAGLDYLFGISHSQWVQVILITLMMGAAVAVAVAGVEKGVRVMSDINLFLACALLLF
                     VLFAGPTQHLFNTLIQNLGDYLGALPRKSFDVYAYGDNRDWLGGWTVFYWAWWIAWAP
                     FVGLFIARISRGRTIREFVFGVLLIPLGFTLAWMSIFGNSALDQVINHGMTALGQSAL
                     DNPSMSLYLLLETYPWSKAVIATTVFISFVFFVTSADSGTVVLSTLSAKGGDADEDGP
                     NWLRIFWGAMTALITSALLFAGSIDSLKSAVVLTSLPFSLILLCMMWGLHKAFYLESQ
                     RQIAQMHSLAPFAQSRRGRGGWRQRLSQAVHFPSRDEVYRFMDDVVRPAIADVREVFE
                     QKGLVIITQDDPSHDNVSLKIGHGEEQPFIYQVQMRGYFTPSFALGGLGTQELKNRRY
                     YRAEVHLSEGSQNYDLVGYSKEQIINDILDQYERHMQYLHLVR"
     CDS             complement(295214..296047)
                     /codon_start=1
                     /gene="tauD"
                     /locus_tag="PP4_02490"
                     /product="taurine dioxygenase"
                     /protein_id="BAN52102.1"
                     /transl_table=11
                     /translation="MSLTVTPLSPALGAQISGVDISRDITAEERDAIEQALLKHQVLF
                     FRDQPINPEQQARFAARFGDLHIHPIYPNVPETPQVLVLDTAVTDVRDNAVWHTDVTF
                     LPTPALGAVLSAKQLPAYGGDTLWASGIAAFEALSAPLREMLDGLTATHDFTKSFPLE
                     RFGTTPEDLARWEATRRNNPPLSHPVVRTHPVSGRKALFVNEGFTTRINELSELESDA
                     LLRLLFAHATRPEFSIRWRWQENDVAFWDNRVTQHFAVDDYRPNRRVMHRATILGDAP
                     F"
     CDS             complement(296096..296935)
                     /codon_start=1
                     /gene="tauC"
                     /locus_tag="PP4_02500"
                     /product="taurine ABC transporter permease protein"
                     /protein_id="BAN52103.1"
                     /transl_table=11
                     /translation="MSSLDLPVAGKHNAQTRPAAKQRRPLSTRWISALTMVSLLLVWW
                     LVTAAGWIEPLFLPSPGDILARAWTLLTQGYMDASLWQHLGASLGRIGLALVAATLTA
                     IPVGIAIGYNRVARGILDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAP
                     IAIATATGVRTVDPAKLRAAQSLGATKTQLIRHVILPSALPDILTGIRIGLGVGWSTL
                     VAAELIAATSGLGFMVQSAAQFLVTDVVVLGILLIALIAFALEMSLRALQRKLVPWHG
                     QSH"
     CDS             complement(296932..297720)
                     /codon_start=1
                     /gene="tauB"
                     /locus_tag="PP4_02510"
                     /product="taurine ABC transporter ATP-binding protein"
                     /protein_id="BAN52104.1"
                     /transl_table=11
                     /translation="MALLELERISAQYPGASTPVLADINLSLGPRQLLVALGPSGSGK
                     TSLLNLIAGFVAPSGGRITLDGVPVQGPGAERGVVFQDDALLPWQNVLGNVAFGLELA
                     GVPRAQREAKAREMLALVDLDGFGERRIWQLSGGQKQRVGLARALAADPRVLLMDEPF
                     GALDAFTREQMQELLLQVWQRTAKPVFLITHDIEEAVFLASELVLLAPNPGRVVERLQ
                     LDFGQRYAAGESARAIKSDPAFIETREHVLARVFSQRQSLQERA"
     CDS             complement(297734..298705)
                     /codon_start=1
                     /gene="tauA"
                     /locus_tag="PP4_02520"
                     /product="taurine ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN52105.1"
                     /transl_table=11
                     /translation="MIPHAPLRLFAALTLASTSWVAQAADLTVAYQTTVDPAKVAQVD
                     GDYEKASKASIDWRKFDNGADVITAVASGDVQIGYLGSSPLAAAATRKLPVETFLIAT
                     QIGAGEALVARDSIKTPQDLIGKKVAVPFVSTGHYSLLAALKSWNIDPSKVQILNLAP
                     PAIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAQKGAPTFDAWIVRKDFADK
                     HPEVVKAFAKVTLDAYADYRKDPKAWLADKGNVDKLVKLSGAKASDIPVLLEGNVYPL
                     AADQANALGAPTTQALTDTANFLKQQGKVDAVLPDYSPYVSAKFLPN"
     CDS             299358..300686
                     /codon_start=1
                     /gene="oprE"
                     /locus_tag="PP4_02530"
                     /product="porin OprE"
                     /protein_id="BAN52106.1"
                     /transl_table=11
                     /translation="MYKSSLALAVALGVLAQQAGAAGFVEDSKLSLSSRTMYFNNDNR
                     DGGADNRESGQGFKLDYISGFTEGTVGFGVDAQALWGIHLDGGRGKHPDNSSFFPSDS
                     DGSAESQWARVGANAKARFSKTEVHYGSALAPNLPILVSNDGRLLPQTFEGGTIQSKE
                     IDNLTINAGQLTHAMGRASSNRTGLSVAGATQDSNKFRYGGLDYKLTPDLTLQYYYSN
                     LEDFYKQHFLGATHVFKIADDQSFKTDLRYFDSSSDGKNGEAGYRFSNNGGYAKNTGE
                     VDNKTWSAMFTYTLGGHSLMLGHQRVNDDGGFVWLNQGNVVDGNGRNEGAGGSSFYLF
                     TDSMINQFAKAGENTTFGQYAYDFARLGVPGLKASVAYLKGEDGKNANGNGHFSEWER
                     DARIDYVIQEGTFKGLGASLRHGVYRGTGTSSLADQDQTRLIFNYTYNFL"
     CDS             300852..301490
                     /codon_start=1
                     /locus_tag="PP4_02540"
                     /product="putative peroxiredoxin"
                     /protein_id="BAN52107.1"
                     /transl_table=11
                     /translation="MSLKLGDIAPDFEQDSSEGKIRFHEWLGNSWGVLFSHPADFTPV
                     CTTELGLTAKLKDDFAKRGVKAIALSVDPVDSHHKWIEDINETQNTVVNFPIIADADR
                     KVSDLYDLIHPNASDTLTVRSLFVIDPNKKVRLTITYPASTGRNFNEILRVIDSLQLT
                     DNHKVATPGNWQDGDEVVIVPSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR"
     CDS             301777..302370
                     /codon_start=1
                     /gene="ssuE"
                     /locus_tag="PP4_02550"
                     /product="FMN reductase"
                     /protein_id="BAN52108.1"
                     /transl_table=11
                     /translation="MLVVSIGGSPSLRSRSGVLLERSRQWLQGRGVEVVTFQVRDFPA
                     EDLLHARFDSPHVQHFQQLVAQADGLIVSTPVYKASFAGALKTLLDLLPERALAHKIV
                     LPIATGGSIAHMLAVDYALKPVLSALKAQETLQGIFADDSQVSYADGTKPAQLVPALE
                     ERLLDSLETFHVALARRPRPVAPGVLNERLISARWSI"
     CDS             302456..303421
                     /codon_start=1
                     /gene="ssuA"
                     /locus_tag="PP4_02560"
                     /product="aliphatic sulfonate ABC transporter
                     substrate-binding protein"
                     /protein_id="BAN52109.1"
                     /transl_table=11
                     /translation="MRTVFLRRGLVALFAAAVSFGAITQAQAESLRIGYQKYGTLVLL
                     KAKGTLEKRLAEQGVQVQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLL
                     YVAYEPPAPHSEAILVPKGSSIQSIKELKGKKVALNKGSNVHYLLVRALEDAGLKYSD
                     IQPVYLPPADARAAFERGSVDAWVIWDPYQAAAEKQLQARTLRDGKGLVDNHQFYLAT
                     RNYATQHPAVINTLIEEVRAVGEWSQANPQEVTDQVAPLLGLPADITLTSVKRQGYGA
                     APLTPEVVAAQQKIADTFQALKLIPKPLSIKDVIWTPPAKVASAP"
     CDS             303481..304629
                     /codon_start=1
                     /EC_number="1.14.14.5"
                     /gene="ssuD"
                     /locus_tag="PP4_02570"
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="BAN52110.1"
                     /transl_table=11
                     /translation="MSLNIFWFLPTHGDGKYLGTSDGARAVDHGYLQQIAQAADRLGF
                     GGVLIPTGRSCEDSWLVAASLIPVTQHLKFLVALRPGIISPTVAARQAATLDRLSNGR
                     ALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENVDYDGKHIQVKGA
                     KLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPSAVAEKIAQVREKAAAQ
                     GREVRFGIRLHVIVRETNEEAWAAADRLISHLDDDTIARAQASLARFDSVGQQRMAAL
                     HGGNRDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGIDTFIFSGYPH
                     LEESYRVAELLFPHLDVQRPEQPKTGGYVSPFGEMVANDILPKSVSQS"
     CDS             304640..305437
                     /codon_start=1
                     /gene="ssuC"
                     /locus_tag="PP4_02580"
                     /product="aliphatic sulfonate ABC transporter permease
                     protein"
                     /protein_id="BAN52111.1"
                     /transl_table=11
                     /translation="MSRATSSTLTQRLAPWALPVLLLAVWQLAVSAGWLSTRILPAPS
                     AVVSAGVELVRSGDIWTHLAISGWRAGLGFAIGGSIGLVLGFITGLSNWGERLLDSSV
                     QMIRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMAR
                     SYGLSGFSLFRQVILPGALPSILVGVRFALGFMWLTLIVAETISANAGIGYLAMNARE
                     FLQTDVVVLAIVLYAVLGKLADLAARGLERVWLRWHPAYQVAKKEGA"
     CDS             305434..306246
                     /codon_start=1
                     /gene="ssuB"
                     /locus_tag="PP4_02590"
                     /product="aliphatic sulfonate ABC transporter ATP-binding
                     protein"
                     /protein_id="BAN52112.1"
                     /transl_table=11
                     /translation="MTVLKEQPPRLLRGIPLASNGLRKTFGQREVLKGIDLHIPAGQF
                     VAIVGRSGCGKSTLLRLLAGLDQPTGGQLLAGAAPLEEAREETRLMFQDARLLPWKKV
                     IDNVGLGLSGDWRPRALEALDAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLL
                     LDEPLGALDALTRIEMQQLIERLWLQHGFTVLLVTHDVSEAVAVADRVILIEDGEVGL
                     DLTVDLARPRALGSHRLAALESEVLNRVLSAPGIAPEPDPVAPLPTQLRWAH"
     CDS             306291..306506
                     /codon_start=1
                     /gene="ssuF"
                     /locus_tag="PP4_02600"
                     /product="putative molybdopterin-binding protein SsuF"
                     /protein_id="BAN52113.1"
                     /transl_table=11
                     /translation="MTIKAINVRNQFKGTVKEILEGPVLSEIDVQTASGIVTSVITTR
                     SVKELELQVGSEVIAFVKSTEVSIAKL"
     CDS             complement(306629..307261)
                     /codon_start=1
                     /locus_tag="PP4_02610"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAN52114.1"
                     /transl_table=11
                     /translation="MSRAVASRKPRASSQARIEAILAAARELLAEQGVAALSIYSVAE
                     RAQIPPSSVYHFFASVPALLEALTADVHRAFREALSAPFDSSAFSTWHQLSRLIEQRM
                     LDIYNEDAAARQLILAQHGLSEVVQADRQHDMELGDLMHKLFDQHFHLPVMPLDVDVF
                     ALAMELSDRVYARSVQLHEAITPRMAEEGKRVFEAYLGLYLPPFLAKRQP"
     CDS             complement(307261..308838)
                     /codon_start=1
                     /EC_number="6.3.2.2"
                     /gene="gshA"
                     /locus_tag="PP4_02620"
                     /product="glutamate--cysteine ligase"
                     /protein_id="BAN52115.1"
                     /transl_table=11
                     /translation="MSELLNRRLSLLGANLPLLKQCLHGIERECLRVTDEGRLAQTPH
                     PEALGSALTNEQITTDYSESLLEFITPALPDPAKVLESLEQTHRFVYSKLGDEYLWSP
                     SMPCTLPAEEDIPIAEYGSSNIGKLKHVYRKGLALRYGRTMQCIAGIHYNFSLPEALW
                     PLLREAEGSTQDNRDYQSSAYIALIRNFRRYSWLLMYLFGASPALDKGFLRGRPHQLE
                     ELDAETLFLPYATSLRMSDLGYQSNAQAGLTPCYNNLASYTDSLRKAVGTPYPPYVEV
                     GTHVDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALTSRGVQYVEVRCLDIN
                     PFLPVGIDLTEARFLDAFLLFCALEDSPQLDNGECRQCTDNFLTVVKEGRRPGLELHR
                     DGQPITLKDWASELIERIRPLADLLDQAQGGDAHGKALDAQQAKVDDAALTPSAQVLA
                     RMTEHDETFIQFSLRQSRVHAETFREQPLSNEQQQAFETLARESLTKQSELEQEEVGD
                     FDLFVGAYQASILAISN"
     CDS             complement(308992..309375)
                     /codon_start=1
                     /locus_tag="PP4_02630"
                     /product="hypothetical protein"
                     /protein_id="BAN52116.1"
                     /transl_table=11
                     /translation="MDVPREYVESAFSQLLGCRLQRLDTGVAEVALALEPHLRNRGQK
                     LHGGAIFSLVDIAMGLACSASHGFDQQSVTIECKINYMRAVSDGEVLCTARVLHAGRR
                     TLVVDADVVQGDKLVAKAQGTFAVL"
     CDS             complement(309375..311699)
                     /codon_start=1
                     /locus_tag="PP4_02640"
                     /product="putative RNA-binding protein"
                     /protein_id="BAN52117.1"
                     /transl_table=11
                     /translation="MDSINSRIAEELGVRPQQVEAAVGLLDEGSTVPFIARYRKEVTG
                     SLDDTQLRHLEERLRYLRELDDRRASILASIEEQGKLTPELAREIKLADTKTRLEDLY
                     LPYKQKRRTKGQIALEAGLGDLADGLFNDPNLAPESEAARFVNAEKGVADVKAALEGA
                     KYILMERFAEDAALLDKLRSFLKQEAVLSARVVAGKEEEGAKFRDYFAHDELLRNAPS
                     HRALAIFRGRNEGVLSASLKVGEELPGTLHPCEVMIGNHVGIENRSRPADKWLGEVVR
                     WTWKVKLYTHLETDLFGELRDNAEGEAINVFAHNLHDLLLAAPAGPRATLGFDPGLRT
                     GCKIAVVDATGKLLDYTTVYPHAPKNDWDRTISIMAALCAKHSVELIAIGNGTASRES
                     DKLVAELVKKYPALKITKIMVSEAGASVYSASELAAREFPDLDVSIRGAVSIARRLQD
                     PLAELVKIDPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLTRIS
                     GLNATLAQNIVAHRDANGPFATRAALKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAV
                     HPEAYPLVQRIAADTDRDIRSLIGDSSFLKRLDPKKFTDESFGLPTVTDILQELDKPG
                     RDPRPEFKTATFQDGVEDLKDLEPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALS
                     EKFIKDPREAVKAGDVVKVKVMEVDISRKRVGLSMRMGDTPGEKVEGNRGGNRGNGGN
                     RQQPAQRPRETATAAPANNAMASLFANAKQLKKK"
     CDS             311917..312657
                     /codon_start=1
                     /gene="ompR"
                     /locus_tag="PP4_02650"
                     /product="two-component response regulator OmpR"
                     /protein_id="BAN52118.1"
                     /transl_table=11
                     /translation="MTGTANTAEGDKILIVDDDPGLSSLLERFFTSKGYRARAVPNTE
                     QMDRLLQREVFNLVVLDLMLPGEDGLSACKRLRQQNNQIPIIMLTAKGDELSRIKGLE
                     LGADDYLGKPFNPDELMARVKAVLRRQAPAVPGAPGSEDESVTFGDYELSLATRELKR
                     GDEVHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRMI
                     EPDPSKPRYIQTVWGLGYVFVPDGNAGK"
     CDS             312671..313984
                     /codon_start=1
                     /gene="envZ"
                     /locus_tag="PP4_02660"
                     /product="two-component histidine kinase EnvZ"
                     /protein_id="BAN52119.1"
                     /transl_table=11
                     /translation="MKTPLWFPQSFFARTLWLVLIVVLFSKALTLVYLLMNEDVLVDR
                     QYSHGVALTLRAYWAADEENRDKIAEAAGLIRVTGSGVPEGEQHWPYSEIYQRQMQAE
                     LGEDTEVRLRIHAPPALWVNAPSLGPGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLST
                     ASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPISDTPSEMTEVYKAFNQMAEDVEQA
                     GRGRELMLAGVSHDLRTPLTRLRLSLSLLDSDSDLSDDMVRDIEDMDAILDQFLAFIR
                     DGRDEPVEEVDLAELVREVVAPYNQPKERVRLCLEPIPPFPLRRVSLKRMLGNLIGNA
                     LHHAGKGVEVAAYVSGDESAPYVVLSVLDRGTGIDESELETIFNPFIRGDRARGGKGT
                     GLGLAIVKRIAAQHGGNVELRNRSGGGIEARVRLPLGLLLPRNAV"
     CDS             complement(314108..315013)
                     /codon_start=1
                     /gene="rimK"
                     /locus_tag="PP4_02670"
                     /product="ribosomal protein S6 modification protein"
                     /protein_id="BAN52120.1"
                     /transl_table=11
                     /translation="MKIAVLSRNPRLYSTRRLVEAGTQRGHEMVVIDTLRAYMNIASH
                     KPQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAIARSRDKLR
                     SLQLLSRRGIGLPITGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETTQAA
                     ESVIEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGG
                     VASLIKITPEERITAIRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTGK
                     NVAGMIIEHLEKNGGPNQTRTKGKG"
     CDS             complement(315010..315492)
                     /codon_start=1
                     /locus_tag="PP4_02680"
                     /product="hypothetical protein"
                     /protein_id="BAN52121.1"
                     /transl_table=11
                     /translation="MKTFDHLTVIGLREWIALPDLGVAGLRAKIDTGASTSSLHATEV
                     EPFERDGQPWVRFTAHLGSVVQLRHRRCEAPLVTMKTIKSSNGHAQTRYVIRTSLALG
                     DGVWEVEFTLACRKNMRYRLLLGSKALIQGQLVVNPGLKYVQDKPAFPATLSPVTGAA
                     "
     CDS             315602..316003
                     /codon_start=1
                     /gene="hslR"
                     /locus_tag="PP4_02690"
                     /product="heat shock protein HslR"
                     /protein_id="BAN52122.1"
                     /transl_table=11
                     /translation="MAQKAEDDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGER
                     CKPGKEPRVGDEFLLRTGFDERTVVVKALSVVRRGAPEAQTLYEETEESVRRREQAAE
                     MRKAGAMGVTTDGRPTKKQRRQIHQLHGSFE"
     CDS             complement(316110..316868)
                     /codon_start=1
                     /locus_tag="PP4_02700"
                     /product="hypothetical protein"
                     /protein_id="BAN52123.1"
                     /transl_table=11
                     /translation="MGPLAACTLLPIALLCFWLWPFGQILCLTFDEWLFHSLNAPLAD
                     NTTWRYIWTVGSLRPFDIVVGLILLAVLIRGDWVFKAAQVRQAFFGFLVTLLLLVVIR
                     ALFSKWVDAAGWQHKSPSMIFDDVVHLSDYYPNLEAAWELKDRSSKSFPGDHASVLLI
                     WALFMSVFSRRLVQFLVIWGLAVLFMLPRLVAGAHWGQDDYIGGLLMAVLALGWSYYT
                     PLAAKGSEALMRWTAPLFNLLARLPLVGRMAVLR"
     CDS             317025..317924
                     /codon_start=1
                     /gene="hslO"
                     /locus_tag="PP4_02710"
                     /product="33 kDa chaperonin"
                     /protein_id="BAN52124.1"
                     /transl_table=11
                     /translation="MSDLPDTDFTQRFIFDERDVRGEWVSLDDSYAAVLARHEYPQPV
                     QVLLGELMAATALLVGALKFDGLLILQARSEGPIPLLMVECSGDRDIRGVARYEADQI
                     AADATLAQLMPEGHLTLTIDPVKGQRYQGTVDLDGANLSECFTNYFVQSQQLNTRFWL
                     NAENGKARGLLLQQLPRDRQPDDEEREDSWQHVIALAKTLKPEEWAEGNETLLHRLYH
                     EDAVRLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVQECGGQVEIDCQFCNERYF
                     FDASDVAQLFAGGGTDTASETRH"
     CDS             318104..319645
                     /codon_start=1
                     /EC_number="4.1.1.49"
                     /gene="ppcK"
                     /locus_tag="PP4_02720"
                     /product="phosphoenolpyruvate carboxykinase [ATP]"
                     /protein_id="BAN52125.1"
                     /transl_table=11
                     /translation="MTQANNTVYTDLSVDELVKEALQRGEGVLADTGALVVETGHRTG
                     RSPADRFIVEEPSTQDAISWGPINRKFPADKFDALWDRVEAFNNAQDHFVSYVHVGAA
                     AEHYLPVKMTTQTAWQNLFGRCLFINPEQFNPAGRDQWQVLNVANFVCEPERDGTNSD
                     GCVIINFAARKVLIAGMRYAGEMKKAMFSVQNFLLPAADVLPMHCAANIGEEGDVTLF
                     FGLSGTGKTTLSADESRYLIGDDEHGWGEGVVFNMEGGCYAKCIDLSEKNEPVIWKAI
                     KHGAVLENVVLDGNKHADYTDVSLTQNSRAAYPLEHVAKRSEANLGGEPNAVIFLTCD
                     LTGVLPPVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGE
                     YAELLIKRINGFNSKVYLVNTGWTGGGYGVGKRFSIPTTRAVIAAIQSGALVGAETEH
                     LDIINLDVPKVVPGVETELLNPRTNWADKAAYDEAAKGLAKLFIENFKKFEVSDAIKA
                     AGPQL"
     CDS             complement(319705..319977)
                     /codon_start=1
                     /locus_tag="PP4_02730"
                     /product="hypothetical protein"
                     /protein_id="BAN52126.1"
                     /transl_table=11
                     /translation="MQLMWRQMALKDRMRIMDHIAQDNPAAAIELDETFGDKARRAAQ
                     NPVLYKVGRYPGTREIVVRPNYVMIYRVVDNRVEIIRILHARQQWP"
     CDS             complement(319977..320420)
                     /codon_start=1
                     /locus_tag="PP4_02740"
                     /product="hypothetical protein"
                     /protein_id="BAN52127.1"
                     /transl_table=11
                     /translation="MPTHLLDHANLSRMAESGRINATHIVGHPGGWAVQVDINHQEHV
                     LTAQRSGNVRLFKKLETLVTYLLDLGIDHFVVDASTFDPGQMTTYQRPDRAQALKRAH
                     EAAAYEAWFHEQVIASLDDTAPVMDDEEAELLFAARRATLAAKIR"
     CDS             320546..320986
                     /codon_start=1
                     /locus_tag="PP4_02750"
                     /product="hypothetical protein"
                     /protein_id="BAN52128.1"
                     /transl_table=11
                     /translation="MTESPQRTAFSHFHPILTRPSDNDVNGHIAGATVHGFFETAIQA
                     FLVEQAEVDLRDGELAAFVVSSAADFFALPGFPDVLEVGLGVTRLAGSTVEYRLALFR
                     PGEPEACAAGTVVQVFIERASGRPVVLPEPLQMILSGLVLEQQA"
     CDS             complement(321042..321521)
                     /codon_start=1
                     /locus_tag="PP4_02760"
                     /product="hypothetical protein"
                     /protein_id="BAN52129.1"
                     /transl_table=11
                     /translation="MKKYSSILLLSFSLLSGVAMAGGNTEAGIGGALGGVLGSVVGNS
                     IGGSTGGAIGAGLGGAAGGALGADKRQRGEAAIGGALGAAGGNVVGRSVGGTTGSYIG
                     AAAGGGAGGALGNYMGNKADEDERHDDRRYRRDYDDRRHYDRGRHYGHRKHKRHWRD"
     CDS             complement(321717..324062)
                     /codon_start=1
                     /locus_tag="PP4_02770"
                     /product="putative oxidoreductase"
                     /protein_id="BAN52130.1"
                     /transl_table=11
                     /translation="MTSYQHLPDNAPASPPRYKPYHGPAGGWGALRSVAKAWVGSDNA
                     LKNIRALLKTNQNGGFDCPGCAWGDSPESGMVKFCENGAKAVNWEATKRRVDAAFFAR
                     YSVTSLLQQSDYWLEYQGRLTEPMVYDAPSDRYLPISWDAAFALIARELNKLANPDQA
                     EFYTSGRASNEAAYLYQLFVRAYGTNNFPDCSNMCHEASGVALGQSVGVGKGTVTFDD
                     FEHADTIFVWGQNPGTNHPRMLDPLRDAVKRGAQVVCVNPLKERGLERFQHPQNPLEM
                     LTNSDRPTNTAFFRPALGGDMAMLRGMAKFALQWEREAQAKGEPAVFDHAFIAEHGHS
                     VDEYLAVVDATPWEHIQAQSGLALADIELAARMYCRGKRVIMCWAMGITQHRHSVPTI
                     QEIVNLQMLRGNIGAPGAGLCPVRGHSNVQGDRTMGINERPPVALLDAIEKRFGFPVP
                     RHNGHNTVEAIHAMLDGRAKVFIGLGGNFAQATPDTERTAQALRNCELTVHISTKLNR
                     SHLVHGKQALILPCLGRTDIDLQADGPQAVTVEDSFSMVHASNGQLKPLSTQMRSEPA
                     VVAGIAAATLGKQPVDWHWLVADYDRIRDLIGDTIAGFSGFNQRLQHPGGFYLGNSAA
                     SREWKTSTGRANFKANLLPDSLLDERVRASGQLPDLIMQSMRSHDQYNTTIYGLDDRY
                     RGVRGQREVLFANEADIIRLGFQPGQKVDIVSLWGDEHVRRVQGFTLLAFDIPAGQAA
                     AYYPEVNPLVPLESIGDGSHTPTSKFIAIKLERARDDGRIL"
     CDS             complement(324068..324853)
                     /codon_start=1
                     /gene="fdhD"
                     /locus_tag="PP4_02780"
                     /product="formate dehydrogenase accessory protein FdhD"
                     /protein_id="BAN52131.1"
                     /transl_table=11
                     /translation="MPAASNTYDYVQLSDAQRDSTPLAEEVALAIVYNGLNQAVMLVS
                     PTDLEDFAVGFSVGSGIVEGTAEIYDLKLSGSGSAMYADLEISSRAFWNLKNQRRQLA
                     GTSGCGLCGVEALEQALPDLPELPGAPLPPPQWLVGLRERIDAFQPLGQHCGAVHAAL
                     FMDRHGELLLGREDIGRHNALDKLIGALLRQGIDSQGGLAIVTSRCSLELIQKVLRAG
                     IQTLVSLSAPTGLALQWARKHNLNLIHLPKHSAPRVYSPAAES"
     CDS             325076..325516
                     /codon_start=1
                     /locus_tag="PP4_02790"
                     /product="hypothetical protein"
                     /protein_id="BAN52132.1"
                     /transl_table=11
                     /translation="MSLFSFVKEAGEKLIDLLTPGNANAEEQLKKHVQDVGLGNPNIT
                     ATVEGDTITLKGEVASQEEKEKIILAAGNINGVASVDDQITVTGPVVKAARFVTVKKG
                     DTLSAISVVVYGNANQYNKIFEANKPMLSHPDKIYPGQVLRIPD"
     CDS             complement(325567..326229)
                     /codon_start=1
                     /locus_tag="PP4_02800"
                     /product="putative hydrolase"
                     /protein_id="BAN52133.1"
                     /transl_table=11
                     /translation="MPVIPWSAIDTVLLDMDGTLLDLHYDNRFWLEHLPQRYAELHGV
                     SRTMAEMELQPLFERNAGTLNWYCLDFWSRELRLPIRELKQEIADLIALRPDADTFLA
                     AIRKAGKRVVMITNAHRDSLSLKLERVELAPYFERLISSHDYGYPKESPQFWDALQAD
                     IGFEPGRSLFIDDTLAILRSAQRFGVGHLLAVRQPDSKAGPRDTEEFAAVEDYRELLV
                     GL"
     CDS             326294..326860
                     /codon_start=1
                     /gene="nudE"
                     /locus_tag="PP4_02810"
                     /product="ADP compound hydrolase"
                     /protein_id="BAN52134.1"
                     /transl_table=11
                     /translation="MRQKPTVLSREIVASSRLFRVEAVQLRFSNGNERTYERLVGRGN
                     GYGAVMIVAMLDAEHAVLVEEYCGGTDEYELSLPKGLIEPGEDVLAAADRELKEEAGF
                     GARQLEHLTELSLSPGYMSQKIQVVLATDLYEESLEGDEPEPMRVDKVNLRELSALAM
                     HPQFTEGRALAALYLARDLMIQRGLLEL"
     CDS             326857..327675
                     /codon_start=1
                     /gene="cysQ"
                     /locus_tag="PP4_02820"
                     /product="3'(2'),5'-bisphosphate nucleotidase"
                     /protein_id="BAN52135.1"
                     /transl_table=11
                     /translation="MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAAD
                     LAAHRVIADGLLALAPHIPVLSEEDCNIPLAERQGWSRWWLVDPLDGTKEFIAGSEEF
                     TVNIALVENGEVVFGVVSMPTNGRCYFGGRGMGAWRADAGEAAQPIQVRNAPAQGERF
                     TVVASRRHSSPEQEALLAGLGAAVGELELANIGSSLKFCLLAEGSADCYPRLAPTSQW
                     DTAAAQGVVEGAGGEVIGLDGLPFRYPPRESLLNPYFLALPANAAWRQAFLKLI"
     CDS             complement(327835..328290)
                     /codon_start=1
                     /locus_tag="PP4_02830"
                     /product="hypothetical protein"
                     /protein_id="BAN52136.1"
                     /transl_table=11
                     /translation="MNTDSQYLQSVLHSDIPLTREMGLEVIDWQQHTLRLQLPLAANV
                     NHKSTMFGGSLYCAAVLAGWGWLHLRLRALGIDDGHIVIQEGQISYPLPVTGAAVARC
                     APPDEKTWERFLAMYQRRGRARLTLETTVSNAGSDEPAVKFSGQYVLHR"
     CDS             complement(328290..329696)
                     /codon_start=1
                     /gene="dctD"
                     /locus_tag="PP4_02840"
                     /product="two-component response regulator DctD"
                     /protein_id="BAN52137.1"
                     /transl_table=11
                     /translation="MTTETLIDSQAQVILVDDDPHLRQALSQTLDLAGLKVVALADAQ
                     GLAERIEADWPGVVVSDIRMPGIDGLQLLEQLHGRDSELPVLLITGHGDVPLAVQAMR
                     AGAYDFLEKPFATDALLDSVRRALALRRLVLDNRSLRLALSDRQQLATRLVGHSPSML
                     RLREQIGALAGTRADVLILGETGAGKEVVARALHDLSSRRDGPFVAINAGALAESVVE
                     SELFGHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRMLQERVVERL
                     GGNQLIPLDIRIIAATKEDLRQSADQGRFRADLYYRLNVAPLRIPPLRERGDDILVLF
                     QHFADAASQRHGLPPHTLQPAQRAVLLRHPWPGNVRELQNAAERFALGLELALDGQAP
                     PATAAAVPVLSGNLSEQVEQFERSLIAAELAQPHSSMRSLAEALGIPRKTLHDKLRKH
                     SLSFDGGSGGHDDQEDHR"
     CDS             complement(329693..331507)
                     /codon_start=1
                     /gene="dctB"
                     /locus_tag="PP4_02850"
                     /product="two-component histidine kinase DctB"
                     /protein_id="BAN52138.1"
                     /transl_table=11
                     /translation="MIAKPTPPRRPRWRSLALLALCLAPLLWPLHHLAERYYQEELAS
                     QNRQTLDLYVANLLGTLHRYETLPQILGDLPALRGVLADPFRLEAVTNANRLLKDIVQ
                     QTGAEVMYLMDVSGNTLAASNWDKRDSFVGRNFAFRPYFNEAMAGHLGRFFGQGTTSA
                     KRGYFFAAAVRDRERIVGVLVVKVDLDHTETLWGRTPEQLLLTDHNGVVILTSRPDWR
                     FRSTRTLTEAERQAIIAIQPYPTQAPQPLVLNPDAWITQTRDIKETGWQVSILAPRML
                     VDRSVQTVMAIGAGTLLVLMLLAGLVMQRRRHYIDRIDFEARGRQELEKRVAQRTADL
                     EGLNTRLKNAVLERENAQQEAVRAQDELVQAGKLSVLGTMSASISHELNQPLAAIRSY
                     AENAEILLDHQRTDDARGNLKLIGELTGRMASIIAHLRAFARRDRHAPESVALQPALD
                     DALALLAKRRRAMAVELIRDLPEATLWVQAGETRLRQVLGNLLANALDALTEKANPRR
                     LWLSAEQRDDCVYLYIRDNGPGFSRQALEHAKEPFFTTKTRTQGLGLGLAICESLMRA
                     LGGELLLANHPEGGALLTLQLRVAAPGATLPNSEDSSA"
     CDS             complement(331550..332095)
                     /codon_start=1
                     /gene="rmlC"
                     /locus_tag="PP4_02860"
                     /product="dTDP-4-dehydro-6-deoxy-D-glucose 3,5-epimerase"
                     /protein_id="BAN52139.1"
                     /transl_table=11
                     /translation="MNIIPTAIPEVLIIEPKVFGDSRGFFFEAFNAREFARQTGVRTE
                     FVQDNHSRSIKGVLRGLHYQVENTQGKLVRVVHGEIRDVAVDVRKSSPTFGQWVAVHL
                     SADNHRQLWVPPGFAHGFAVMSESAEFLYKTTDYYNPGADRCIRWDDPQLAIDWGLQQ
                     PPVLSDKDKLGLPLAEAELLP"
     CDS             332374..333480
                     /codon_start=1
                     /EC_number="3.5.3.12"
                     /gene="aguA"
                     /locus_tag="PP4_02870"
                     /product="agmatine deiminase"
                     /protein_id="BAN52140.1"
                     /transl_table=11
                     /translation="MKTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQ
                     AAHVTLAKAIARFEPVTVAASAGQYENARRQLDQPNIRVVEISNDDAWVRDTGPTFVI
                     NDQGEVRGVDWGFNAWGGFDGGLYAPWNRDEELAAKVLEMERCQRYQTEGFVLEGGSI
                     HVDGEGTVITTEECLLNRNRNPHLNREQIEAVLRDQLAVDTVVWLPDGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDSNDPNYARCHAAMEVLKNTRDAKGREFIVHKMPIPGPLF
                     ATAEECAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPADAEARAILAKI
                     FPDHEVVMIPGRELLLGGGNIHCLTQQQPAPVKR"
     CDS             complement(333996..336071)
                     /codon_start=1
                     /locus_tag="PP4_02880"
                     /product="putative TonB-dependent receptor"
                     /protein_id="BAN52141.1"
                     /transl_table=11
                     /translation="MLVPCRLSPLTLGLSLLFSAGLASAATTTLPESSVTADSEREKD
                     NPRVKEVSTATRTSTPVRYVPQAIDTVKTANVLDYGNNTLGKALEGIPNVSSGADTRF
                     DSVRIRGFEASNDFYLDGIRDDSQYIRDLHNIERVEVLKGPAAVLYGRGSQGGIVNRV
                     SKAPEQGRRSSIEAQAGSEDLRSLYADLSADPSDTVSLRLNMGNQDNNSFREGIDGSR
                     QLFAPSVSWQITPDLNWLVQYEYSRYNRTPDRGIPGVNGRPADVSRGTTYGDQRDYID
                     DRAQSLRSRLNYQLNETWQLRHTLGLFKLDSEFDNTYVTGYNASTNVLTRQRWQQDLN
                     TRNLFNNLEAEGDFDTLGLEHKLLLGLEFGNQKRDPVLYTAGSQPLPGLGKPGSNQQH
                     NGTLALSSNNHTVVDSRGLYLQDQIRLNDQWQILAGVRFDQFDVETTNKDGVREPQDS
                     NSTSPRLGVVYTPWRDHSFYASWSKTFSPVGGGLIGITPDAPGNGNDAKPEETRQKEI
                     GVKSDWLDQRLTTTLAIYELELYNRRTRDPENPNNILLSGLQRSRGIELTATGNIVGN
                     WYVRGGIGLQDAIIVKDNNGQEGNRINDVAKRNASLFVTWKPELGWYAETGVTLVGER
                     YADNQNTTVLPGYGRWDALAGYRTHDWDVRAALSNIADKTYYSSATSAAQIQVGDPRS
                     LVVTGSYSF"
     CDS             336547..337866
                     /codon_start=1
                     /gene="oprQ"
                     /locus_tag="PP4_02890"
                     /product="outer membrane protein OprQ"
                     /protein_id="BAN52142.1"
                     /transl_table=11
                     /translation="MLKTRISLVALAMIAATQAQANDQADSKGFIEDSHANVLLRNAY
                     INRDKKHGTDDQIEWGQAFIANFSSGFTQGTVGVGVDAFGLYAVRLDGGKGHNGGGGV
                     DFFKPHETTNAEGNASSPHNLARGGAAVKFRISNTVLKYGDQMPALPVLQYDDARLLP
                     ESFTGTLITSKEIEGLELNAGRFTQEARKSAERRDGGGLKSINVFGGSYKFTDNFTAS
                     LYTADNEDVMKKHYLGLNYVFPIASDQSLTLDFNGYKSDIDSKYVQAAGLNGDSNTIW
                     SLAATYAYGAHSFTLAHQRSTGSTGYNYGFYQNAGGVGDGGSTIYLANSYWSDFNAED
                     ERSWQLGYGLDFGAYGIPGLTYKLAYVVGDNINTRNVANPQGFGEGKEREIFNQIRYV
                     VQDGPAKDLSIKLRSSFLRTNNAVQQNGYNDDGNEVRVFVEYPISIF"
     CDS             complement(337921..339591)
                     /codon_start=1
                     /locus_tag="PP4_02900"
                     /product="hypothetical protein"
                     /protein_id="BAN52143.1"
                     /transl_table=11
                     /translation="MNHSLPSRYACLVICLLFTFASLPLLPQHAWLWPITLITALLSL
                     VGLNDLRQSHHAVRRNYPILGNIRYLIETIRPEIRQYLIEGDDDKLPFSRSQRSLVYA
                     RAKNESAEKAFGTLNDAYKPGFEFISHSMLPVATPDPASFRIAIGGPQCRLPYSASIF
                     NISAMSFGALSANAIAALNRGARMGRFAHDTGEGSISPYHREHGGDLIWEIGSGYFGC
                     RTEDGRFDPHRFAEQARSPQVKMIEIKLSQGAKPGHGGILPGHKVSAEIAETRGVRAG
                     EDCISPAAHSAFRTPAGLLQFVASLRELSGGKPVGFKFCLGHPWEFMGIAKAMLATGI
                     TPDFIVVDGKEGGTGAAPREFSDNMGVPMREGLMFVHNTLVGLNLRSSIRIGAAGKIV
                     SAFDIASVLAIGADWVNSARGFMFAIGCIQSQSCHTNKCPTGVATQDPLRQRALVVPD
                     KAERVASFHRNTLHALAEMLAAAGLEHPSELKPKHLARRISPSEIGLFSDLHTFLKPG
                     ELLSGSIESEFYARMWRMARSDSFAPETGDTATRVVASRLRHEETEPA"
     CDS             complement(339707..341083)
                     /codon_start=1
                     /locus_tag="PP4_02910"
                     /product="putative two-component histidine kinase"
                     /protein_id="BAN52144.1"
                     /transl_table=11
                     /translation="MPDMRWLRRLWPRTLFGQLLLIMISGTLVIQLMSSSIWFDVRFA
                     QVLEAPIRLIAARSAPLIAQASCHAGALKVPAHYQLRCAETLPTPEHDERRGRRRVEL
                     LLQQALRYELGHAQDVRLLKVRLTDELGQPIVWRSLFGLRTAQAHVQFAVPLADGHWL
                     TIEGQELQGWSGESAWVLISDYLLRVYALRIVAVLLVCLIAVRLCLRPLRRLADAARG
                     LGGNLEQPPLALDGPEEVRQAAQAFNAMQQRLIAMVNDKAYFLAAVSHDLRTPLTRMR
                     LRLERLPDDEHRQRLRQNITQMDDMIGQVLDYLRAGEQLNLQQVDLDRLVARQCAELA
                     SAEEALPVHGKVGCSQVDALLLQRCLQNLLVNALRYAKDISVTLERAVDGVFIHIDDR
                     GPGIAPGLLTTITDPFVRGEGSRNQASGGYGLGLSIAQRIANSHGGELMVANREGGGL
                     RVSILLPG"
     CDS             complement(341076..341798)
                     /codon_start=1
                     /locus_tag="PP4_02920"
                     /product="putative two-component response regulator"
                     /protein_id="BAN52145.1"
                     /transl_table=11
                     /translation="MTTTLLVVDDDDEIRELLCDYLTDAGYNVLAAADGEQMREQLAR
                     HKVDLVVLDLMLPGEDGLSLCRQLQATPGLAVIMLSAKGSTLDRIIGLEVGADDYLAK
                     PFEPRELIARIKAVLRRPQRLDTPAEESAVADAQLFAGFRLEHVKRLLTRPDGETLTL
                     PRSDYRVLRELLEANNRVVSRDQLTRSAFGRDHLPDDRSVDMCVSRLRQQLRRAPAGA
                     AQILTIRNEGYLLSIANLAADA"
     CDS             341939..344236
                     /codon_start=1
                     /locus_tag="PP4_02930"
                     /product="putative TonB-dependent receptor"
                     /protein_id="BAN52146.1"
                     /transl_table=11
                     /translation="MNPKRIPKVFTPISQSGNRLKPLAFFVAVAISGGAMAADGKPLE
                     LDATQIEDSALLPADDAGQLGYTVESTRSSTGLALTPRQTPQSVTTITRQQMDDRDIH
                     TIEQALETTPGVTANKSEVGGRTDYRARGYSISNWKVDGLQTQGGSDFSGSGNALNMD
                     LYERIDIVRGANGLLGGTGDPSATVNLIRKAPTKTFGGSAYATYGSWDKRRLGADLNL
                     PLSADGRLRSRFVMTQQDANSFRDNQSERSRAALANFEFDLDDATTLGAGYQYEYNKV
                     VGGGWGANIPIWYRDGSKTDLPRSTNVVPSWSFGEYTTRTAFGSLEHRFDNDWTLDLK
                     AAQATTEALNHRGLAKVNSAGRGSFGGYWDQDGSGAVLNGLHSSSDTTQQSAQIDLSG
                     PFQLFGRTHQAMVGYNDSRTVGWSPQYTCTMVGDGMASAPALGCQFRANNGFPVTDWH
                     NGVDDDYDLIASRTGLHSKTTTRLQGMYAATRLSITDPLSVIVGVRTSNYSSVTRSVA
                     GERSSQEENGIVTPYLGAVYDLNDNYSLYASYTDIFTPQTSETSSGSKVEPIRGQSYE
                     TGIKGEWFDGRLNASAAYFRTKQENKAVLDGDLTTPTGASAYKAGSGVETDGIDLEVA
                     GALTPNWNVYAGYTYLHFRRVDSDGRSDPSHLFKASTTYRLSGPLDRLTLGAGVTAQT
                     NIRAISSPAGQPTNGVSNGATDVNWSGYAIWNAMAKYQLTDETSVSLNANNLFDKHYY
                     TQYGFYAGAIYGDPRNLSLTVSTAF"
     CDS             complement(344528..344734)
                     /codon_start=1
                     /locus_tag="PP4_02940"
                     /product="hypothetical protein"
                     /protein_id="BAN52147.1"
                     /transl_table=11
                     /translation="MAKRFPTNPRHPERICWGCDLYCPAKALACGNGADRTMHPVELF
                     GEDWDSFEGHLEKPADAGHAAEPT"
     CDS             345076..345549
                     /codon_start=1
                     /locus_tag="PP4_02950"
                     /product="hypothetical protein"
                     /protein_id="BAN52148.1"
                     /transl_table=11
                     /translation="MKRAKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIK
                     DDAELQARMALIDELYSHADSEGHAAARFAEMVADRVYEYESESVLVPFASQAEALAF
                     LLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQVKGFAEFFSVPVEFFMHGVV"
     CDS             345959..347257
                     /codon_start=1
                     /locus_tag="PP4_02960"
                     /product="hypothetical protein"
                     /protein_id="BAN52149.1"
                     /transl_table=11
                     /translation="MLPKVFVYPEGQRIWLVRASGGKHFQNFLKHGVVAIAHIDKLIK
                     KHALDEIPSREILRGYLEAESDSFFDSPLAVLKKLDDTSTELEQDVELAEEEYFESKM
                     SLANREAQVNKFAQEMCVGDLVVTLCKTHIVIGQFTSESYIDETVLVNKIYRGSKEPK
                     VEYLESKLRRNVAWGKPIARELLSAGLKKPLLARNTVSSLDEYWDKIYCLIYPIFVRS
                     NVVYFSNRVAKIGPVGTRSMCKLLDFVVCTQLTTDALLKPTMPGFDLARLLEDSLHGT
                     DFQERLTSQAEVMSPGYFHHAVQVLNGVKPEVYARVLASLLAFGLTGCQGGSDALASL
                     SEEIVSTLKQDDMSQERTAKPADRDKTDKMLEEYKQIMGKKGVTSLTSSLDLKLANAD
                     SALPSISFSPQIDIESGSEKTMGAKQHSSGTGEQFRLDLE"
     CDS             347261..347839
                     /codon_start=1
                     /locus_tag="PP4_02970"
                     /product="hypothetical protein"
                     /protein_id="BAN52150.1"
                     /transl_table=11
                     /translation="MTVRNGILEFVGGAFLLTAITYASGRGYFNGYFRSVRVDPAFVD
                     VAVDQIFFEGGREIIKVVSPVAYPFLFFVVASVLSALLGTLYLKKIASARAENLLLAC
                     SQLKGIFLLVGIVWFSNYLFNSAMKSGGEVAVTNGCNFVVVHVNDKDSQTGCLIYKSV
                     DNIWVRYETEESEYVSVFPRDNFYRADMKMRN"
     CDS             complement(348041..348814)
                     /codon_start=1
                     /EC_number="2.1.1.148"
                     /gene="thyX"
                     /locus_tag="PP4_02980"
                     /product="FAD-dependent thymidylate synthase ThyX"
                     /protein_id="BAN52151.1"
                     /transl_table=11
                     /translation="MKVSSPIVRCVAKSSIDFDAIQEFLDSEKMVWQRTTDSKSSDDL
                     VEFSGRICYMSFGQRQSPRSNQEYILNLIDSGHGSVLEHASWTFIVSGVSRGFTHQLV
                     RHRAGFSYSQLSQQYYDESDADFVAPPSLKKDSPLYKKWLDAMHSSVELYRELIASAK
                     KLSISNSFSNKEKLRELRTTARSILPNAIETKLVFTANARALRHFLITRGAIEGDWEM
                     RDVSTQILKIVKQDAPSLFQDFETIKLSDGSSSVIKKTI"
     CDS             complement(348765..348944)
                     /codon_start=1
                     /locus_tag="PP4_02990"
                     /product="hypothetical protein"
                     /protein_id="BAN52152.1"
                     /transl_table=11
                     /translation="MTHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLTIRRQN
                     ESLKSYCEMRCKKLY"
     CDS             complement(350726..352045)
                     /codon_start=1
                     /gene="intB"
                     /locus_tag="PP4_03000"
                     /product="putative prophage P4 integrase"
                     /protein_id="BAN52153.1"
                     /transl_table=11
                     /translation="MARTTAPLTDTACRTAKPREREYKLFDGDGLYLLVQPNGRKGWR
                     LRYVKPDGREGLTALGSYPVVGLGDARRKRFEIKQQLANGIDPIQYKQQTKTQAVING
                     RTFESVALDWYASMVPKWAPGHAKTVLSRLKTHVFPLIGARAIVELDTHDLMQPLEAV
                     TKRGTIDVALRIKNYLQSIMREAKRLRLITANPAHDLDGSIKTPRVTHRPALPLSRLP
                     GLLACIEDYRGRPLTRLTVMLSLHVFVRSSELRFARWNEFDLKRGIWEIPDTRPALDG
                     VPFSTRGTKMAGDIHVVPLSPQAVALLEQIHAITGKFELVFAGDAKPWKPMSENTVNA
                     ALRTMGYDTKVDICGHGFRAMACSALVESGLWSETAIERQMSHKERNNVRAAYTHKAE
                     FLEERRMIMTWWSRFLEANREDHVTPHEFAKQTGENVTRLRSAKRTE"
     tRNA            complement(352212..352284)
                     /locus_tag="PP4_t0040"
                     /product="tRNA-Thr"
     CDS             complement(352383..352631)
                     /codon_start=1
                     /locus_tag="PP4_03010"
                     /product="hypothetical protein"
                     /protein_id="BAN52154.1"
                     /transl_table=11
                     /translation="MTQAKPLALLTLALALTGCASGTSPHPNSNLGWNHPGMQLGGDN
                     GLPLRTESPCRKRGCDNDKLFFNPGKSEPSVNTIHRGW"
     CDS             353151..353420
                     /codon_start=1
                     /locus_tag="PP4_03020"
                     /product="hypothetical protein"
                     /protein_id="BAN52155.1"
                     /transl_table=11
                     /translation="MKQDEPVTTAGVETFLAAGNPSLNLLRVEPGVPVDAAYEHVSIL
                     MGYIKHLVREGDMEDDHKFLGAADYLCDMAKALMNDIEIAKGKAH"
     CDS             complement(353658..354863)
                     /codon_start=1
                     /locus_tag="PP4_03030"
                     /product="hypothetical protein"
                     /protein_id="BAN52156.1"
                     /transl_table=11
                     /translation="MPNHLHSHHLSTRFKALDQFLVEHQQLWKPRPFTTLQLAWETTH
                     PELATHLRQCSLADAEADSAADRLPAPFAQLAEQARKLAALGSLPQTDLPPAAHRLDV
                     AVPGRKWQQIEAFASHLAFRDPPRHWLDWCSGKGHLGRRLLQPGQQLTCLEYDAELVV
                     AGQALSAHHHLPAQHVHQDVMASDSARHLAGDKSVVALHACGDLHVRLMQLASQQGCR
                     QLAVAPCCYNRIAAPQYQALSTAAQASSLQLSLDDLGLPLSETVTAGARVRRQRDTSM
                     ARRLGFDLLQRQQRQSSEYLPTPSLPVAWLEKPFEQYCRDLADLKQMPLTGNPDWTAL
                     EAAGWQRLAEVRNLERVRNLFRRPLELWLVLDRALFLEEQGYAVRLGLFCDYPLTPRN
                     LLILAERDR"
     CDS             complement(354991..355680)
                     /codon_start=1
                     /locus_tag="PP4_03040"
                     /product="amino acid ABC transporter permease protein"
                     /protein_id="BAN52157.1"
                     /transl_table=11
                     /translation="MNWEVIFKWLPRLAEGAVLTLELVAIAVVAGLILAIPLGIARSS
                     RHWYVRAVPFSYIFFFRGTPLLVQLFLVYYGLAQFDAVRSSSLWPYLRDPFWCTVLTM
                     TLHTAAYIAEILRGALQSIPKGEIEAARALGMSRGKALFYIMLPRAARIGLPAYSNEV
                     ILMLKASALASTVTLLELTGMARTIIARTYLPVEIFFAAGVFYLVISFLLVQGFKLLE
                     RWLRVDACQGR"
     CDS             complement(355680..356372)
                     /codon_start=1
                     /locus_tag="PP4_03050"
                     /product="amino acid ABC transporter permease protein"
                     /protein_id="BAN52158.1"
                     /transl_table=11
                     /translation="MNIDLHGFGPAMMAGTLMTVKLALCALLLGLVLGLLGALAKTSP
                     LKPLQWLGGFYSTLVRGVPELLWVLLIYFGTVGLMNSLGEALNMPGLELSAFAAGVIA
                     LGLCFGAYATEVFRGAILAIPKGHREAGLALGLSKGRILSRIILPQMWRIALPGLGNL
                     FMILMKDTALVSVIGLEEIMRHSQIGVTVTKEPFTFYMVAACIYLGLTVIAMTGMYFM
                     EKRAARGFARAE"
     CDS             complement(356427..357179)
                     /codon_start=1
                     /locus_tag="PP4_03060"
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN52159.1"
                     /transl_table=11
                     /translation="MHTYKKFLLAAAATLVMSANAMAAEKLRMGIEAAYPPFNNKDAS
                     GNVVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLVSSLSITDERKQAV
                     DFTEPYYSNKLQFIAPKNVDFKTDAASLKGKSIGTQRATLAGTYLEDNFKGVDVKLYD
                     TQENAYLDLVSGRIDGILADKYVQYEWLKSKDGSNFEFKGEPVMDSDKIGIAVRKGDT
                     KLRDELNKALAEIKADGTYKKINDKYFPFSIE"
     CDS             complement(357191..357964)
                     /codon_start=1
                     /locus_tag="PP4_03070"
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="BAN52160.1"
                     /transl_table=11
                     /translation="MAQATPALEIRNLHKRYGEQEILKGISLTARDGDVISILGSSGS
                     GKSTLLRCINLLENPHQGEILVAGEALKLKAAKNGDLVAADNRQINRLRSEIGFVFQN
                     FNLWPHMSILDNIIEAPRRVLGQSKAEAIEAAEALLNKVGIYDKRHSYPAQLSGGQQQ
                     RAAIARTLAMKPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARH
                     VSSEVVFLHQGLVEEQGSPQQVFENPNSARCKQFMSSHR"
     CDS             358606..359991
                     /codon_start=1
                     /gene="gabP"
                     /locus_tag="PP4_03080"
                     /product="gamma-aminobutyrate transporter"
                     /protein_id="BAN52161.1"
                     /transl_table=11
                     /translation="MSGNNSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGP
                     AVLLAYAAAGTLVVLVMRMLGEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWV
                     LVIPLEANAAAAILHAWFPAVDLWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVL
                     AIVGFIAVGCAALFGFVPSSQVSGASHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEI
                     VTIAAAESKDPGKQISRATNSVIWRICLFYLVSIFLVVALVPWNDPALAETGSYQTVL
                     SRIGVPNAKLIVDIVVLIAVTSCLNSALYTSSRMLFSLSKRGDAPAIAQRTTKAATPY
                     VAVLLSTAAAFLCVFANFVAPAQVFEFLLASSGAIALLVYLVIAISQLRMRAKREASG
                     EKIAFKMWLFPGLTWATIAFIVAILVVMALREDHRAEIIATALLSIGVVAAGLLVHRK
                     REAAGRVALDN"
     CDS             complement(360173..360616)
                     /codon_start=1
                     /locus_tag="PP4_03090"
                     /product="hypothetical protein"
                     /protein_id="BAN52162.1"
                     /transl_table=11
                     /translation="MATPTKQQKRAKRAASKAKQNRMVRSGQAVKPSAGDSASVEQVF
                     NKAMESGSYDAMFEKMKEAQAGGLVPMISVFLVDPLLALVLKGHKEEHATDYIVLVFN
                     AYRKWLDGADEEATMAWLESDEFQDAYIAASELVAKQQQQQKQFG"
     CDS             complement(360817..361797)
                     /codon_start=1
                     /locus_tag="PP4_03100"
                     /product="polyphosphate kinase 2"
                     /protein_id="BAN52163.1"
                     /transl_table=11
                     /translation="MSEESPLLLPAPSEPAITPVRTRRPRQRKPEPAIASISQQPAAL
                     EVATAPKGSNEDSTSARLPASYPYRTRLRRQDYEKAKHALQIELLKVQSWVKETGQRV
                     VILFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSEQEQGQWYFQRYIQHLPTAGE
                     MVFFDRSWYNRAGVEKVMGFCTPLQYLEFMRQAPDLERMLCNSGILLFKYWFSVNREE
                     QLRRFISRRDDPLKHWKLSPIDIKSLDKWEDYTGAKEAMFFHTDTADAPWTVIKSDDK
                     KRARINCIRHFLHSLDYPGKDHSVAHAPDALLVGRASRGFEEDEPIGVAS"
     tRNA            complement(361970..362042)
                     /locus_tag="PP4_t0050"
                     /product="tRNA-Phe"
     CDS             complement(362133..362405)
                     /codon_start=1
                     /gene="yggX"
                     /locus_tag="PP4_03110"
                     /product="putative iron-sulfur protein protection protein"
                     /protein_id="BAN52164.1"
                     /transl_table=11
                     /translation="MTRTVMCRKYKEELPGLERPPYPGAKGQDIFEHISQKAWADWQK
                     HQTMLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPPAE"
     CDS             complement(362402..363469)
                     /codon_start=1
                     /gene="mutY"
                     /locus_tag="PP4_03120"
                     /product="A/G specific adenine glycosylase"
                     /protein_id="BAN52165.1"
                     /transl_table=11
                     /translation="MSPEQFSSAVLDWYDEHGRHDLPWQQGITPYRVWVSEIMLQQTQ
                     VSTVLNYFDRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKIVVAQHGG
                     EFPRSVEQLTELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKV
                     ANQLWATAERFTPLERANHYTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETR
                     YPEPKPRKALPQRRTLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDLAQLDDLAY
                     QHGLRLAGSRAMAGLTHTFSHFQLAIEPWLVRVDLVGEHVAEADWLWYNLATPPRLGL
                     AAPVKKLLERAADELIAGDAR"
     CDS             complement(363466..365724)
                     /codon_start=1
                     /locus_tag="PP4_03130"
                     /product="hypothetical protein"
                     /protein_id="BAN52166.1"
                     /transl_table=11
                     /translation="MKAFGKILGLGLLGLLLIIVALGFALTHLFDPNDYKDEIRQLAR
                     DKAHVELTLNGDIGWSLFPWLGLELHEASIATLAKPKEPFADLQMLGLSVRVLPLLRR
                     EVQMSDVRVEGLNLTLARDEQGHGNWEDIGKPLPAPNGTPADAQANAPAQATAEQKPA
                     PANGNERAVKLDIDSLTVNNARVQYSDAKTGQSYSAESIQLSTGPVHEGANIPLKASA
                     FISASEPNIKARTELAGELRFDRKLKRYNFEDMRLSGETSGEPTGGKTVTFAAQGQLL
                     VDLAANVASWNGLKVSANQLRALGELNVRDLDKAPQLSGGLSIAQFNLRTFLDSIGRT
                     LPATNDPAAFAKLELVTRLQGTANSLALEDLAVKLDDSTFSGRVAVEDFAKQALRLQL
                     KGDTFDADRYLPAKSEEAKGATAARQAEVKQQEASAVAGAGTTPLPNAPTQVAWSDDK
                     LLPVDRLRALDLQADLAFGSLTVDKLPIEDAQLKAIGQGGLLTLQTLRGELYNGTFEA
                     KGTVDVRPAVPQLGVNTNIQRVPVEHFIKTEGKDQVPPVKGLLTLTSDLTASGNSQKA
                     LVDTLNGSANFTINDGVLVNANLEQQLCQAIATLNRKTLSGEPRGKDTPFQELRGSLV
                     VRNGVASNPDLKARIPGLTVNGHGDLDLRVLGMDYNVGVIVEGDQRAMPDPACQVNER
                     YVGVEVPLRCRGPLELGAKACRLDQGGMGKVAAKLAGNRLKDKIDEKLEEKLGDKVSP
                     EVKDALKGLFKR"
     CDS             366093..367754
                     /codon_start=1
                     /locus_tag="PP4_03140"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAN52167.1"
                     /transl_table=11
                     /translation="MTSTVAAGASASAPGFLSKERIIARPGFNRWLVPPAALAIHLCI
                     GMAYGFSVFWLPLSQALGITAPVACAPDMGFIARLFSAECDWPISMLSWIYTLFFVFL
                     GCSAAVLGGWLEHAGPRKAGLVSALCWCGGMLISAIGVKTHQLWLMWLGSGVIGGIGL
                     GLGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMGHFGNEHEVGVWQ
                     SFVAMAAIYFVFMTAGALAYRVPPTGWKPEGWSAPAKKAGNTMVTDRHVHVSVAWKTP
                     QFALIWLVLCLNVSAGIGILGMASPLLQEVFAGKLLGNELTFSQLNAAQLAQIAAIAA
                     GFTGLLSLFNIGGRFFWASFSDYIGRKNTYFAFFALGVGLYSLVPNMGHLGNVALFVA
                     AFCIILSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLITYLRESQ
                     LAAGVERAAAYDMTLYILAGLLVLGFICNMLVRPVADKHFMSDAELAAERALSHDKGA
                     DGARSLEWKAAPGSLPLVLLAWAVVVVPLAWGVWVTLQKTAVLFH"
     CDS             367886..368518
                     /codon_start=1
                     /EC_number="4.2.1.19"
                     /gene="hisB"
                     /locus_tag="PP4_03150"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="BAN52168.1"
                     /transl_table=11
                     /translation="MEPFSPNDFAELVMVERKASVERNTLETQVKCSINLDGSGKARF
                     DIGVPFLEHMLDQIARHGLIDLDIECKGDTHIDDHHTVEDVGITLGMAFAQAIGDKKG
                     IFRYGHAYVPLDEALSRVVIDFSGRPGLQMHVPYTRASVGGFDVDLFQEFFQGFVNHA
                     LVTLHIDNLRGHNTHHQIETVFKAFGRALRMAVTLDERMAGQMPSTKGCL"
     CDS             368519..369157
                     /codon_start=1
                     /EC_number="2.4.2.-"
                     /gene="hisH"
                     /locus_tag="PP4_03160"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="BAN52169.1"
                     /transl_table=11
                     /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLVTSDAAVIREADRV
                     VFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLEHSEENAGVDCIGM
                     FPGQVRFFGKDLQEDGEHLKVPHMGWNEVSQTIHHPLWHDIPDQARFYFVHSYYINAG
                     KPGQVVGRGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFVAWDGRW"
     CDS             369158..369418
                     /codon_start=1
                     /locus_tag="PP4_03170"
                     /product="hypothetical protein"
                     /protein_id="BAN52170.1"
                     /transl_table=11
                     /translation="MSRSKAKTPVITLAPEQERDALDTLKRFLEDRFELELGSFEVAE
                     VLELFSKEIAPLYYNRAIADVQLHLKERFESIESDLWALEKP"
     CDS             369446..370183
                     /codon_start=1
                     /EC_number="5.3.1.16"
                     /gene="hisA"
                     /locus_tag="PP4_03180"
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino] imidazole-4-carboxamide isomerase"
                     /protein_id="BAN52171.1"
                     /transl_table=11
                     /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGC
                     RRLHLVDLNGAFEGQPVNGEVVTAIAKRYPTLPIQIGGGIRSLETIEHYVKAGVSYVI
                     IGTKAVKQPEFVAEACKAFPGKVIVGLDAKDGFVATDGWAEVSTVQVIDLAKRFEADG
                     VSAIVYTDIAKDGMMQGCNVPFTKALAEATRIPVIASGGIHNLGDIKALLDAKAPGII
                     GAITGRAIYEGTLDVAEAQAFCDNYQG"
     CDS             370194..370964
                     /codon_start=1
                     /gene="hisF"
                     /locus_tag="PP4_03190"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="BAN52172.1"
                     /transl_table=11
                     /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYNEQG
                     ADEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVS
                     INTAAVFNPEFVGEAADRFGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAV
                     EWAKKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLAD
                     GILEGHASAVLAASIFHFGEYTVPEAKAYMASRGIVVR"
     CDS             complement(371082..372260)
                     /codon_start=1
                     /locus_tag="PP4_03200"
                     /product="putative glycine betaine/L-proline ABC
                     transporter ATP-binding subunit"
                     /protein_id="BAN52173.1"
                     /transl_table=11
                     /translation="MSIIRFEDVDVIFSNKPREALSLLDQGKTREQILKQTGLVVGVE
                     KANLDINKGEICVLMGLSGSGKSSLLRCINGLNTVSRGKLFVEHEGKHIDIAHCSPAE
                     LKMMRTKRIAMVFQKFALMPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQW
                     RNKKPDELSGGMQQRVGLARALAMDADILLMDEPFSALDPLIRQGLQDELLGLQAKLS
                     KTIVFVSHDLDEALKLGTRIAIMKDGRIIQYSKPEEIVLNPADEYVRTFVAHTNPLNV
                     LCGRSLMRSLDNCKRVNGSVCLDPGIDSWLDLGEGGALKRARQGQNGLDMQNWAPGQD
                     VELLERRPTVVHADIGMREALQIRYQTGNKLVLQDNDRVVGILGDTELYHALLGKNHG
                     "
     CDS             complement(372257..373102)
                     /codon_start=1
                     /locus_tag="PP4_03210"
                     /product="putative glycine betaine/L-proline ABC
                     transporter permease protein"
                     /protein_id="BAN52174.1"
                     /transl_table=11
                     /translation="MLIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTS
                     ALTWFNPFVLIALFAGLAHLIQRKWGLTAFVALSFLLIFNLGYWQETMETLAQVTFAT
                     VVCVVIGVPLGILAAHKPMFYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLIST
                     VVFAIAAPIRLTYLGICDVPQELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCI
                     MLSLSMVVIAALVGADGLGKPVVNALNTADISLGFEAGLAIVLLAIMLDRICKQPELP
                     VRGEA"
     CDS             complement(373187..374134)
                     /codon_start=1
                     /locus_tag="PP4_03220"
                     /product="putative glycine betaine/L-proline ABC
                     transporter substrate-binding protein"
                     /protein_id="BAN52175.1"
                     /transl_table=11
                     /translation="MKGSPSLLLVALLSTPLLAQAAEPEQCQTVRFSDVGWTDITVTT
                     ATTSVVLEALGYKTHTTMISVPVTYKSLATGKDLDVFLGNWMPTMENDIKQYRDAGTV
                     ETVRANLENAKYTLAVPQALYDKGLKDFADIPKFKKELDGKIYGIEPGNDGNRTIQSM
                     IDKNAFGLKDAGFKIVQSSEAGMLSQVDRAQKRGEALVFLGWEPHPMNTRFKMQYLTG
                     GDDFFGPDFGKATVLTNTRKGYAQECSNVGQLLKNLSFELKDESTMMGYVLDDKMKPE
                     AAAKKWLKDNPGKLDTWLAGVTTVDGKPGLEAAKAKLAQ"
     CDS             374588..375964
                     /codon_start=1
                     /gene="sdaA"
                     /locus_tag="PP4_03230"
                     /product="L-serine dehydratase"
                     /protein_id="BAN52176.1"
                     /transl_table=11
                     /translation="MAISVFDLFKIGVGPSSSHTVGPMRAGALFVQGLRERGELERVK
                     RIEVRLYGSLSATGIGHGTDNATVMGLMGEWPDAIDPTQIVPRIADLRETNTLQLDSR
                     LPIEFVWARDMLLLDENLPYHPNAMTLIAEGEQGELHRDTYYSVGGGFVVDAAQAASG
                     VLDADQTVLPYDFNSAAELLRLCKQNDLSVSQLMMANEKVWRSEEEIRAGLHKLWEAM
                     QECVNNGLKYEGTLPGGLNVRRRAAKLHRSLQEIGKPNVIGSTMSAMEWVNLFALAVN
                     EENAAGGRMVTAPTNGAAGIIPAVLHYYMRFSDEVNESSIVDYFLAAAAVGILCKKNA
                     SISGAEVGCQGEVGSACAMAAAGLAEVLGATPPQVENAAEIALEHNLGLTCDPVGGLV
                     QVPCIERNAIAAVKAINAVQMALRGDGEHFISLDQVIRTMRDTGADMHDKYKETSRGG
                     LAVSAIEC"
     CDS             376457..377563
                     /codon_start=1
                     /gene="gbdR"
                     /locus_tag="PP4_03240"
                     /product="AraC family transcriptional regulator GbdR"
                     /protein_id="BAN52177.1"
                     /transl_table=11
                     /translation="MTSYTSGTPTQNRTAPQSIGFLLLDNFTLISLASAVEPLRMANQ
                     LSGRELYRWHTLTVDGGQVWASDGLQITPDAAMHSAPPIDTVIVCGGVGIQRTVTREH
                     VTWLQAQARQSRRLGAVCTGSWALACAGLLDGFDCSVHWECLAAMQEAYPRVNMSTRL
                     FTLDRNRFTSSGGTAPLDMMLHLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKH
                     MLGTNQPKLQEIVALMEANLEEPIDLDELAVYVAVSRRQLERLFQKYLHCSPSRYYLK
                     LRLIRARQLLKQTPMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVA
                     MMPIPQAMTLSPHSGPMAALSQARNESTFASVRL"
     CDS             complement(377683..377940)
                     /codon_start=1
                     /locus_tag="PP4_03250"
                     /product="hypothetical protein"
                     /protein_id="BAN52178.1"
                     /transl_table=11
                     /translation="MMHADLIDQDDLAGHLRARGFDIPAGASAEQACEAVVRGLTEPN
                     ARALKGMVEQMYTGSATILPAVRQAIDKQLLPALASFNKRA"
     CDS             378322..380271
                     /codon_start=1
                     /locus_tag="PP4_03260"
                     /product="putative peptidase M72 family protein"
                     /protein_id="BAN52179.1"
                     /transl_table=11
                     /translation="MNTTIWNRILLASMVMFFGGCSISERTVAAANSTPPQLFTLEPT
                     PERNVLQKTASGYLATLLGDPANAEVTLVKIDPARVSQQTQDLAVSLPDGKTAQFHLR
                     DFTTLKSGIDSWVGYKPSAWKATHAASASEIDYDPFYYLSMVREGDKLVGNLIVEGQR
                     YRLDSIGSGRYVLIKVDESKLPPDGEPLVAPAGGARDDTKVKSPQSAHSVIRLMFLAT
                     NQRKAANPWWWLDLLLAMRDANQYMKNSDVQITYQWAGNFYGDYDETGRSSSQQLGDI
                     GNAQPFASQVLSMREELRADMVLMYTTEPSVCGRAYISTGKNSPHSIVTCPRSLAHEL
                     GHNIGALHKQGETGNVPEYAYGYETPLYNLHTQMVASRDALPNFSNPRVTYLGMPLGD
                     SKFNDVARRFNERRETVENFYPPPNPLTVLVQLFSDYNQRGDMCTLKIEPGVDQPSCN
                     KVKSIRVYDFAPGMKLCFRSEEYRRVCYAGSYAGDFAVPNLKAVSVLPSGLVREGRVG
                     DDAFYGDVKYVEYAMDNQVTIKLYSLADFKGETCEFRMPTSTVGSLSEWPQCAALSGG
                     KSRSAKVFSFSSPYNKLCFFNADHRQSLCFNGNYQGNFSIRNWDVGTDLPSGLVRTHR
                     GGGYMNGSVHRISYGNDSEDWPPAP"
     CDS             complement(380275..380475)
                     /codon_start=1
                     /locus_tag="PP4_03270"
                     /product="hypothetical protein"
                     /protein_id="BAN52180.1"
                     /transl_table=11
                     /translation="MSYRGQERAPPLCVCVSEGNQTLSTTPGMHPLHVRKALRDFISD
                     GFYDDNWVSNGIRGAYYAPNLR"
     CDS             380572..382152
                     /codon_start=1
                     /locus_tag="PP4_03280"
                     /product="putative peptidase M72 family protein"
                     /protein_id="BAN52181.1"
                     /transl_table=11
                     /translation="MNRKQLKFCLLGVVFLFGGCTASDPANYLESSAVTLFQIKPDQN
                     RAALERQSGTDQYLKILLNVAEDAEVKEVQVKPGLVSKDTTMLSMPLTDGRTVSFKLS
                     RSDNVASGMVGWVGDMPSNRRQLYPSPAEINMDPLNWVSLVSDGKLVVGDIRVEGQLY
                     RLTAVGKGQQVLVKVDESKLPPEAAPIAAPVQPQGNAQLVIAPLSSKSTIRVLFVTTR
                     QSRARFPNYKIELAQALQNANQYLINSKVDAVYELSDIYDSDYDETGKEPQTQLNDMI
                     ADKPLGAKIHIEREKVRADLVSMLSTYSIYCGIAKMPARKETAFSSISCFGALGHELG
                     HNMGAMHSDEFPDQGIPAYAYGYKHTAPNFHTQMRTSHGAIPYHSNPRLQYQGVPMGT
                     VDKNDVARTFNENRDTVANFYPDPAHRVRLWLYGANRGCFIDLKPGEQALLSWYTECK
                     DNDVDPVRVEVKDFYSGSTPRKLCFSNIFYTVRSCYTGSNFSGDFVITSVHSGGGKPE
                     GFKFTRRLIGPVYRVSYE"
     CDS             complement(382252..382722)
                     /codon_start=1
                     /locus_tag="PP4_03290"
                     /product="hypothetical protein"
                     /protein_id="BAN52182.1"
                     /transl_table=11
                     /translation="MPALITYRTTVQEDWVDYNGHLRDAFYLLIFSYATDALMERIGL
                     DADSRGQSGNSLFTLEAHINYLHEVKLGTEVWVQTQIIGFDRKRLHVYHSLHRAGFDE
                     ALAASEQMLLHVDLAGPKSAPFGHTTVCRLNHLVEQQEGAQAPQYMGRTIKLPS"
     CDS             complement(382733..383698)
                     /codon_start=1
                     /locus_tag="PP4_03300"
                     /product="putative 3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="BAN52183.1"
                     /transl_table=11
                     /translation="MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQ
                     ALRKRIANAWPALEKQGLAQSASQDRLKFVSTIEECVRNADFIQESAPERLDLKLDLH
                     AKISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGSRT
                     SPEAIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDD
                     AIRFGAGLRWSFMGTFLTYTLAGGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDD
                     VVNGTSEQQGERSIAALERYRDDTLLAVLEAVKTSKASHGMSFSD"
     CDS             complement(383717..384601)
                     /codon_start=1
                     /locus_tag="PP4_03310"
                     /product="hypothetical protein"
                     /protein_id="BAN52184.1"
                     /transl_table=11
                     /translation="MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGAT
                     VVHCHVRDPQTGRFSRDVALYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLEF
                     GPGTDLIGPLERLAHVEALLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELG
                     VKAELEIFDTGHLWFAKQMMKEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPANV
                     TWAGFGIGRMQMPMAAQAVLLGGNVRVGLEDNLYLDRGVLASNGQLVERASEIITRMG
                     GRVLSPAEGREKMNLKRR"
     CDS             complement(384725..385669)
                     /codon_start=1
                     /locus_tag="PP4_03320"
                     /product="putative glycine betaine/L-proline ABC
                     transporter substrate-binding protein"
                     /protein_id="BAN52185.1"
                     /transl_table=11
                     /translation="MHSLIRRSLLTLALSSIATSPLYAAEPAACKNVRLGVVNWTDVI
                     ATSAMAQVLLDGLGYQTKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFIDAQ
                     QVKVLEKPSLEDARATLAVPKYLYDKGLKTFADIHKFEKELGGKIYGIEPGSGANTQI
                     KAMITKNQFGLGKFQLVESSEAGMLAAVDRAVRRKEAVVFFGWAPHPMNVNIDMAYLG
                     ESQDALGPDEGRATVWTVTAPDYAERCPNAHRLLANLNFSAEDESRMMQPLLDHKDAL
                     ESARQWLKDHPDDKARWLEGVTTFDGKPAADNLKLTAN"
     CDS             385816..386760
                     /codon_start=1
                     /locus_tag="PP4_03330"
                     /product="putative AraC family transcriptional regulator"
                     /protein_id="BAN52186.1"
                     /transl_table=11
                     /translation="MLQNIQFLLLPGFSAMGFISALEPLRVANRFKGPSYRWQVLSLD
                     GGAVQASNGMSVNADAALAAGEPAGILLIVAGFDPLACYGQALQQVLRRLDHEGVILG
                     GIDTGAVVLAEAGLLDGHRATVHWEALEAFKENYPSLQATQELFEIDRRRITCAGGTA
                     SIDLMLDLIAQAHGSELAVQVSEQFVLGRIRQRQDHQRMQIASRYGISNKKLVKVIGE
                     MERNTEQPLNTQVLAEAVQVTRRQLERLFRVHLDDTPSGFYLRLRLDKARQLLRQTDM
                     SVLEVGVACGFESASYFTRCYRARYQRCPREDRLARAV"
     CDS             complement(386888..387289)
                     /codon_start=1
                     /locus_tag="PP4_03340"
                     /product="hypothetical protein"
                     /protein_id="BAN52187.1"
                     /transl_table=11
                     /translation="MKSLAWLALLAVVSGAQAGEEESTPCDNVDTDQQTYACAAFNKQ
                     TAERELKSAYDDLIQRIRDQYADESDQATALIGRMDAAEKLWMQLRDADCKVETYAEK
                     QGSKAFQAAWDTCVAQRSDDRSEYLQSIGQQ"
     CDS             387574..388551
                     /codon_start=1
                     /locus_tag="PP4_03350"
                     /product="putative peptidase M19 family protein"
                     /protein_id="BAN52188.1"
                     /transl_table=11
                     /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVW
                     EGFKATVDQIAASQKLIRDNSDLVMPVRTTADIRKAKELGKTGILFGFQNAHAFEDQI
                     AYVDVFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHV
                     GSKTSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLA
                     KGIDSTIDDYAEAIEYTMNIVGEDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTNFG
                     KIINPLGIRTVGEFPNLTETLLKRGHSERVVRKIMGENWVNVLKDVWGE"
     CDS             388629..389159
                     /codon_start=1
                     /locus_tag="PP4_03360"
                     /product="hypothetical protein"
                     /protein_id="BAN52189.1"
                     /transl_table=11
                     /translation="MAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHIGIEEV
                     LGADAYAEILYKAGYKSAWHWCEKEAECHGLEGVAVFEHYMKRLSQRGWGLFEIQDID
                     LDKGTCSVKLKHSAFVYVYGKVGRKVDYMFTGWFAGAMDQILAARGSSIRTVAEQVYG
                     GSEEGHEDGLFVTKPL"
     CDS             389175..391235
                     /codon_start=1
                     /gene="dgcA"
                     /locus_tag="PP4_03370"
                     /product="dimethylglycine catabolism protein DgcA"
                     /protein_id="BAN52190.1"
                     /transl_table=11
                     /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKY
                     YEEKAKGGIGLAICGGSSVVAIDSPQEWWASVNLSTDRIIPHFQNLADAMHKHGAKIM
                     IQITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEVEEIWRVIGNYAQAARRAK
                     EGGLDGVELSAVHQHMIDQFWSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGDDF
                     CVGMRICGDEFHPDGLSHEDMKQIAAYYDGTGMLDFIGVVGSGCDTHNTLANVIPNMS
                     YPPEPFLHLAAGIKEVVKVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHMADPHLI
                     AKIKMGQIDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKTTGVKRK
                     VVVVGAGPAGMEAARVAAERGHDVTLFEKKDQIGGQITIAAKAPQRDQIAGITRWYQL
                     ELARLKVDLRLGTAASVDAIQDLRPDVIVLAVGGHPFVEQNEHWGAAEGLVVSSWDVL
                     DGKVAPGKNVLVYDTICEFTGMSAADYIADKGSQVEIVTDDIKPGVAMGGTTFPTYYR
                     SMYPKEVIMTGDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVIENGVRPDEQLY
                     YALKEGSRNKGQIDVEALFAIKPQPILSQPGEGYLLYRIGDCVAQRNVHAAIYDALRL
                     CKDF"
     CDS             391443..393395
                     /codon_start=1
                     /gene="dgcB"
                     /locus_tag="PP4_03380"
                     /product="dimethylglycine catabolism protein DgcB"
                     /protein_id="BAN52191.1"
                     /transl_table=11
                     /translation="MLNTLLPILLFAALGLAVLGALRRVRMWRRGRASKVDLIGGLLA
                     MPRRYLVDLHHVVERDKYMSKTHVATAGGFVLSAALAILVHGFGLQSKVLGYALLVAT
                     VIMFTGAIFVFKRRLNPPARLSKGPWMRLPKSLLVFAASFFIATLPVAGILPANTGGW
                     VMVAVLGLGVLWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKPLD
                     LEDPNAPLGVEKPADFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIG
                     LAGGTDAKFAGSPYPGKPIGEHGGHPHQPIVNGLVDAETLWSCTTCRACVEECPMMIE
                     HVDAIVDMRRHLTLEKGATPNKGAEVLDNLIATDNPGGFAPGGRMNWAADLNLKLLSE
                     VKTTEVLFWVGDGAFDMRNQRTLRSFVKVLKASGVDFAVLGLEERDSGDVARRLGDEA
                     TFQQLAKRNIQTLAKYKFQRIVTCDPHSFHVLKNEYGALGGEYQVQHHSTYMAELIAA
                     NKLNLAQHKGGSVTYHDPCYLGRYNGEYEAPREVLKALGIEVREMQRSGFRSRCCGGG
                     GGAPITDIPGKQRIPDMRMDDIRETEAELVAVGCPQCTAMLEGVVEPRPQIKDLAELV
                     ADVLIEEDAPSAAKPQTAKREPAEVH"
     CDS             393395..394627
                     /codon_start=1
                     /locus_tag="PP4_03390"
                     /product="putative electron transfer flavoprotein alpha
                     subunit"
                     /protein_id="BAN52192.1"
                     /transl_table=11
                     /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQTQQTSWMGPNGLIRKNP
                     HAIAAGFIGPAGIKRIDRSGAQQGTGVGGRRTAAAEVKLPLHQVPAPAFYIAVVPDMV
                     GGRLSSHDRDLLGLAHSLAGSDGAVLAVVFNEHKESNFSTAGVDRLLVVEGEAFEGYA
                     PEQLVQGLRAVDNQFTPRHWLLPDSRTGGGELGRRLGAALGERPATRVWQVKDGQCIG
                     RAGAGQQDLQRAVPRLILAAAECAEPVSETRHEALPVELSTSVARSLSRIEDLGSVAV
                     DPATIAMAEAEFIISGGNGVKDWDLYHQATAALGATEGASRVAVDDGFMPRNRQVGAT
                     GTWVTARVYVAVGISGAIQHLQGIGACDKVVAINMDPGCDMIKRADLSVIGDSSAILK
                     ALIEAVDNYRSGGQRDAA"
     CDS             394638..395408
                     /codon_start=1
                     /locus_tag="PP4_03400"
                     /product="putative electron transfer flavoprotein beta
                     subunit"
                     /protein_id="BAN52193.1"
                     /transl_table=11
                     /translation="MSTKVISLVSIGAHPSSGRARRAEQDARAVELGLQLAGDNLQVV
                     HAGNPQEEALRAYLGMGLDHLDVLEQPAGADVLGVLGDYLRDAGAQLVLTGSQAETGE
                     GSGMLPFLLAEKLGWPLIVGLAEVESIENGTAQVLQALPRGQRRRLKVRLPLLATVDN
                     AAPKPRQSAFGPARRGVLAARNVAIVEDELLADAELQPARPRPKRLKVIKAKSGADRM
                     KAATAKASGGGGKVLKDVSPQEGAEAILKLLVEEGVLR"
     CDS             396339..397061
                     /codon_start=1
                     /locus_tag="PP4_03410"
                     /product="hypothetical protein"
                     /protein_id="BAN52194.1"
                     /transl_table=11
                     /translation="MAFCGQHPDPLTGCYPLGNGRRFYSPSLRRFISSDSLSPFGKGG
                     IHAYAYCGGDPVNRHDPSGAFWGVVLRIVGVASSGATLFGSLARTAKNVVGRRAAFWA
                     NNNPPGGGGPVPSVRHQELPHASRVSNQQFFITGSAGVAGQLAAAISGVTPAFQTATD
                     VLGVVNSVTNLSGGSIGNFAAAREVGSYLWANPREIPVVALETFMDVTMVDEVFANVG
                     RGFTAVAERIRSARPTPHDVTV"
     CDS             complement(397144..398436)
                     /codon_start=1
                     /gene="gbcA"
                     /locus_tag="PP4_03420"
                     /product="glycine betaine catabolism protein GbcA"
                     /protein_id="BAN52195.1"
                     /transl_table=11
                     /translation="MDVTATLSLGDPLEPARKATAEMLQTRERTYSLPQPFYTDERLF
                     QIDMQEIFQKEWLIAGMTCEIPAKGNYITLQIGKNPILVVRGAEGKVHAFHNVCRHRG
                     SRLCVSDKGKVAKLVCHYHQWTYELDGRLLFAGTEMGADFDMKEYGLKPVHVKVAGGY
                     IFISLAENPPAIDEFLATLEHYMEPYDMENTKVAVHTTLMEKANWKLVLENNRECYHC
                     SGSHPELLQTLLEWDDTNDPRASQEFKDHVAASAAAWEAEKIPYLHKSHGLRNRIVRM
                     PLLKGTVSMTMDGKQACQKLMGRIKNPDLGSMRILHLPHSWNHCMGDHMIVFTVWPIS
                     AQETMVTTKWLVHKDAVEGVDYDPERMRKVWDATNDQDRRLAEENQRGINSTAYQPGP
                     YSKTYEFGVVNFIDWYSDRVLANLGAEPAPYLKEVKAQ"
     CDS             398745..399845
                     /codon_start=1
                     /gene="gbcB"
                     /locus_tag="PP4_03430"
                     /product="glycine betaine catabolism protein GbcB"
                     /protein_id="BAN52196.1"
                     /transl_table=11
                     /translation="MSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPI
                     MFFFKPGQFVTLELEIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMH
                     EGAELPVHGPVGLFNAIDFPAGKALYLSGGVGITPVMSMARWFYDTNANVDMVFVHSA
                     RSPKDIIYHRELEQMASRIPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYME
                     RVVFCCGPTPYMTAVKRMLEAAGFDMKNYHEESFGATPPEAKADAVEHAEQAADAPEL
                     DISDLNLVEFIGSDKSIRVAPGETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVE
                     MEHNGGITEEDEAEGYILSCCSVPKGDVRIDY"
     CDS             complement(399978..401603)
                     /codon_start=1
                     /locus_tag="PP4_03440"
                     /product="putative methyl-accepting chemotaxis transducer"
                     /protein_id="BAN52197.1"
                     /transl_table=11
                     /translation="MSLRNMNIAPRALLGFALIGLLMLGLGVFSLVQMGNIRQAGVAI
                     EQVSVPSIKILDEITALNLRMRTLSYRLLTNREPAIQSDTLNLLAQRNSQIDRARQAY
                     LPMIGAADEQAAFDQYGQLLEQYRQLESRMRSLSQADRVDELRDLLNRDLLANSEQIN
                     KVMDTLVRINTDQTRATNEKAASQYAAAFALVIGLLVAATVLTFACAFLLTRSIVKPI
                     DEALKCAEQVADGDLTHVIRAEGTDEAARLLRAMARMQDKLRDTLQQIAGSATQLASA
                     AEELNAVTDESARGLQQQNNEIEQAATAVTEMTSAVEEVARNAVSTSEASSEASRSTG
                     DGRDLVMETVGAIERMSGDVQATAKLITHLAEQSRDIGKVLDVIRGLADQTNLLALNA
                     AIEAARAGEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQGGTEEAVESMRTSTE
                     RAESTLNIAKGAGMALDTIAGAVAQINERNLVIASAAEEQAQVAREVDRNLVNINDLS
                     VQSATGAHQTSAASAELSRLAVDLNGLVARFRT"
     CDS             401880..402110
                     /codon_start=1
                     /locus_tag="PP4_03450"
                     /product="hypothetical protein"
                     /protein_id="BAN52198.1"
                     /transl_table=11
                     /translation="MLEASLNQIEQLVSDLMQKNAQLTEQNTTLGTQLAQAKEENETL
                     QLSLMEQEEKNGSTAARLQALVDRASAGVVGA"
     CDS             402107..402409
                     /codon_start=1
                     /locus_tag="PP4_03460"
                     /product="hypothetical protein"
                     /protein_id="BAN52199.1"
                     /transl_table=11
                     /translation="MRLQEQPVNVVSILGIDYSIKAPEGQEETLAQAVRMLNTALNET
                     KRQYPTLIGDKLLVLAALNLCSKQVELQKEHQQTLARTQAQIDATVDAIVRTIAES"
     CDS             402605..404542
                     /codon_start=1
                     /locus_tag="PP4_03470"
                     /product="putative methyl-accepting chemotaxis transducer"
                     /protein_id="BAN52200.1"
                     /transl_table=11
                     /translation="MRIWRKSIQWQLITSMGAALLASILVVVIIFTVALNRLTDRYLV
                     DTALPASVEAIRNDIERMLGQPLVAAADIAGNTLLRDWLAAGEDPAQAAAFIEYLGAA
                     KQRNRAFTTLFASTETGHYYNENGLDRTLSRSNPKDKWFYGYIDSGAERFINIDIDGA
                     TGELALFIDYRVEKAGKLVGVAGMGLRMTELSQLIHDFSFGEHGKVFLVRNDGLIQVH
                     PDAAFSGKRQLAEQLGTDAAKAVMTGGEGLRNSRFSRDGERYLALGLPLRDLNWTLVA
                     EVPESEIYAQMHQAVWLTSLIGGAVALVSLLLVVLLARGLVRPVRRVTAALVQIGSGA
                     GDLSHRLDDSRQDELGDLARGFNRFLDSQRSLIGEVLQTSERLHRAVEQVTQVVENTA
                     ERSGRQQEMTEMVATAVHEMGLTVQDIARNAGDAAQASQSARDEALQAREVVRRSIQG
                     IEGMSGDIGKAADAVSQLANEVASIDEVLAVIRSISEQTNLLALNAAIEAARAGEMGR
                     GFAVVADEVRTLARRTQLSTDEVQQMIQRLKQGAGSAVSSMQAGQQATGSGVESSQRT
                     GASLGAITDQVEHISDMNHQVATATEEQSAVTEEINRTVQGISDLARETAAEVQGCRE
                     ECQALRGLADDLARQMGGFRL"
     CDS             complement(404648..405688)
                     /codon_start=1
                     /gene="ltaE"
                     /locus_tag="PP4_03480"
                     /product="L-threonine aldolase"
                     /protein_id="BAN52201.1"
                     /transl_table=11
                     /translation="MTDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERA
                     SEYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFS
                     NGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAI
                     SATCKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILF
                     FNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLALLVS
                     DLPGVELMFPVEANGVFLQMPEHAIEALRAKGWRFYTFIGSGGARFMCSWDTEEERVR
                     ELAADIRSIITA"
     CDS             406012..407265
                     /codon_start=1
                     /EC_number="2.1.2.1"
                     /gene="glyA"
                     /locus_tag="PP4_03490"
                     /product="serine hydroxymethyltransferase"
                     /protein_id="BAN52202.1"
                     /transl_table=11
                     /translation="MFSKQDQIQGYDDALLAAMNAEEQRQEDHIELIASENYTSQRVM
                     QAQGSGLTNKYAEGYPGKRYYGGCEHVDKVEALAIERAKQLFGADYANVQPHSGSSAN
                     GAVYLALLQAGDTILGMSLAHGGHLTHGAKVSSSGKLYNAVQYGINTDTGLIDYDEVE
                     RLAVEHKPKMIVAGFSAYSKTLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPI
                     PFADVVTTTTHKTLRGPRGGLILAKSNEEIEKKLNAAVFPGAQGGPLMHVIAAKAVCF
                     KEALEPGFKAYQQQVIENAQAMAQVFIDRGYDVVSGGTDNHLFLVSLIRQGLTGKDAD
                     AALGRAHITVNKNAVPNDPQSPFVTSGLRIGTPAVTTRGFKVAQCVALAGWICDILDN
                     LGDADVEADVAKNVAALCADFPVYR"
     CDS             407281..408531
                     /codon_start=1
                     /gene="soxB"
                     /locus_tag="PP4_03500"
                     /product="sarcosine oxidase beta subunit"
                     /protein_id="BAN52203.1"
                     /transl_table=11
                     /translation="MQRYSGFGLFKHSLSHHENWQRMWRTPTPKKVYDVVIVGGGGHG
                     LATAYYLAKEHGITNVAVIEKGYLGGGNTARNTTIVRSNYLWDESAQLYEHAMKLWEG
                     LSQDINYNVMFSQRGVYNLCHTLQDIRDSERRVSANRLNGVDGELLNTAQVAAEIPYL
                     DCSKNTRYPILGATVQRRGGVARHDAVAWGYARAADALGVDLIQQTEVIGFRKENGAV
                     IGVETNKGFIGAKRVGVVTAGNSGHMAKLAGFRLPLESHPLQALVSEPIKPIIDSVIM
                     SNAVHGYISQSDKGDLVIGAGIDGWVGYGQRGSYPVIEHTLQAIVEMFPNLSRVRMNR
                     QWGGIVDTSPDACPIITKTPVKNMFFNCGWGTGGFKATPGSGNVFAASLAKGEMHPLA
                     APFSMDRFYNGALIDEHGAAAVAH"
     CDS             408546..408881
                     /codon_start=1
                     /gene="soxD"
                     /locus_tag="PP4_03510"
                     /product="sarcosine oxidase delta subunit"
                     /protein_id="BAN52204.1"
                     /transl_table=11
                     /translation="MLHIFCPHCGELRSEEEFHASGQAHIARPLDPAACSDEEWGTYM
                     FYRDNPRGIHHELWDHVAGCRQYFNVTRDTVTYEILETYKIGEKPQVTANGKAANAPS
                     TVKGQGEKV"
     CDS             408878..411892
                     /codon_start=1
                     /gene="soxA"
                     /locus_tag="PP4_03520"
                     /product="sarcosine oxidase alpha subunit"
                     /protein_id="BAN52205.1"
                     /transl_table=11
                     /translation="MSQTYRLASGGRIDRSKVLNFTFNGKTYQGYAGDSLAAALLANG
                     VDIVGRSFKYSRPRGIIAAGTEEPNAILQIGSSEATQIPNVRATQQALYAGLVATSTN
                     GWPNVNNDVMGILGKVGGSMMPPGFYYKTFMYPKSFWMTYEKYIRKAAGLGRAPLQND
                     PDSYDYMNQHCDVLIVGAGPAGLAAALAAARSGARVILADEQEEFGGSLLDSRETLDG
                     KPAADWVNAVIKELEGLPEVTLLPRATVNGYHDHNFLTIHERLTDHLGDRAPIGQVRH
                     RVHRVRAKRVVLAPGAHERPLVYGNNDVPGNMLAGAVSTYVRRYGVAPGRKLVLSTNN
                     DHAYRAALDWHDAGLQVVAIADARHNPRGSLVEEARAKGIRILTSSAVVEAKGSKHVT
                     GARVAAIDVQAHKVTSPGETLECDLIATSGGYSPIVHLASHLGGRPVWRDDILGFVPG
                     DAPQKRECVGGINGVYALGDVIADGFEGGVRAATEAGFKASVGTLPKTVARKEEATVA
                     LFQVPHDKGSKGPKQFVDQQNDVTAAGIELATREGFESVEHVKRYTALGFGTDQGKLG
                     NINGLAIAARSIGITIPEMGTTMFRPNYTPVTFGAVAGRHCGHLFEPVRFTALHAWHV
                     KNGAEFEDVGQWKRPWYFPKAGEDIHAAVARECKAVRDSVGLLDASTLGKIDIQGPDA
                     REFLNRIYTNAWTKLDVGKARYGLMCKEDGMVFDDGVTACVGDNHFIMTTTTGGAARV
                     LQWMELYHQTEWPELKVYFTSVTDHWATMTLSGPNSRKLLSELTDIDMDKEAFPFMTW
                     KEGNVGGVPARVFRISFTGELSYEVNVQANYAMGVLEQIIEAGKKYNLTPYGTETMHV
                     LRAEKGFIIVGQDTDGSMNPDDLNMSWCVGRNKPYSWIGLRGMNREDCVRENRKQLVG
                     LKPVDPTKWLPEGAQLVFDPKQPIPMDMVGHVTSSYASNSLGYSFAMGVVKGGLKRMG
                     ERVYSPQADGSVIEAEIVSSVFFDPKGERQNV"
     CDS             412072..412704
                     /codon_start=1
                     /gene="soxG"
                     /locus_tag="PP4_03530"
                     /product="sarcosine oxidase gamma subunit"
                     /protein_id="BAN52206.1"
                     /transl_table=11
                     /translation="MSAINVFQQNPGAEAKAQSPLHHADLASLVGKGRKNAGVTLRER
                     KFLGHLTLRGDGHNPEFAAGVHKALGLELPVALTVVANNDMSLQWVGPDEWLLIVPGG
                     QELAVEQKLRAALDGQHIQVVNVSGGQSLLELRGPNVREVLMKSTSYDVHPNNFPVGK
                     AVGTVFAKSQLVIRRTAEDTWELVIRRSFADYWWLWLQDASAEYGLSIEA"
     CDS             412717..413574
                     /codon_start=1
                     /gene="purU"
                     /locus_tag="PP4_03540"
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="BAN52207.1"
                     /transl_table=11
                     /translation="MSRAPDTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDR
                     QSGRFFIRVEFRQPDDFDETGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHC
                     LNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPNDKAGQERKVLQV
                     IEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMV
                     GATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVF
                     LNANRTVVL"
     CDS             413845..415044
                     /codon_start=1
                     /gene="fdhA"
                     /locus_tag="PP4_03550"
                     /product="glutathione-independent formaldehyde
                     dehydrogenase"
                     /protein_id="BAN52208.1"
                     /transl_table=11
                     /translation="MSGNRGVVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVST
                     NICGSDQHMVRGRTTAQVGLVLGHEITGEIVEIGRDVERLKIGDLVSVPFNVACGRCR
                     SCKEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAME
                     KIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGD
                     LNPARLAHAKSQGFEVVDLSKDTPLHEQIIDILGEPEVDCAVDAVGFEARGHGHEGAK
                     HEAPATVLNSLMQVTRVAGNIGIPGLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSF
                     HTGQTPTMKYNRQLMQAIMWDRINIAEVVGVQVINLDQAPEGYGEFDAGVPKKFVIDP
                     HKMWGAA"
     CDS             416192..416767
                     /codon_start=1
                     /locus_tag="PP4_03560"
                     /product="hypothetical protein"
                     /protein_id="BAN52209.1"
                     /transl_table=11
                     /translation="MKAFTLATLMTLAASPVFAFNLSDAANAVSAMQTQKQQGQVQAP
                     EAQANLLNTLGSELKITPEQAVGGAGAMLGLARNNLSSDDYGQLTKAVPGLDLLAGAN
                     ALGGLSGFGDLLGKNSESESALSNALGNNVENRSDLDSAFKALGMDTGMIGQFAPLIL
                     QYLGQQGIAGSLLQNLSSLWTAPASTPAPSV"
     CDS             complement(416844..417539)
                     /codon_start=1
                     /locus_tag="PP4_03570"
                     /product="hypothetical protein"
                     /protein_id="BAN52210.1"
                     /transl_table=11
                     /translation="MSVAMFTYCPYGQSNNYTNQNAVLGFNGERYDLAARAYALGQGY
                     RSYSPVLMRFHAPDHLSPFEQGGLNAYAFCEGDPVNYQDPTGHMRGASIWLTPKKAFK
                     RLISIFDRPAPPTVGVEVIPGTLTTPVTAIKKITRFSNLPLRINYTDEAELTRLDQFR
                     YRAELIKYYERELMKNEPLLNKFADLRKKIEMRASNGIEIDVADEERFGILENTKQRF
                     DQLRKEIRKTRSI"
     CDS             complement(417629..418978)
                     /codon_start=1
                     /locus_tag="PP4_03580"
                     /product="putative amino acid transporter"
                     /protein_id="BAN52211.1"
                     /transl_table=11
                     /translation="MANQPSSTPAQLRRVLGLPALVFFGLVYMVPLTIFTTYGIVTEL
                     TGGRTAGAYLVTLVAMLFTAASYSFMVKRFPVAGSAYSYTNMAFGPNIGFLAGWSLLL
                     DYLFLPMINYLLIGLFLNIAFPAVPAWAFVLACIALVTVLNVVGINSVAKTSNLIVGA
                     QIVFIGVFVALSCQTLAGQPLDLLSPLLGDGSKPGFGHLMAGAAVLCLSFLGFDAVST
                     LAEECRDARRDVPRAIILTTLFAGLLFTLLAYVSQLVLPGSSFANADAAANEVMFKAG
                     GQFLTNFFTAAYVAGSLGSALASQAAVSRILFTMGRDNVLPRRSFGYLSPRFGTPVFA
                     ILLVSAFSLLALVIDLATLASLISFGALVAFSAVNLAVVKTHLMDDASQRDAKGLLSY
                     GVVPLVGLGLTLWLWTSLSALTLVIGLCWFALGLAYLAALTAGFRRPVRMVDFSEAG"
     CDS             complement(419210..420097)
                     /codon_start=1
                     /locus_tag="PP4_03590"
                     /product="putative acyltransferase"
                     /protein_id="BAN52212.1"
                     /transl_table=11
                     /translation="MRRLLTGILTTTLLLLNTVVLICPLLVFALLKLVLPGRGRDYAS
                     WAVMWVAETWSEIDKAIFALCIPTEWDIRGVENLRKDTSYLAVSNHQTWVDIPALIES
                     LNRRTPFFKFFLKKELIWVPLLGLAWWGLDYPFMKRYSKAFLEKHPELKGKDLEITKA
                     ACELFKRQPVTVVNYLEGTRFTETKRQEQQSPYRYLLKPKAGGVAFVLAALGEQLDAL
                     LDVTIVYPGNQAPGFWALLNGSISRVIIDIQVRELDPALWAGDYENDPEFRQTVQAWV
                     NQLWAAKDQRIEELRGELG"
     CDS             420280..420780
                     /codon_start=1
                     /locus_tag="PP4_03600"
                     /product="hypothetical protein"
                     /protein_id="BAN52213.1"
                     /transl_table=11
                     /translation="MKSLFAMLSLLALPVMAAEPTIYGRYENIALPELGETLKAKMDT
                     GAFTASLSAKDIELFNRDGDEWVRFRLATKDSDGKVYEHKVSRISKIKGRADEEEEGD
                     APEISKRPVVDLELCLGDVKRTVEVNLVDRSSFNYPLLVGSKALREFKAAVNPAKKFT
                     AGKPDC"
     CDS             421026..421979
                     /codon_start=1
                     /locus_tag="PP4_03610"
                     /product="putative transposase"
                     /protein_id="BAN52214.1"
                     /transl_table=11
                     /translation="MAMQVGKLIVGADVAKAELVIHHDDRDEIIKVKNTKPEIKKWLK
                     QQPLNTAIAVEATNVYHLDLVELAHSLGFEVYVIDGFQLSNYRKSVGVRVKTDPTDAR
                     LLSRFLRNEGEDLRPWTPPPAVYGKLQSLLRRRAALVTARTAMTQSWANEALLKAAFT
                     TFVKSIDRLDLLIQKKIKEVLREAGLHEQVARCQAVEGIGFLTATALVMAFMRGEFKS
                     SDSYIAFLGMDLRVIDSGQKNGRRRLTKRGCSEIRRLLHNAAMSASRTATWKGLYEQH
                     RNAGKATTQALVILARKLARVAFALMKNQDEYVTKGGKAPC"
     CDS             422190..422870
                     /codon_start=1
                     /gene="creB"
                     /locus_tag="PP4_03620"
                     /product="two-component response regulator CreB"
                     /protein_id="BAN52215.1"
                     /transl_table=11
                     /translation="MPHILIVEDEAAIADTLVYALQADGHSTEWVTLGGAALDQQRQR
                     PADLIILDIGLPDISGFETCRQLRRFSDVPVMFLSARDGEIDRVVGLEIGADDYVVKP
                     FSPREVAARVRAILKRMGPRADPATDAALFQLDTLRMQITYRGQPLTLTRHEFRLLQS
                     LLEQPQRVFSREQLLDALGVASDAGYERTIDSHIKSLRAKLRQVAGDAEPIQTHRGLG
                     YSYSPDHA"
     CDS             422870..424306
                     /codon_start=1
                     /gene="creC"
                     /locus_tag="PP4_03630"
                     /product="two-component histidine kinase CreC"
                     /protein_id="BAN52216.1"
                     /transl_table=11
                     /translation="MRLGIRIFLVYFLFVGLAGYFLLNTVREQIRPVVRQSSEETLVD
                     TANLLAEILRDDVKAGTLSQSRLPQVLKAYGSRSPGAQIWGLAKNQVSHRIYVTDAKG
                     IVLLDSSGEALGKDYSQWNDVLLTLRGQYGARSTRSDPNDESTSVMHVGAPIIDDGKV
                     IGVVTVAKPNSSLQPYIDRSERRLLTLGLGLIGLGLLIGAALSWWLARSLRRLARYAQ
                     AVSEGERAALPHYKGGELAHLAQAVERMRTQLEGKAYVERYVHTLTHELKSPLAAIRG
                     ACELLQDEGMPADQRARFAGNIERESERLQQMVERLLNLARVEQMQALEDEQQVALAA
                     LVDELLLAHGARIEGAGLHVRQRVPAGLRLLCDPFLMRQALANLLDNALDFTPAGGAL
                     LFDLERDGERVALSLFNQGQAIPAYAIGRVSERFYSLPRPGSGRKSTGLGLNFVAEVM
                     QLHGGALAVDNVDGGVRVRLWLPVRRIS"
     CDS             424507..425835
                     /codon_start=1
                     /gene="creD"
                     /locus_tag="PP4_03640"
                     /product="inner membrane protein CreD"
                     /protein_id="BAN52217.1"
                     /transl_table=11
                     /translation="MTKTLGYKLGMIAVLILLLLIPLLLINGLIDERQALRDNVLRDI
                     AQSASFDQQLSGPLLVVPYRKYQRRWIEKDGERTQETSTIAGHLYFLPDTFAADLGVD
                     TELRARGIYQARLFHAKGRISGRFKLPERWGIDKDFDDYRFDKPFLVVGISDIRGIEN
                     GLELSMDEQKVPFEAGTQLDWMRGGVHASLPGLDGMQARKFSYGFDLALQGTGQLHIV
                     PVGRTSSVDMRANWPHPSFVGSYLPNRRDIDAQGFSAHWQTSFFATNLEDALRQCATA
                     GQCEDISERSFGVSFVDPVDQYLKSERAIKYALLFIALTFAGFFLFEVLKNLSVHPVQ
                     YILVGVALAFFYLLLLSLSEHIGFGLAYGLSASACVLLIGFYLSHVLRSLARGVGFAA
                     GLAALYALLYGLLSAEDYALLMGSLLCFGLLGVFMVLTRRLDWARVGRSA"
     CDS             complement(425983..426597)
                     /codon_start=1
                     /locus_tag="PP4_03650"
                     /product="glutathione S-transferase family protein"
                     /protein_id="BAN52218.1"
                     /transl_table=11
                     /translation="MTLFHSPLSPFVRKVMVVLHETAQLERVTLQPVNISPVSGDPQL
                     NHDNPIGKIPALRLDDGTVLHDSRVICEYLDLQHVGLPLLPREGSARWRRLTLVSQAD
                     AIMDAAVSSRYESFLRPEDKRWDGWLQAQGDKIRRSLANLEQEHLPELVSGFDLAAIG
                     VACALGYLDLRQPEFGWRERQPGLAAWYAEVAKRPSMVATAPTA"
     CDS             complement(426610..427278)
                     /codon_start=1
                     /EC_number="1.8.4.11"
                     /gene="msrA"
                     /locus_tag="PP4_03660"
                     /product="peptide methionine sulfoxide reductase MsrA"
                     /protein_id="BAN52219.1"
                     /transl_table=11
                     /translation="MVLRSEILVNKNVLPTAEQALPGRETPMSLPEFHYVFEGTPLLG
                     PFFEGAIDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHT
                     EVVLVVFDKDKVSYRELLAMFWELHNPTQGMRQGNDVGTQYRSAIYCTSPEQLEQAKA
                     SRDAFQAELNKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNPQGYCGIGGTGVCLPPS
                     LQGN"
     CDS             complement(427447..430134)
                     /codon_start=1
                     /locus_tag="PP4_03670"
                     /product="putative sensory box protein"
                     /protein_id="BAN52220.1"
                     /transl_table=11
                     /translation="MKSQPDAASRVAAEVVTPLPVPSRLGMLRFERLNEATWSMLYLD
                     PACERQFGLHAADLCALVDAPYASLMEPEARYRLHDEIQLQLAQRGYYRVRYSLHTPT
                     TSLRLLETGEAYKQHNRQLLRGYLSVLDDQPDDAGESASDLESRNNRLQLALQLNQRA
                     QQEQLEHLERVRGQQDLILRLARQRYSAENSLLEAAQLITQSACEIYKVDSASIWHLD
                     DQRLEPITAWYRDAQEHRQPEAIDASRFPDYLEALHASRAIDAHNAGHDPRTRALTQS
                     LRPENKAMLDASIRVDGQVVGVLCLEQSGQPRAWQSDEIAFAGELADQFAQVITNHNR
                     RAAASALHLFQRAVEQSASAFLLVNRDGRVEYVNPSFTAITQYSTDEVQGRQLGELPA
                     LENLSELLFDSPSSLAMGNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGIY
                     EDVTQTKLAQQRIERLAYTDNLTNLGNRPAFIRSLDERFVRDGESAMCLLLVDIDNFK
                     RINDSLGHQTGDKLLISLARRLRNSLHSGGILARFASNEFAVLLDDTSLEDGQGVALQ
                     LLSTLDKPMFVDNQLINVTASVGLACAPLHGVDPASLMKNAGLALHKAKANGKHQVQV
                     FTEVLNAEASYKLFVENNLRRALTQNELEVFYQPKICLRSGRLLGLEALLRWNHPERG
                     MIRPDQFISVAEETGLIIPIGKWVVRQSCRMSKQLREAGLGNLHVAINLSPKQFSDPD
                     LVASISTILNEEALPPHLLELELTEGLLLEASEDTHRQLDELKALGLTLAMDDFGTGY
                     SSLSYLKKFPIDILKIDRSFINEIPDNQDDMEITSAVVAMAHNLKLKVVAEGIETPEQ
                     LAFLRRHRCDVGQGYLFDRPIPGRELAERLKRYPRGPVA"
     CDS             complement(430496..432133)
                     /codon_start=1
                     /gene="aceF"
                     /locus_tag="PP4_03680"
                     /product="pyruvate dehydrogenase E2 component"
                     /protein_id="BAN52221.1"
                     /transl_table=11
                     /translation="MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASM
                     EIPAPKAGIVKELKVKLGDRLKEGDELLVLEVEGAAAAAPEAPAAAAAPAAAPAPAAE
                     AAPAPAAAPAAASVQDIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASME
                     IPSPAAGVVEEVLCKLEDEVGTGDLIFKLKVAGAAPAAAPAPAAAPAPAKAEAAPAAA
                     PAAAAPAAAPAPAATAPAAGNNAKVHAGPAVRQLAREFGVELGAVAATGPHGRILKED
                     VQVYVKAMMQKAKEAPAAAGATGGAGIPPIPVVDFSKFGEVEEVALTRLMQVGAANLH
                     RSWLNVPHVTQFDSADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAFLLKELPDF
                     NSSLAPSGKAIIRKKYVHIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAEKART
                     KKLSADDMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATMQPVWDGKAFQPKL
                     MLPLSLSYDHRVINGAAAARFTKRLGDVLGDIRTMLL"
     CDS             complement(432147..434792)
                     /codon_start=1
                     /gene="aceE"
                     /locus_tag="PP4_03690"
                     /product="pyruvate dehydrogenase E1 component"
                     /protein_id="BAN52222.1"
                     /transl_table=11
                     /translation="MQDLDPIETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGS
                     QLPYAITTPYRNTIPVTHEARMPGDLFMERRIRSMVRWNALAMVMRTNLKDSDLGGHI
                     SSFASSATLYDIGFNYFFQAPTEEHGGDLIFFQGHASPGVYARAFMEGRINEDQMNNF
                     RQEVDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQK
                     VWCFMGDGECDEPESLGAIALAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGV
                     FRGGGWNVNKVVWGRFWDPLLAKDTNGALQRRMDEVIDGEYQNYKAKDGAYVRENFFN
                     TPELKAMVEDLSDDEIWKLNRGGHDPYKVYAAYHQAVNHKEQPTVILAKTIKGYGTGA
                     GEAKNTAHNTKKVDVDSLRHFRDRFDIPVKDADLENLPFFKPEEGSAEAKYLAERRAA
                     LGGFVPQRRAKSFSVPTPSLETLKAILDGSGDREISTTMAFVRILAQLVKDKEIGQRI
                     VPIIPDEARTFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAG
                     AMSSFIAAGTSYSCHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRT
                     TLNGEGLQHEDGHSHMMAGTIPNCRTYDPTYGYELAVIIQDGMKKMTEEQQDIFYYIT
                     VMNESYQQPAMPAGVEEGIIKGMYLLEEDTREAAHHVQLMGSGTILREVREAAKILRE
                     EFNVGADVWSVTSFNELRRDGLAVERANRLKPGQKPQQTYVEECLAGRKGPVIASTDY
                     MKLFAEQIRQWVPSKEFKVLGTDGYGRSDSRKKLRHFFEVDRHFVVLAALEALADRGE
                     IEPKVVADAIVKFGIDPDKRNPLDC"
     CDS             435176..438109
                     /codon_start=1
                     /EC_number="2.7.7.42"
                     /gene="glnE"
                     /locus_tag="PP4_03700"
                     /product="glutamate-ammonia-ligase adenylyltransferase"
                     /protein_id="BAN52223.1"
                     /transl_table=11
                     /translation="MRLPLPSDLPATLQPLLARNRQFLSDAVAAHADLDLNAWSPVHR
                     QQFDQVAAASDFVLGLAQREPAMLFELLASGELERRYAPGELRGQIAAAAQAAQSDDE
                     LARNLRRARNRQQLRIIWRDITRQAELGETCRDLSDLADAAIDEAYQWLYPRHCQQFG
                     TPIGNRSGQPQHMVVLGMGKLGAVELNLSSDIDLIFGFPEGGETEGVKRSLENQEFFT
                     RLGQRLIKALDPVTVDGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAM
                     IKARVVAGDQAAGAQLQEVLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMADNIK
                     LGAGGIREVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAELREGYE
                     FLRYTEHAIQAIADRQTQMLPEGETDQARVAYILGFADWQSFHDQLMYWRGRIDWHFR
                     QVIADPDDEDGEGELVVGGEWSPLWEQAQDEEAAGRQLEEAGFKQPVEALRRLAGLRS
                     SPQLRSMQRIGRERLDAFIPRLLAQAVEHDNPDLVLERVLPLVEAVARRSAYLVLLTE
                     NPGALRRLLTLCAASPWIAEQIAHYPLLLDELLNEGRLFSPPLAPELASELRERLTRI
                     PEDDLEQQMEALRHFKLAHSLRVAASEISGNLPLMKVSDYLTWLAEAILDQVLALAWR
                     QTVARHGQPRRSDGSLCDPGFIIIGYGKVGGLELGHGSDLDLVFIHDGDPHAETDGSK
                     PIDSAQFFTRLGQRIIHLLATQTNSGQLYDVDMRLRPSGASGLLVSSLGAFERYQQNE
                     AWTWEHQALVRARVLVGCKQVGAAFEGVRAKVLGQTRDLEKLRTEVSEMRAKMRGNLG
                     TKATAAGTAANAFEAGVPFDIKQDAGGIVDIEFMVQYAALAWSHDHPAILRWTDNIRI
                     LEELEQANLMPASDAVLLREVYKAFRSASHRQALQKQAGVIDATQFADERREVRRIWG
                     ELGLT"
     CDS             438336..439385
                     /codon_start=1
                     /gene="waaF"
                     /locus_tag="PP4_03710"
                     /product="heptosyltransferase II"
                     /protein_id="BAN52224.1"
                     /transl_table=11
                     /translation="MRILIIGPSWVGDMVMAQTLFQCLKQQHPDCVIDVLAPEWSRPI
                     LERMPEVRQALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIP
                     KRTGWRGELRFGLLNDVRKLDKARYPLMIERFMALAYAPGAELPQPYPRPSLQIEAQS
                     RDAALAKFGLELDRPVLALCPGAEFGEAKRWPVEHYAAVADAMVRQGWQVWLFGSKND
                     HPVGEQIRDRLIPGLREESSNLAGETSLAEAIDLMSCAHAVVSNDSGLMHVAAALNRP
                     LVAVYGSTSPGFTPPLADQVEVVRTGIECSPCFDRTCRFGHYNCLRLLEPGKVIAALH
                     SLSGPDLIDTVAEVD"
     CDS             439386..440444
                     /codon_start=1
                     /gene="waaC"
                     /locus_tag="PP4_03720"
                     /product="heptosyltransferase I"
                     /protein_id="BAN52225.1"
                     /transl_table=11
                     /translation="MRVLIIKTSSLGDVIHTLPALTDAAHAIPGIRFDWVVEEGFAEI
                     PSWHPAVDQVIPVAIRRWRKNLWQTLKSGEWKAFKQRVRERKYDLVIDAQGLVKSAWL
                     TRYVKAPVAGLDRYSAREGWASRFYDRRLSVATGQHAVERVRQLFAMALAYDLPEGIG
                     DYGLDLERLQLPPAAPYVVFLHGTTWATKHWPEAYWRELAERMGRRKLEVRLPWGNPA
                     EKARAERIAQGLNNCQVLPKLNLAGVARVLAAAKACVAVDTGLGHLAAALDVPTISLF
                     GPTNPGLTGAYGRTQIHQASDWPCAPCLQKKCTYKPSADDLRRFDLKREWPLCFTRLN
                     PEHVAGRLSALLLAEDVR"
     CDS             440444..441568
                     /codon_start=1
                     /gene="waaG"
                     /locus_tag="PP4_03730"
                     /product="lipopolysaccharide core biosynthesis
                     alpha-1,3-glucosyltransferase WaaG"
                     /protein_id="BAN52226.1"
                     /transl_table=11
                     /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTLIWEGD
                     IPPGFEVLVAPVKAIFNHRRNEKLSAWMAADLAKRPVDRLIGFNKMPGLDVYYAADGC
                     FEDKAQTLRGGLYRRWGRYRHFAEYERAVFAKDAHTEVLMISEVQQPLFIKHYGTPVE
                     RFHLLPPGISQDRRAPANAAEIRAEFRKEFNLGDDDLLLVQIGSGFKTKGVDRSLKAL
                     AALPSALRKRTKLMVIGQDDPKVFQLQSATLGLGDQVQFLKGRSDIPRFLLGADVLIH
                     PAYNENTGTVLLEALVAGLPVLVSKVCGYAHYIAEADCGLVLDEPFEQDQLNGYLQRM
                     LEDPQARASWSRNGLAFAETADLYSMPQHAADVILGQKTV"
     CDS             441565..442371
                     /codon_start=1
                     /gene="waaP"
                     /locus_tag="PP4_03740"
                     /product="lipopolysaccharide core sugar kinase WaaP"
                     /protein_id="BAN52227.1"
                     /transl_table=11
                     /translation="MKLILAEPFKRLWAGRDAFDAVEALQGEVYRELEGRRTLRTVVA
                     GEGFFVKIHRGIGWGEIFKNLFTAKLPVLGAGQEWRAIQRLHEVGVPTMTAVAYGERG
                     SNPATQHSFIITEELAPTISLEDFSIDWAKQPPEPRLKRALIAEVAKMTGGMHRAGVN
                     HRDCYICHFLLHTDRPVTADDFKLSVIDLHRAQTRATISRRWRDKDLAALYFSALDIG
                     LTQRDKLRFLRGYFQRPLRQVLKDEAQLLTWLERKAQKLYDRKQRYGDAL"
     CDS             442371..443105
                     /codon_start=1
                     /gene="wapP"
                     /locus_tag="PP4_03750"
                     /product="lipopolysaccharide kinase WapP"
                     /protein_id="BAN52228.1"
                     /transl_table=11
                     /translation="MAGWTLAPGYEHLATDFGSLDAVFALQGERLTRDPLSEVVRIER
                     DGVNYYVKRYTGAGKHMRRYLGRPRIKAEWQNLKQFAKWGIPTAEVVAWGLERKGLAF
                     GRGAMITRELPNTEDLSALAERNDARLADRAWVDHLSRQLARHTRVMHEHRFAHNDLK
                     WRNLLVDDQGTLFFIDCPTGDFWRGFMWRHRMIKDLACLDKVAKYHLSATQRLRFYLQ
                     YRGRDRLNERDKKRIRQVLGFFEGRE"
     CDS             443102..443854
                     /codon_start=1
                     /gene="wapQ"
                     /locus_tag="PP4_03760"
                     /product="lipopolysaccharide kinase WapQ"
                     /protein_id="BAN52229.1"
                     /transl_table=11
                     /translation="MTDYLASADLALLKRHGLDDFEALWALQLEAVDEPNTGRGGWSS
                     VFRLELEGKGYYLKRQSDYLTRTLHRPFGEPTFAREFRNISRYQKLHIPALQAVFYGE
                     RKQGGKHRAILMTRALDEWADLDSLLAQWPQLGDAERNGILKACGQLARTLHSAGQVH
                     GCFYPKHIFLRQRREGWDAQLIDLEKTRPLLLGMRDRLKDLEPLLRRAPAWSEADVRT
                     MLATYLAQPADSTLVNNWLQRLTQRRREKEAR"
     CDS             443854..445296
                     /codon_start=1
                     /locus_tag="PP4_03770"
                     /product="putative lipopolysaccharide kinase"
                     /protein_id="BAN52230.1"
                     /transl_table=11
                     /translation="MRLSELKDAGRSPSLPLNITLADAAGSAELQLLSLLRVLPGQRY
                     VGAGVWRGTPVLAKLLVGGNAARHFQRELQGVKLLAEQGLTTPKLLADGLKEGEGGWL
                     LFEFLDGAESLADAWAAVENLPVLADEQHLVLGEALTAVAHMHAQGLWQEDLHLDNLL
                     RHGGKLYLIDGAGIKAETPGQQLSRPRVLENLGVFFAQLPKRLEPFIEELLVHYLLAN
                     AEHALPLEALQKQVDKVRNWRQKDYLDKAGRECSLFSVQRSLSGLQAIRRTEVDAMQR
                     VLEQADALIEKGHLYKTGGAASVARIEVNGRKLVLKRYNIKNTAHWFKRFWRPSRAWH
                     SWIEGHRLEFLGIATPRPLAVLEQRVLGLRSRAYLVTEYVDGPDLTACFAPYVESGDA
                     PEEQVDALVHVMQQLIRERISHGDFKGHNLFWHNGQWSLIDLDAMCQHATQLSFAPAY
                     ARDRARLLRNWPSGSALHQRLDRLLPKLVE"
     CDS             complement(445315..448092)
                     /codon_start=1
                     /locus_tag="PP4_03780"
                     /product="hypothetical protein"
                     /protein_id="BAN52231.1"
                     /transl_table=11
                     /translation="MRPLEQLEQIDRQISDLLGGLPTIALQHPINPDTRTWLHGELAS
                     FWTTADEQGETPRQKLLALRKALMLAEVELRLGDETLGYRSADQLWACLQQPLPSQRR
                     HMPLAKRPQVYRVLLEGLRPNWRSYLPGTLIIVAGTAEGPMLTPEDAAGMALLCSLSQ
                     GVEAFESLAALHQELCERLEDPLQSKPLLHLYTDAQADRVRLSQRLRYDWYADSLLEA
                     QIDSVIEAQRQRLSDTGLWSSSPQPNRIHKAMELWHEVGAKPILQTRYSRLLEKNLPN
                     WLRNTSAQGLSHMMQAMQELVAIAEQAAAPGVLSFNDFKQRNSLLGWANARLRERLRH
                     DLGYAADPRDIKIVVVRARRTGAVLHPFAISSYVTYAGMRRVGDEMVEMVEEINTLEE
                     IALKNLPWFDTDYWLTARVIHAHGNAMPAGLTPQYVKHMVRELNVGDSYAEYLRTQLI
                     SSRAGKWRLTAHSKVNRARMHAEAVKARYAGHFGEDPFEHGYNWVRAVLDQPHNALRA
                     PVAGYPVTVRQLNIMGHTLQGVLLLNSITYKSPACVLYTPDAPDRRAWRRFRTTRELL
                     RTLRQQPALRAYVALRLPLLPAVTVQRLLDKGRMSTHLTTPEIKDDLFFVYYMAEARA
                     LIAQADADSMTTREVNVESVMALSWRLLDFISLLLPNRALLVLSIGRMAIDIWDGAEA
                     FKQEDVEGVMRHAYQALSHLNDAGTSFLGSRVLRRSLRGIPKQPPLPLPARQQVQPSS
                     SLRYRIDGIYGEGVYEQSSVFGGQSLYFVKDNDNRYYQVSFDGYRWRAIDPAQPDTYL
                     QQPLKRKADGQWVIDSPVLWYDGLPDLKQLLQDCYLQVPVAGLPLNSEQGLFEADDQL
                     YLGLESGQLPVRRHLLPDHYHLQMASPDNAGVVPWAVMRHESGQWLIRVRQAGRSSDW
                     LTLPDQPPPAQ"
     CDS             complement(448159..448344)
                     /codon_start=1
                     /locus_tag="PP4_03790"
                     /product="hypothetical protein"
                     /protein_id="BAN52232.1"
                     /transl_table=11
                     /translation="MSHRSQSTARLFAWPALIAMLGFLGLFAALLGDGGWDVLAWAGL
                     GLPALLSLRGLLWRRGR"
     CDS             complement(448341..449492)
                     /codon_start=1
                     /locus_tag="PP4_03800"
                     /product="hypothetical protein"
                     /protein_id="BAN52233.1"
                     /transl_table=11
                     /translation="MRPPFQQAKIGTVMKSPTIRRWSVIHTWSSLVCTLFLLLLALTG
                     LPLIFHHELEHLLGDAPELREMPAGTPHLDLQQLVLKAEQHRPGEVVQYFGYEEDEPN
                     GVVAITAATAGTDPNLSHTFMLDARTGEAVAMPAANGGFMMIMLRLHVDMFAGLPGKL
                     LLAFMGVLFIVAIVSGTVLYAPFMRRLAFGTVRHEKSRRLRWLDLHNLIGAVTLAWAL
                     TVGVTGVISALSDLVIAAWRNDSLAAMVAPYRDATPLVDRAPATRLLEIAEQAAPGMR
                     PDFIAFPGTRFSSEHHYAVFMNGATHLSSHLFTPVLIDARTLAVTAVGDRPWYMDAMG
                     LSQPLHFGDYGGRPMQILWALLDVLTIIVLGSGLYLWWGKQRKPREVRA"
     CDS             complement(449509..451944)
                     /codon_start=1
                     /locus_tag="PP4_03810"
                     /product="ferrichrome-iron receptor"
                     /protein_id="BAN52234.1"
                     /transl_table=11
                     /translation="MSRAVDRILRPSLMALAIGLAAPLASSALFAAELSTPRAYNLPS
                     APLATTLNQIASQAGIALAIDPALVSGRTSAPVSGQYDGLGALQAALRGTGLQLQQSS
                     VGSYSLVATQEGALALPETAINATSNYESAWGAVEGYTATRTAASTKTDTAIAELPRS
                     VSVITRQQMEDRPVLSLNDALRYTAGVQSSGYGSDSRSDWLLVRGFVPTQFLDGLPLP
                     KGNYATPKIEPWNLERIAVLRGPASSVYGQTPPGGLLDMTSRRPQLESSHEIEAQVGS
                     NNHKQINFDSTGKLDDEGQFLYRVSGTVRDSGSPIDHIPDKRYNIAPSLTWNINDDTK
                     LTFISQYTRDDTGITGQFLPLQGTKLDSPAGKISHHKNLGDPDWESYDRTYYHLGYAF
                     ETRLNDTWQFRQNLRYARNELDFKGITAGGSIWPAGPDEAVSADGTVQRTAGIVEEDI
                     SQFAVDNNFQADFQTGQLAHTLLLGLDHQRSDSNARWRWGSAGVPSSNIHNPVYGQDF
                     SNVQYFDMYDYDQKTQQTGLYAQDQMALDNWRLTLGGREDWVHTGTTFHNQGDATNTQ
                     RDKKFSGNAALSYVFDSGLTPYISYAESFQAATGSAVNSTDAFKPTEGKQYELGIKYQ
                     PPGSKSLFTAAVFDLTQQNMSVTEGGVTRQVGEVRVKGLELEATSDVSENLKLVGSYT
                     YNDSEITKGTSEEKGKRMAQVPRNQATAWADYTWHSGALDGFGVGVGVRYVGDTYGNT
                     TNTDWGHVGSYTVYDASVHYDLGRLNSTLKGVTVAVDAKNLFNKDYLSTCDGYYCYYG
                     DERNVVASVNYKF"
     CDS             complement(452165..453121)
                     /codon_start=1
                     /locus_tag="PP4_03820"
                     /product="putative transmembrane sensor"
                     /protein_id="BAN52235.1"
                     /transl_table=11
                     /translation="MSNAPVSSQVLEAAIAWKLSLGDASGTPDERNEFMRWHAASEEH
                     ARAWRQLGAMDQRVSAAAGPARQALLQSRTSLRRRIGNVGGGLAGMFLLGSLLAWVGA
                     PSLAPSYWLADQRTATGELRTLRLEDGTLLSLNTHTAVDIDYAGEQRVIVLHQGEISV
                     ETGHQDPRPLLVRTDDGRLRPLGTRFLVRREADGTRLEVLQASVAAMPHNSGDEQVLR
                     EGQQVLMNANGLGQVGAVPVGADAWTRGMLVVDNVRLGDLLAALGKYRSGHLGVDEQV
                     ADLRVTGSFPLTNTNLALESLVPPLPVKIERHTQWWVNVVPK"
     CDS             complement(453118..453636)
                     /codon_start=1
                     /locus_tag="PP4_03830"
                     /product="putative RNA polymerase ECF-type sigma factor"
                     /protein_id="BAN52236.1"
                     /transl_table=11
                     /translation="MSSAQSPHADLVGALYRDHRGWLLAWLQRSMACRQRAEDLSQDT
                     FVRLLGREQLDTPREPRAFLAAVAKGLMFDHFRRAALEQAYLAELALIPEAEQPSPEV
                     QLLILEDLKAIDRLLGKLSSKARAAFLHNRLDGMGHGEIAERLGVSVSRVRQYIAQGM
                     RQCYVALYGEPT"
     CDS             complement(453906..454616)
                     /codon_start=1
                     /locus_tag="PP4_03840"
                     /product="putative exonuclease"
                     /protein_id="BAN52237.1"
                     /transl_table=11
                     /translation="MSLFTWLRPSAPELDPATRQRLSRLPKPTPLGVCTLREQRWVVL
                     DLETSGLNPNRDQVLSIGAVAIEDGAIDFAQQFERTLHRPLQKTNASVLIHGLGPGAL
                     AAGCDPAEALLDLLDFIGNSPVLAFHAPFDQRMLARALKESLGHRLQSLFLDVAELAP
                     MLNPDTVLREAGLDDWVARFGLQVEERHHASADAQVTAELALILFSQARRQQLDSPLQ
                     LEQRLRGWRRRKAQSHGL"
     CDS             complement(454613..456550)
                     /codon_start=1
                     /locus_tag="PP4_03850"
                     /product="hypothetical protein"
                     /protein_id="BAN52238.1"
                     /transl_table=11
                     /translation="MSKKDAYSQAGRTAVLQNIQGTLQFLQRFPPFNQMEHSHLAYLV
                     EQCQLRFYACGESIVKPADGPVEHFYIVKQGRVVGERQHLVKPGVETTFEITSGECFP
                     LAALLGERATRTEHLAGEDTFCLQLNKAAFIRVFSMSEVFRDFALRGVSSLLDQVNQQ
                     VRQRAVETLGTQYSLNTPLGELAMRHPVVCTAQTPLREAVRLMHEQQVGSIVVVDAQR
                     YPTGIFTLRDLRQVVASADADLGAPIERHMTVKPFYLSPQASAFDAAMAMTERHIAHV
                     CLVENRRLCGVVSERDLFSLQRVDLVHLARTIRHAPRLDTLVSLRGEISQLVERMLAH
                     GASSTQITQIITLLNDHTVCRVIELALAERGDPGMPFSWLCFGSEGRREQTLHTDQDN
                     GILFEAADSAEADAIRARLLPLAQYINQCLAQCGFTLCKGNVMAGNPDLCLSRSEWAR
                     RFAGFVREASPENLLGSSIYFDLRVVWGDEQGCEQLRQRLLDQVADNRIFQRMLAENA
                     LRQRPPVGRLREFVLTRQGNDKAATLDLKVQGLTPFVDGARLLALANGVGACNTLERL
                     RQLVAKGVIEPLDGAAYEEAYHFIQQTRMQQHQRQARDNLPYSNRLDPDSLNHLDRRI
                     LREALRQAQRLQSSLALRYQL"
     CDS             456758..457207
                     /codon_start=1
                     /locus_tag="PP4_03860"
                     /product="putative two-component response regulator"
                     /protein_id="BAN52239.1"
                     /transl_table=11
                     /translation="MSMPEHTDILSDAEREALAVVSAPVAPRPLVLIVDDNPVNSEAL
                     GYFLKSRGIDSMIADGAQEALWKLHWEPRIALMITDLRMEPWDGIDLIRQVRESKWAA
                     LSIIVVSGDTDVKEAVDVMHLGVVDFLLKPVDLGKLLELVKKELKIE"
     CDS             complement(457346..459523)
                     /codon_start=1
                     /EC_number="2.3.3.9"
                     /gene="glcB"
                     /locus_tag="PP4_03870"
                     /product="malate synthase G"
                     /protein_id="BAN52240.1"
                     /transl_table=11
                     /translation="MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIIN
                     DLAPKNKALLAKRDELQAKIDAYHQARKGQAHDAVAYRAFLQEIGYLLPQADDFQATT
                     QNVDEEIAHMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGY
                     NKVRGDKVIAFARAFLDEAAPLAAGSHVDSTGYRIEGGKLVVALKGGSNSGLRDDAQL
                     IGFHGDAAAPTAVLLKHNGLHFEIQVDANTPVGSTDAASVKDILMESALTTIMDCEDS
                     VAAVDADDKVIVYRNWLGLMKGDLAETVSKGGKTFTRTMNPDREYAAPNGGSVTLHGR
                     SLLFVRNVGHLMTNPAILDAQGNEIPEGIQDGLFTNLIALHNLNGNTSRKNTRTGSVY
                     IVKPKMHGPEEVAFAAEIFSQVEGLLGMPRNTVKVGIMDEERRTTVNLKSCIKAAAER
                     VAFINTGFLDRTGDEIHTSMEAGAVVRKGAMKNEKWIGAYENNNVDVGLATGLQGRAQ
                     IGKGMWAMPDLMAAMLEQKIAHPLAGANTAWVPSPTAATLHALHYHKVDVQARQRELA
                     SRTPASVDDILAIPLAADTNWSDEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPDIN
                     NVGLMEDRATLRISAQLLANWLRHGVVSQDQVLESLKRMAVVVDQQNAGDALYRPMAP
                     NFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFKARNGL"
     CDS             459973..460491
                     /codon_start=1
                     /locus_tag="PP4_03880"
                     /product="hypothetical protein"
                     /protein_id="BAN52241.1"
                     /transl_table=11
                     /translation="MDHLVLTVIAPDKAGQVERIAQCIADHSGNWLESRMSRMAGQFA
                     GILRVAVPAENYAELVASLQGLARYDIRVLIAESGIEPSCTWKPIAMELVGNDRPGIV
                     RDITRLLADLGVNLERFTTEVRPAPMSSEPLFHADALLALPLTLPLEELQQRLERLAD
                     DLIVELKLRAED"
     CDS             complement(460740..461627)
                     /codon_start=1
                     /gene="rarD"
                     /locus_tag="PP4_03890"
                     /product="RarD protein"
                     /protein_id="BAN52242.1"
                     /transl_table=11
                     /translation="MHAANPRRGYILGLSAYIIWGLFPIYFKAIQNVPAVEIIVHRVL
                     WSALFGSLLLLVWKHPGWWRELRDNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEA
                     SLGYYINPLINVVLGMLILGERLRRLQWLAVGMAAVGVAQQVWQVGSLPWVSLVLALS
                     FGFYGLIRKQAPVAALPGLVVETWMLVPLALGWLLLHPAAMSAQGAFYTSSEALWLMA
                     AGPVTLIPLVCFNAAARHLPYTTLGFLQYLAPTLVLLQAVLLFDEHLSSSTLVAFMFI
                     WAGLAIYSVDAWMNLRKRS"
     CDS             complement(461692..462666)
                     /codon_start=1
                     /locus_tag="PP4_03900"
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="BAN52243.1"
                     /transl_table=11
                     /translation="MSHPFDTLTPDLVLDTVESIGFLSDARVLALNSYENRVYQVGIE
                     DAQPLIAKFYRPGRWSDAAILEEHSFTAELADCEVPVVAPMQHDGRTLFEHQGFRFTL
                     FPRRGGHAPEPGNLDQLYRLGQLLGRLHAVGATKPFEHREALAVDNFGHASLNTLLDG
                     GFVPRELLPAFESVARDLLKRVEDIYARTPHQLIRLHGDLHPGNLMHRDEVYHVVDLD
                     DCRMGPAVQDLWMMLAGSREERLGQLAELIDGYNEFHDFDPRELALIEPLRALRQLHY
                     SAWLARRWSDPAFPPSFPWFGQPRYWGDQILALREQMAALDEAPLKLF"
     CDS             complement(462819..463646)
                     /codon_start=1
                     /locus_tag="PP4_03910"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAN52244.1"
                     /transl_table=11
                     /translation="MTLRSPPQSAFRTITYNDSMPMPLPTLLTQHIARRPQRIALLQH
                     IAEQGSITRAAKAAGVSYKAAWDAIDELNNLASQPLVERSTGGRGGGGARLSPEGERV
                     LRLYQRLQALQAEILEAAEESSDLDLLGRLMLRTSARNQLQGQVSGLRREGRFDRVSL
                     ALGGGLEIDALITHDSTARLELTLGTTVVALLKAGWVRLLAEGEAADAGSNCLSATVE
                     EVLAEDEGPSEVRLALGNGQTLCAIADADWLAGQQVAADSAVRVQFHPSYVLIGVPA"
     CDS             complement(463643..464275)
                     /codon_start=1
                     /locus_tag="PP4_03920"
                     /product="competence protein ComF homolog"
                     /protein_id="BAN52245.1"
                     /transl_table=11
                     /translation="MCIACEEELPWLGDHCLQCALPLPMAGLICAQCSRRLPAFEQVI
                     ALWHFGFPVDTLISRFKHNRQWPLGRLMAELLGYGLLHRFAEGLPRPDLLLPVPLAKR
                     RLRERGFNQAGMLGRWLSTQLGLPCDERLLLRTRETPAQQKLDARARRRNLRQAFALS
                     GELTGKHVAIVDDVFTTGATAQAIAEVLRKAGARRVDVYCLARTPKPGYA"
     CDS             464464..465522
                     /codon_start=1
                     /EC_number="2.8.1.6"
                     /gene="bioB"
                     /locus_tag="PP4_03930"
                     /product="biotin synthase"
                     /protein_id="BAN52246.1"
                     /transl_table=11
                     /translation="MSASTTATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPN
                     RVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRF
                     CMGAAWKHPSAKDMPYVLEMVKGVKAMGLETCMTLGKLDQEQTAALAQAGLDYYNHNL
                     DTSPEFYGSIITTRTYSERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANL
                     PEHPESVPINMLVKVAGTPLAEEEDVDPFDFIRMLAVARLLMPKSHVRLSAGREQMNE
                     QMQALAFMAGANSIFYGEKLLTTANPQADKDMQLFARLGIKPEAREEHADEVHQAAIE
                     QALVEQRSSEMFYNAASA"
     CDS             465524..466696
                     /codon_start=1
                     /EC_number="2.3.1.47"
                     /gene="bioF"
                     /locus_tag="PP4_03940"
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="BAN52247.1"
                     /transl_table=11
                     /translation="MAFDLAARLAERRAADLYRQRPLLESPQGPEVVVDGQRLLAFCS
                     NDYLGLANHPEVIAAWQAGAERWGVGGGASHLVVGHSTPHHQVEEALAELTGRPRALL
                     FSTGYMANLGAITALVGQGDTVLQDRLNHASLLDGGLLSGARFNRYLHNDAASLASRL
                     DKAVGNTLVVTDGVFSMDGDLADLPALADVARARGAWLMVDDAHGLGTLGAQGGGIVE
                     HFGLSVDDVPVLIGTLGKACGTAGAFVAGSEELIEALVQFARPYIYTTSQPPALACAT
                     LKSLELLRHETWRREHLAALIRQFREGAQQIGLALMDSPTPIQPIMIGDSAQALRLSR
                     MLRERGLLVTAIRPPTVPAGGARLRVTLSAAHSEAQVQLLLNALAECYPQLENADA"
     CDS             466689..467420
                     /codon_start=1
                     /gene="bioH"
                     /locus_tag="PP4_03950"
                     /product="putative biotin biosynthesis protein BioH"
                     /protein_id="BAN52248.1"
                     /transl_table=11
                     /translation="MRNRLVLLPGWGLGTASLEPLAASLRAQDARLQVELMPLPELDH
                     SDVQAWVDHLDRKVPSDVWLGGWSLGGMLASALAHQRGDHCCGLLTLASNPSFVARPD
                     WPHGMPEDTFGTFLDGCRSHTQVTLKRFRTLCSDGAQQPRTLLRQLGVGVPETDPLYL
                     ATGLEVLAKLDTREALQAYAGPQLHLFAGSDALVPAEAAKALSELLPDVEVGLVEDSS
                     HAFLLEYPQELAAGIKSFLHESGDD"
     CDS             467413..468231
                     /codon_start=1
                     /gene="bioC"
                     /locus_tag="PP4_03960"
                     /product="malonyl-CoA O-methyltransferase"
                     /protein_id="BAN52249.1"
                     /transl_table=11
                     /translation="MTDLSRPTLPGALPDKRQVAASFSRAAASYDSVAALQRAVGLNL
                     LEQLPAGLQPSHWLDLGSGTGHFSRKLAECFAQASGVAVDIAEGMLRHARDEQGGAHY
                     HVAGDAERLPLRDASVDLVFTSLAVQWCDQFACVLAEALRVLRPGGVLAFSSLCVGTL
                     DELRASWQAVDGLVHVNRFRRFEDYQRLCAGSGFEQLGLQRCPHVLHYPDVRSLTHEL
                     KALGAHNLNPGRPSGLTGRARMHGLLQAYEAFRQPEGLPATYQVVYGVLRKPQA"
     CDS             468242..468922
                     /codon_start=1
                     /EC_number="6.3.3.3"
                     /gene="bioD"
                     /locus_tag="PP4_03970"
                     /product="dethiobiotin synthetase"
                     /protein_id="BAN52250.1"
                     /transl_table=11
                     /translation="MSQAYFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGC
                     TMTPKGLRNSDAQALIDESTIKLPYDQVNPFAFEPAIAPHVAAREAGVTLAVAELLAA
                     MRNVLQQNADFTLVEGAGGWRVPLSGLENLSDLAVALQLPVILVVGVRLGCISHALLS
                     AEAIERDGLQLAGWVANIIEPRTSRLEENLASLAERLPAPCLGRVPKLKQASADMVAE
                     HLQLDLLD"
     CDS             469135..469431
                     /codon_start=1
                     /locus_tag="PP4_03980"
                     /product="hypothetical protein"
                     /protein_id="BAN52251.1"
                     /transl_table=11
                     /translation="MEITGSSAYYAGLSAIQTGQNRVDQAAGQIANTTAERTATSQSS
                     DFQAERLRAVDRSQQMDLATSTVQMVVGKTEVELGAKVVKASDEMLGRIIDTYA"
     CDS             469719..471524
                     /codon_start=1
                     /locus_tag="PP4_03990"
                     /product="phenylacyl-CoA dehydrogenase"
                     /protein_id="BAN52252.1"
                     /transl_table=11
                     /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGCQDATPDMVDAILE
                     EGAKFCEQVLAPLNRVGDQEGCTWSESGVKTPTGFKAAYEQFVEGGWPSLAHDVEHGG
                     QGLPESLGLALSEMVGGSNWSWGMYPGLSHGAMNTISAHGTAEQQHTYLTKLVSGEWT
                     GTMCLTEPHCGTDLGMLRTKAEAQADGSYKVSGTKIFISAGEHDMADNIVHIVLARLP
                     DAPAGTKGISLFIVPKFLPNAEGGVGERNGVSCGSIEHKMGIHGNATCVMNFDAATGY
                     LIGPANKGLNCMFTFMNTARLGTALQGLAHAEVAFQGGLKYARERLQMRSLTGPKAPD
                     KAADPIIVHPDVRRMLLTMKAFAEGNRAMVYFTAKQVDIVKYSQDEEERKKADALLAF
                     LTPIAKAFMTEVGFEAANHGVQIYGGHGFIAEWGMEQNVRDSRISMLYEGTTGIQALD
                     LLGRKVLMTQGEALKGFTKIVHKFCQAQEGNEAVKEFVEPLAAINKEWGELTMKVGMA
                     AMKDREEVGAASVDYLMYSGYACLAYFWADIARLAAEKLAAGTSEEAFYTAKLQTARF
                     YFQRILPRTRTHVATMLSGANNLMAMDEEHFGLSY"
     CDS             471728..473011
                     /codon_start=1
                     /locus_tag="PP4_04000"
                     /product="putative GGDEF domain protein"
                     /protein_id="BAN52253.1"
                     /transl_table=11
                     /translation="MFRLNAVRASHFLPSLILLLAGLAAAYVRDLSVFFTSLFNVLPT
                     LVLLLGGAYCAVYRRQRELFMMLTVYIAYYLLDTQTDFYRDHGRVREDAAVIFHLVCL
                     LLPALFGLYGAWQERTHLLQDMVARGAVLFAVGSVAVALEQSYPEALLTWLAEIRWPT
                     LHGQWMSLIQMVYPLFLGVFILLVVQYLRAPRPLHAALITGLLGIFWMLPQTFILPFT
                     LNIMCSQVMLMIAAAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVIAMTDVDH
                     FKKFNDTHGHDVGDQVLRLVASRLSKVTGGGRAYRYGGEEFALVFAGKTAEECVPHVE
                     AVREVIANYVMHLRDQSSRPQDDTSGRQRRAGNSGGTVSVTISIGVAERQVDHRNPEA
                     VLKSADQALYSAKGAGRNCVMVHGQQSQRGAVRTA"
     CDS             473136..474914
                     /codon_start=1
                     /gene="acdA"
                     /locus_tag="PP4_04010"
                     /product="acyl-CoA dehydrogenase AcdA"
                     /protein_id="BAN52254.1"
                     /transl_table=11
                     /translation="MADYKAPLRDMRFVLNEVFNVAEQWAQLPGLAEVVDADTAMAVL
                     EEAGKVTAKTIAPLSRGADEEGCHWDNGAVSTPAGFIEAYNTYAEGGWVGVGGDPVFG
                     GMGMPKAISAQVEEMVNASSLAFGLYPMLTAGACLSINAHASEALKAKYLPNMYAGVW
                     AGSMCLTEPHAGTDLGIIRTKAEPQADGSYKVSGTKIFITGGEHDLTENIIHLVLAKL
                     PDAPAGPKGISLFLVPKFLVNEDGSLGTRNPATCGSIEHKMGIQASATCVMNFDEAVG
                     YIVGEPNKGLAAMFTMMNYERLGVGIQGLASAERSYQNAVEYARDRLQSRAPTGPHAK
                     DKAADPIIVHPDVRRMLLTMKAQIEGGRAFSTYVAMQLDSAKYSEDAAVRKRSEELVA
                     LLTPVAKAFLTDLGLESTVHGQQVFGGHGYIREWGQEQLVRDVRITQIYEGTNGIQAL
                     DLMGRKVVASGGAYYRLFSDEIRQFIASAGSELDEFAKPLAASLDQLDGLTEWVLEQA
                     KGNPNEIGAASVEYLHAFGYVAYAYMWALMARAAKAGEGDEAFYSGKLGTARFYFARL
                     LPRVDSLVASVKAGSESLYLLDAEQF"
     CDS             complement(475286..476209)
                     /codon_start=1
                     /locus_tag="PP4_04020"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAN52255.1"
                     /transl_table=11
                     /translation="MDFRQLRYFVAVYEEGHVGRAAERLSLSQPALSQQIRQLEHSLD
                     LSLFERSNKRLLPTLAAHTLYNHALPLLDGLQRAHEAMRNFKGQSLRTLAIGVLQTVR
                     PSLVPQLLERLRKAQPHLVVQIYELSGLEIERRLLNGSLDIGISYLPPRQPGLHGLLL
                     YEDELQLVIPDTHPLKDFKKVSIRQAAELPMLMLGEEFQIRQIWQAQLASQGRRPHVQ
                     AEMNNMAGILDSLAHTALATILPGRAKEAAEDDQGLLWKPLSEPRVPLKVGLVFRDVQ
                     RQQASVELLRTLLEEETDARLLGASPLDVLA"
     CDS             476420..477700
                     /codon_start=1
                     /locus_tag="PP4_04030"
                     /product="putative acetylornithine aminotransferase"
                     /protein_id="BAN52256.1"
                     /transl_table=11
                     /translation="MNLFNLRRSAPAAVAEPKRAPVIVPHADELSRDRLMPSAERAAQ
                     VFVRGQGSWLWDNEGRAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHSR
                     GLLGLVNRLCQSTGSEQAYLLNSGAEACEGAIKLARKWGQLHRNGAYHIITATQACHG
                     RSLGALSASDPLPCNRCEPGLPGFSKVPFNDLAALHAAVDSRTVAIMLEPIQGEAGVI
                     PATQEYLKGVETLCRELGILLILDEVQTGIGRCGALLAEELYGVRADIITLGKGLGGG
                     VPLAALLARGTACCAEPGELEGSHHGNALMCAAGLAVLDTVLEPGFFAQVQDNGRHLR
                     EGLSRLAGRYGQGEVRGQGLLWALQLKENLAKELVAAALHEGLLLNAPQADVVRLSPA
                     LTVSKGNIDEMLLRLARAFARLHAQQQAHREMPA"
     CDS             477853..478011
                     /codon_start=1
                     /locus_tag="PP4_04040"
                     /product="hypothetical protein"
                     /protein_id="BAN52257.1"
                     /transl_table=11
                     /translation="MDFIRIIIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVH
                     AVYIIAKR"
     CDS             complement(478045..479868)
                     /codon_start=1
                     /gene="pqqH"
                     /locus_tag="PP4_04050"
                     /product="peptidase S9 family protein PqqH"
                     /protein_id="BAN52258.1"
                     /transl_table=11
                     /translation="MIETPVSSPAAEFSAAQAVAAGTDFTELKVSADGLFWIEFRPAD
                     GACRIWHWLYHQARCLTPDGFSVRSRVYEYGGGSFCLGGDGLVFVNEKDQQVYTQPLD
                     DVPPRALTQDASCRYGDVQWHHGQVLAVEERHAEQVEHRLVALAESSREVLAEGADFY
                     ASPTVSDDGMRLAWIEWDRPAQPWTLTRLMCRVRDSSGHWGPAQCVASDGESLQQPRF
                     DAEGRLYCLSDRNGFWQPWGEVDGHWQALPAGPADHAAAPWQLGTCTWLALGPQSYLA
                     SWFKDGFGQLGLRHEDGRMARYASAYTRFRSLAMDSENLYAIAASPISPPAVIAIDRR
                     NHEVRVLAGGVEMLPAEQISLPQPIRYGSDGEQAHGFFYPPAQAQGAAPLVVFIHGGP
                     TSACYPVLDPRIQYWTQRGFAVADLNYRGSTGYGREYRQALHLRWGESDVADACAAVE
                     YLAAQGLVDKHKAFIRGGSAGGYTTLCALAFHDVFRAGASLYGVSDPVALGRATHKFE
                     GDYLDWLIGDPLQDAERYRQRTPLLHAGQIKVPVIFFQGELDAVVVPEQTRAMLAALQ
                     ANGIEAEGHFYAGERHGFRKADNLAHALEEEWKFYCRVLET"
     CDS             complement(479834..480994)
                     /codon_start=1
                     /gene="pqqE"
                     /locus_tag="PP4_04060"
                     /product="coenzyme PQQ synthesis protein E"
                     /protein_id="BAN52259.1"
                     /transl_table=11
                     /translation="MPNTGSSSPDLPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLDF
                     AAQGQELSTAQWFKVMAEAREMGAAQIGFSGGEPLVRQDLAELIGEARRLGYYTNLIT
                     SGIGLTEARIADFKKAGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGY
                     PMVLNFVTHRHNIDKTDRIIELCIALEADFVELATCQFYGWAHLNRLGLLPTREQLER
                     AERITNEYREKLKAEGNPCKLIFVTPDYYEERPKACMNGWGNLFLTITPDGTALPCHG
                     ARQLPVKFPNVRDHDLHHIWYESFGFNRFRGYEWMREPCRSCDEKEKDFGGCRCQAFM
                     LTGDASNADPVCAKSAEHGIILKAREEAETAQLAIEQMTFRNDRNSRVIARG"
     CDS             complement(480966..481241)
                     /codon_start=1
                     /gene="pqqD"
                     /locus_tag="PP4_04070"
                     /product="coenzyme PQQ synthesis protein D"
                     /protein_id="BAN52260.1"
                     /transl_table=11
                     /translation="MSLDRNQVPSWRPGYRFQYEPAQKGHVLLYPEGMIKLNESASLI
                     GGLIDGQRDVAAIISELEQQFPDVPEVADDIEQFMEVARAEHWIVLA"
     CDS             complement(481238..481993)
                     /codon_start=1
                     /EC_number="1.3.3.11"
                     /gene="pqqC"
                     /locus_tag="PP4_04080"
                     /product="coenzyme PQQ synthesis protein C"
                     /protein_id="BAN52261.1"
                     /transl_table=11
                     /translation="MSDALPMSPAEFEQALRAKGAYYHIHHPYHVAMYQGRATREQIQ
                     GWVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHDGAPGEDGGIEAWLRLGQ
                     AVGLDPDQLRSQDLVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDS
                     WPQHYPWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDIL
                     WSMLDAMSMAYELNRPPYHSVTQDRVWHKGITL"
     CDS             complement(482149..483060)
                     /codon_start=1
                     /gene="pqqB"
                     /locus_tag="PP4_04090"
                     /product="coenzyme PQQ synthesis protein B"
                     /protein_id="BAN52262.1"
                     /transl_table=11
                     /translation="MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLRATARTQSSIAL
                     SDDGVHWVLCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLRE
                     GCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFP
                     LRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDENLLAMMHGADCLL
                     VDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPI
                     LDEDSPERAEVLRRGVEVAFDGMSIEL"
     CDS             complement(483383..485671)
                     /codon_start=1
                     /gene="pqqF"
                     /locus_tag="PP4_04100"
                     /product="coenzyme PQQ synthesis protein F"
                     /protein_id="BAN52263.1"
                     /transl_table=11
                     /translation="MPDTTRHLTLANGLQLTLRHAPRLKRSAAALRVHAGSHDAPARW
                     PGLAHFLEHLFFLGTAQFPLNDGLMRYVQALGGQVNASTRERATDFFFEVPTNALAGG
                     LERLCQMLAEPDLGIERQRREREVIHAEFIAWSRNPQAQQQFALLQSVSPGHPLGAFH
                     AGNRHTLALQNPAFQQALEGFHQRYYQGGQMTLSLCGPQALDELEQLGRQHASLFATG
                     TQALQTLPPLLSPTNTRLVFTHEKLPAGAEQALELLISCLGDNRPGTWLHALRQRGWL
                     QSFKAERVYSFAGQLLWHIDLQLSASAKPDEADALLQGWFSFIRQADLEQMNHAFGLL
                     QLSRERSAGALELARRDSTGQPFAKLDAQGQQALGALLQGLPGQAHGQWQLPPVDPLL
                     MADLPNAPAQPLPAALKTSDLLPGTRQYAALYLRWHLPSPLRQRLQAVLEQALAPLQE
                     RCERASVQLLFSAVGEYWQLRCAGQPAAVLRAVEQALALMLKPATSCWQPSTATPPPL
                     IPIRALLKQLPDAVVGAHPASAPASMPTQSQLDSLWQHARWHGLATGFDAAALSALGT
                     ALQHCPGQGSLPAPPPTWASHRWQHAEVPGSEHALLLFCPLPAASEASGRVLAQLLQG
                     PVYQRLRVELQLGYAVFSTFRQVEGVGGLLFGVQSPHTRQAQVLDHLLTLLRQGITLD
                     PGARVALAEQFDEPAMANADVAEWAWQTHLATQPGTLDELRRAILKTRQTDMDQLLGT
                     LLDKDCPWLCLANAAAPTLEWQ"
     CDS             complement(485815..486609)
                     /codon_start=1
                     /locus_tag="PP4_04110"
                     /product="putative hydrolase"
                     /protein_id="BAN52264.1"
                     /transl_table=11
                     /translation="MRIALFQGAPKPLDVPGNLQRLRHQAQLAADRGAQLLVCPEMFL
                     TGYNIGLPQVERLAEADDGPAAMDVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDA
                     HGRSLCNYRKTHLFGELDRAMFSAGADHFPVVELDGWKVGLLICYDIEFPENARRLAL
                     GGAELILVPTANMAPYDFVCQVTVRARAQENQCYLVYANYCGSEDDIQYCGQSSIIGP
                     DGSLLAMGGRDECLLLAELEHEQVVQGREAFPYLTDLRQELHLRKS"
     CDS             complement(486624..488306)
                     /codon_start=1
                     /locus_tag="PP4_04120"
                     /product="putative tryptophan 2-monooxygenase"
                     /protein_id="BAN52265.1"
                     /transl_table=11
                     /translation="MNKKNRHPADGKQPITIFGPDFPFAFDDWLEHPAGLGSIPADRQ
                     GEEVAIVGAGIAGLVAAYELMKLGLKPVVYEASKLGGRLRSQAFNGTDGIIAELGGMR
                     FPVSSTAFYHYVDKLGLETKPFPNPLTPASGSTVIDLEGQTYYAEKTTDLPKLFHEVA
                     DAWADALESGAQFADIQQAIRDRDVPRLKELWNKLVPLWDDRTFYDFVATSRSFAKLS
                     FQHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDDHQHLVVGGVEQVPQGIWRHV
                     PERCAHWPEGTSLSGLHGGAPRTGVKRIARAADGRLAVTDNWGDTRHYGAVLATCQTW
                     LLTTQIDCEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKDPQTGRDLMSMTLT
                     DRLTRGTYLFDNGDDKPGVICLSYAWMSDALKMLPHPVEKRVQLALDALKKIYPKTDI
                     AGHIIGDPITISWEADPHFLGAFKGALPGHYRYNQRMYAHFMQQDMPAEQRGMFIAGD
                     DVSWTPAWVEGAVQTSLNAVWGIMNHFGGQTHPDNPGPGDVFDEIGPIALAD"
     CDS             complement(488469..488783)
                     /codon_start=1
                     /locus_tag="PP4_04130"
                     /product="putative transcriptional regulator"
                     /protein_id="BAN52266.1"
                     /transl_table=11
                     /translation="MPRNLFTELTEGFDALAEERQGKKTLRSHKASLTELAPLVPNEL
                     LELRQRLNMSRALFANHLRTNARTLENWEQGRSRPNAQAVALIRLVQKYPETVDHLAS
                     LA"
     CDS             489540..489701
                     /codon_start=1
                     /locus_tag="PP4_04140"
                     /product="hypothetical protein"
                     /protein_id="BAN52267.1"
                     /transl_table=11
                     /translation="MRTRFLARGLNQVATDYAQHHAPERSRDIVWSMQHSAESLSAIL
                     DGLLDGQEA"
     CDS             complement(489714..490175)
                     /codon_start=1
                     /locus_tag="PP4_04150"
                     /product="putative AsnC family transcriptional regulator"
                     /protein_id="BAN52268.1"
                     /transl_table=11
                     /translation="MSDSRSITLDEIDRQLIALLQINARESVATLARQLGIARTTVNS
                     RLERLEKNKVISGYGVRLGQSVMGGGLQAYVGIKVQPRSGKEVVRRLSAMGQVQQLCA
                     VSGEFDYVAWLRTDSPEQLDQLLDQIGSVDGVEKTTTSIILSSKVDRGQPV"
     CDS             490302..490889
                     /codon_start=1
                     /locus_tag="PP4_04160"
                     /product="putative acetyltransferase"
                     /protein_id="BAN52269.1"
                     /transl_table=11
                     /translation="MMKRQSNGKLSVNLDHLLECWRLEVSNKKRPGRRTSLLFNVLRR
                     ARKDNKLRFLFAFRLAQYLDARGGLLRRHARRMQQRLNLKYAVDIDIGAQIAPGLRIA
                     HLPGVVITRHVSIGRNFFVRQNCSIGIKTLGLAEYALRIGDNVSMGANSCIVADCIEI
                     GDDVVIGAMSLVTRDIPDGMTFYNPRQVEMRPRET"
     CDS             490974..491216
                     /codon_start=1
                     /locus_tag="PP4_04170"
                     /product="hypothetical protein"
                     /protein_id="BAN52270.1"
                     /transl_table=11
                     /translation="MPTIHRLSNCVICLYANDHLPPHFHLRFSDGRQALIAINDLTPV
                     AGFGGSRVSQREMSEALEWASRNRARLLAIWEELNP"
     CDS             491213..491746
                     /codon_start=1
                     /locus_tag="PP4_04180"
                     /product="hypothetical protein"
                     /protein_id="BAN52271.1"
                     /transl_table=11
                     /translation="MTNKQFQLTEVAAVAPASLLLTFADGQQFTVALDEIIGKHTTLA
                     PLADPEVFATAAIGEWNDTVIWANNDNLELAADNLRARAVEQAGECSHELIWNWMAKH
                     ELTLDRAAQELGLSRRMLAYYRSGEKPVPKTVALAMKGWEALRLAEARANSASRHTSG
                     KYTDSLVGAGHVRKKRA"
     tRNA            complement(491805..491878)
                     /locus_tag="PP4_t0060"
                     /product="tRNA-Met"
     CDS             complement(491895..495638)
                     /codon_start=1
                     /locus_tag="PP4_04190"
                     /product="putative sensory box protein"
                     /protein_id="BAN52272.1"
                     /transl_table=11
                     /translation="MPLMPAILLLLLILWNTTAGALTLTDEEKAWLAAHQQLSLGVDA
                     SWPPFEFRDQEGRYQGLAADYIAAIQQRLGVTLKPVEPSSWTEVLAQARENRIDLLPG
                     IMSTPERQGYLAFTRPYLDFPIVILAHKGGAQPRKLDDLYGLKIAVVENYAPHELLRT
                     HHPDLNLVALPNVSSTLQALATDQVDAVVGDLASSIWSLRQLKLDGLYVSGETPYRYQ
                     LAMAAPRDNKVLVGILDKVMADMSSGEVSQIQQRWVGNVVDQRMFWSDLLVYGLPTVL
                     LLMAVLAVVIRINRRLSSEISRRIALEQELRSSEYHYRGLVESLSAIAWEADANDFTY
                     SYVSPHAEDLLGYPLSDWLRPGFWRSILHPEDALWAQAYCDSETAAGRDHSLDYRVIR
                     ADGQPLWVRNIVSMIEHGHQPVMRGLMIDISETKRTEDALRLSEQKFASVFQQCPDIL
                     LIARHSDGCLLEVNEAFEEQIGLTAGQVLGRSATDLHLWGVEGSGPPLLERLHQGGIR
                     NLEMSFRRSNGQLFTGLTSAETFELDGTPALVVAVRDISQLKETQGQLQTSEEKFAKA
                     FHASPDGLLLSRQSDGLLLEVNEGFCRLTGYDLNPTIDQTSLDLGIWVDLNERKRMVD
                     QLNRDGFVRDFTCHIRRSDGQIRLCELSARPLPIGGVDCMLTIARDITERHLMQEKLQ
                     LAATVFENTAEGVLITDIDQRISAVNRAFSEITGYSEIEALGQTPRLLASGQHDSAFY
                     AAMWHQLTAEGHWQGEIYNKRKNGELYPGWLTISAVRNSEREITHFVAVFADISSLKH
                     AQAKLDYQAHHDPLTGLPNRALFENRLQAVLTCAQVSNRQGAVLFLDLDRFKHINDSL
                     GHPVGDLLLKGIAQRLKEQVRDVDTVARLGGDEFIILLPGLHKPSDASTIANKLLACF
                     VAPFQAGEHEFFTSASIGISLYPQDGTDVATLIRNADAAMYRSKAKGRNRVEAYTRDL
                     TAQASERIALEHELRRAVERNEMSLCFQPKLSLKTQNLVGAEALIRWSHPTFGEVPPE
                     HFIHLAEENGTILQLGDWVLEQACRQMQAWKQHYEPFGPLSINLAGAQLRQPHLARRI
                     EQLLKHYQLKAGDLQLEITENFIMSQAEEALAVLYQLKKLGVQLAIDDFGTGYSSLSY
                     LKRLPLDILKIDKSFIRGLPDDPHDAAIARAIIALGRSMQLTIIAEGVENQAQQRFLA
                     AEGCEQIQGYIVSLPLPPSEFAATFLRIALSDLSDGTGAKPSL"
     CDS             complement(495867..497717)
                     /codon_start=1
                     /gene="rpoD"
                     /locus_tag="PP4_04200"
                     /product="RNA polymerase sigma-70 factor"
                     /protein_id="BAN52273.1"
                     /transl_table=11
                     /translation="MSGKAQQQSRIKELITRGREQGYLTYAEVNDHLPEDISDPEQVE
                     DIIRMINDMGINVFESAPDADALLLAEADTDEAAAEEAAAALAAVETDIGRTTDPVRM
                     YMREMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFPGTVDYILGEYDRVTTEGGRL
                     SDVLSGYIDPDDNIAAPTEEVPIPGAKAAAAKEESDDEEEEAESSDDEEETESGPDPV
                     VAAQRFGAVSDQLQATFKVVKKHGRAHKESIAALQALADLFMPIKLVPKQFEVLVERV
                     RDALNRLRQQERAIMQLCVRDARMPRADFLRMFPSNETDQTWSGDLAKRNTKWAAALG
                     EKDAAIVACQQKLIDLETETGLTVAEIKDINRRMSIGEAKARRAKKEMVEANLRLVIS
                     IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQA
                     RTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEPI
                     SMETPIGDDEDSHLGDFIEDSTMQSPIDVATVESLKEATRDVLSGLTAREAKVLRMRF
                     GIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPTRSEHLRSFLDE"
     CDS             complement(497785..499767)
                     /codon_start=1
                     /gene="dnaG"
                     /locus_tag="PP4_04210"
                     /product="DNA primase"
                     /protein_id="BAN52274.1"
                     /transl_table=11
                     /translation="MAGLIPQSFIDDLINRLDIVDVVSSRVQLKKTGKNYSACCPFHK
                     EKTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDNLDFPQAVEELARAAGMEVPREQG
                     RRDQKPRQPTDSPLYPLLDAASEFYRQALRSHPTRKAAVDYLKGRGLSGEIARDFCLG
                     FAPPGWDNLLKHLGADALQQKVMIDAGLLIENAESGKRYDRFRDRVMFPIRDSRGRII
                     AFGGRVLGDDKPKYLNSPETPVFHKGQELYGLYEARKHNRNLDEIIVVEGYMDVIALA
                     QQGLRNAVATLGTATSEEHLKRLFRVVPSVLFCFDGDQAGRKAAWRALESTLSNLQDG
                     RRARFLFLPEGEDPDSLVRAEGTDAFRARINQHAQPLADYFFEQLGVEADPRSLEGKA
                     HMATLATPLIEKIPGANLRQLMRNRLKEITGLDPQQVEQLAQQAPAASSVPDYDPGYD
                     YDAMASYTPDYGDMPQHDFVPAQQEQAWKPNKGGGKKQWSDKPWDKNRKGGKPWQQRD
                     EAPPRVPAPVEPPTLAALRTLLHHPLLAGKVEDASHFADEEHLYSQLLVSLIEAAQKN
                     PGLSSMQLIARWHGTEQGRLLRALAEKEWLIVADNLEQQFFDTITSLSARQRERSLEQ
                     LLRKSRQSELTSEEKTQLLALLSRNVPAQTPTSSGA"
     CDS             complement(500071..500286)
                     /codon_start=1
                     /gene="rpsU"
                     /locus_tag="PP4_04220"
                     /product="30S ribosomal protein S21"
                     /protein_id="BAN52275.1"
                     /transl_table=11
                     /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAE
                     RKRKAAAAVKRHAKKVQREQRRAVRLY"
     CDS             500491..501516
                     /codon_start=1
                     /gene="gcp"
                     /locus_tag="PP4_04230"
                     /product="putative tRNA threonylcarbamoyladenosine
                     biosynthesis protein Gcp"
                     /protein_id="BAN52276.1"
                     /transl_table=11
                     /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVFGGVVP
                     ELASRDHVKRMLPLIRQVLEEAGCVATEIDAIAYTAGPGLVGALLVGASCAQALAFAW
                     DIPAIGVHHMEGHLLAPMLEENPPEFPFVALLVSGGHTQLVRVDGIGQYELLGESLDD
                     AAGEAFDKTAKLIGLNYPGGPEIARLAEQGVPGRFVFPRPMTDRPGLEFSFSGLKTFA
                     LNTWQQCKNAGDDSEQTRCDLSLAFQQAVVETLTIKCKRALKQTGLKRLVIAGGVSAN
                     KALRASLEDMLGSIKGNVYYARPQFCTDNGAMIAYAGCQRLLAGQHQDLAISVQARWP
                     MEQLPPL"
     CDS             complement(501534..502103)
                     /codon_start=1
                     /EC_number="2.3.1.15"
                     /gene="plsY"
                     /locus_tag="PP4_04240"
                     /product="putative glycerol-3-phosphate acyltransferase
                     PlsY"
                     /protein_id="BAN52277.1"
                     /transl_table=11
                     /translation="MFWLLALLAYLLGSLSFAILLSRLSGSPDPRSSGSGNAGATNML
                     RLAGRKLAILTLLGDLCKGLLPVLLARVAGLDLHAQAWVGVCAVLGHLFPLYFRFRGG
                     KGVATAAGMLMGLYFPAALLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEAL
                     LPITVLTVMIVWRHRNNLRDLFAGRERHF"
     CDS             502187..502534
                     /codon_start=1
                     /gene="folB"
                     /locus_tag="PP4_04250"
                     /product="dihydroneopterin aldolase"
                     /protein_id="BAN52278.1"
                     /transl_table=11
                     /translation="MFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAGDDL
                     NLALDYASVSARIQAFAEQARFELVETFAERLVATLMEEFHIPWVRLKLTKPGAVPAA
                     RGGVGVEIERGCL"
     CDS             502525..503034
                     /codon_start=1
                     /locus_tag="PP4_04260"
                     /product="putative 2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="BAN52279.1"
                     /transl_table=11
                     /translation="MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPVFESQP
                     VGIKSGPFINFVVTGQTALPLIELDRRLKFIEAENGRYAPDRKGLPLDIDVLMYDDLH
                     GTFDGLVLPRAEILKNAFVLWPLSLLAPELVHPGAGKSMARLWQEAQIDQVLAPVAFE
                     WRGLQLTPA"
     CDS             complement(503262..504368)
                     /codon_start=1
                     /EC_number="2.7.7.72"
                     /gene="cca"
                     /locus_tag="PP4_04270"
                     /product="CCA-adding enzyme"
                     /protein_id="BAN52280.1"
                     /transl_table=11
                     /translation="MHIYKVGGAVRDRLLGLPVSDIDWLVVGATVEEMHAKGYRPVGA
                     DFPVFLHPKTGEEYALARTERKSGRGYGGFTFHASPDVTLEEDLIRRDLTINAMAEDE
                     AGTVYDPHHGKDDLERRILRHVSPAFTEDPLRVLRVARFAARYAPLGFRVAEETLELM
                     RQISASGELQALTAERSWKEIERALMEAQPQVFFQVLRDCDALQALLPELVDDAMALA
                     ALEQAAAHEQPLHVRWACLLRGLAPASIKAVNQRLKAPRECQELALLTGECLAQANQA
                     LELPAKALLELLQKFDVYRRPQRFEDFVVVCQMTSLGEGKQGYPQADYLRGAATAARA
                     VDVKPLVQAGLTGQALGEALKAERLKALEAYHLD"
     CDS             complement(504424..505992)
                     /codon_start=1
                     /locus_tag="PP4_04280"
                     /product="hypothetical protein"
                     /protein_id="BAN52281.1"
                     /transl_table=11
                     /translation="MTARAQRRQPISTGSEWTFELIQTYDREIGRLAERYALDTYPNQ
                     IEVITAEQMMDAYASVGMPLGYHHWSYGKQFLSTEKSYSRGQMGLAYEIVINSDPCIA
                     YLMEENTMCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIAQCEER
                     HGIDAVEDLIDSCHALMNYGVDRYKRPYPISAEEERRRQKEREEHLQRQINDLWRTIP
                     KSAERGNERDEGRFPAEPQENILYFIEKNAPLLEPWQREVVRIVRKIAQYFYPQRQTQ
                     VMNEGWATFWHYTLMNDLYDEGLITEGFMMEFLTSHTSVVFQPGFDSPYYSGINPYAL
                     GFAMYTDIRRMCENPTDEDRHWFPDIAGSDWLSTIKFAMSSFKDESFILQYLSPKVMR
                     DLKLFSILDDDQRDDLLVPAIHDEAGYRVIREMLAAQYNLGNREPNVQIWSVDRRGDR
                     SLTLRHQQHNRKPLGDSTDEVLKHLHRLWGFDIHLETVQGEQVMKTHHMPPRGEHGES
                     ADYGRMDLAVIHHL"
     CDS             complement(505989..507263)
                     /codon_start=1
                     /locus_tag="PP4_04290"
                     /product="hypothetical protein"
                     /protein_id="BAN52282.1"
                     /transl_table=11
                     /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSIM
                     DMEHGEQISIPGRDIDEPVLHHGRGGKQTVVHPGNKEFTAGEHIPRPQGGGGGGGGRG
                     KAGNSGDGMDDFVFQITQEEFLEFMFEDLELPNLVKRHLTGTDTFKTVRAGIANEGNP
                     SRINIVRTLRSAHARRIALTGSSRALLREAQKELDRLRVEEPDNFTDIQEVEQEIERL
                     KARINRLPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLY
                     LFLKRNYDRIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPAS
                     DWNIYAAQASDGDNWNDDSPICREILSKQIMPHVQYYTYVEITPREHQALWYEYERIG
                     EAFPDTFAQQQLVSAGDIYPVFRELFQRRLAT"
     CDS             complement(507395..509317)
                     /codon_start=1
                     /gene="prkA"
                     /locus_tag="PP4_04300"
                     /product="serine protein kinase"
                     /protein_id="BAN52283.1"
                     /transl_table=11
                     /translation="MSIFSHFQQRFESTRQEELSLQEYLELCKGDRSAYASAAERLLL
                     AIGEPELIDTSTNSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVSYFRHAAQGLEEK
                     KQILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNATEDGAILEEE
                     YGISRRYLNTIMSPWATKRLQEFGGDISKFKVVKLYPSILNQIAIAKTEPGDENNQDI
                     SALVGKVDIRKLEEFPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQ
                     EGNYNSTEGLGAIPYTGILLAHSNESEWHTFRNNKNNEAFIDRIYIVKVPYCLRVSDE
                     IKIYDKLLINSSLAKAHCAPDTLKMLAQFTVLSRLKEPENSNIYSKMRVYDGENLKDT
                     DPKAKSIQEYRDSAGVDEGMNGLSTRFAFKILSKVFNFDPHEIAANPVHLLYVLEQQI
                     EQEQFPAEVRERYLRYLKEYLAPRYIEFIGKEIQTAYLESYSEYGQNIFDRYVLYADF
                     WIQDQEYRDPETGEILNRIALNEELEKIEKPAGISNPKDFRNEIVNFVLRARANNNGK
                     NPSWLSYEKLRVVIEKKMFSNTEDLLPVISFNAKASKEDQQKHNDFVTRMVERGYTDK
                     QVRLLSEWYLRVRKSQ"
     CDS             complement(509603..509935)
                     /codon_start=1
                     /EC_number="2.8.1.1"
                     /gene="glpE"
                     /locus_tag="PP4_04310"
                     /product="thiosulfate sulfurtransferase GlpE"
                     /protein_id="BAN52284.1"
                     /transl_table=11
                     /translation="MSEFKRIPPEQALELRKQEGAVVVDIRDSQAFAAGHITGARHLD
                     NHSVADFIRNADLDAPTLVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFELWRATYPA
                     ETAQGTAE"
     CDS             complement(509950..510816)
                     /codon_start=1
                     /EC_number="3.6.1.41"
                     /gene="apaH"
                     /locus_tag="PP4_04320"
                     /product="bis(5'-nucleosyl)-tetraphosphatase"
                     /protein_id="BAN52285.1"
                     /transl_table=11
                     /translation="MATYAVGDVQGCLQPLKCLLERVSFNPAVDRLWLVGDLVNRGPE
                     SLETLRFLYSIRQSLVCVLGNHDLHLLAAWHNVERLKKSDTLREIIEAPDADLLFHWL
                     RQQKLLHYDEARGIAMAHAGIPPQWTLGQALDLAAEVEEVLRDDGRLKLYLDGMYGNE
                     PNKWSKRLTGIERLRVITNYFTRMRFCTAEGKLDLKSKEGLGTAPKGYKPWFAHKDRR
                     SRHVKIIFGHWAALEGRVDEPGVVALDTGCVWGGAMTLYNVDSGEYHRCDCADDGTLR
                     QPAQPTTLNDHT"
     CDS             complement(510816..511196)
                     /codon_start=1
                     /gene="apaG"
                     /locus_tag="PP4_04330"
                     /product="ApaG protein"
                     /protein_id="BAN52286.1"
                     /transl_table=11
                     /translation="MSDPRYLIDVSVVTRYLKEQSDPENSRFAFAYTITVHNSGSLKA
                     KLLSRHWLITNGDGEVEEVRGSGVVGQQPNIDPGQSHTYSSGAVITTRVGTMQGSYQM
                     FAEDGKRFDAEIAPFRLAVPGALH"
     CDS             complement(511340..512143)
                     /codon_start=1
                     /EC_number="2.1.1.182"
                     /gene="rsmA"
                     /locus_tag="PP4_04340"
                     /product="16S rRNA dimethyladenosine transferase"
                     /protein_id="BAN52287.1"
                     /transl_table=11
                     /translation="MNEQYQHRARKRFGQNFLHDAGIIDRILRAINAKAGEHLLEIGP
                     GQGALTEGLLGSGAQLDVVELDKDLVPILQHKFGNRSNFRLHQGDALKFDFNQLGVPP
                     RSLKVVGNLPYNISTPLIFHLLSHAGLIRDMHFMLQKEVVERMAAGPGGGDWGRLSIM
                     VQYHCRVEHLFNVGPGAFNPPPKVDSAIVRLVPHEVLPFPAKDHLLLERVVREAFNQR
                     RKTLRNTLKGLLDSAAIEAAGVDGSLRPEQLDLAAFVRLADQLADQQQA"
     CDS             complement(512140..513129)
                     /codon_start=1
                     /EC_number="1.1.1.262"
                     /gene="pdxA"
                     /locus_tag="PP4_04350"
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="BAN52288.1"
                     /transl_table=11
                     /translation="MKPQRFAVTPGEPAGIGPDLCLLLAADAQPHPLIAITSRDLLAE
                     RATQLGLAVSLLPVAPGQWPDRPAPAGSLYVWDTPLAAPVVPGQLDKANAAFVLETLT
                     RAGQGCLDGHFAGMITAPVHKGVINESGIAFSGHTEFLAELTHTAQVVMMLATRGLRV
                     ALVTTHLPLRDIADAITAERVERVTRILHADMRDKFGIANPRILVCGLNPHAGEGGHL
                     GREEIDIIEPTLARLRTEGMDLRGPLPADTLFTPKYLEHCDAVLAMYHDQGLPVLKYK
                     GFGAAVNVTLGLPIIRTSVDHGTALDLAGTGNVDTGSLRVALETAYQMAENRP"
     CDS             complement(513126..514451)
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /gene="surA"
                     /locus_tag="PP4_04360"
                     /product="chaperone protein SurA"
                     /protein_id="BAN52289.1"
                     /transl_table=11
                     /translation="MNVKTKLIDRLRPVLLGAVLLSGAVNAAVQPLDRVVAIVDNDVV
                     MQSQLDQRVREVQQTIAKRGGGVPPTGALEQQVLERLIVENLQLQIGERSGIRITDEE
                     LNQAIGTIAQRNGMSLDQFRAALAHDGLSFDDAREQVKREMIISRVRQRRVAERIQVS
                     EQEVKNFLNSDMGKMQMSEEYRLANILIPTPEAASSDDIQKAARKVGDVYQQLRQGAD
                     FGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILK
                     LEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATEQLAERLYDRIKNGEDFGELAKSF
                     SEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRAT
                     DSTEQAREQQAQSVLRNRKYDEELQTWLRQIRDEAYVEIKLPGADQAAQ"
     CDS             complement(514426..517185)
                     /codon_start=1
                     /gene="lptD"
                     /locus_tag="PP4_04370"
                     /product="lipopolysaccharide assembly protein LptD"
                     /protein_id="BAN52290.1"
                     /transl_table=11
                     /translation="MLVTGGLLALQPLATSYVVAAEQFDCQVSASGGWDCKPKAPVNN
                     LPPRPVHEGAAVSSGTEAASEAETADRPMLVTEAKGRALKSRSEDYSHLDWVPREKLT
                     AAQLAETGPYCGGAYIEPTRPGMADTTPKDESPTYINAKVSKYQQEQQIATLAGDVVM
                     RQGSMQAEADEANLYQTENRGELKGNVRIRDNGSLVVGDEAQIQLDTGEAQVDNAEYV
                     MHKSHIRGSALYAKRGENAIIRLKDGTYTTCEPGSNAWQLKGNNITLNPATGFGTATN
                     VTLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSSSDTGFMLVTPYYFNLAPNYDATL
                     YPRYMTKRGLLMEGEFRYLTPSSEGQLGGAYLNDKNDDRKDQTDYKEQRWMVNWQHKG
                     GLDERLMAEVDYTDISDPFYFQDLESDQIGVESRDLLNQQGALTYRGDSYTARLNVHA
                     YEMATISQITPYDRLPQITFNGALPFHPGGVNIGYETEAVRFDRDLKNDFVLNKDGLP
                     DTSAGLPGRRLDENISGIARANGTRLNVAPSISLPMEASYGYLTPKLKYAYTHYDLDL
                     DSQGKTQALAQSANPAYGSYNSTLNRDVPIFSVDSGLYFDRKTSMFGTDYKQTLEPRL
                     FYLYVPYKDQRDIPLFDSGETLFSYDSLFRDNRFSGTDRIGDENKLSLGVTTRWIEEN
                     GFERQNFSIGQAYYFKDRKVQLPGINYRTRTDSQSDVSPYALVYNYYFNRDWRFNSDF
                     NWDPDSRSTRSGSAMFHYQPEDNPNKVLNLGYRYRNDTISYDSQTGTWKTGGGDYGVP
                     GSENYIKDYYKIQQHDFSVIWPIVPQWNVIARWQHDYNRNRTLEAMGGFEYDNCCWKL
                     RLINRYWIDYDDFSQALPANEKGDHGIFLQIVLKGLGGVVGNKVESFLDQGIQGYRER
                     EDQAY"
     CDS             517355..518374
                     /codon_start=1
                     /locus_tag="PP4_04380"
                     /product="hypothetical protein"
                     /protein_id="BAN52291.1"
                     /transl_table=11
                     /translation="MPEHDVRLQQLTVWLDEQLNDLFLNNAWGEVPAGSLTAASSDAS
                     FRRYFRWQGAGHSFVIMDAPPPQENCRPFVAIDHLLASADVHVPLIHAQDLERGFLLL
                     GDLGHQTYLDVIDADNADGLFADAIEALLAFQRLPMDAPLPSYDDALLRREVELFPEW
                     YVGRELGLALSEAQKATWQRVSQLLIDSALAQPKVLVHRDYMPRNLMQSTPNPGVLDF
                     QDAVYGPVTYDITCLFKDAFLSWPQARVEGWLRNYWQQAKAAGIPVQGDFEAFQRASD
                     LMGVQRHLKVIGIFARICHRDGKPRYLGDVPRFFAYIEEVIGRRPELAELGELIAELQ
                     AGVRA"
     CDS             518371..519042
                     /codon_start=1
                     /locus_tag="PP4_04390"
                     /product="putative nucleotidyltransferase"
                     /protein_id="BAN52292.1"
                     /transl_table=11
                     /translation="MKAMILAAGKGERMRPLTLHTPKPLIAVAGQPLIEYHLHALAAA
                     GVTEVVINHAWLGQQIEDHLGDGSRFGVSIRYSPEGEPLETGGGIFKALSLLGDAPFL
                     LVNGDVWSDYDFTGLQAPLQGLAHLVLVDNPGHHGRGDFRLVGEQVVDGDDAPGTLTF
                     SGLSVLHPALFDGCQPGAFKLAPLLRQAMADGKVTGEHYRGHWVDVGTLERLAEAERL
                     IGERA"
     CDS             519044..519811
                     /codon_start=1
                     /locus_tag="PP4_04400"
                     /product="DnaJ-like protein"
                     /protein_id="BAN52293.1"
                     /transl_table=11
                     /translation="MWWPGTLIGVGAGFAVASIPGALLGGLLGQALDRRLRLQGWEDM
                     RERLGGRAALRDDELLFVMLGRLAKCDGRVAEQHIRQARQEMLRLDLAEAARLRAIAA
                     FNRGKAGKDRLGSHLRRIRQQPHAAEGTLRACWRMVWADGKMGNKERELLLDWGQKLG
                     LSRRQVQAMSLEYEPRKAAGTEGVAMTYAAALRLLAVEADTETDKVKQAYRRLVSRHH
                     PDKLAGTGASEAQVREATERTRELHQAYAMIRKRRGL"
     CDS             complement(519858..520826)
                     /codon_start=1
                     /locus_tag="PP4_04410"
                     /product="hypothetical protein"
                     /protein_id="BAN52294.1"
                     /transl_table=11
                     /translation="MCCLASILPLGALAADAEKPPTTTEAPAAEAPRPPLLERSQEDA
                     QALERLVPKAEQQTLQAGADSFLALWKPANDNDPHGAVIIVPGAGETADWPNAVGPLR
                     QKFPDVGWHSLSVSLPDLLADSPQARVEATPPAEPEKDKGESAPAKDVPADANANVAQ
                     ATAADADTAESTDAEQASEQADPADAERIFARLDAAVAYAQQHNARSIVLIGHGSGAY
                     WAARYLSEKQPPQVQKLVMVAAQTPARVEHDLQSLAPTLKVPTADIYYVTRSTDRNAA
                     EQRLQASKRQKDSQYRQLSLIAMPGNKAAEQEQLFRRVRGWMSPQG"
     CDS             520952..523339
                     /codon_start=1
                     /locus_tag="PP4_04420"
                     /product="putative two-component histidine kinase"
                     /protein_id="BAN52295.1"
                     /transl_table=11
                     /translation="MKRVRRLLVIGCLWLPLIALARPEVVPTVTLEPAQQQWLDAHRS
                     LRVGLVLQAPYAQFDRRLQQLYGANVELVNSLAQALRLDLTWRNFSDQASLEHALQSG
                     EIDFAPGLTQTPASLRLWLFSDPYMRVPQLVVGPRTGAMAVELEKLEAEQRVAVRMPS
                     QLADYLRGNYGNLNLQGVPNEREALQLVVGGQASFAVLDEAQLSRLSRESEFSELAVV
                     GDIGLPQLLRIGSRRDWPLLADVLERGLQALPAKELEQLHQRWLQPKYPRLSESPGFW
                     QNLALLFGMLLLCALATLVWQRRQQRQLERSLLTTRESLVERQVREEALRLSQFAIDQ
                     STVGILWVNWDSHVRYANHAAERMLGYGDGELLERPLSTFEPSLNMDRWLELWKGART
                     GEGGVGQFEAQCRRADNNLLPVELSLSFLRFRDSEYLVVYLADVTERHRALAALRESE
                     ARLKGIAGNVPGLVFRLERDPAEGELEFPYISEGSEALVGYAPVEIQHPQMGLRNLVH
                     PEDRADYHRVQDLALASDQDWSWQGRILTRHGEQRWADIKASTRRLANGQVVWDGVVW
                     DITQGKRAELALAKSQEQLRELSAHLESVREEEKARIAREVHDELGQMLTVLKLEVSM
                     CELAFADLDPGLHERLASMKRLIAQLFQLVRDVATALRPPILDAGIASAIEWQARRFE
                     ARTQIPCLVQVPDNLPALSDAKATGLFRILQEALTNVMRHAQAHSVEIELVREEGQLR
                     MTVSDDGQGFCREQTRPTSFGLVGVRERVLMLGGSMALDSEPGEGTSLSVAIPLE"
     CDS             523350..523979
                     /codon_start=1
                     /locus_tag="PP4_04430"
                     /product="putative two-component response regulator"
                     /protein_id="BAN52296.1"
                     /transl_table=11
                     /translation="MIRVLVAEDHTIVREGIKQLIGLAKDMQVVGEAGNGEQLLDTLR
                     HTPCEVVLLDISMPGVNGLEAIPRIRALHDAPAILMLSMHDEAQMAARALKAGAAGYA
                     TKDSDPALLLTAIRRVASGGRYIDPSLADRMVFEVGLTESRPLHTLLSEREFTVFERL
                     AQGANVNDIAQQLALSSKTISTHKARLMQKLKVNSLAELVKYAMEHKLV"
     CDS             524275..525399
                     /codon_start=1
                     /locus_tag="PP4_04440"
                     /product="putative polyamine ABC transporter ATP-binding
                     protein"
                     /protein_id="BAN52297.1"
                     /transl_table=11
                     /translation="MSEAKSNAATSETLVSFRGVQKSYDGESLIVKDLNLDIRKGEFL
                     TLLGPSGSGKTTSLMMLAGFETPTAGEIQLAGRSINNVPPHKRDIGMVFQNYALFPHM
                     TVAENLAFPLTVRNLSKTDVSERVKRVLNMVQLDTFAKRYPGQLSGGQQQRVALARAL
                     VFEPQLVLMDEPLGALDKQLREHMQMEIKHIHQRLGVTVVYVTHDQGEALTMSDRVAV
                     FHQGEIQQIADPRTLYEEPCNTFVANFIGENNRINGTLLTSDGKRCQVQLPRGERVEA
                     LAVNVGQAGEPVTLSIRPERVRLNGHSESCVNRFSGRVAEFIYLGDHVRVRLEVCGKA
                     DFFVKQPIAELDPALAVGDVVPLGWEVEHARALDPIAEAH"
     CDS             525440..526474
                     /codon_start=1
                     /locus_tag="PP4_04450"
                     /product="putative polyamine ABC transporter
                     substrate-binding protein"
                     /protein_id="BAN52298.1"
                     /transl_table=11
                     /translation="MRKQLKLTALALGLFAAGQAMAADLTVISFGGANKAAQVKAFYE
                     PWEKAGNGKIVAGEYNGEMAKVKAMVDTKSVSWNLVEVESPELARGCDEGMFEELDPA
                     LFGSESDYVPGAIQPCGVGFFVWSTVMAYNADKLKTAPTSWADFWDTKQFPGKRGLRK
                     GAKYTMEFALMADGVAPKDVYKVLATKEGQDRAFKKLDELKPSIQWWEAGAQPPQFLA
                     SGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFGAWAIPKGAKNVEEAKKFIAYSVK
                     PEQQKIYSENIAYGPANSNAVSLLSDEVKKDMPTTPENIANQVQIDVAFWADNSEQLE
                     QRFNAWAAKK"
     CDS             526763..528010
                     /codon_start=1
                     /locus_tag="PP4_04460"
                     /product="putative polyamine ABC transporter permease
                     protein"
                     /protein_id="BAN52299.1"
                     /transl_table=11
                     /translation="MAIAVPLNEGAGPSLKQRLKHAERVNRWKAQALIAPLALFLLLV
                     FLVPIAALLYKSVGNPEVVAGLPRTVDVITQWDGKSLPGEDVYKALSQDLAESRKNQT
                     LGDLSKRLNMELAGYRSLLTKTARALPFKVEPASYKDALQAVDERWGDPAYWQAIRRN
                     TSTVTSFYLLASVDHRIDDLGELAKATPDQAIYLDIFARTLWMGVVITAICLVLAYPL
                     AYLLANLPTRQSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINSALMAMGIIDQPL
                     ELVFNRTGVYISMVHILLPFMILPLYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQ
                     TYAGVGAGCLLVFILAIGYYITPALLGSPNDQMVSYFVAFYTNTSINWGMATALGGLL
                     LLATVLLYLIYSWLVGASRLRLS"
     CDS             528022..528849
                     /codon_start=1
                     /locus_tag="PP4_04470"
                     /product="putative polyamine ABC transporter permease
                     protein"
                     /protein_id="BAN52300.1"
                     /transl_table=11
                     /translation="MLSPYMSPVERVWFYSLRILCGLVLLFLILPVLVIVPLSFNSGS
                     FLVYPLQGFSLQWYQDFFGSAEWMRALKNSIIVAPAATVLAMVFGTLAAIGLTRGDFP
                     GKSLVMALVISPMVVPVVIIGVASYLFFAPLGMGNSFTSLILVHAVLGVPFVIITVSA
                     TLQGFNYNLVRAAASLGASPLLAFRRVTLPLIAPGVISGALFAFATSFDEVVVTLFLA
                     GPEQATLPRQMFSGIRENLSPTIAAAATLLIAFSVVLLLTLEWLRGRSEKLRTQQPA"
     CDS             529090..529764
                     /codon_start=1
                     /gene="rpe"
                     /locus_tag="PP4_04480"
                     /product="ribulose-5-phosphate 3-epimerase"
                     /protein_id="BAN52301.1"
                     /transl_table=11
                     /translation="MQPYAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVP
                     NLTIGPMVCTALRKYGVTAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEASQHVDRS
                     LQLIKDGGCKAGLVFNPASSLDALKYVMDKVDMVLLMSVNPGFGGQKFIPGTLDKLRE
                     ARALIDASGRDIRLEIDGGVNVNNIREIAAAGADTFVAGSAIFNAPDYQEVIARMRAE
                     LAQARP"
     CDS             529761..530579
                     /codon_start=1
                     /EC_number="3.1.3.18"
                     /gene="gph"
                     /locus_tag="PP4_04490"
                     /product="phosphoglycolate phosphatase"
                     /protein_id="BAN52302.1"
                     /transl_table=11
                     /translation="MSGFEQLFPGTLPRLVMFDLDGTLIDSVPDLAAAVDRMLLELGR
                     PPAGLEAVRHWVGNGAHVLVRRALAGGIDHAAVDDALADQALALFMDAYAQSHELTVV
                     YPGVQDTLRWLRKRGVEMALITNKPERFVGPLLDQMKIGNYFRWIIGGDTLPQKKPDP
                     AALLFVMQMASVTPQQSLFVGDSRSDVLAAKAAGVQCVGLTYGYNHGRPIHDESPNLV
                     IDDLRALLPGCADPATGITLANLQALQDREPTVVVTGKFWMKVIKALARWRWRA"
     CDS             530649..532130
                     /codon_start=1
                     /gene="trpE"
                     /locus_tag="PP4_04500"
                     /product="anthranilate synthase component I"
                     /protein_id="BAN52303.1"
                     /transl_table=11
                     /translation="MNREEFLRLAAAGYNRIPLACETLADFDTPLSIYLKLADQPNSY
                     LLESVQGGEKWGRYSMIGLPSRTVMRVHGYHVSILQDGVEVESHDVEDPLAFVESFKD
                     RYKVADIPGLPRFNGGLVGYFGYDCVRYVEKRLGASPNPDPLGVPDILLMVSDAVVVF
                     DNLAGKMHAIVLVDPAEDQAFEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPEFR
                     SSYTRDDYENAVGRIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMY
                     FFNFGDFHVVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIA
                     EHLMLIDLGRNDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVTGQLREGLTAMDALR
                     AILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVIKDG
                     ELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALAEQTLAK"
     CDS             complement(532262..534151)
                     /codon_start=1
                     /gene="estP"
                     /locus_tag="PP4_04510"
                     /product="esterase EstP"
                     /protein_id="BAN52304.1"
                     /transl_table=11
                     /translation="MRKAPLLRFTLASLALACSQAFAAPSPYSTLIVFGDSLADAGQF
                     PDLTGGTSGARFTNRDANGNFAPVSPMILGGRLGINPDELNPSTSVGIQPDGNNWAVG
                     GYTTQQILDSITTTSETVIPPGNPGAGLVLREKAGYLANGLRADPNALYYLTGGGNDF
                     LQGLVNSPADAVAAGARLAASAQALQQGGARYIMVWLLPDLGQTPNFSGTPQQNPLSL
                     LSGAFNQSLISQLGQIDAEIIPLNIPVLLGEALASPNQFGLASDQNLVGTCYSGASCV
                     ENPVYGINGTSPDPTKLLFNDSVHPTIAGQQLIADYAYSIISAPWELTLLPEMAHASL
                     RAHQDELRNQWQTPWQAVGQWQAFVATGAQDLDFDSQHSAASGDGRGYNLTVGGSYRL
                     NDAWRLGLAGGAYRQKLEAGANDSDYKLNSYLASAFAQYRQDRWWADAALTAGHLDYS
                     DLKRTFALGVNERSEKGDTDGEAWAMSGRLGYNLAADSSNWQLAPFISADYARVKVDG
                     YNEKSGRSTALGFDDQERTSRRLGLGLLGSVQVLPGTRLFAEVAQEHEFEDDQQDVTM
                     HLTSLPANDFTLTGYTPHSDLTRASLGVSHEVVAGVHVRGNYNWRKSDELTQQGVSLG
                     VSVDF"
     CDS             534519..535112
                     /codon_start=1
                     /gene="trpG"
                     /locus_tag="PP4_04520"
                     /product="anthranilate synthase component II"
                     /protein_id="BAN52305.1"
                     /transl_table=11
                     /translation="MLLMIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNP
                     ERIVVSPGPCTPSEAGVSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHG
                     KTSPVHHRDLGVFAGLNNPLTVTRYHSLVVKRETLPDCLEVTAWTAHADGSVDEIMGL
                     RHKTLNIEGVQFHPESILTEQGHELFANFLKQTGGHR"
     CDS             535122..536171
                     /codon_start=1
                     /EC_number="2.4.2.18"
                     /gene="trpD"
                     /locus_tag="PP4_04530"
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="BAN52306.1"
                     /transl_table=11
                     /translation="MDIKSALSRIVGQLDLSTEEMRDVMRQIMTGQCSEAQIGAFLMG
                     MRMKSESIDEIVGAVSVMRELADKVELKSLDGVVDIVGTGGDGANIFNVSTASSFVLA
                     AAGCTVAKHGNRAVSGKSGSADLLEAAGIYLNLTPVQVARCIDSLGIGFMFAQSHHSA
                     MKYAAGPRRDLGLRTLFNMLGPLTNPAGVKHQVVGVFAQALCRPLAEVLQRLGSKHVL
                     VVHSKDGLDEFSLAAPTFVAELKNDEITEYWVEPEDLGMKSQSLHGLAVENPQASLEL
                     IRDALGRRKTENGQKAAEMIVLNAGAALYAADHAMSLKAGVELAHDVLHTGLAWEKLQ
                     ELGAFTAVFKVENEA"
     CDS             536168..537001
                     /codon_start=1
                     /gene="trpC"
                     /locus_tag="PP4_04540"
                     /product="indole-3-glycerol-phosphate synthase"
                     /protein_id="BAN52307.1"
                     /transl_table=11
                     /translation="MSVPTVLERIIARKFQEVAERSARVSLAELEGLAKVADAPRGFA
                     NALIEQAKRKQPAVIAEIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYF
                     QGADEYLQQARAAVSLPVIRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAA
                     TAKDVGLDVLVEVHDGDELERALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRD
                     RLAITESGILNRADVELMAINEVYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQHL
                     D"
     CDS             537151..537855
                     /codon_start=1
                     /locus_tag="PP4_04550"
                     /product="hypothetical protein"
                     /protein_id="BAN52308.1"
                     /transl_table=11
                     /translation="MTDQPLALTVEQGLHTEQELLAAVCRGERESGVLFWRPTDHALV
                     MPRRMSRLDNFEAACSELAIAGWPVLLRETGGEPVPQSHSTVNVALVYVAPRSEGDHG
                     RIESAYERLCLPLCDVLREWGGVASVGEIDGAFCDGRYNVNLNGRKLVGTAQRWRQGL
                     GGKRPVVLVHGALLLDNERESMVAAVNRFNECCELEQRCRADAHIALHEVAPAAPWFA
                     RLSQAYAKVLADLPKD"
     CDS             complement(537865..538509)
                     /codon_start=1
                     /gene="crp"
                     /locus_tag="PP4_04560"
                     /product="cAMP receptor protein"
                     /protein_id="BAN52309.1"
                     /transl_table=11
                     /translation="MVASALPAKIKNIDKLLVHCQRRRYTAKSNIICAGDRAETLSFI
                     IKGSVTILIEDDDGREMIIAYLNNGDFFGELGLFEPVDGEQQRSAWVRAKTECEVAEI
                     SYEKFRELARQDPEILYALGSQMAQRLRNTTRKVGDLAFFDVTGRVARCLLELCKQPD
                     AMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKDLEERSLVQVKGKTMVVYGTR"
     CDS             538699..539121
                     /codon_start=1
                     /locus_tag="PP4_04570"
                     /product="hypothetical protein"
                     /protein_id="BAN52310.1"
                     /transl_table=11
                     /translation="MKARIQWAGEAMFLGESGSGHVVVMDGPPEAGGRNLGVRPMEML
                     LLGLGGCSSFDVVSILKKSRQAVESCEAFLEAERASEDPKVFTKIHMNFVVKGRGLKE
                     AQVKRAVELSAEKYCSASIMLERAGVEITHGYEIVELG"
     CDS             complement(539261..540301)
                     /codon_start=1
                     /locus_tag="PP4_04580"
                     /product="hypothetical protein"
                     /protein_id="BAN52311.1"
                     /transl_table=11
                     /translation="MTDRIDAKDLARAVQAGILQPGQDQALLVFLRQQPAQRGSFQLA
                     HVAFYFGAMLIMAAMGWLLTEAWMSIGDGALLVIASLYILLITLFALHLQRRAQPVAA
                     GVLAAVAVSIVPLAVFAIERLAGWWPLDDAQANYHQYYTYVQGGWLAMEAATVLAGLL
                     MLRLIPYPFVMMPIAVALWFMSMDLSEWFFGSPFSWEQRREVSLWFGLALLVVFLVID
                     GRTREDYARWGYLAGLAAFWGGLTLVDSGSELGKALYCLINIVLMGMAVLLRRPVFMV
                     FGALGVAAYLGYLSYEVFAESLLFPMVVTLIGLGVIWLGLVYQKRRERLSQAMRGWLP
                     GWVQAALPALRS"
     CDS             complement(540312..540959)
                     /codon_start=1
                     /gene="coq7"
                     /locus_tag="PP4_04590"
                     /product="putative 2-polyprenyl-3-methyl-6-methoxy-1,4-
                     benzoquinol hydroxylase"
                     /protein_id="BAN52312.1"
                     /transl_table=11
                     /translation="MATERHYSPLDRLLLQADTAMRTLLPFSGQPARPSPAIVQPDAD
                     LDDQQTRHIAGLMRINHTGEVCAQALYQGQALTAKLPQVRKAMEHAAEEEVDHLAWCE
                     QRIRQLNSHPSVLNPLFYGMSFGIGALAGLVSDKVSLGFVAATEHQVCKHLDEHLEQI
                     PHEDEKSRAILEQMRIDEEQHAESALEAGGYRFPAPVRFGMSLLAKVMTKSTYRI"
     CDS             complement(541025..541363)
                     /codon_start=1
                     /locus_tag="PP4_04600"
                     /product="HIT family protein"
                     /protein_id="BAN52313.1"
                     /transl_table=11
                     /translation="MDDLFLKIINREIPADIIYEDDQVLAFKDIAPAAPVHFLVIPKK
                     HIRTLNDLTEEDKALAGHILFTAQRLAVEQGCEEGFRVVMNCNPKGGQTVYHIHMHVL
                     GQRQMNWPPG"
     CDS             complement(541427..542209)
                     /codon_start=1
                     /locus_tag="PP4_04610"
                     /product="putative oxidoreductase"
                     /protein_id="BAN52314.1"
                     /transl_table=11
                     /translation="MTRYAMITGASSGLGLALAEALARRGRNLILVARQRETLEPVAI
                     ELTQRFGVEVLFRACDLSQPLRLSGFVLELEEGERRIDLLVNCAGLRTYGPFLAHEWA
                     DEQDLLEVNVLALSRLCHAIGNLMAVQGGGQILNVAGLAGVAPGPWMAAYAASKAYVL
                     SFSQALREELKRAGIKVSVLCPGPVRSPHRRIARLDGKPRCLSPEEIALYTVRALDKN
                     RALILPGRRNRWLAFAPRLLPRWLVCKLAGAIHRRYCPAGME"
     CDS             complement(542277..543233)
                     /codon_start=1
                     /locus_tag="PP4_04620"
                     /product="hypothetical protein"
                     /protein_id="BAN52315.1"
                     /transl_table=11
                     /translation="MSLPASLEQRLRLPVVAAPMFLISNPTLVLACCASGVVGSFPAL
                     NQRDSAGFKAWLEEIEAGLAQLQAPAPYAVNLIVHPTNPRLQADLALCVEHRVPIVIT
                     SLGAVKEVVDAVHGYGGLVFHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFA
                     LAAEIRQFFDKTLLLAGCLNHGHEILAAQLLGADLAYMGTRFIATTESQAQDAYKQML
                     LDAHAADIIHTPAVSGIPASFLRSSLEQAGYDMSALKGGHEQGKLKPVDDEAKAWKTV
                     WSAGQGVGEIHDLPSASALIERLHSEYREALERCQILRARTL"
     CDS             complement(543262..543687)
                     /codon_start=1
                     /locus_tag="PP4_04630"
                     /product="hypothetical protein"
                     /protein_id="BAN52316.1"
                     /transl_table=11
                     /translation="MLYLWIKALHIVSVVCWFAGLFYLPRLFVYHAQSEDSTSKDRFV
                     TMERKLYRGIMNPAMIATYVFGAWMLYLTPGWLSQGWLHAKLTLVILLTGYHHMCGAQ
                     RKRFASGNNTRSHVYYRWFNEVPVLFLLGIVILVVVKPF"
     CDS             543830..544864
                     /codon_start=1
                     /EC_number="1.2.1.38"
                     /gene="argC"
                     /locus_tag="PP4_04640"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="BAN52317.1"
                     /transl_table=11
                     /translation="MIKVGIVGGTGYTGVELLRLLAQHSQAEVAVITSRSEAGVAVAD
                     MYPNLRGHYDGLAFSVPDSKALAACDVVFFATPHGVAHALAGELLAAGTKVIDLSADF
                     RLQDATEWGKWYGQPHGAPELLKDAVYGLPEVNREKIRQARLIAVPGCYPTATQLGFL
                     PLLEAGLADPSRLIADCKSGVSGAGRGAAVGSLFCEAGESMKAYAVKGHRHLPEISQG
                     LRLAAGKDIGLTFVPHLTPMIRGIHATLYANVVDTSVDLQALFEKRYADEPFVDVMPA
                     GSHPETRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDER
                     MGLSHAGLLP"
     CDS             545011..545361
                     /codon_start=1
                     /gene="erpA"
                     /locus_tag="PP4_04650"
                     /product="iron-sulfur cluster insertion protein ErpA"
                     /protein_id="BAN52318.1"
                     /transl_table=11
                     /translation="MSVETFTPTGLEFTHGAAQKVKNLVDEEGNERLKLRVFVTGGGC
                     SGFQYGFTFDEDVAEDDTIVEREGVALVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNP
                     NAATTCGCGSSFSI"
     CDS             complement(545421..546512)
                     /codon_start=1
                     /EC_number="2.7.1.170"
                     /gene="anmK"
                     /locus_tag="PP4_04660"
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="BAN52319.1"
                     /transl_table=11
                     /translation="MALYLGVMSGTSLDGLDIALIKQGEQLELLATHYLPMPGDLRQD
                     LLALCSSGADEIARAALAENRWASLAAEGIRELLARQGLQADAIRAIGSHGQTIRHEP
                     ARGFTVQIGNPALLAELTGISVVADFRRRDVAAGGQGAPLVPAFHETLFGHLGQRLAV
                     LNVGGFSNLSLIEQDKPVHGFDCGPGNVLLDAWIERKRGQAYDADGAWAASGVVQAGL
                     LGVLLSDPFFAGSGPKSTGREVFNLPWLDGHLAGLPTYQDEDVQATLLELTARSIIDS
                     LSHAQQGTKALLVCGGGARNGALMARLGQLLPEARVASTGAHGVDPDWVEAMAFAWLA
                     HCCLEGICANRPSVTAAKGLRVLGAIYPA"
     CDS             complement(546517..547938)
                     /codon_start=1
                     /locus_tag="PP4_04670"
                     /product="putative peptidase M23 family protein"
                     /protein_id="BAN52320.1"
                     /transl_table=11
                     /translation="MTNEPPKAPPLYPKSHLLAASGIAALLSLALLVFPSSEVEAKKT
                     TLNLELESPAEQLKDESRAAPLVQAEGEQGSPFAQIEEATPETQKAEQSTPAAEPVAE
                     AAKEPGHREVTVARGDTLSTLFAKVGLPSNAVHDLLASNKQAKQFSQLKHGQVLQFEL
                     DKDGQLASLHSKVSNLETIRLTKSAKGYTFNREISKPVVRTAYAHGVIKSSLSASAQR
                     AGLSHSMTMDMARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKVVGTGNILSARFTNR
                     GKTYTAVRYTNKQGNTTYYTADGNSLRKAFIRTPVDFARISSRFSAGRKHPILNKIRA
                     HKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLYGHMQGFAKGIK
                     TGSSVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPIAKNERQRFQ
                     QQSQPLIARMDQEKATLLAANKR"
     CDS             548152..549351
                     /codon_start=1
                     /EC_number="6.1.1.1"
                     /gene="tyrS"
                     /locus_tag="PP4_04680"
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="BAN52321.1"
                     /transl_table=11
                     /translation="MKSVEEQLALIKRGAEEVLVESELVEKLKRGQPLRIKAGFDPTA
                     PDLHLGHTVLINKLRQFQELGHQVIFLIGDFTGMIGDPSGKSATRPPLTREQVLDNAE
                     TYKQQVFKILDPAKTEVAFNSTWMDKLTPADFIRLASQYTVARMLERDDFDKRYTTNQ
                     PIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRAYGQEAQNIVTMPLL
                     EGLDGVKKMSKSLGNYVGIQEAPGVMYSKLVSIPDTLMWRYFELLSFRSMEEIEQFRA
                     DVAKGANPRDIKIKLAEEIVARFHGEEAAANAHRGAGNRMKEGELPEDLPEVEVAAAE
                     DLPIAAVLNRAGLVKNSAQARDLLSGGAVKVDGAVVDRDFVFALGATHVCQAGKKSFA
                     RVTLKAE"
     rRNA            550066..551605
                     /locus_tag="PP4_r0080"
                     /product="16S ribosomal RNA"
     CDS             complement(551407..551640)
                     /codon_start=1
                     /locus_tag="PP4_04690"
                     /product="hypothetical protein"
                     /protein_id="BAN52322.1"
                     /transl_table=11
                     /translation="MWELISRLMSSIKEVIQPQVPLRLPCYDFTPVMNHTVVTVLPKV
                     RLATSGATHSHGVTGGVYKARERIHRDILIRDY"
     tRNA            551683..551756
                     /locus_tag="PP4_t0070"
                     /product="tRNA-Ile"
     tRNA            551766..551838
                     /locus_tag="PP4_t0080"
                     /product="tRNA-Ala"
     rRNA            552079..554968
                     /locus_tag="PP4_r0090"
                     /product="23S ribosomal RNA"
     rRNA            555105..555220
                     /locus_tag="PP4_r0100"
                     /product="5S ribosomal RNA"
     CDS             555490..556449
                     /codon_start=1
                     /gene="birA"
                     /locus_tag="PP4_04700"
                     /product="biotin protein ligase/biotin operon repressor"
                     /protein_id="BAN52323.1"
                     /transl_table=11
                     /translation="MLKLLNLLKDGRFHSGEALGAALGVSRSAVWKQLQHLESELNLT
                     IHKVRGRGYQLAAPLALLEAQAIARFAEGEQWPVFIHEIIDSTNAEGLRLANQGQVAP
                     FLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDGGMRQLEGLSLVVGVAVMRTLQ
                     AFGVKDVGLKWPNDVLVRGQKITGILLELVGDPADVCHVVLGIGINVNMQVNDQVDQE
                     WTSMRREVGAAIDRNHLVASLNQQMQHELARHRRYGFAAFQEEWEQAHLWQGRNVSLV
                     AGNTRIDGVVLGVDGQGGLRLEVDGVEKSFSGGELSLRLRDDS"
     CDS             556439..557188
                     /codon_start=1
                     /EC_number="2.7.1.33"
                     /gene="coaX"
                     /locus_tag="PP4_04710"
                     /product="type III pantothenate kinase"
                     /protein_id="BAN52324.1"
                     /transl_table=11
                     /translation="MILELDCGNSFIKWRVIHTADAVIEGGGIVDSDQALLAEVAALA
                     SVRLTGCRIVSVRSEEETDALCALIAQAFAVQAHVALPARSMAGVRNGYDDYQRLGMD
                     RWLAALGAFHLAKGACLVIDLGTAAKADFVAADGEHLGGYICPGMPLMRSQLRTHTRR
                     IRYDDASAERALTSLSPGRSTVEAVERGCVLMLQGFARTQLEQARSLWGEEFAVFLTG
                     GDAPLVREAVPQARVVPDLVFVGLAMACPLD"
     CDS             557196..557621
                     /codon_start=1
                     /locus_tag="PP4_04720"
                     /product="hypothetical protein"
                     /protein_id="BAN52325.1"
                     /transl_table=11
                     /translation="MRWLFLLLLVLNVFYYVWHQQEAPLKVKEVAPLSLYKGNQQEIR
                     LLRETGVSAPPRRREECLVVGGVAGQEQLDALRQRLLSLDIATLPVVGQLPGADGRWL
                     KVAPESERLLDQTVLSALSNDFKDLKHKIIFCQGIATGE"
     tRNA            557774..557854
                     /locus_tag="PP4_t0090"
                     /product="tRNA-Tyr"
     tRNA            557882..557952
                     /locus_tag="PP4_t0100"
                     /product="tRNA-Gly"
     tRNA            557985..558057
                     /locus_tag="PP4_t0110"
                     /product="tRNA-Thr"
     CDS             558139..559332
                     /codon_start=1
                     /gene="tuf"
                     /locus_tag="PP4_04730"
                     /product="elongation factor Tu 1"
                     /protein_id="BAN52326.1"
                     /transl_table=11
                     /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAV
                     VEFDKIDSAPEEKARGITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLST
                     YDFPGDDTPIIIGSARMALEGKDDNEMGTTAVKRLVETLDSYIPEPERAIDKPFLMPI
                     EDVFSISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGE
                     NCGVLLRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVV
                     AKIIE"
     tRNA            559387..559459
                     /locus_tag="PP4_t0120"
                     /product="tRNA-Trp"
     CDS             559507..559875
                     /codon_start=1
                     /gene="secE"
                     /locus_tag="PP4_04740"
                     /product="preprotein translocase subunit SecE"
                     /protein_id="BAN52327.1"
                     /transl_table=11
                     /translation="MTPKTEAQESRFDLFKWLAVVALVVVAVVGNQYYSASPILYRVL
                     ALLVLAAVAGFVALQTAKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVM
                     ALLLWGLDSLLGWAVSLIVG"
     CDS             559885..560418
                     /codon_start=1
                     /gene="nusG"
                     /locus_tag="PP4_04750"
                     /product="transcription antitermination protein NusG"
                     /protein_id="BAN52328.1"
                     /transl_table=11
                     /translation="MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEDGFGEILVPTEE
                     VVEMRNGQKRKSERKFFPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDK
                     EAEAILRRVADGSDKPKPKTLFEPGEVVRVIDGPFADFNGSVEEVNYEKSRLQVAVLI
                     FGRSTPVELEFSQVEKV"
     CDS             560538..560969
                     /codon_start=1
                     /gene="rplK"
                     /locus_tag="PP4_04760"
                     /product="50S ribosomal protein L11"
                     /protein_id="BAN52329.1"
                     /transl_table=11
                     /translation="MAKKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNA
                     RTQGQEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVT
                     RAQLEDIAKAKQADLTAADLDAAVRTIAGSARSMGLNVEGV"
     CDS             560969..561664
                     /codon_start=1
                     /gene="rplA"
                     /locus_tag="PP4_04770"
                     /product="50S ribosomal protein L1"
                     /protein_id="BAN52330.1"
                     /transl_table=11
                     /translation="MAKLTKRQKAIAEKIEAGKSYNFEEAATLLASLPAAKFVESYDI
                     AVNLGVDPRKSDQVVRSATVLPHGTGKTVRVAVFTQGPAAEAALAAGADRVGMDDLAA
                     EMKAGDLNYDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVSPDVATAVKNAKAGQ
                     VRYRTDKNGIIHTSVGKVGFEAGKLKENVEALIADLKRIKPASSKGIYVKRVTLSTTM
                     GPGLVIDQSSLNV"
     CDS             561862..562362
                     /codon_start=1
                     /gene="rplJ"
                     /locus_tag="PP4_04780"
                     /product="50S ribosomal protein L10"
                     /protein_id="BAN52331.1"
                     /transl_table=11
                     /translation="MAIKLEDKKAIVAEVNEAAKVALSAVVADARGVTVGAMTGLRKE
                     AREAGVYVRVVRNTLLKRAVEGTEFSILSDAFKGPTLIAFSNEHPGAAARLFKEFAKG
                     QDKFEIKAAAFDGNFIAANQIDVLATLPTRDEAIARLMSVIQGATSKLARTLAAIRDQ
                     KEATAA"
     CDS             562440..562805
                     /codon_start=1
                     /gene="rplL"
                     /locus_tag="PP4_04790"
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="BAN52332.1"
                     /transl_table=11
                     /translation="MSLTNEQIIEAIGQKTVLEVVELIKAMEETFGVTAAVAAAGPAA
                     AAAVVEEQTEFNVVLVEAGEKKVNVIKAVRELTGLGLKEAKEKVDGAPQVVAEGVSKE
                     AAEDAKKKLEEAGAKVELK"
     CDS             563026..567099
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoB"
                     /locus_tag="PP4_04800"
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="BAN52333.1"
                     /transl_table=11
                     /translation="MAYSYTEKKRIRKDFSKLPDVMDVPYLLAIQLDSYREFLQAGAS
                     KDQFRDVGLHAAFKSVFPIISYSGNAALEYVGYRLGEPAFDVKECVLRGVTFAVPLRV
                     KVRLIIFDKESSNKAIKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVF
                     FDHDRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVFVRIDRRRKLPASVLLRALG
                     YSTEEVLNTFYTTNVFHISGEKLSLELVPQRLRGEVAVMDIHDETGKVIVEQGRRITA
                     RHINQLEKAGVKQLDVPMEYVLGRTTAKAIVHPATGEILAECNTELTTDLLIKVAKAQ
                     VVRIETLYTNDIDCGPFISDTLKIDTTSNQLEALVEIYRMMRPGEPPTKDAAETLFNN
                     LFFSAERYDLSAVGRMKFNRRIGRTEIEGSGVLSKEDIVEVLKTLVDIRNGKGIVDDI
                     DHLGNRRVRCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAVK
                     EFFGSSQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPI
                     ETPEGPNIGLINSLAAYARTNQYGFLESPYRVVKEGVVSDDIVFLSAIEEADHVIAQA
                     SAAMNDKKQLIDELVAVRHLNEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDAN
                     RALMGSNMQRQAVPTLRADKPLVGTGMERNVARDSGVCVVARRGGVIDSVDASRIVVR
                     VNDDEVETGEAGVDIYNLTKYTRSNQNTCINQRPLVSKGDKVQRSDIMADGPSTDMGE
                     LALGQNMRIAFMAWNGFNFEDSICLSERVVQEDRFTTIHIQELTCVARDTKLGPEEIT
                     ADIPNVGEAALNKLDEAGIVYVGAEVGAGDILVGKVTPKGETQLTPEEKLLRAIFGEK
                     ASDVKDTSLRVPTGTKGTVIDVQVFTRDGVERDSRALAIEKMQLDEIRKDLNEEFRIV
                     EGATFERLRSALNGQVVDGGAGLKKGTVVTDEVLDGLEHGQWFKLRMAEDALNEQLEK
                     AQQYIVDRRRLLDDKFEDKKRKLQQGDDLAPGVLKIVKVYLAIRRRIQPGDKMAGRHG
                     NKGVVSVIMPVEDMPHDANGTPVDVVLNPLGVPSRMNVGQILETHLGLAAKGLGEKID
                     RMIEEQRKAAELRVFLTEVYNEIGGRQENLAEFTDEEILALAHNLKKGVPMATPVFDG
                     AKESEIKAMLKLADLPESGQMVLFDGRTGNKFERPVTVGYMYMLKLNHLVDDKMHARS
                     TGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMY
                     KNIVDGDHRMEPGMPESFNVLIKEIRSLGIDIDLETE"
     CDS             567164..571363
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoC"
                     /locus_tag="PP4_04810"
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="BAN52334.1"
                     /transl_table=11
                     /translation="MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERM
                     AHIELASPVAHIWFLKSLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLL
                     NDEQYFEALEEFGDDFDARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLS
                     KRLKLMEAFQGSGNLPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLSAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLAT
                     TIKAAKKMVERELPEVWDVLAEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTREAINAKGEGRVFADLQEVDRVFRAGEAALHAKIKVRINETVNDRDGSSTKN
                     TRIVDTTVGRALLFQVVPAGLPYDVVNQPMKKKAISKLINQCYRVVGLKETVIFADQL
                     MYTGFAYSTISGVSIGVNDFVIPDEKARIINSATDEVKEIESQYASGLVTQGEKYNKV
                     IDLWSKANDEVSKAMMANLSKEKVIDREGKEVEQESFNSMYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLSVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEIDCGTDQGLLMTPHIEGGDVVEPLGERVLGRVIARDVFKPGTEDV
                     IVPAGTLVDEQWVEFIELNSIDEVIVRSPINCETRFGICAKCYGRDLARGHQVNIGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKNGGMVRLHNLKHVVRADGN
                     LVAVSRSGELAIADEFGRERERYKLPYGAVISVKEGEKVEAGAIVAKWDPHTHPIVTE
                     LKGTVTFVGMEENITIKRQTDELTGLTNIEVLDVKDRPAAGKEIRPAIKMVDANGKDL
                     YLPGTDVPAQYFLPANALVGVADGAQIGVGDVIARIPQETSKTRDITGGLPRVADLFE
                     ARRPKEASILAEVSGTIAFGKETKGKRRLVITPTDGSDPYEELIPKWRHLNVFEGEQV
                     NRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDKHIETILRQMLR
                     KVEISESGDSSFIKGDQMELTHVLVENERLAGEDKFISKFTRVLLGITKASLSTESFI
                     SAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKRRREADKP
                     LRVSASEVEAALTEALNSSGN"
     CDS             571575..571946
                     /codon_start=1
                     /gene="rpsL"
                     /locus_tag="PP4_04820"
                     /product="30S ribosomal protein S12"
                     /protein_id="BAN52335.1"
                     /transl_table=11
                     /translation="MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPKK
                     PNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSL
                     DTSGVKGRNQGRSKYGTKRPK"
     CDS             572053..572523
                     /codon_start=1
                     /gene="rpsG"
                     /locus_tag="PP4_04830"
                     /product="30S ribosomal protein S7"
                     /protein_id="BAN52336.1"
                     /transl_table=11
                     /translation="MPRRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVY
                     GALDKVKERKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMR
                     WLVDYARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF"
     CDS             572554..574698
                     /codon_start=1
                     /gene="fusA"
                     /locus_tag="PP4_04840"
                     /product="elongation factor G"
                     /protein_id="BAN52337.1"
                     /transl_table=11
                     /translation="MARTTAINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVH
                     DGAATTDWMVQEQERGITITSAAVTTFWKGSVGQYDNYRVNVIDTPGHVDFTIEVERS
                     LRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRVVYVNKMDRAGANFLRVVGQIKN
                     RLGHTPVPVQLAIGSEDNFQGQVDLIKMKAIYWNDDDKGTTYREEEIPADMLELAQEW
                     RSNMVEAAAESSEELMNKYLEGEELTVEEIKAGLRARTLASEIVPAVCGSSFKNKGVP
                     LVLDAVIDYLPAPTEIPAIQGINPDDKELDKEDPAVRKDVRHADDDEPFSALAFKIAT
                     DPFVGTLTFVRVYSGVLTSGDSVINSVKGKKERVGRMVQMHANQREEIKEVRAGDIAA
                     LIGMKDVTTGETLCNADKPIILERMDFPEPVISLSVEPKTKADQEKMGIALGKLAQED
                     PSFRVKTDEETGQTIISGMGELHLDILVDRMKREFNVEANIGKPQVSYREKITKSNVE
                     IEGKFVRQSGGRGQFGHCWIRFSEPDQDEKGNITEGLVFSNEVVGGVIPKEFIAPIQK
                     GIEEQMKNGVVAGYPLIGLKAAVFDGSYHDVDSNEMAFKIAASMATKQLAQKGGGVVL
                     EPIMKVEVVTPEDYLGDVMGDLNRRRGLVQGMDESVSGRVVRAEVPLGEMFGYATDVR
                     SMSQGRASYSMEFSKYAEAPSNIVEALVKKQG"
     CDS             574726..575919
                     /codon_start=1
                     /gene="tuf"
                     /locus_tag="PP4_04850"
                     /product="elongation factor Tu 1"
                     /protein_id="BAN52338.1"
                     /transl_table=11
                     /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAV
                     VEFDKIDSAPEEKARGITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLST
                     YDFPGDDTPIIIGSARMALEGKDDNEMGTTAVKRLVETLDSYIPEPERAIDKPFLMPI
                     EDVFSISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGE
                     NCGVLLRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVV
                     AKIIE"
     CDS             576062..576373
                     /codon_start=1
                     /gene="rpsJ"
                     /locus_tag="PP4_04860"
                     /product="30S ribosomal protein S10"
                     /protein_id="BAN52339.1"
                     /transl_table=11
                     /translation="MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPT
                     RKERFTVLVSPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL
                     G"
     CDS             576454..577089
                     /codon_start=1
                     /gene="rplC"
                     /locus_tag="PP4_04870"
                     /product="50S ribosomal protein L3"
                     /protein_id="BAN52340.1"
                     /transl_table=11
                     /translation="MTIGVIGRKCGMTRIFTEEGVSIPVTVIEIEPNRVTQFKTEETD
                     GYRAVQVTVGERRASRVTAAQAGHFAKANVAAGRGVWEFRLEEGDFQAGDLIKAELFT
                     AGQLVDVTGQSKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQTPGRVFKGKK
                     MSGHMGAERVTVQSLEVVRVDAERNLLLVKGAVPGATGGDVVVRPAVKARG"
     CDS             577102..577704
                     /codon_start=1
                     /gene="rplD"
                     /locus_tag="PP4_04880"
                     /product="50S ribosomal protein L4"
                     /protein_id="BAN52341.1"
                     /transl_table=11
                     /translation="MQLNVNDAQAIEVSELTFGGEFNETLVHQAVVAYMAGGRQGTKQ
                     QKTRSDVAGGGKRPWRQKGTGRARAGTTRGPIWRGGGVTFAARPQDHSQKLNKKMYRA
                     ALRSILAELVRSDRLVVVQDFAVEAPKTKDLLNKLNGMGLSDVLIVSDAVDQNLYLAA
                     RNLPHVDVRDVQGSDPVSLIAYEKVLITVSAVKKFEELLG"
     CDS             577701..578000
                     /codon_start=1
                     /gene="rplW"
                     /locus_tag="PP4_04890"
                     /product="50S ribosomal protein L23"
                     /protein_id="BAN52342.1"
                     /transl_table=11
                     /translation="MNQERVFKVLLGPHVSEKATVLAEKKGQFVFKVATDATKLEIKK
                     AVEGLFNVKVENVSTVNVLGKTKRTARGLGKRNDWKKAIVSLQPGQDLDFSSSAE"
     CDS             578015..578839
                     /codon_start=1
                     /gene="rplB"
                     /locus_tag="PP4_04900"
                     /product="50S ribosomal protein L2"
                     /protein_id="BAN52343.1"
                     /transl_table=11
                     /translation="MAIVKCKPTSPGRRFVVKVVNKELHKGAPHAPLLEKKSKSGGRN
                     NNGRITTRHVGGGHKQHYRLVDFRRNDKDGIPATVERIEYDPNRTAHIALLCYADGER
                     RYIIAPKGVSAGDQLIAGALAPIKAGNSLQLRNIPVGSTIHGVELKPGKGAQIARSAG
                     ASAQLIARDGVYVTLRLRSGEMRKVLAECRATLGEVSNSEHSLRSLGKAGAKRWRGVR
                     PTVRGVAMNPVDHPHGGGEGRTSGGRHPVSPWGFPTKGAKTRGNKRTDNMIVRRRK"
     CDS             578856..579131
                     /codon_start=1
                     /gene="rpsS"
                     /locus_tag="PP4_04910"
                     /product="30S ribosomal protein S19"
                     /protein_id="BAN52344.1"
                     /transl_table=11
                     /translation="MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPVKTWSRRSMILPQM
                     VGLTIAVHNGRQHVPVLVNEDMVGHKLGEFAGTRTYRGHVADKKAKR"
     CDS             579143..579475
                     /codon_start=1
                     /gene="rplV"
                     /locus_tag="PP4_04920"
                     /product="50S ribosomal protein L22"
                     /protein_id="BAN52345.1"
                     /transl_table=11
                     /translation="MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAA
                     EIMKKVLESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCH
                     ITVKVADK"
     CDS             579489..580175
                     /codon_start=1
                     /gene="rpsC"
                     /locus_tag="PP4_04930"
                     /product="30S ribosomal protein S3"
                     /protein_id="BAN52346.1"
                     /transl_table=11
                     /translation="MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLKTREYLQ
                     DKLKSASVSRIDIHRPAQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHIN
                     IEEIRKPELDAMLVAQSVAQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGA
                     EIARTEWYREGRVPLHTLRADIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQ
                     APAPRKKAAK"
     CDS             580188..580601
                     /codon_start=1
                     /gene="rplP"
                     /locus_tag="PP4_04940"
                     /product="50S ribosomal protein L16"
                     /protein_id="BAN52347.1"
                     /transl_table=11
                     /translation="MLQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKAVARGRLTA
                     RQIESARRALTRHVKRGGKIWIRVFPDKPISKKPLEVRMGKGKGSVEYWVAQIQPGKV
                     LYEIEGVSEELAREAFALAAAKLPLATSFVKRTVM"
     CDS             580601..580792
                     /codon_start=1
                     /gene="rpmC"
                     /locus_tag="PP4_04950"
                     /product="50S ribosomal protein L29"
                     /protein_id="BAN52348.1"
                     /transl_table=11
                     /translation="MKANELREKSAQQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLS
                     QVKRDIARVKTVLNQQAGK"
     CDS             580789..581061
                     /codon_start=1
                     /gene="rpsQ"
                     /locus_tag="PP4_04960"
                     /product="30S ribosomal protein S17"
                     /protein_id="BAN52349.1"
                     /transl_table=11
                     /translation="MIMAEAEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVK
                     RSTKLHAHDETNQCKIGDKVSITETRPLAKTKSWALVEVLERAVEV"
     CDS             581085..581453
                     /codon_start=1
                     /gene="rplN"
                     /locus_tag="PP4_04970"
                     /product="50S ribosomal protein L14"
                     /protein_id="BAN52350.1"
                     /transl_table=11
                     /translation="MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVK
                     EAIPRGKVKKGQVMTAVVVRTRHGVRRADGSIIRFDGNAAVLLNNKQEPIGTRIFGPV
                     TRELRTEKFMKIVSLAPEVL"
     CDS             581465..581779
                     /codon_start=1
                     /gene="rplX"
                     /locus_tag="PP4_04980"
                     /product="50S ribosomal protein L24"
                     /protein_id="BAN52351.1"
                     /transl_table=11
                     /translation="MQKIRRDDEIIVIAGKDKGKRGKVLKVLADDRLVIGGVNLVKRH
                     TKPNPMAGVQGGIVEKEAPLHASNVAIFNGETNKADRVGFKVEDGKKIRVFKSTQKAV
                     DA"
     CDS             581800..582339
                     /codon_start=1
                     /gene="rplE"
                     /locus_tag="PP4_04990"
                     /product="50S ribosomal protein L5"
                     /protein_id="BAN52352.1"
                     /transl_table=11
                     /translation="MARLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAI
                     GDKKVIEHAVADLEKITGQKPVVTFARKSIAGFKVREGWPIGVKVTLRSDKMYEFLDR
                     LLAISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTA
                     RSDDEGRALLRAFKFPFRN"
     CDS             582353..582658
                     /codon_start=1
                     /gene="rpsN"
                     /locus_tag="PP4_05000"
                     /product="30S ribosomal protein S14"
                     /protein_id="BAN52353.1"
                     /transl_table=11
                     /translation="MAKKSMKNRELKRQLTVAKFAKKRAELKATIVNVNASPEERFAA
                     VVALQKQPRDASASRLRNRCRLTGRPHGVYRKFGLGRNMLRQAAMRGDVPGLVKASW"
     CDS             582868..583260
                     /codon_start=1
                     /gene="rpsH"
                     /locus_tag="PP4_05010"
                     /product="30S ribosomal protein S8"
                     /protein_id="BAN52354.1"
                     /transl_table=11
                     /translation="MSMQDPLADMLTRIRNAQMAEKSVVSMPSSTLKVAVAKVLKDEG
                     YIAGYQVTGEAKPSLSIELKYFEGRPVIEELKRSSRPGLRQYKAVTDLPKVRGGLGVS
                     IVSTNKGVMTDRAARAAGVGGEVLCTVF"
     CDS             583273..583806
                     /codon_start=1
                     /gene="rplF"
                     /locus_tag="PP4_05020"
                     /product="50S ribosomal protein L6"
                     /protein_id="BAN52355.1"
                     /transl_table=11
                     /translation="MSRVAKNPVKLPSGVEVKFAGQQLSVKGAKGTLELNVHSSVEVT
                     EESGELRFVARNGDQQARAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTV
                     LNLALGFSHPVDYELPAGITAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGK
                     GVRYADEVVRRKEAKKK"
     CDS             583817..584167
                     /codon_start=1
                     /gene="rplR"
                     /locus_tag="PP4_05030"
                     /product="50S ribosomal protein L18"
                     /protein_id="BAN52356.1"
                     /transl_table=11
                     /translation="MTDKKVIRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISAD
                     GSKVLASASTLDKDLRDGATGNIDAATKVGKLVAERAKAAGVSQVAFDRSGFKYHGRV
                     KALADAAREGGLEF"
     CDS             584171..584671
                     /codon_start=1
                     /gene="rpsE"
                     /locus_tag="PP4_05040"
                     /product="30S ribosomal protein S5"
                     /protein_id="BAN52357.1"
                     /transl_table=11
                     /translation="MANNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGK
                     GRVGFGRGKSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASE
                     GTGIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKRGK
                     SVEEIF"
     CDS             584674..584850
                     /codon_start=1
                     /gene="rpmD"
                     /locus_tag="PP4_05050"
                     /product="50S ribosomal protein L30"
                     /protein_id="BAN52358.1"
                     /transl_table=11
                     /translation="MATVKVTLIKSVSGRLPNHKLCVKGLGLRRIGHTVEVLDTPENR
                     GMINKAYYMLRVEG"
     CDS             584854..585288
                     /codon_start=1
                     /gene="rplO"
                     /locus_tag="PP4_05060"
                     /product="50S ribosomal protein L15"
                     /protein_id="BAN52359.1"
                     /transl_table=11
                     /translation="MKLNDLSPAPGSRREKHRPGRGIGSGLGKTGGRGHKGQTSRSGG
                     SIAPGFEGGQQPLHRRLPKFGFVSLKAMDRAEVRLSELAKVEGDVISVQSLKDANVIN
                     QHIQRVKIMLSGEVTRAVTIKGIAATKGARAAIEAAGGKFEE"
     CDS             585289..586620
                     /codon_start=1
                     /gene="secY"
                     /locus_tag="PP4_05070"
                     /product="preprotein translocase subunit SecY"
                     /protein_id="BAN52360.1"
                     /transl_table=11
                     /translation="MAKQGALSSLGKGGMSELWARLRFLFMAIIVYRIGAHIPVPGIN
                     PDRLADLFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAVSPQLE
                     QLKKEGEAGRRKISQYTRYGTVILALVQAIGMSIGLANQGVAFSAGLGFHVVAVSTFV
                     AGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLPRAIGQSFESARTGDINIFALVAI
                     GLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFAS
                     SILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILLFSAGIIFFCFFYTALMFNP
                     KDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMMAVCLLPQFLVVAANV
                     PFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKGYGGSGLLR"
     CDS             586649..586765
                     /codon_start=1
                     /gene="rpmJ"
                     /locus_tag="PP4_05080"
                     /product="50S ribosomal protein L36"
                     /protein_id="BAN52361.1"
                     /transl_table=11
                     /translation="MKVRASVKKLCRNCKIIRREGVVRVICSAEPRHKQRQG"
     CDS             586897..587253
                     /codon_start=1
                     /gene="rpsM"
                     /locus_tag="PP4_05090"
                     /product="30S ribosomal protein S13"
                     /protein_id="BAN52362.1"
                     /transl_table=11
                     /translation="MARIAGVNIPDNKHTVISLTYIYGVGRTTAQKICADAGVNPAAK
                     IKDLSDEQIETLRGEVAKFTTEGDLRRDINMKIKRLMDLGCYRGLRHRKGLPVRGQRT
                     KTNARTRKGPRKPIRK"
     CDS             587272..587661
                     /codon_start=1
                     /gene="rpsK"
                     /locus_tag="PP4_05100"
                     /product="30S ribosomal protein S11"
                     /protein_id="BAN52363.1"
                     /transl_table=11
                     /translation="MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSW
                     ATSGGSGFRGSRKSTPFAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNS
                     CGYKIASITDVTPIPHNGCRPPKKRRV"
     CDS             587677..588297
                     /codon_start=1
                     /gene="rpsD"
                     /locus_tag="PP4_05110"
                     /product="30S ribosomal protein S4"
                     /protein_id="BAN52364.1"
                     /transl_table=11
                     /translation="MARYIGPKCKLSRREGTDLFLKSGVRALESKCNIEAAPGIHGQR
                     RGRQSDYGTQLREKQKVRRIYGVLERQFRGYYQAAASKKGATGENLLQLLECRLDNVV
                     YRMGFGSTRSESRQLVSHKAISVNGKTVNIPSYQVRPGDVVAVREKSLAQLRIVQALE
                     LCAQRGRVEWVDVDAAKKSGVFKNVPARSDLSADINENLIVELYSK"
     CDS             588320..589321
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoA"
                     /locus_tag="PP4_05120"
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="BAN52365.1"
                     /transl_table=11
                     /translation="MQISVNEFLTPRHIDVQVVSPTRAKITLEPLERGFGHTLGNALR
                     RILLSSMPGCAVVEAEIDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHGRDEVTLTL
                     SKKGSGVVTAADIQLDHDVEIVNPDHVIANLASNGALNMKLTVARGRGYEPADSRQTD
                     EDESRSIGRLQLDASFSPVRRIAYVVENARVEQRTNLDKLVIDLETNGTLDPEEVIRR
                     AATILQQQLAAFVDLKGDSEPVVVEQEDEIDPILLRPVDDLELTVRSANCLKAENIYY
                     IGDLIQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASLKKDDKATA"
     CDS             589364..589750
                     /codon_start=1
                     /gene="rplQ"
                     /locus_tag="PP4_05130"
                     /product="50S ribosomal protein L17"
                     /protein_id="BAN52366.1"
                     /transl_table=11
                     /translation="MRHRKSGRHLSRTSSHRKAMFQNMAVSLIEHELIKTTLPKAKEL
                     RRVAEPLITLAKEDSVANRRLAFDRTRSKSAVGKLFNDLGKRYATRQGGYLRILKCGF
                     RAGDNAPMAYVELVDRPVGGAVEAAE"
     CDS             589922..591361
                     /codon_start=1
                     /gene="katA"
                     /locus_tag="PP4_05140"
                     /product="catalase"
                     /protein_id="BAN52367.1"
                     /transl_table=11
                     /translation="MSKILTTASGAPVADNQNSRSAGPRGPLLLDDFHLIEKLAHFNR
                     ENIPERRVHAKGSGAYGTFTVNRDITHYTSAKLFEQIGKQTDTFLRFSTVGGERGSAD
                     TERDPRGFAVKFYTEEGNWDIVGNNTPVFFIRDPLKFPDFIHTQKRHPQSNLKNAQMM
                     WDFWSHSPEALHQVTILFSDRGIPDGYRHMHGFGSHTYSLINAKGERTWVKWHFKTQQ
                     GIKNLAPADAARLAGTDPDYAQRDLFEAIERGDYPRWTVCIQVMSEAEAASRDENPFD
                     VTKTWSQKDYPLIEVGVLELNRNPLNYFAEVEQAAFGPSNMVPGVGLSPDRMLQGRVF
                     AYADAHRYRVGTNHQHLPVNAPRCAVNSYQRDGSMATGSYGSAPNYEPNSYAEAPKQS
                     PRHAEPALALNGSADRYDHREDTDYFSHAGALFRLMSDEQKALLISNIAGTMAGVSED
                     VIQRQLQYFFKADPAYGEGIAKALGINLA"
     CDS             591525..591989
                     /codon_start=1
                     /gene="bfrA"
                     /locus_tag="PP4_05150"
                     /product="bacterioferritin A"
                     /protein_id="BAN52368.1"
                     /transl_table=11
                     /translation="MQGHPDVINYLVTLLKGELAARDQYFIHSRMYEDWGLSKLYERI
                     NHEMEEETQHADALMRRILMLEGTPDMRADDLEVGSTVPEMIEADLKLEYKVRGALCK
                     GIELCELHKDYVSRDILRAQLADTEEDHTYWLEKQQGLIKAIGLENYLQSQM"
     CDS             complement(592059..594893)
                     /codon_start=1
                     /gene="uvrA"
                     /locus_tag="PP4_05160"
                     /product="UvrABC system protein A"
                     /protein_id="BAN52369.1"
                     /transl_table=11
                     /translation="MDKILIRGARTHNLKNIDLTLPRDKLIVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSMMEKPDVDTIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIYDYLRLLYARVGTPRCPDHDIPLEAQTISQMVDLVLERPEGSKLMLLAPVVRERKG
                     EHLAVFDELRAQGFVRARVNGKLYELDELPKLDKQKKHSIDVVVDRFKVRADLQQRLA
                     ESFETALKLADGIALVAPMDDEEGEEMIFSARFACPVCGHAISELEPKLFSFNNPAGA
                     CPTCDGLGVKQFFDTKRLVNAELTLAEGAIRGWDRRNVYYFQMLGSLAAHYGFSLEEP
                     FGELSAEHQKVILQGSGKQTVDFKYLNDRGDIVKRSHPFEGIVPNLERRYRETESATV
                     REELAKFLGTQPCPDCRGTRLRREARHVWVGEKTLPAVTNLPIGEASNYFGELTLTGR
                     RGEIASKILKEICERLQFLVNVGLDYLTLDRSADTLSGGEAQRIRLASQIGAGLVGVM
                     YILDEPSIGLHQRDNDRLLATLNHLRDLGNTVIVVEHDEDAIRLADYVVDIGPGAGVH
                     GGQIVAEGTPQEVMDHPDSLTGKYLSGRKKIVVPAKRTPRNKKLQLKLKGARGNNLQN
                     VDLEVPIGLLTCVTGVSGSGKSTLINNTLFPLAATALNGASTLEAAPHSSMDGLQHLD
                     KVVDIDQSPIGRTPRSNPATYTGIFTPIRELFSGVPESRSRGYGPGRFSFNVKGGRCE
                     ACQGDGLIKVEMHFLPDIYVPCDVCKSKRYNRETLEIKYKGKNIHEVLEMTIEDAREF
                     FDAVPALARKLQTLMDVGLSYIKLGQSATTLSGGEAQRVKLSRELSKRDTGKTLYILD
                     EPTTGLHFADIQQLLDVLHRLRDHGNTVVVIEHNLDVIKTADWLVDLGPEGGSKGGQI
                     IACGTPEELSGMKQSYTGHYLKPLLERDRA"
     CDS             595023..596417
                     /codon_start=1
                     /locus_tag="PP4_05170"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAN52370.1"
                     /transl_table=11
                     /translation="MHDTHNERMSGGETRAAGGLALVFAFRMLGMFMVLPVLATYGMD
                     LAGATPALIGLAIGAYGLTQAVLQIPFGMISDRIGRRPVIYLGLVIFALGSVLAAQAD
                     SIWGVIAGRILQGAGAISAAVMALLSDLTREQHRTKAMAMIGMSIGLSFAVAMVVGPL
                     LTSAFGLSGLFLATAGLALVGILLVAFVVPNSHSILQHRESGVARQAIGPTLRHPDLL
                     RLDVGIFVLHAILMASFVALPLAFVERGGLPKEQHWWVYLTALFISFFAMVPFIIYGE
                     KKRKMKRVLAGAVSVLLLTEIYFWEWADGLRGLVIGTVVFFTAFNLLEASLPSLVSKV
                     SPAGGKGTAMGVYSTSQFLGAALGGILGGWLFQHGGLNMVFLGCAVLCAIWLVVALRM
                     NEPPYVTSLRMPLTPEAVREAGLTERLMAVPGVTDAVVVAEEAAIYIKLDTKILDRTT
                     LERLVNPASSACEA"
     CDS             596427..596978
                     /codon_start=1
                     /gene="ssb"
                     /locus_tag="PP4_05180"
                     /product="single-stranded DNA-binding protein"
                     /protein_id="BAN52371.1"
                     /transl_table=11
                     /translation="MARGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWTDKQ
                     SGQKVERTEWHRVSLFGKVAEIAGEYLRKGSQCYIEGKLQTREWEKDGIKRYTTEIIV
                     DINGTMQLLGGRPQGQQQGGDPYNQGGGNYNQGGGQQQQYNQAPPRQQAQRPQQAPQR
                     PAPQQPAPQPAADFDSFDDDIPF"
     CDS             complement(597180..598616)
                     /codon_start=1
                     /locus_tag="PP4_05190"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAN52372.1"
                     /transl_table=11
                     /translation="MLGFRALADSGAISMWVPHYSDLAQPVYLMIADALEQDIGNGRL
                     APGDRLPTLKDLAESLQVTPGTIGRAYDEAAKRGLVVGEVGRGTFVLQQRPAPAPAPT
                     APLRPAALKHESGQIDLSIIKPNDAHMADWLRRAITELASSPDLDQVLDYVTDGGHAT
                     HKQAGATWIQRWLPDARAQQVVLTSGAQHGLLVAISSLSKGDDVILCESLCYPGIISL
                     AHSMGRRLRGVAMDEHGLIPESLRAACQEHRPSLLVCVTTHQNPTNSVMPHARREAIA
                     QIAREFDLFIVDDDIYGFLEPAPDYKPLAAYAPERSVYLTSLSKSVLPALRIGYLYAP
                     PQTLSRLSSMVRSSVWMPSPLMAQLASNLINSGTADQLVREQQEEAAARQLMAQEILG
                     RYKIRSQPNSFHIWLELPEPWTSDEFANLARNNGVTVVSGSQFLPERTPTSCGVRIAL
                     MTPSRAELSFALTKLASLLDSSEPRLFY"
     CDS             598985..600010
                     /codon_start=1
                     /locus_tag="PP4_05200"
                     /product="hypothetical protein"
                     /protein_id="BAN52373.1"
                     /transl_table=11
                     /translation="MESAHLQQAAEPQTSLEIRLPWVVSSAWQTLLSNTPLDFETSKE
                     LYPQLKEQAQEVLGKALCQQIRGFVEDPQLTSMIVRNCPRDRDVPPTPYSGVLSPRST
                     PIACLVSLTMQNLMGINPVVYEGENDGRLFRHVIPARTSSSQKSSHGSRLRFSYHVDN
                     PDLPLSSEPLGSVSCCPEYLSFFGMRCDPRISTTLVNLDAVIASLPLATVRELCEAQF
                     EIRRPDSFTGNRRCTAELPVLVRGHSGEWLCRFDSENTHGLNLRAEQALATLRVLLET
                     RRFDEPHLLLPGDFMIFKNQRVLHARDGFEPQNDGADRWLLRVFAVNDLNRVRFARAD
                     HLYEVLS"
     CDS             600042..600827
                     /codon_start=1
                     /locus_tag="PP4_05210"
                     /product="hypothetical protein"
                     /protein_id="BAN52374.1"
                     /transl_table=11
                     /translation="MELLGAYWAEHWLLAILLLGAIAFVAGFVDSIAGGGGLFLVPGF
                     LLVGMPPQVALGQEKLVSTLGTLAAIRNFLANSKMVWQVALVGVPFSLLGAYLGAHLI
                     VSISQETVGKIILALIPFGILIFLTPKDRPIEERVLSARMLYTVVPLTCLAIGFYDGF
                     FGPGTGSMFIIAFHYLLRMDLVSSSANSKTFNFASNIGALVAFIMAGKVVYLLALPLV
                     ACNILGNHMGSALALRKGNDVVRKVLVFSMLCLFTSLGVKYLV"
     CDS             600852..601613
                     /codon_start=1
                     /locus_tag="PP4_05220"
                     /product="putative oxidoreductase"
                     /protein_id="BAN52375.1"
                     /transl_table=11
                     /translation="MKTAFVTGASSGFGRAICRTLVAKGYRVIGGARRLDKLQALEHE
                     LGDNFIPLALDVTDGQSISAAVAQINEAASSINVLVNNAGLALGIERAPACSAENWQR
                     MIDTNITGLAMVTHAVLPQMVEADSGMIINMGSIAGTYPYPGGNVYGASKAFVRQFSL
                     NLRADLAGTRVRVSNIEPGLCSGTDFSVVRLNGDLNAVDALYRDVQAILPEDIAATVA
                     WIAEQPPHVNINTLEIMPVAQSSAALNVARNLPLC"
     CDS             601742..604810
                     /codon_start=1
                     /gene="fdoG"
                     /locus_tag="PP4_05230"
                     /note="contains selenocysteine"
                     /product="formate dehydrogenase O alpha subunit"
                     /protein_id="BAN52376.1"
                     /transl_except=(pos:602330..602332,aa:Sec)
                     /transl_table=11
                     /translation="MDLNRRQFFKVAAVGLGGSSLAALGMAPTPAFAEQVRHFKLAHT
                     KEARNTCPYCSVGCGLILYSQGDAGKNVKQSIIHIEGDADHPVNRGTLCPKGAGLLDF
                     IHSPSRLQYPEVRKPGSKEWVRVSWDEALDRVADLMKQDRDANFIEKNAQGQTVNRWL
                     TTGFLAASAASSEAGYLTHKVVRATGMLGFDNQARVUHGPTVASLAPTYGRGAMTNHW
                     SDIANANLVLVMGGNAAEAHPCGFKWVTEAKAHNKARLIVVDPRFTRTASVADYYAPI
                     RTGTDIAFMGGLINYLLSTDKIQHEYVRNYTDVSFIVKESYGFEDGLFSGYDEAKRVY
                     ADKSGWGYELGEDGFAKVDPTLQHPRCVFQLMKQHYSRYTPELASMICGMPQDAMMKV
                     WEEIATCSVPGKTMTILYALGWTQHSIGAQIIRSAAMVQLLLGNVGMPGGGVNALRGH
                     SNIQGLTDLGLLSNSLPGYLTLAGDAEQDYATYIDKRASKPLRPGQLSYWQNYGKFHV
                     SLMKAWYGANATAENNWGYDWLPKLDVPAYDVLRMFEMMSQGKVNGYVCQGFNPIAAL
                     PDKNRVTAALGKLKWLVIMDPLATETSEFWRNAGPFNDVDTASIQTEVIRLPTTCFAE
                     EDGSLVNSSRWLQWHWKGADGPGETRTDVQIMSELFLRMRQRYQAEGGAYPDAIMNIS
                     WPYRIPEEPSPEELAKEMNGWAVTDLTDATGATLKAGQQLSGFGQLKDDGSTASGCWI
                     FAGSWTEQGNQMARRDNSDPYGMHQVQNWAWAWPANRRILYNRASSDPQGKPWDPEKK
                     RLVWWNGKAWTGTDVPDFKVDSPPEAGMNPFIMNPEGVARFFAIDKMAEGPFPEHYEP
                     FETPIGINPLHPQNKKVVSNPAGRIFDSVWDTLGTHDEFPYAATTYRLTEHFHFWSKH
                     CRLNAIAQPEQFVEIGEVLANEKGIKAGDRVRVSSKRGHIDAVAVVTKRIRPLQVNNQ
                     TVHQIGIPLHWGFTGATRHGYLTNTLVPFLGDGNTQTPESKSFLVKVEKL"
     CDS             604810..605760
                     /codon_start=1
                     /locus_tag="PP4_05240"
                     /product="formate dehydrogenase beta subunit"
                     /protein_id="BAN52377.1"
                     /transl_table=11
                     /translation="MASQDIIARSATTTVPPSVRQQQEVAKLIDTTKCIGCKACQVAC
                     SEWNELRDEVGHNHGTYDNPQDLTAETWTLMRFTEHERDDGNLEWLIRKDGCMHCADP
                     GCLKACPSPGAIIKHANGIVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCTLCS
                     DRVSVGLEPACVKTCPTGAIVFGSKDEMKVHAAERIVDLKSRGYDKAGLYDPDGVGGT
                     HVMYVLHHADTPRLYAGLPDQPVISPLVGLWKGFTKPLALLAMGAAVLAGFFHYVRVG
                     PQRVEEDEHPAPPDDSVHQVDPAVHVYDPKQPGGQGEQRP"
     CDS             605757..606413
                     /codon_start=1
                     /locus_tag="PP4_05250"
                     /product="formate dehydrogenase gamma subunit"
                     /protein_id="BAN52378.1"
                     /transl_table=11
                     /translation="MNDNKPILRYNANERTNHWIVAILFFMAGLSGLALFHPALFWLS
                     HLFGGGPWTRILHPFMGVAMFVFFLGLVFRFWRANFITANDRLWLRRIDRVMVNREDG
                     VPPIGKYNAGQKLLFWTLLLCMLVLLISGVVIWRAYFSHFFDIGSIRLASLAHALAGF
                     VLILSIIVHIYAGIWIKGSIGAMLHGWVSRAWARKHHALWYREVTGDKTPGNHGRKEG
                     "
     CDS             606418..607344
                     /codon_start=1
                     /gene="fdhE"
                     /locus_tag="PP4_05260"
                     /product="formate dehydrogenase accessory protein FdhE"
                     /protein_id="BAN52379.1"
                     /transl_table=11
                     /translation="MSTILEPGQIEASAVAPPFLHLPPANLFELRAARLEQLADGNAL
                     GDYLRLIAQLCRIQQQLLGNPPGGMPVAEERQRLCISHGLPPLAADSLVREGPWLVWL
                     QALLEHCSGATGGPLGEALQVLRSSDDHQRKGWGIALLAGQYDAVPAALVPFLGAALQ
                     AAWSSWLLALPAPELKPAGSLAQCPACGSPAMAGVVRNRGKHNGLRYLACSLCACEWH
                     VVRVKCVYCESSKDLRYTSLEDDRHAPGKAPLRAECCPGCSTYLKQNYLENDAAAEPL
                     ADDLASLVLDMRLDEEGFHRLAPNLMLAPGSG"
     CDS             607466..608893
                     /codon_start=1
                     /EC_number="2.9.1.1"
                     /gene="selA"
                     /locus_tag="PP4_05270"
                     /product="L-seryl-tRNA(Sec) selenium transferase"
                     /protein_id="BAN52380.1"
                     /transl_table=11
                     /translation="MSSSLASHTLRLPSIDTLLRHPAGLALIDRHGRDAVLSTLRQLL
                     DDLRAPARNGELTPAELAPEILLGRTGERLAVQQRSQVRRVLNLTGTVLHTNLGRALL
                     PEEAIEAMQTAARYPLNLEFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVL
                     LALNSLGARKEGIISRGELIEIGGAFRIPDIMARAGVKLHEIGTTNRTHARDYEAAIG
                     PRTGLLMRVHCSNYSIQGFTTQVPTAELARIAHQHELPLLEDLGSGSLLDLTRWGLPA
                     EPTVRQALADGADIVTFSGDKLLGGPQAGIIVGRKDLIARIKKNPLKRALRVDKITLA
                     ALEAVLALYRNPDRLAERLPSLRLLTRSQAEIQAQAERLAPGLKAHLGEQWAVSVEPA
                     LGMIGSGSQPVARLPSAALCLRPQVSKKLRGRSLHVLERALRELPVPVLGRIDDDALW
                     LDLRQLDDELQWLAQLPALQLGPVQ"
     CDS             608890..610812
                     /codon_start=1
                     /gene="selB"
                     /locus_tag="PP4_05280"
                     /product="selenocysteine-specific elongation factor"
                     /protein_id="BAN52381.1"
                     /transl_table=11
                     /translation="MIVGTAGHIDHGKTALLQALTGQAGDQRQEERARGMTIDLGYRY
                     AALAEGAPLTGFIDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMPQTREHLAIIEL
                     LGIPQALVAISKCDRVEPARLAEVRAQVSELLAPGPYAGARQFPVSSINGEGIDALRQ
                     ALLEAEAAVRKRSAGGGFRLAVDRAFAVTGAGVVVTGTALAGRVSAGDTLLLGKAGKP
                     VRVRGLHAQNQAALVAEAGQRVALNITAERLAMEQVHRGDWLVPEWLHAPSVRVDIEL
                     NLLPGEPRTFEHFSAVHVHLGTQDVTARVALLEGESLAAGQRMFAQLLLNAPLQAVHG
                     DRLVLRDQRAQRTLGGGKVLDPFAPSRQRRSDERLRQLQVLRDADDLEQALPALLASA
                     PGGIDPQRLERQFNRLRATWQLPEGVLVVATRQGQLLFANAQWQALKQQVLEHLARFH
                     EQEPDQLGPDRDRLRRFAALPLERPAFVSLLDELLDDGAIASSGPWLHLPDHKVQLSE
                     ADSALWARLQPKLLAGQYDPPWVRTLATEENCAEADVRLLLRKLARLGVVHQVVRDLF
                     YPEATLQRMAELLRGQASETPIVQVAAFRDMLGIGRKRSVQILEYFDRIGLTRRVADQ
                     RHIRADSALAQQQARH"
     CDS             complement(611021..612010)
                     /codon_start=1
                     /gene="ansA"
                     /locus_tag="PP4_05290"
                     /product="L-asparaginase I"
                     /protein_id="BAN52382.1"
                     /transl_table=11
                     /translation="MRAVKNLLVLYTGGTIGMLETPEGLAPAGGFEARMREHFAKMAD
                     APQVHWSLQELNPLLDSANMQQHNWLAMRDAIVEAVDVAGHDGVLVLHGTDSMAYSAA
                     ALSFLLLGLPVPVLLTGSMLPAGAADSDAWANLCGALRQFEQGLENGVQLYFHDQLLH
                     GCRASKLRSEAFDAFAALPRHRDGERAGAIPAELGYKHPRQPVNLAIVPVFPGLQAGH
                     LQALIDSGVQGLLLECYGSGTGPSDDQALLNVLRAARQRGVMLAAISQCPEGSVVFDT
                     YAAGNRLRGAGLVSGGGMTREAALGKMVALLGAGLDVDTAEQWFALDLCGERA"
     CDS             complement(612083..613525)
                     /codon_start=1
                     /locus_tag="PP4_05300"
                     /product="amino acid transporter"
                     /protein_id="BAN52383.1"
                     /transl_table=11
                     /translation="MLEVLNDFLSGKLLIVLIVGLGSYFTIRSRFVQFRHFGHMFTVF
                     KESLRGQAGQLSSFQALMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMSS
                     SFFECTLAQVYKRADGDGLYRGGPAYYIQHGLKRKSMAIVFSILLLVTYGFAFIGLQS
                     YTVTHSLQNAFDFAPSQTGIVLAVLLAITFIGGIKRIAAVSDLLVPIKTLAYIGVTLY
                     VIGTQIEHVPAMLETIFKSAFGLDPAFGGLLGSAIVMGVKRGVFANEAGLGSAPNVAA
                     VAAVKHPGAQGVVQAFSVFLDTFVICTCTALLILLSGFYTPGFEGDGIVLTQNSLAAV
                     VGDWGRVFVSVALSLFVFTCILYNYYLGENSLQFLTRNRVVLMVFRGLVLALVVWGSM
                     QDLSTVFAFADITMTCLAFVNLVALALLFKVGLRVMRDYDDQRKAGIGQPVFDSSKFT
                     DLDLDRNAWPANPQVETAADKAAVQAQPQR"
     CDS             613704..614513
                     /codon_start=1
                     /locus_tag="PP4_05310"
                     /product="putative transcriptional regulator"
                     /protein_id="BAN52384.1"
                     /transl_table=11
                     /translation="MSDHFATNLKLACSHYRSISEVCRQLSINRAQFNKYLSGQSRPT
                     AFNLKRIGDFFGVEDYELNLPAEQFARLIGARVSTLAEQPSDPISELFRPLHDHAGNL
                     SRYCGYYFEYSNCMSVPGTILVSLVHLWEERGRFLFERQERQERSSATDQHAEVRCRY
                     LGAAFQLQDRVFLIDYESLTFNEMSQTILIPSFKSRITRLNGLKAGVSSGDRRNPACT
                     RVVWEYLGEEINRINAYRQVKLYRPDDPRIDDDVRERLSVGPLRNSLFEIE"
     CDS             complement(614525..615370)
                     /codon_start=1
                     /locus_tag="PP4_05320"
                     /product="hypothetical protein"
                     /protein_id="BAN52385.1"
                     /transl_table=11
                     /translation="MHLQKGSSQRLKWQFDEPAPGKELFINEAFGNYQQQARLLVPDT
                     ERAAPALVLGGARSDFTRLNPLLYRLQAAGIGSLTGNLSGHSLASEPGAVAPSLATNL
                     KEAQRFHTHIAPRCRTLIGHSLGAAITLKLAARLPQVDRIVLICPAVYPDDALRAPFG
                     PAFTTAISKPYGFLDSDSYAFLKQFQGRVLMVIGEYDGLNSQRFGKGPGTSAGSLWLA
                     GAERYSPIPEEVTQALMQSVPAARLQCLFLTDCDHGIASHLRSTPAIADQVASAVAGF
                     ILEDA"
     CDS             complement(615379..616170)
                     /codon_start=1
                     /gene="yfcA"
                     /locus_tag="PP4_05330"
                     /product="hypothetical protein YfcA"
                     /protein_id="BAN52386.1"
                     /transl_table=11
                     /translation="MIEFDLTLVLILALVALMAGFFDAIAGGGGLITLPVLFIAGIEP
                     LAAIATNKVQAASATVSATCAFARKGMIDWRRGSPMAVMSFIGGALGALSITYVPKSF
                     LQACVPPLLILIAIYFAFSPKPNEQTRKAKLSSSLFCVTVAPIIGFYDGIFGPGVGSF
                     FMLACVVLLGQQLIQAVCTSKLLNAACNLGALSVFLLSGAIIWPLALAMAIAAFLGAQ
                     LGARCAVRFGSRLIKPLLVSVCIIMAFKLLLDTGNPLGEWLDQFF"
     CDS             complement(616186..617226)
                     /codon_start=1
                     /locus_tag="PP4_05340"
                     /product="hypothetical protein"
                     /protein_id="BAN52387.1"
                     /transl_table=11
                     /translation="MPHPEAAYLDFRPDQSRAIALASQTIADLGGPEAKGAAFEARAF
                     ADQLEKGLDEKQRSLLQRFDEGNVSTLMFRQMRCADEPIPEHLPEICDLAQSPRCLYL
                     ASRNQLLLELARHRSFAFDIDNEGKQVRLVGNFKGGGRIPRPNEAPCLTVETSSHAGL
                     YLGPHTEAPYNCSTIARNGHSPAPSALILTARWNPANEPTHVFPLREIIECLSSLDTL
                     ALTSRSFDFTRSDCFAKGKGNAGKEVSILQFEPNGGFSIRYNSYRFRLSDRACSAAAR
                     AFTTFQKKLDNAQPLAFVLQPDSALLVNNSRALHGRDRVQDNRRLLIRQFGYSPLAEP
                     LVLVEDPLLVRG"
     CDS             617489..618373
                     /codon_start=1
                     /locus_tag="PP4_05350"
                     /product="putative oxidoreductase"
                     /protein_id="BAN52388.1"
                     /transl_table=11
                     /translation="MRMRLMLLGGGNALGQALIRLGAEEDIAFLAPRPPENGWTPANL
                     TQLLDDHRPDALVNLAYYFDWFQAESVSEQRLAQQERAVERLAELCQHHQITLVQPSS
                     YRVFDGSRATAYSEKDEPVPLGLRGQALWRIEQSVRATCPQHVLLRFGWLLDESIDGS
                     LGRFLTRAEQPQELLLADDRRGNPTPVDDAARVILSVLKQLDCSAPLWGTYHYAGNEA
                     TTPLALGQAILTEAGQYRQLAVQAPTPQAHAARPDASEEPQNAVLACKKILHTFGIKP
                     RAWRAGLPPLLDRFYRHG"
     CDS             618366..619298
                     /codon_start=1
                     /locus_tag="PP4_05360"
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="BAN52389.1"
                     /transl_table=11
                     /translation="MADAPILITGGAGFIGSHLCDALLDKGYAVRILDDFSTGRRSNL
                     QVDHPRLELIEGDVADAGLVTQAAAGCSAVVHLAAVASVQASVEDPVRTHQSNFIGTL
                     NVCEAMRVHGLRRVLFASSAAVYGNNGEGESIAEDTPKAPLTPYAVDKLASEQYLDFY
                     RRQHGLEPVVFRFFNIFGPRQDPSSPYSGVISIFCERAVQGLPITIFGDGEQTRDFLY
                     VGDLVQVMVQALEQPQVEEGAVNIGLNQATSLNQLLVALEKVVGSLPAISHVAARSGD
                     IRHSRADNQRLLARFEFPQATPMVEGLARLLGKS"
     CDS             complement(619431..619874)
                     /codon_start=1
                     /locus_tag="PP4_05370"
                     /product="putative HxlR family transcriptional regulator"
                     /protein_id="BAN52390.1"
                     /transl_table=11
                     /translation="MLDENNAQCPVARALEVLGDRWALMILRDAFDGLRRFSEFQKNL
                     GLAKNILASRLKLLVESGLLMTQPASDGSAYKEYVLTEKGLSVFPVVVGLRQWGELYL
                     FEAGEARSELVEGVTGRALETLQVRALDGRVLGAEDCLRRVVRHG"
     CDS             619976..621181
                     /codon_start=1
                     /locus_tag="PP4_05380"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAN52391.1"
                     /transl_table=11
                     /translation="MTSALTRGLTLLLAITSAMAVATVYFAQPLLESMAADLGVVQQQ
                     IGWVVGVTQAGYALGLLLIVPLGDLIDRKRLLLGQLLFSALALVGVGMAPNWAMLLLA
                     LAITGLMAVMVQIMVAHAASLASPGEQGQAVGTVTSGVVLGILLARLVAGGLADLAGW
                     RSVYLVAAGLLTLLALVLWRSLPGGQPLVHRPGYRALIVSQFRLYREDRLLRQRGVFG
                     VLIFAAFSVLWSAMVMPLSAAPLALSHTEIGLFGLAGVAGTLAAARAGRLADQGQGER
                     TTGLALALLTLSWLPTAFVGLSLMAFVLGVLMLDFAVQAVHVTNQSLLLAGRGAMASR
                     LIGAYMCCYSLGSGLGAVLASWVHARWGWAAVCGLGMAFSAAALGYWLWLQRARAAEA
                     ALQCSGQNL"
     CDS             complement(621169..621852)
                     /codon_start=1
                     /gene="oprG"
                     /locus_tag="PP4_05390"
                     /product="outer membrane protein OprG"
                     /protein_id="BAN52392.1"
                     /transl_table=11
                     /translation="MNKSLLGASLVALALAAPAAHAYQAGDMILRAGAITTAPNESSG
                     DLKFDGNKVSGTKATLDSDTQLGLTFAYMLTDHIGLELLAATPFKHTVGVKGLGGGLD
                     GKLADIKQLPPTLSLQYYPMEPNSRFQPYAGVGINYTLFFDEDLSSARKQQGFSNLKL
                     QDSVGIAGQLGMDYMLTENLLVNASVWYVDIDTKASVNGPTALGYSKTKVDVDVDPWV
                     YMVGLGYKF"
     CDS             complement(621962..622474)
                     /codon_start=1
                     /locus_tag="PP4_05400"
                     /product="hypothetical protein"
                     /protein_id="BAN52393.1"
                     /transl_table=11
                     /translation="MRMLLALLLLVAMPLWAAEPKELDWPALIPEGAPVIPPQLAPLH
                     DMSQLSNALSAESAPAARQQAPDAPVVKGLDGQQVKLPGYIVPLEVSEEGRTTEFLLV
                     PYYGACIHVPPPPSNQIVHIFSEMGVRVEDLYQPYWIEGKMQVRASSSELADAGYQME
                     AEKIYVYELR"
     CDS             complement(622601..623866)
                     /codon_start=1
                     /locus_tag="PP4_05410"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAN52394.1"
                     /transl_table=11
                     /translation="MYLLRLALASLANRRFTAFLTAFAIALSVCLLLAVERVRTEARA
                     SFASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSFEHYAQDPRVKWAIPIS
                     LGDSHRGYRVMGTTTDYFSHYQYGRRQHLEMSQGREFASDPFEVVLGAEVAEALHYKL
                     GDKLVLAHGVAAISLVKHDDKPFTVVGVLKRTGTPVDRTLHIGLGGMEAIHIDWHNGV
                     PARGAGRISAEQARTMDLQPAAITAFMLGLNNKIATFSLQREINEYRSEPLLAILPGV
                     ALQELWSLMGTAEQALFVVSLFVVLTGLIGMLTAILTSLNERRREMAILRSVGARPWH
                     IAGLLILEALSLAAVGIVAGLGLLYAGIALAQGYVQANYGLYLPLALPSAHEWTLLAI
                     ILGAALLMGSVPAWRAYRQSLADGLSIHL"
     CDS             complement(623866..624576)
                     /codon_start=1
                     /locus_tag="PP4_05420"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAN52395.1"
                     /transl_table=11
                     /translation="MSQPLIELHDLVFGWPGQPPLLDIPAFHLDAGEALFLKGPSGSG
                     KTTLLGLLGGVNVPAQGRIQLLGQDLGKLGQGARDRFRVDHTGYIFQQFNLLPFLSVR
                     ENVELPCRFSHSRKARAEQRHGSVDQAAGTLLAHLGLGDPALLARRADSLSIGQQQRV
                     AAARALIGQPELVIADEPTSALDADTREAFIRLLFDECRAAGASLLFVSHDQSLAPLF
                     DRHLSLADLNRAAKPREA"
     CDS             complement(624577..625146)
                     /codon_start=1
                     /locus_tag="PP4_05430"
                     /product="hypothetical protein"
                     /protein_id="BAN52396.1"
                     /transl_table=11
                     /translation="MRRLLLALPFALLPLAVAHAHDDHDHDHGTLGAHEHGVAKLNVV
                     LDDNTLELELDSPAMNLVGFEHAASSDADKAKVAAVRQQLEQPLKLFGLSAAANCKEE
                     QQELESPLFGDALKADDEGDEHAHGHQHSDIGAHYQLTCANPDKLAQVDLAPLFKAFP
                     ATQKINVQLIGPNGQKGVETTPAKAAVAF"
     CDS             625277..625639
                     /codon_start=1
                     /locus_tag="PP4_05440"
                     /product="hypothetical protein"
                     /protein_id="BAN52397.1"
                     /transl_table=11
                     /translation="MRIRGQIGDWPVDLTIELEPAEWAQLGRQIEGQAPPPGGTVSAA
                     VVPAPRQDDGQWAAALEMLRQAGRLSGPELLESLTGLAGSPAAGKRLLVRLRHCAQVR
                     VLAGEDAPLYCWQENANG"
     CDS             625741..627279
                     /codon_start=1
                     /locus_tag="PP4_05450"
                     /product="hypothetical protein"
                     /protein_id="BAN52398.1"
                     /transl_table=11
                     /translation="MHTQNAPAAQQYDLRGWRTHFVFDAEKLNAFCLHYYEGRLDTAH
                     TDAVDFVHQRPTGWLTTRCVLGSPLPEFPTGDGETITVARRFVSYTSYEFHREHGAQY
                     ADIVELVAGSRNERRALFQTFRLDQCVGTYQYNDDTIFTLSAGSDFSVGFLGFPERDT
                     DAGLPFKIRFDKLPAGEKIVVLPKTADVTYGKWLMQDIRFYLRRVPGQLSHVMYIANA
                     GDGDGIIPASMEDECEQGPATAEDALGYCYVRSTDIPAEGFYGRDFEELAQILFPLGR
                     VAYTDFDWGDPVAKATLVEPSTGLETPLPDASVYSSHIDPLVRIVSAGSAGQRLVLNT
                     VNPAAPIWEFTSPAVGQLVPNGRSCDYIPQDEGGVIYGENPLTGQEAALLSSMTRNPV
                     DIVRILSGFALLPYFSTMVVLNARPTHYFKLDTVGGQLQLTLLYKPWGGGETVVPPEL
                     VEWKVLAGDGKVSDGIFSPGTMNRFSVVQAIHRDPDYLLFAVIIIPMPLLTAAEFVAM
                     RNGG"
     CDS             complement(627345..628217)
                     /codon_start=1
                     /locus_tag="PP4_05460"
                     /product="putative thioredoxin"
                     /protein_id="BAN52399.1"
                     /transl_table=11
                     /translation="MTQDTPYIFDATDATFQQLVIENSFHKPVLVDFWAEWCAPCKAL
                     MPLLAKITEGYQGELLLAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPE
                     SAIRAMLEPHVQMPAAPTASPLEQAKALFAESRFAEAEALLQALLGEDNSNAEALILY
                     ARCLAERGELGEAQVVLDAVKTDEHKAALAGAKAQLTFLRQAASLPEVADLKSRLAQN
                     PQDDEAAYQLSIQQLARQQYEAALDGLLKLFQRNRGYENGLPQKALLQVFELLGGDHP
                     LVGVYRRKLSAAMF"
     CDS             complement(628249..628908)
                     /codon_start=1
                     /locus_tag="PP4_05470"
                     /product="hypothetical protein"
                     /protein_id="BAN52400.1"
                     /transl_table=11
                     /translation="MAPLALQQALGGLIGEARLIVSELPGCDLKLWLIDDQNMDRAFS
                     SDETRRILEEPPYWSFCWASGLAMARYLAERPEWVAGKRVLDFGAGSGIAGIAAARAG
                     ALEVVACDLDPLALHACRANAALNGVALSYSSDFFAEDDRFDLILVADVLYDRANLPL
                     LDAFLSRGRQALVADSRVRDFSHPLYQQLGVLEALTLPDLAEPHEFRRVSLYHASRDA
                     L"
     CDS             complement(628909..629361)
                     /codon_start=1
                     /locus_tag="PP4_05480"
                     /product="hypothetical protein"
                     /protein_id="BAN52401.1"
                     /transl_table=11
                     /translation="MHYRALVVLCCAALLAACGSDRPKTDTPPAPTPTRSAKPAEVLG
                     PLPAYQRELSGTLLEIPAGADVELALLVIDERDRPQRLLASSNLTGTGQALPYHLRFN
                     PEAFPAGARVELRGRASRSGQLIMHLPPVRISQAQTQATGPLRFEKAP"
     CDS             629468..629932
                     /codon_start=1
                     /gene="nrdR"
                     /locus_tag="PP4_05490"
                     /product="transcriptional repressor NrdR"
                     /protein_id="BAN52402.1"
                     /transl_table=11
                     /translation="MHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFTTFETA
                     ELVLPRLIKQDGTRQPFDEDKLRAGMQRALEKRPVSVERLEAALAHIKSRLRATGERE
                     VKSLVVGEMVMAELRKLDEVAYIRFASVYRRFQDLDEFREEIDRLAREPAKE"
     CDS             629935..631065
                     /codon_start=1
                     /gene="ribD"
                     /locus_tag="PP4_05500"
                     /product="diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase/5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /protein_id="BAN52403.1"
                     /transl_table=11
                     /translation="MPSQAAILDAHYMARALELARKGLYTTHPNPRVGCVIVRDGEVV
                     GEGWHVRAGEPHAEVHALRQAGERARGACAYVTLEPCSHHGRTPPCAEALVKAGVARV
                     VAAMQDPNPQVAGQGLRRLAEAGIEVASGVLEAEARALNPGFLKRMETGLPFVRAKLA
                     MSLDGRTAMASGESQWITGPAARSAVQRLRARSSVVLTSAASVLADNARMTVRGAELG
                     LDAETTALALSRTPLRVLVDGRLRLPLDAPFFQAGPALVVTAVADDPRYAAAGHELLS
                     LPGDNGQVDLPALLQALAARGVNEILLEAGAGLVGAFARQGLVDEYQLFVAGTFLGSQ
                     ARPLLDWPLDRMSEAPRLKITEMRAVGDDWRVTAIPLPAPGV"
     CDS             631108..631773
                     /codon_start=1
                     /gene="ribE"
                     /locus_tag="PP4_05510"
                     /product="riboflavin synthase"
                     /protein_id="BAN52404.1"
                     /transl_table=11
                     /translation="MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAV
                     NGVCLTAVELPGNGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGH
                     VDGVGEIISRSDNARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTI
                     VPHTLSETIMADYRAGRRVNLEVDLLARYLERLLLGDKAAEPSKGSGITESFLAANGF
                     LKS"
     CDS             631792..632883
                     /codon_start=1
                     /EC_number="3.5.4.25"
                     /EC_number="4.1.99.12"
                     /gene="ribBA"
                     /locus_tag="PP4_05520"
                     /product="3,4-dihydroxy-2-butanone 4-phosphate
                     synthase/GTP cyclohydrolase II"
                     /protein_id="BAN52405.1"
                     /transl_table=11
                     /translation="MALNSIEELVEDIRQGKMVILMDDEDRENEGDIIMAAECCLPEH
                     INFMAKHARGLICMPMTRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAA
                     DRARTVQAAAAKDAKAEDIVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSG
                     VICEVMNDDGTMSRRAELEVFAAEHGLKIGTIADLIHYRMIHERTVQRVSEQPVESEL
                     GEFNLVTYRDAVEGDVHLALTLGKICAEEPTLVRVHNMDPLRDLLLVKQPGRWSLRAA
                     MAAVAEAGSGVVLLLGHPLDGDVLLAHIRESAGDAPAKAPTTYSTVGAGSQILRDLGV
                     RKMRLMSSPMKFNAISGFDLEVVEYVPSE"
     CDS             632975..633451
                     /codon_start=1
                     /EC_number="2.5.1.9"
                     /gene="ribH"
                     /locus_tag="PP4_05530"
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="BAN52406.1"
                     /transl_table=11
                     /translation="MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHG
                     VSESDITIIRAPGAFEIPLVAQKVAQQGAYDAIIALGAVIRGGTPHFEYVAGECTKGL
                     AQVSMEFGVPVAFGVLTVDSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK"
     CDS             633448..633948
                     /codon_start=1
                     /gene="nusB"
                     /locus_tag="PP4_05540"
                     /product="transcription antitermination protein NusB"
                     /protein_id="BAN52407.1"
                     /transl_table=11
                     /translation="MISDESDRFNPRDPKPADAGKPSKSAKRREARKLATQALYQWHM
                     AQHSLNEIEAQFRVDNDFTDVDGAYFREILHGVPAIKGEIDKALVPCMTMTLEELDPV
                     ELAVLRLSTWEFIKRVDVPYRVVINEGVELAKVFGATDGHKFVNGVLDKLAPSLREAE
                     VKANKR"
     CDS             633967..634935
                     /codon_start=1
                     /gene="thiL"
                     /locus_tag="PP4_05550"
                     /product="thiamine-monophosphate kinase"
                     /protein_id="BAN52408.1"
                     /transl_table=11
                     /translation="MGEFELINHYFAAAPCAQGGEGVALGIGDDCALLALPPGEQLAV
                     STDTLVAGVHFPAVCDPLLLGQRSLAVAASDLAAMGATAIGFTLALTLPDVGPDWLAA
                     YADGLSRMAHRCRMSLIGGDTTRGPLSITVTVFGRVPAGQALRRSGARPGDLLCVGGV
                     LGKAAGALPLVLGEREAPAEQAEPLLAHYWSPMPQLTLGTLLRGRASAALDISDGLLA
                     DCGHIAKASGVALEVNLAQVPVSPAVEAFLGRQAAVQAALTGGDDYVLAFTLPPEALA
                     PLAGLGLVEVHTIGRVLEGQGVTLRDVQGRDITPVQRGYQHFRETP"
     CDS             634932..635435
                     /codon_start=1
                     /gene="pgpA"
                     /locus_tag="PP4_05560"
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="BAN52409.1"
                     /transl_table=11
                     /translation="MTDHPNQVPAEFVPPSVWRNPWHFIAFGFGSGTLPKAPGTWGSL
                     VAIPFIPLWQMLPDWGYWLLLGVSMLFGFWLCGKVANDLRVHDHEGIVWDEIVGMWIT
                     LWLVPEGWQWLLAGFLMFRFFDILKPWPIRWIDRHVHGGVGIMLDDILAGVFAWLGMQ
                     VLVWAVA"
     CDS             635451..636194
                     /codon_start=1
                     /locus_tag="PP4_05570"
                     /product="hypothetical protein"
                     /protein_id="BAN52410.1"
                     /transl_table=11
                     /translation="MAIRTLLLAVLLSVAPWVAAAEGVPKQIHLVSEEWLDYTNADGT
                     GVAWDVLRKVFEPAGVKVVPQSAPYSRAVGLVKRGEADAWVGSYKQENADNLYPRWHF
                     DMDHIYALGLASKPAPTAQNVGKYRLAWVRGYDYGSYLPDVHEYREIQRREGILPMLE
                     HDRVDFYIDAQTEVDYVLSQSSQPERFSRTHVAELPLYLAFARNGQAKALCDLFDKRM
                     DELVRSGELKPIFEHWKQPYPFTADSKPH"
     CDS             636428..637045
                     /codon_start=1
                     /EC_number="3.5.4.25"
                     /gene="ribA"
                     /locus_tag="PP4_05580"
                     /product="GTP cyclohydrolase II"
                     /protein_id="BAN52411.1"
                     /transl_table=11
                     /translation="MPVVFVAASKLPTPFATFTMHGFLDEATGREHVVLSLGDIADGQ
                     PVLGRLHSECLTGDALFSQRCDCGSQLEAALQAIAREGRGVLLYLRQEGRGIGLLNKI
                     RAYELQDGGADTVEANERLGFAADQRDYAICLPMLEHLGVKALRLMTNNPRKVKALTD
                     MNIVVAERVPLHTGHNPHNRYYLATKAGKLGHMLGNEHQGEVPQA"
     CDS             637042..637461
                     /codon_start=1
                     /locus_tag="PP4_05590"
                     /product="hypothetical protein"
                     /protein_id="BAN52412.1"
                     /transl_table=11
                     /translation="MTRAEVKRRLALAWWQYLAMGLVPLPVMAWAFGGGDALIPVLAM
                     PLFIAGAATMFLSLPRFGAYKRALIATSKVLGTGEEPAAWIELARVRRMAMLYACFPA
                     WVAALSVLVGLEAVPQILLALSTVVVLYLYRIPRQLG"
     CDS             637461..638273
                     /codon_start=1
                     /locus_tag="PP4_05600"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAN52413.1"
                     /transl_table=11
                     /translation="MRLLPGLLALFACTVLAADPLRVVSLAPSMTEIMLELRADDLLV
                     GVLDGGERPAALRDLPSVGRQGQLNMERLLSLRPELLLLWPGSVPPAQRDQLKRLGIA
                     TFSAEAHDIDQLIAQIEAIAERIGRAEQGHQYAQALRERLQQLREQYRRDEPLQVFYQ
                     VWDQPLYTLGGRQVVSDALAVCGARNVFADLNQPAPQVNVETVLLRNPQVILAGDPAQ
                     LASWKAWPQLRAVADGRLLVVPDKGLERPSGQMIEATARLCALLAAKAPASR"
     CDS             complement(638251..640098)
                     /codon_start=1
                     /locus_tag="PP4_05610"
                     /product="putative TonB-dependent receptor"
                     /protein_id="BAN52414.1"
                     /transl_table=11
                     /translation="MKAPSFATLLCLPLPLLAAERDDALKLPDVLISASRQVESRTAT
                     SAANTVFTRTDIDRLQPTSVTDLLSRVPGVQVAPTGGRGSLPGIFIRGTKAAQSLVLV
                     DGVRIANATSGDSGLQFLDVDQIERVEVLRGSRSAVYGSDAIGGVIQIFTRRSNGPGL
                     QPRLRMAAGSNQTFQRSLGLSGGDGATRFNLGASLDETAGIDSTGPSFASDGDHDAYR
                     NKAFNLSLSHTFGERFEAGLNLLDSRGRSEYDEPRGASPQVPYSNFAVSSIGSYLDAQ
                     VSEQWNTRLELAHSENRDDSRDKLRHSSAPFNTYRDQATWQNNLVMDERNNLLLGADW
                     YEDRVHASTDFTEDSRWNRAVFVQHRYQGERFSTEVGVRHDRNQQFGGQTTWSGSLAV
                     PLNAQNDVLLSYSEGFRAPTFNDLYYPQFSNPDLDPEHSRSYELQWRSQLTADSRLEA
                     SLYRTDLRDAIVFGQGSIPRNVASARINGFEMALAQQWGAWHSQLGLALIDPRDRDSG
                     HTLARRARRTLSLDLDRELGRFTVGAGWQAVSGSYDDEANRNRIGGYGLLGLRGSWAA
                     TDELKLEAKLDNLLDHTHSRALYSYEGAYYPYREEGRTLLFSVTWTPAL"
     CDS             complement(640311..642206)
                     /codon_start=1
                     /EC_number="2.2.1.7"
                     /gene="dxs"
                     /locus_tag="PP4_05620"
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="BAN52415.1"
                     /transl_table=11
                     /translation="MPTTFQEIPRERPVTPLLDRADTPAGLRRLAEADLETLADELRQ
                     ELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRNRM
                     LSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSARKSIAVIGDG
                     ALTAGMAFEALNHAQEVNADMLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREG
                     SKKVLSRLPGAWEIARRTEEYAKGMLVPGTLFEELGWNYIGPIDGHDLPTMIATLRNM
                     RDLKGPQFLHVVTKKGKGFAPAEVDPIGYHAITKLEPADKPAAPKKVSGPKYSAVFGQ
                     WLCDMAAADNRLVGITPAMKEGSDLVDFSERYPERYFDVAIAEQHAVTLAAGMACEGS
                     KPVVAIYSTFLQRAYDQLIHDVAVQNLDVLFAIDRAGLVGEDGPTHAGSYDLSYLRCI
                     PGMLVMTPSDENELRKMLSTGHLYNGPAAVRYPRGTGPNAPISGDLEPLEIGKGVVRR
                     QGENVALLVFGVQLAEAMQVAEQINATVVDMRFVKPLDEALVLELAGSHALLVTIEEN
                     AIMGGAGAAVGEFLASQAVLKPLLHLGLPDIYVEHAKPAQMLAECGLDAAGIEASVKA
                     RMAMLGL"
     CDS             complement(642412..643299)
                     /codon_start=1
                     /gene="ispA"
                     /locus_tag="PP4_05630"
                     /product="geranyltranstransferase"
                     /protein_id="BAN52416.1"
                     /transl_table=11
                     /translation="MIGTYQASCQARVDAALEPLFVAPSKELERLYAAMRYSVMNGGK
                     RVRPLLAYAACEALGAPAEQANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHK
                     AFDEACAILAGDGLQSLAFSALLDPGLSPQADGIRLAMVQALAKAAGPAGMVGGQAID
                     LGSVGLKLDQQALEFMHRHKTGALIEASVRLGALASARAEQAQLDALQVYAQAIGLAF
                     QVQDDILDVESDTATLGKRQGADIARDKPTYPALLGLEAAKAYAIELRDQALIALQGF
                     GETAEPLRALARYIVERRN"
     CDS             complement(643296..643538)
                     /codon_start=1
                     /EC_number="3.1.11.6"
                     /gene="xseB"
                     /locus_tag="PP4_05640"
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="BAN52417.1"
                     /transl_table=11
                     /translation="MARKKASLDFEQSLADLQALVERLENGELSLEESLAAFEQGIAL
                     TRDCQGALAQAEQKVQILLERDGELAAQPFDAEPEA"
     CDS             complement(643670..644320)
                     /codon_start=1
                     /EC_number="4.1.99.12"
                     /gene="ribB"
                     /locus_tag="PP4_05650"
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="BAN52418.1"
                     /transl_table=11
                     /translation="MSTRNHPQFPAVSAAIAAFQAGRPVLLLDDDDREDEADIIAAAE
                     NITLQTMAMMIRDCSGIVCLCLDEATVDALQLAPMVQNNQARHGTGFTVTIEAAEGIT
                     TGVSAQDRITTIGAALRSSAEQRHIVSPGHVFPLRARNGGVLTRRGHTEGSVDLARLA
                     GLRPAAVLCELMNPDGSMARGEQVAVYARQYNLPVLTIEELARYREAMLEREAEPA"
     CDS             644634..645839
                     /codon_start=1
                     /gene="rtcB"
                     /locus_tag="PP4_05660"
                     /product="RNA-splicing ligase RtcB"
                     /protein_id="BAN52419.1"
                     /transl_table=11
                     /translation="MDILQVAGGKPIKLWTDGVPVEDEARQQLLNTARMPFIFKHLAV
                     MPDVHLGKGSTIGSVIPTVGAIIPAAVGVDIGCGMIAARTSLHARDLPDNLHGLRSAI
                     EQAVPHGKSFGKRDQGAWADVPAKADKAWGQLAGRFKAITDKYPRLEKTNNRHHLGTL
                     GGGNHFIEVCLDEADRVWFMLHSGSRGVGNAIGNLFIELAQADMRQHLANLPDKDLAY
                     FEEGSRHFADYVEAVEWAQEYARQNRELMMLAVVGAARKALGKPFEASLEAVNCHHNY
                     VQREQHFGREVLVTRKGAVSAQKGELGIIPGSMGARSFIVRGLGNEESFCSCSHGAGR
                     VMSRTKAKSRFTVEDQRRATAHVECRKDKDVVDEIPMAYKDIDAVMRAQQALVEVVHT
                     LRQVVCVKG"
     CDS             645935..646921
                     /codon_start=1
                     /locus_tag="PP4_05670"
                     /product="hypothetical protein"
                     /protein_id="BAN52420.1"
                     /transl_table=11
                     /translation="MATLYPFTDSDVDSAFAQLDHALFDKAREADGPGSDPTPNMLIV
                     AGAQGSGKTYLLEKQLLPSERYPNHVRLYLPEFRKLHPHYAEMSEHGVLHVYEHTEAF
                     IRALSGKVFGYAFANRYNIIMETALDDEAFAGFPPAAVEAGYRFEIHMIACKVEFSHW
                     ATLDRGVKSVAKGEIERFVALSQIQASQANAKKILNAFEHACTQAPGSQVTLYERGFE
                     TDQQSKVLCHSICDAPGVLTPQADYDGQPFFRAPYHDTLVEIRRSPEGNDSGTYLQFF
                     QVVHAGMLDEPVRQQMVMACCKTLGRSTDLVPRISRDAFRDLSQYLLKYTYP"
     CDS             complement(646960..647850)
                     /codon_start=1
                     /locus_tag="PP4_05680"
                     /product="hypothetical protein"
                     /protein_id="BAN52421.1"
                     /transl_table=11
                     /translation="MSKMTLTLALALALAAPVALAQPERNQKMDTSLLQRQDLAYRFT
                     QLDLDSADGQRHYRLWVGKPNRPAPASGYPVLWMLDGNAALGALNSQQLAKLAAGQAP
                     LLVAVGYQTGQRIERAGRTYDYTPALPGQAEQRDPLTGLPSGGVDAFLDLLTERMRPM
                     VAGLAPIDLQRQTLWGHSYGGLAVLHALFTRPGAFSDYAAASPSLWWHDGAIVQEAQG
                     LEQRLGSNPVRLLLMRGSEEPANPRAQLKGDVEKPARELAADLAMVQGLQVRFERFEG
                     LGHGEMLGASLQTVVEQLAR"
     CDS             complement(647933..649279)
                     /codon_start=1
                     /gene="pfeS"
                     /locus_tag="PP4_05690"
                     /product="two-component histidine kinase PfeS"
                     /protein_id="BAN52422.1"
                     /transl_table=11
                     /translation="MRRHPLLWKLAVLQVSFCLLLIWLIWTWGLSVERSTYFLSPADQ
                     DYLARYAQQAEDAWNQGGAVGAEAWRRQLEQAEDTWVAVIGPHLQSLGTTPLSAEEAS
                     HLTFMRKLDWPMSRRLQDELPYVSIEFPQHPERGRLVLQLPERLLPTGLTPWTHVITH
                     GVAPALLALLLGLALYRHLVVPLNRLRDRADALRADDLDSPALPLLARRDELGELAQA
                     FEHMAGRLRQSLEQQRLLLRTLSHELRTPLARLRIAHDSDLPPLQLRERLDREVADMQ
                     KLLEDTLDLAWMDTEQPSLPTEPILMVSVWEALCQDACFESGWDRARLPCSLGTDCLV
                     QAHLDSLAQALENLMRNAIRHSPAEGRVSLEGWREGDCWHLRLSDQGPGVPDADLERI
                     FKPYQRLTDSGAGFGLGLAIARRAIELQGGRLWASNGRPGLCLHLTLPMARDCLES"
     CDS             complement(649279..649971)
                     /codon_start=1
                     /gene="pfeR"
                     /locus_tag="PP4_05700"
                     /product="two-component response regulator PfeR"
                     /protein_id="BAN52423.1"
                     /transl_table=11
                     /translation="MPTSLLLAEDDASLRQDLERHFLKRGFRVHACATGTQALDAIRQ
                     TPFELVLLDIMLPGIDGLSLLDELRRQQAVPVMLMSALGAEQDRISGFTRGADDYLPK
                     PFSLAELDARVDALLRRVAFDRGTALRADVGEVMLDHDRQDVIHNGNAAGLTASEFRL
                     LVTLRAHPGEALSKPFLYQTVLHRAYTRLDRGLDVHVCNLRRKLADISAQHLQIQAVR
                     GQGYILVDTEQP"
     CDS             650153..652330
                     /codon_start=1
                     /locus_tag="PP4_05710"
                     /product="putative TonB-dependent receptor"
                     /protein_id="BAN52424.1"
                     /transl_table=11
                     /translation="MNGFKGVGSSRRARGWLVLGLLAPFSVSALAETVATQAAAEDTS
                     LDLPALTIEGNRLYDMLPSEATGGYSVDAATVGTKTPAALKDIPQSITVYTQDYVKDR
                     QFVHLDDLAKYTAGLRTLTNDSGRSSIYARGYEYSEFNIDGLPAPMASIFGTVPSLAA
                     FDRVEIMRGPAGLFSSTSELGGIVNMVRKRPTAEFQGHVEGSYGTWDTNHEEIDLSGP
                     LDDAGRVRGRFVASRDDTNGEVDYNANTSNSYYGALDVDLDDATTLSFGLMHEVKNIT
                     PHNGYPATLSGDVPDFSRSRFLGADWNYFDGKTTDLVAELTHRFDNGGYGRIAARGSH
                     RDTNYLYAFTATNATTGANSERASARDFTQDTYSLDASYSQPFETLGQVSEFVVGTDY
                     KNYDTEYLNGTTNLGAINVNTYSPKQFAKPSPNYSTETGMQEEEYGLYSKVTFRPIER
                     LALIAGGRFSWYRGDFYTTTLSSGASTNDSKRVDGHFTPYGGLVYDLTENHALYASYS
                     QVFKPQSDTDSNGRVLKPREGEQYEFGLKSSYFGGDLNTRFSVFRLTDKNRATTEYDE
                     DGVDTNFSIASGKTRVKGAEVEVSGKLTPNWELLAGYTWMETETLKGDAETTFFIMPR
                     NQASLWSKYTISQGPLTGLAIGGGVSAMSSFYSENGGVRIDAPGYATVDAMLSYPVTS
                     KLTATFNVNNLFDRDYLSRVGSTSTFNFYGPSRSMMVGARYDF"
     CDS             653482..653673
                     /codon_start=1
                     /locus_tag="PP4_05720"
                     /product="hypothetical protein"
                     /protein_id="BAN52425.1"
                     /transl_table=11
                     /translation="MDALPKPPSEAEQESIRSKLMGWRKGSGSAKHYNERFVSKKANQ
                     VGIELQEKLRDKVRRKNET"
     CDS             653831..655225
                     /codon_start=1
                     /locus_tag="PP4_05730"
                     /product="hypothetical protein"
                     /protein_id="BAN52426.1"
                     /transl_table=11
                     /translation="MSYYARDNSPAYTTNIFERFFHLVEFAAGQEITVDLLIDYRAAL
                     SGRIWYLTFLKALFVRWKKLGVGFVSEDVVGYFKAMKSVGNPKGDAVRRRDPIKGPFS
                     DIELSGLYEVLIQGYESGAVKLESFALTLITLALGSRPIQITDLRCLDLIVEIDKNGE
                     PVYVVMMPRAKQRGQEFRKNRKRRSIPADVWNILNRQKQHVIEKIKSLCSESVPEELS
                     ENFPLFPNWVNLKDGVNINTLREAVFSDVLHLRGASMTTRVKNAVAVLNVQSERTGKP
                     LTVCPRRFRYTVATRAAREGYGPLIIAELLDHNDVQSVTVYTENVPEYGAKISAALDP
                     MLASYAKAFAGVLVNSKSNALRGDDQSATIRTHDGKPSGTCGYYGYCTASVPVPCYTC
                     AHFQPWLNGPHQTVYDYLLSERTRILEATGDAAIATSLDRCMLAVAEVIELCKARQAN
                     AKDHEDLVIGSDLK"
     CDS             655307..657292
                     /codon_start=1
                     /locus_tag="PP4_05740"
                     /product="hypothetical protein"
                     /protein_id="BAN52427.1"
                     /transl_table=11
                     /translation="MLSEAYGVELARGDCRANLDRFVEKMKLHAQHVVDDWESWSWPG
                     IRLKKLNSSKGPDLQEGELLDEGFLPFAKAYLVFMFLERRGPTFSQLGIMFRAVEAAL
                     CTLTGTGDVSKVSLAVLDEAALLLKANFSKESAYNASRLLATLASFLTDNFFVAIDLK
                     TWQSPNGASAKNMRATGRKGDRARESKMPRKEALNALGEIFSSNLSSPRDIFTTSLVA
                     LLLCAPSRGNEILALTVDAEVEEADLSGNMQYGFRFYASKGAGPMIKWIPSSMVPLAK
                     EAFSRLVKLSEPGRKLAEYLEGQPQGFYRHSACPKVMSNLWLSNVQAAQALGMVSDCN
                     KQANGFLTIRGYSSANEAYTLDDLWGTVQQDDINFPWFDEAKGVKFSQCICTLLKYQL
                     SSRVWTNPVVLARPALKTLADDLGGRSFQRHGTSIFERHGYKGAQGEKLKMSSHAVRH
                     LLNTLAIRGGLSDFDLARWSGRLNVKSNRDYDHTTDEEVIERVRQLGLVSAAFPQAEV
                     RPQYVPVDESDFPLRAMAAMHVTEYGFCSHSFSIEPCRKFRDCINCTEHVCIKGLASN
                     YERILRRLDQLELVLEKTKDEQEPDDYGADRWIVHTEMTIDRLKELVSLMSNPKLVDG
                     AVIRLKGNDFTQLSRVINRLDSEGIEGLNHGEAPEGL"
     CDS             657267..657677
                     /codon_start=1
                     /locus_tag="PP4_05750"
                     /product="hypothetical protein"
                     /protein_id="BAN52428.1"
                     /transl_table=11
                     /translation="MAKHLKASDVAAIVNVLHGWKRARLTWDELCDEVKCLVGKRPTR
                     QSLNHHPEIVSAFTSKKAELKVAGPKLRTPSSLAFAAQRIHNLESQVKDLQRRNSLLL
                     EYLTLLQYNAYKNGLTEEVITAPLPSIDRDRSEA"
     CDS             657757..658194
                     /codon_start=1
                     /locus_tag="PP4_05760"
                     /product="hypothetical protein"
                     /protein_id="BAN52429.1"
                     /transl_table=11
                     /translation="MLSRQLSVVLAGVKTEELSQLELVLLIKKGFALGSLKAMLEMST
                     LYSSRQILTRIMGKSIRTLRRMEAQKGVVLLNEYQSAVALQYALALERATSTFGTQRL
                     AENWLEKPCSQLSGEIPLEMLGNLWGYRLVVSYLDRVVLGVYQ"
     CDS             complement(658246..658551)
                     /codon_start=1
                     /locus_tag="PP4_05770"
                     /product="hypothetical protein"
                     /protein_id="BAN52430.1"
                     /transl_table=11
                     /translation="MKITTQIATEVVTDIRCDVCDASTRLESENLQYGTLQAQWSYGA
                     LHDGERYEVHLCEMCFFATIAYLKQERRTANMFEEDPRQLQKDFGLAARDDFFLDGR"
     CDS             complement(658523..658876)
                     /codon_start=1
                     /locus_tag="PP4_05780"
                     /product="hypothetical protein"
                     /protein_id="BAN52431.1"
                     /transl_table=11
                     /translation="MSSQLAARSLPNQLPVFCNCYSTVLRAVDALYDVRGYLLAELVV
                     LCLKNRAKVPLFRRAYYERNVQEEAIRYLEHFTAHLLFGPKGRFSPQEYCWSQHLMLE
                     IQRLIRNENHYPDSD"
     CDS             659223..659450
                     /codon_start=1
                     /locus_tag="PP4_05790"
                     /product="hypothetical protein"
                     /protein_id="BAN52432.1"
                     /transl_table=11
                     /translation="MAKLARDQIGAESLTVVADRGYYTGTEIVACEQAEISPFVLKLL
                     TSSSKAEDRFGKQDFLYVSTLDEYRCLVGNY"
     CDS             659950..660525
                     /codon_start=1
                     /locus_tag="PP4_05800"
                     /product="hypothetical protein"
                     /protein_id="BAN52433.1"
                     /transl_table=11
                     /translation="MKSPSFSLDRRIHELLQKAEFERFTPRSLRDAYASAYAVPRELA
                     SDLRRYIFRQLIRLQRVGWITRDPEKKGRDQVYHLANLPSSVSLLLVEEGYLSTAATN
                     QLNNDMSKTCRDDVPDARTTQNLQGMVKEARLDFLTSMGEAERYKQLLDDMPHLQPKL
                     ENDYIEARDRSSRLLGHLRAMEKTLKKLGIG"
     CDS             661593..661910
                     /codon_start=1
                     /locus_tag="PP4_05810"
                     /product="hypothetical protein"
                     /protein_id="BAN52434.1"
                     /transl_table=11
                     /translation="MGSSDDQAWLYVMAEPALFEYSKRISDDLPEDLAVISLADDLVG
                     KVLEDVSDNNALQLVSDAAGDLVTQESEGQEWMSAMSMWTSKTNYMLDASANYRTELL
                     SFF"
     CDS             662439..662669
                     /codon_start=1
                     /locus_tag="PP4_05820"
                     /product="hypothetical protein"
                     /protein_id="BAN52435.1"
                     /transl_table=11
                     /translation="MAEAKTERLKDKIEKLKQQMTKLKDIEAQLNASPDQQISLTDPD
                     AGSMAMSCRGSGTVGYNVQTAVDDKHHLIVAH"
     CDS             663766..665064
                     /codon_start=1
                     /locus_tag="PP4_05830"
                     /product="putative long-chain fatty acid transport
                     protein"
                     /protein_id="BAN52436.1"
                     /transl_table=11
                     /translation="MTTSNRTDAKWWMPPAIILLALHTSNVSAGGIFIYEAGQESNGL
                     ANAGSAALATDPSVLMSNPAGIALLPGTQISANAQVILGDLRYSRDSNNQFGGNEGGN
                     ALQYLPGASLFISHQLDERSAIGFGMYGNFGLALDYDDDWAGRYFTQEAAVIGVSFQP
                     TFAYKFSDDLTVGIGPRMMLGYYRTEIAINNSLLGLVERPDGQLEYKDTDFGIGVNLG
                     LLYQLDPRTRIGLAYTSKVKLEFEDSPHVSDINNPLINAALSRLAVDTLELDMNVPQT
                     ATFSVAHQLDDQWTLLGSLGWQDWSEFGDIGVEVDANAAGVSRTVDRQYKDTWHASVG
                     AQYQATRQLRWSVGLGYDSSAVDDKDRTVDNPMGETWRLATGVNYQVEEGLDLYLAYT
                     LVWLGDMDVEQTKARSGDTLSGSFDNAALHIIGGGATWRF"
     CDS             665112..665780
                     /codon_start=1
                     /locus_tag="PP4_05840"
                     /product="hypothetical protein"
                     /protein_id="BAN52437.1"
                     /transl_table=11
                     /translation="MKSRSLIATVCLTSLLLHGCASKYVEPDEYSGFLKDYSKLKEDK
                     SPSGAEVMRWIKPGTNANQFTSVYVEPSQFYPKPQPTAKIPQQTLQGITQYYDQALKN
                     QFSTVLPLATSPGPGVLVVRPAITGVSAKTKGLRPYEVIPIALVAAGISTATGIRDQD
                     TSVATEAAFIDGNSNEVVAQVVRKGAGTELENSSQVMQATDARAVLDGWAKDMVSSFK
                     ALKK"
     CDS             665859..666392
                     /codon_start=1
                     /locus_tag="PP4_05850"
                     /product="hypothetical protein"
                     /protein_id="BAN52438.1"
                     /transl_table=11
                     /translation="MKTVMLKLKHEFLKVLPPTVFFFVILHIVALIRALMIKGSGVEL
                     PVSASVLIAALILGKSVLVADMLPFINRFPDKPLIWNVAWKTCMYALVALIVHYLERL
                     YEYWKEAAGVMDANALLWSSINWPRFWAVQILLITLIFMYCVIAELARVIGRERLKRM
                     FIGPLPPKQPDMPNHSG"
     CDS             666446..667252
                     /codon_start=1
                     /locus_tag="PP4_05860"
                     /product="hypothetical protein"
                     /protein_id="BAN52439.1"
                     /transl_table=11
                     /translation="MLKKNGYPLYALALLVHTGQGQAEDSAELAKKALNPVAAMYSLP
                     VQYNWDQKLGPNGEGKRSLTNIQPVLPFSLNDDWNLISRTILPVIDQHGLGGPADTSG
                     VGDVTQSFFFSPKQPTASGWILGAGPALLIPTGSNDVLSSEQWGLGPTAVALKQSNGW
                     THGILANHIWGLQGSPADGKEKVNQTFVQPFVSYTNSTLTTFGINSESTYDWQSKAWT
                     IPINLTVTQLLKVGGYPITVQAGPRYWLDSPDNGPDGWGFRLAVTLLFPR"
     CDS             667504..669858
                     /codon_start=1
                     /locus_tag="PP4_05870"
                     /product="hypothetical protein"
                     /protein_id="BAN52440.1"
                     /transl_table=11
                     /translation="MGRRNKSKILSWPLKALSCLAILITCLVGSVGTALSAEEAGAEP
                     AFSTESEGYVAAATCLGCHVDQAKAWKDSDHGWAMRDASEANVLGNFNDARFDEAGVS
                     ARFFRRHGGFYVNTEGEDGQPADFEILYTFGYYPLQQYLVALPRGRLQALTIAWDSRA
                     KGEGGQRWFSLYPGQRFAPDDPLHWTGRYQNWNGMCADCHSTRLMKHYDDRQDSFAST
                     WKEQNVGCQSCHGPGKAHVDWANKTKPAEQAYASAKDIGLAVDYKALGSQGLVEQCAF
                     CHSRRQTLGVGQLPGHPQLDQSLPATLRAGLYHADGQIDGEVYEYGSFTQSKMYNAGV
                     GCTDCHNPHTAKVKVEGNGLCLQCHNGNPPVARFATLQAKDYDTPAHHHHVAGSPGAQ
                     CVSCHMPTKTYMVVDPRRDHSLRIPRPDLASKVDSPDACTACHQDQQPAWAAKAIEQW
                     FGKPQRPVLFGEAFQAVRNGQGIPLSLLGTVLADKTKPSIVRATAAEQMADLGPQALI
                     SLGWALNDPSPLVRAYATSGFSSVPPEQRLKPLLPLLEDPSLAVRDEAVRALADVPST
                     QLPAQAKEAFSTALADYEARLRGNADLPGGRLNLAVLLSRQGRQQEAMEQYRQALRLD
                     PYFVPARVNLANLATAEHQLDEAENVLRAGLALEKMSTTDHGNLAYMLALLLVERRQP
                     EEAVGLMESAAVALPGNARIRYNQGLLLSRMNRRDEALAALERGLEQAPDNADLLYSL
                     IYLHALAGERSEAYAYVQRMRKAAPDDSRLQGIEPYWQKYESTN"
     CDS             669964..670938
                     /codon_start=1
                     /locus_tag="PP4_05880"
                     /product="putative ATPase"
                     /protein_id="BAN52441.1"
                     /transl_table=11
                     /translation="MDIRDQIAELEASVAQSVLGQADTIRHVILGLLANGHVLLESLP
                     GLAKTRTVKALATHLEASMRRIQFTPDLLPSDITGGEILQQTAQGNEIKFQPGPLFGN
                     VILADEINRAPAKVQAALLEAMEERQITVAGQSYPMSNLFMVLATQNPIEQEGTYPLP
                     EAQMDRFLMKLQLDYPKVEDETLVLRLVRNEEQQAGHPHQAPGRLPQDVVFAARSAIA
                     GIEVSPAIDRYLIDLINATRHPVEYDPDLARWIKIGASPRGGISLDRVARAHAWLAGQ
                     GYVTPDNVRAVVHPVLRHRLQLSYDAVADGIGADQVIDRLLDTVAIPA"
     CDS             670952..671893
                     /codon_start=1
                     /locus_tag="PP4_05890"
                     /product="hypothetical protein"
                     /protein_id="BAN52442.1"
                     /transl_table=11
                     /translation="MQPTQDGFVYASLSQLMAFEYRVRGLSFLARQPLASILAGNHAS
                     RLRGRGLSFDELRRYIPGDDLRHLDWRASLRYGKPFVRTFTEERDRPTLLLVDQRMNM
                     YFGSRRSFKSVTAAELAALSAWIALQAGDRVGGLVFDDQQVVHIRPLRSRARVQALCA
                     AVVRSNNRLSASGPDSEQEGRLDTALRNVIGLAGHDALVCIISDFAGVTEQTLKLLRQ
                     LSAHNDVIAMQVYDPIALDVPDKGRLSVTQGEMQIDLEIGRRQVHRPLGDFLSGRLEQ
                     VAQLLRRSQIPLMMISTGDEVLGQVQRELGRLGGSGR"
     CDS             671890..672399
                     /codon_start=1
                     /locus_tag="PP4_05900"
                     /product="hypothetical protein"
                     /protein_id="BAN52443.1"
                     /transl_table=11
                     /translation="MSARPSPAAIDQLKELPLPVPPFSYAPQTWGWAVLLAVVVVLGL
                     AYAVYAWRRWQRDRYRREALQRLDALVAAQAHPEQRLPALRELPALLKRVALSMPDAP
                     AVHGLSGQQWQVFLQQRARFALPEQFAAQLHTLAYAPDLQVQAIGEPELRTLVNTCRR
                     WIEAHHVAV"
     CDS             672386..673378
                     /codon_start=1
                     /locus_tag="PP4_05910"
                     /product="hypothetical protein"
                     /protein_id="BAN52444.1"
                     /transl_table=11
                     /translation="MWQFDYLWVFLLLPLPWLAYRFMRPYHEARSALRVPFFFAMSRA
                     VNQLPGTTPPSGGRWQVLLNLLVWGLLLAACARPVLVEKAIEREQPIRDMLLAIDISQ
                     SMQAKDFTDANGQQVDRLSAVKAVVRDFIAQRKQDRIGLIVFGTGAYPQSPLTLDHAS
                     LSLLLDEVGVGMAGPNTAIGDAIGLAIKLLDQAKEQEKVMVLLSDGNDTGSAITPAHA
                     AGLASERNIVVHTIGIGDPQASGEDKVDLQALEGIARTTGGRFFRADDRGALAQVYAT
                     LDRITPHSVKTFSHQPKRDLFWWPLGAALLLLALGHSLAAVAGPLRARPAQGRP"
     CDS             673379..674974
                     /codon_start=1
                     /locus_tag="PP4_05920"
                     /product="hypothetical protein"
                     /protein_id="BAN52445.1"
                     /transl_table=11
                     /translation="MDIDLSALHLLRPYWLLLWLPAALLPWAWQRRNDLKRQLHGVIA
                     PHLVEHLLITPDEQARLRPVHLLAALLGLGALAAAGPTWQRDIPAFVDNRAPLILALD
                     LSPSMDADDVPPSRLQAAKHTLHDLVMRRAGARTALIAYAGSAHLVLPATEDPQLLDT
                     FLQALTTDLIAQPGKDVAGVIDVAKRLLAAEQVPGTLVLLTDGADTGQLSALTGALKG
                     SDLQVMVLAVGSQDSGVVHDAQGRTRVDAQGRPLQADFDQQGLRQLANAVNGPLGSLT
                     LSDDDLDWIELHAQQHFQAAQGDPQQVHWKDAGYWLCWPLALIALLCLRRGWKVHWLA
                     TVLVAVVLGTQPQSARAGPVADAFFTPDQQGRWAFEHGHYPQAAAHFNDPYWKGLAAY
                     TAADYDVALASLGKLDTAQAFFYRGNIYVRQFKFPQAVQAYQQALQRQPAFPEASANL
                     ALAQALLKDYEDQQKAGTPDEKADKVVEDQTPSKGARQKQQQTPQAASDQVWLNNLTT
                     SPAQFLRRKFLLQDASRQTAEGT"
     CDS             674974..676278
                     /codon_start=1
                     /locus_tag="PP4_05930"
                     /product="hypothetical protein"
                     /protein_id="BAN52446.1"
                     /transl_table=11
                     /translation="MKRMLLLLGLYLPLLAVAAPEARVQARLLPPGDTMVGATLELQV
                     DLLVDTWFTQPAVLPVIELPGATVSAPSGEAQHLNERLDGKAFFGLRYTYQITPQTAQ
                     AFTLPAQTFQVFPGQSDAPVTLASEPLSFVAKALAGDATVHRLVARKVSLEQQTQLSH
                     SPLRAGDSITRRVVTRAEGAQAMLIPPPPLIEIEGLKRYVQTPRVAPLSDGRGGSTGG
                     QREDSVSYVVSAAGRYQLPAIELQWWDAATGEARQATLPPIDVTAIEGGYKAPFSIDQ
                     DLRALGRQAQLRLPGHWLWAAGLLLLGGALIYVARPWLWAVWRHLQSWQAARRMARLH
                     SADHAWRQARAQLAQDPPQLDGLYLWIRRATGQRTVSEFSLALPPQLRIRLLDWLQNR
                     YGNGSEVRQSAPSLSPILPALRRAAVSGRQVSHPEGLKPLNP"
     CDS             676322..677323
                     /codon_start=1
                     /locus_tag="PP4_05940"
                     /product="hypothetical protein"
                     /protein_id="BAN52447.1"
                     /transl_table=11
                     /translation="MLDLHRARWWLALLLVLPLAVQAANALPSWRDGPSRQAIEAFVD
                     AVTTEGSEDYVPEAQRIAVFDNDGTLWSEQPLYFEVLFALDEVKRLAPQHPEWTSQQP
                     FKAVLEGDQKALSDSGMDGMLKIVAATHAGVSTEAFIANTQRWLATAVHPRTHRPYTE
                     MVFQPMLELLQYLRANGFRTYIVSGGEVAFMRAFAEEVYGVPPEQVIGTTLQARFIDD
                     NGKLSIERLPKLLHNDDGPGKPVSIDAHIGRRPIFAFGNSDGDLQMLQWTMAGDGKRF
                     AGLVHHTDATREWAYDRDSKVGRLDKALDAAKGANWTVVDMAREWQRIYPFESNQAQ"
     CDS             677422..678987
                     /codon_start=1
                     /locus_tag="PP4_05950"
                     /product="putative sulfatase"
                     /protein_id="BAN52448.1"
                     /transl_table=11
                     /translation="MKSSRRWITTFALAATAAVSVCTATAAEKPNILVIFGDDIGQTN
                     ISAYGKGVVGYQTPNIDRIGQEGMLFTDYYAENSCTAGRSSFITGQTPLRTGLSKVGM
                     PGVPVGLQARDVTIAQALKAQGYATGQFGKNHLGDRDEYLPTNHGFDEFFGNLYHLNA
                     EEEPERELWPKDDEAFVKATSPRGVIKSSADGKIEDTGALTKSRMETIDDETTQAAIN
                     FIDKQAKADKPFFVWMNTTRMHLYTHVRESMRGQSGMQGNEYADGMVEHDGDVGKLLK
                     TLDDLKIADNTIVVYTTDNGPNQFSWPDAATTPFRNEKNSNWEGAYRVPAMIRWPGKV
                     KPGTVSTQIFSGLDWFPTLLAAAGDTGIKDRLLKGADVGGKNFKVHLDGYNQLDYLTG
                     KADKSARSEFYYFNDDGELVSMRFGDWKLVFCEQRAPGGFAVWSEPFTCLRVPKIFNL
                     RMDPYERADVVSNQYYDWVTKNDYLIFQGTRKAAAFLQTFVEYPPSQRPASFSIDQIR
                     ADVDKKIEEKMKK"
     CDS             679083..681599
                     /codon_start=1
                     /locus_tag="PP4_05960"
                     /product="hypothetical protein"
                     /protein_id="BAN52449.1"
                     /transl_table=11
                     /translation="MNLSRADNRSTNETQAPLPWLLPAALLFASGGAALIYQVLWVKQ
                     LSLVVGVEVYAITAGISAFFAGLALGGLLFGRWADGLSHPLKLYAGLELAVAVLAVAA
                     TLGLAQSAALFARLEASVGLLAWLLPFSLVGLPAFLMGGTLPVLVRALTPTDAQTGEA
                     GGRLYAANTAGAICGTLLAAFVLLPLLGVTGAACVAGALNLLAALGAWCGRRRDERTL
                     PSSGDTALPRTPQARLAIALYCLAGGVALGYEVVWTQSIVQFMSTRAFAFSVVLATYL
                     AGLVLGSALYARRADRIRDPWGLFALLIASAGLLALLQIAGLGRWLVAWQTLLESHVV
                     QLTGSQLAGMCARFAAAAVCVVFIPTTLLGAAFPLALRLAVDSGRVGRDVGAVVALNT
                     LGGIIGVMLTGFVLVPELGLVRTLAVLACVAAAIGAVAAWRGHAVHKGMRALVLLVGG
                     ATLVTGVLTPSERLAQLLPGARSGELVFYQEGRGGTVAVVNQQRQGQAFNRLYIQGVS
                     NTGDAMPSLRYMRLQALLPLLIHRGEPRSALVIGFGTGITAGAMLRYPGLEHPVVAEL
                     LPQVLAAAPLFSGNYNAVNDPRLDIRLRDGRRELLRNEQRYDVITLEPPPPSAAGVVN
                     LYSRDFYQLAASRLHEHGLVAQWLPLPTQNDEDSRSLVRSFLDVFPHASLWTTEFHEM
                     LLIGSATPMVLDVSRIRQRFEQSQVSASLAQVGVNSVEALLATWVTDRQGLERYAGDA
                     QPVTDDRPRIEYAPWVRPHEITRVLPALLALRVAPPLENASPSVQAGVNDEWALLRRF
                     YGLSLLAYNGNRQGWMREARALAPISAKNPYMRWFTGGKR"
     CDS             681683..683371
                     /codon_start=1
                     /locus_tag="PP4_05970"
                     /product="hypothetical protein"
                     /protein_id="BAN52450.1"
                     /transl_table=11
                     /translation="MIEFVLHALRANPEIAVFLAIASGVLIGRVHMGSFHLGSVAGAL
                     LMGLLIGQIGLEVPHELKSVFFALFIYAVGFKSGPEFFGSLNRGTLKLVLLSVVLCGT
                     ALATILAMYSVYGFDAGFTAGLGAGALTDTAIMGTASSAIAQLSIDEVAKAQLNSHMA
                     VAYAITYVFGTIGLVVFVGSIAPRLLRVDLASSARELERSLGIEQEDAALSIPYTRIV
                     VRAHQLVGPAAEGRSIADIEARHPNLSIERVVRDGRVLERNGQLRLQRGDVLGVYALR
                     EAVAQLSQWIGPEVDDSIAMSFATRTAQIVLTSRKLSGRTLRQIKHELVGATRMGCYI
                     VDITRQGLDLPLLPDTVLRRGDVITLNGRSRSVETLAEQMGRIRPVHHKSDIAIHALG
                     LVVGSLLGMLSTHIGIIPVELGVGGGVLLVGLLIGWYNSRHPDFGALPPAAQWAFSEF
                     GLTAFGAVVGLLAGPAALAAIETQGLALLISGAAVTLIPPVVTLYFGYYVLRLHPLIL
                     FGALAGAQTEAASMNKIIEQSGSNTPVIGFTVCYAISNVLLAVCGPVIIALTTT"
     CDS             complement(683383..685020)
                     /codon_start=1
                     /locus_tag="PP4_05980"
                     /product="hypothetical protein"
                     /protein_id="BAN52451.1"
                     /transl_table=11
                     /translation="MGRKRTFGWGAWLILLHHLLFSPLLHAAPPQSQPELEGVLAEPA
                     PLTVINRTVLVFRATLLGETPAVRAQRAKKVIEDTLQETNDLDVRLDPILHSYLVLLG
                     GRRAFIVTPLDAAADSITAGEAAAQAAENLRLVVEETRQARSLRFLLTAIGYSAAATL
                     IFFILAKAASYCRRKLLGLLAVLMGKHSERFKVGHTQLFDLQNLYYLIDRSLWLLYWL
                     VLLLLCYQWLGFVLSQFPYTRSWGESLNIHLMELLDYLVSGILRALPGLAVALSIFFI
                     ARGISSFSKRVLRRMARPGTLKWLTVETLQPTMRLTSLGIWLFALVMAYPYLPGSGTD
                     AFKGLSVLLGLMISLGATSVIGQGAAGLILTYTRTLRVGEFVRVADYEGTVTEVGMFT
                     TTIRTGLGEVLTLPNSMITASVTKNYSRIVQGPGYVVDTVVTIGYDTPWRQVEAMLLE
                     AARRTEGVLQEPQPQVFQTALSDFYPEYRLVAQAIPSEPRPRALLLSLLHANIQDVFN
                     EFGVQIMSPHYLGDPEQPKWVPKEQWHAAPSKPENTA"
     CDS             complement(685382..686896)
                     /codon_start=1
                     /locus_tag="PP4_05990"
                     /product="hypothetical protein"
                     /protein_id="BAN52452.1"
                     /transl_table=11
                     /translation="MSVSTFKTLSTFTAVSVLLSACSAFQPKPFTEDEMRQRVVEDQA
                     RMYKEQEPVNGPITFYEASARALKYNLDYRLKLLESALASDLRDVSSHEMLPRLVASA
                     GYAGRNNDSGGTSIGIEDRQVSLRPSTSEERYRTLYSLGLSWSLLDFGVAYFRTQQKN
                     DQMLMAEERREKVAQNVLQDVRNAYWRALGAQRLLPEVDGLLMRTHRALTAAREAEGK
                     GLLPRQDILAYQRALLDSVYMLTVRRQDLEFARAELAALMSLPPNTRMVLADNAEQPL
                     PLLTSNVEQLERLSLERRPEIMEEWYRKRVSMNDLKIAKAQLWPNVSFNYGYEYDSNK
                     YLYNSDWNQTGINVSMNLLRLLQYPDIAAAEKSQEKTDDMRRTALSMAILTQVRVGLL
                     RYQLARQEVEFADESLRVDQSLLSYAQSSRNAALGSELELIRAEGRLLLSRYQREAAY
                     SDAQAAWGRLYNSIGFGVMPKEIEQHDVKTLAHEIENTMDKQTREHLLSVGAPL"
     CDS             complement(686932..697473)
                     /codon_start=1
                     /locus_tag="PP4_06000"
                     /product="hypothetical protein"
                     /protein_id="BAN52453.1"
                     /transl_table=11
                     /translation="MDINRRAGFATVSRPRSQTLALEQRILFDGAAATAVDQQHHSDA
                     SPAETQDSSHPAPTASEAQTAAPAPAPRNLVVVDARVENRDQLVASLPTGTTALVVDP
                     GQDAIAAISTALAQLGKVDSIQVFSHGASGQFTLGNQVFTSQPVEQLGDRLSAWRGEL
                     NSGADIQLYGCDVGAGSAGQALVNELARWTGADVGASSNATGSPLAGGDWRLEVSSGD
                     VDKAIALAAATLDRFQGLLADASPTASLGSGGAEVQLGEQFTFTVSFNNPSTQEGYAP
                     FIDVFMPATGRDGDDGASFVSATYLGQTVNSFVITFDANGNATHPLAKDASGNALVIN
                     AASVGMKPGDQMVVLQLPYASVTNGQPSIDIQITAQLSNLADTTYSDGAPNLTINTRA
                     GFEYGNDSLNNPVQDPSLVEAALHSFVVTPTLLKVEQTVNMPEGETVTGPNFTRTQTV
                     TVTPAPGQTLSNVTVTQTVPDQVHVSAITPGPGGTLTSVTLHDGTVLTNPALIALALA
                     NPNAFVASYDVHYDTLSAASTTQVSFYVPEIDANGRPVIDPATGNPVQINFGTASVTG
                     DWNPLDPRDRPTDPDGYPFNETGNSQGVTFVAKSITLLKQVNLQTDVGTAGLTPGDTL
                     RYTMDVAISDFFAFGENILEQGQFTLTDLLSDGQTFDPNNPPTLLIQQHGVAQNIALI
                     YTQTVNADGSTTLVFDIAESIRQAIAGPGIAALFGDLYDDTVQEGATRLSIVYDATID
                     ATYTSDHPPHDQLNEGDSVGNNATVDATVLRDAVNLGGTQTDGSSTTSTIDTSTVDIE
                     LTQVNGGNPPSNGELRPGDVVTFTINYDLLVADYENFKLTAYLPLPLLDASGINWSFG
                     TGVGQWTFGSGNNILDVPDSVTTGPGNSIIFDFGNFVSGGLNGGTVQVRFTMVVGDQP
                     FADQRELDVLAQSSQTTTVDKTVLTSSDVAVIESVAEPVLDIKHGVVSSTNGSVTGTT
                     GSWTAPGTSGVPFSGSVTSLAAVDGNVSGIDGADTLRLATALKNTGGGGAFDVSTSIT
                     LPAGLSFVGGSLGAANLQIYRGDGTLLVQGTDYSVTGNAITFLDANGQATLLAGRAGT
                     ASDLSGANVVVITYDVTVDNAILASSTLQSTASLTYYASVNGGQDFTPTDITELANQQ
                     VAAPTISKTYKDGSLSEDDSSATHTTGSNLVIGESITYDIVVTLPEGATGSLRINDLI
                     PPGLRLDPRFNGNLGYEIITTTAGSGALSANFNGILNVNPVTLDGSDGADLMLAFSSA
                     GATADNVIGNNSFVIRLVLVASNVPGNQQGTTLNNGAQLVYSDPDGDTPNGTAPIDRS
                     LVSPQQPGVSIVEPTLSVTQQVTSTPTFGGFDEGDTVTFTITVANNSGTDAFDISLLD
                     VLPTEIDNLVVSGTIQYNGGASNNGGVDFVILNGQLVTASGANIDIANGGSIVITLSG
                     VVNATAAGQAAIPNNVDVRWSSLNGTNNTTDTVNGERSGDDGLLNSGVLNDYQVLSAL
                     LIPVTNGIQVSRVGGVSDTPPATNGSGATDTSGLQETVAVGEIVRYRVAVLVPTGDNP
                     SYQIRIELAAGLEFIPADLNNILIAMVSSQLNGLTTDATNLLSGGTLYMTGNQNSDVA
                     LPIHTDLGGVEPSGIFDGNNGRLQITTNADGSQTITFSLGNLTNTEANDSDIEGVILE
                     FNVRVSNVAGNQANTQLGMTVFEHVGDNGGVDRGKSDTVFERVVEPSFTGMDKSVIDV
                     TPGAVAGTTDATVSVSFTQNGGVPAYETHLADQFPNGSNYQVQSILLNGVALDLGNLP
                     AGVSFTDGTAIAVDFARLAPNDTVQVIYTVTLPNQTIADNAASAAVLTWTSLPSDFEN
                     TGWGGSLPATAGGATGERTGQDGAAGLNNYILSDGAGMGVIQGTLWDDTRSATDNVSP
                     DGPGLDGIGVSLTWAGDDGQFGTADDHTFSTVTSNGGLYQFALLPSGSYLIAVAQDHQ
                     ASANNNFRVRIDTDTGAALGGLGRVNVALGEGSTGIADAGYVHINEAPINTVADQQGQ
                     EDTVLHIGGLAISDVDVHVGNSDGIMTITLTVVHGVIWQTATPPAPTATPPAGSGRTL
                     VLTGTLNELNVLLSQLYYKGDQDFNTFRDAETLTMVSNDQGNFGDAPLNGDGIPGQNP
                     ADALTDTDVMNIVIDPVNDAPIAHADLAIAVEAGGLNNADPGVNPTGNVLANDTDVDI
                     QTNNDVLTVTRIASNIVPGGVAVPATGVTAIQGRYGTLLITAGGGFQYNVDNANPEVQ
                     ALRTAGNFISDFFGYDIVDSGGLPSSAVLQVNIHGANDTPVAAADTAIALEAGGTNNT
                     TPGQDATGNLLTNDTDVDSVALGETKQVTAVRYDGPGGGRIIPVATGQATTVQVNFGT
                     LTINADGSYRYVIDNSNPAVQALSPGQTLTEVFTYQMADAGGLSSVNILTITVQGAND
                     APVAVDDVGSASAGASDGSPVPVNASGNVITGNGGVGTDTDVDNLDQPTATQLKVDGV
                     RSGLESAGGALSPVANGAPAAITGTVARLADSSLISGNFGQLVLNEDGTYSFAVNSAD
                     PAIRALSAGQSLQVIFTYQIHDSGDLTDQAQLVITVTGVNDPPVVNPVSIDAIEAGGL
                     NNAQPGLDPAGSIRAAYSDPDGDTLTISGVISPNGINGTPGQALAGNYGSLVLDAQGN
                     YSYVVDNSNSAVQALRTDADRLTEVFQYSVSDGNGKVVTATFTVVIHGRDDTPIATID
                     SPIAIEAGGVNNGTPGQPGSGNALGNDTDVDAGDSKTLDGIYLGTLAAGGTFIQVNAG
                     ATVVAGTYGTLSIDANGNYVYTVNDSLAAVQALKAGEQLRETFSYRMHDTDGASSQAQ
                     INITIEGRYDTPVANDDFAYAVAVDDDGSGGRNPTGNVLNNDTDVDANDTKAVTAVGV
                     GAESNNPVLDPLTGSATVTTNFGTLTLNADGSYQFVVNSNDPTIIALGPLGFVIQRYT
                     YQVTDAGGLNDTATLTIFIRGENQPPVAGPDQGLAVEAGGTDNSIPGSDPSGNVMDND
                     SDPDTINILFPETLEVLAFWSGDGPLPNDASLVGQTLRGQYGDLTVNADGSWSYVLDN
                     SLQAVQQLRTSGQTLVDNFTYLLSDFWGGTANGLLTITIDGRNDYPVANDDIANAVEA
                     GGVNNGTPGVDPQGNVLDNDTDVDGVQYGESKTVLQYTGENGQTASAGQVLQGVYGTL
                     LISADGRYQYVVDNSNPTVQAMRSAGESLREVFTYRMRDTAGITADARLTVTIQGAND
                     NPVARDDSNTASDQVPAPHTSGNVLPNDSDVDGGDGLSVTGIRSGQEAGTGNAGVIGQ
                     PIAGQYGTLVLNADGSYTYTIDLSNPDVLAAAGLGQVLKDYFTYTIGDLAGATDQAQL
                     IITLDISTPYIPPGPYFDRDSQNRLNNLPLPDVSPAIFVAPVVERVNQALTLSAWDAD
                     GSDVRLFATPEIESQSLGNGLGLVPGQFVASAVAESRRASLEDQYWIDGRHGVISLTA
                     DGLLPDPSLWAPVPTDMVAPPEQPPQPARGFRAQLREAAQRRGSNAP"
     CDS             complement(697572..699662)
                     /codon_start=1
                     /locus_tag="PP4_06010"
                     /product="putative peptidase"
                     /protein_id="BAN52454.1"
                     /transl_table=11
                     /translation="MLDLTDLPLPPLREDLRLCEAAESREGEPAWMIHDTVLNRFYRI
                     GWLEFECLLRWGQTPRQISEQVARDSALKPDVEQVLALRGFLEHHHLLRPGTEQLAKL
                     QAASEARTWSSWRWWLHHYLFFRLPLLRPQAGLQRLAAVLGWLFHPLTGVLVASLTLL
                     GIILVMQQWDSFTHAVVESFSTEGLLSFALALVVAKTLHELGHALVATRLGLRVGHMG
                     VAFLVLWPMLYTDTGESWKLKRPRQRLAIASAGIVTELSLAGLATLGWALCDDRALRN
                     ALLYLATTSWVLSLALNASPFMRFDGYFILSDLLDFPNLHERASALARTALRRNLLGL
                     NDPWPEPFPVGQRRLLIAFAFATWLYRLVLFLGIAVAVYLFFFKLLGIVLFMVELAWF
                     IALPVKRELSHWWQQRARIPGRRKHLIYACLGLAVLGLALPWHSQVDAVGVARAEHQW
                     RVYTPYPARLQSLHPAGPIKAGEVLAVLDEPDLDSRLRSSEASARSYQARLSGLLADP
                     GGLAEDAATQQRLNVQNEEARAARSEIARLNLQAPFAGVWLDLDPDWRPGQWLNRQQA
                     LGILIDPGHWQVDAYVAQDQVHHLAVGNAVKFYPEGQATALHGTVLAIGSTRAGQLAH
                     RMLSSHFGGPVPTTNEPLVPSNALFQVLIALDEPLATVRETRGKLKIEGEKRSVLGEM
                     GKWLLGVGLRESGF"
     CDS             complement(699662..701008)
                     /codon_start=1
                     /locus_tag="PP4_06020"
                     /product="hypothetical protein"
                     /protein_id="BAN52455.1"
                     /transl_table=11
                     /translation="MSVNRPLPHPQLLLQLDALRDKAMAAETLNALAFSMANDLYPLL
                     PFHQALVFEQGNSGLELLCVSGLARPTEDSPYLVWLRRASRWLAERLADAQPTWLTQA
                     NCAPPEDIAEGWAEWWPAGLWCLPLHGPAGQRLGVLVLLLEEAPPAVLHQQLEGLVRT
                     WAYCWSALTRRRRVSRWRPSRRQWLITLLVAAGLLLVPVRQTALAPAQVVSRQAQIVS
                     SPIDGVIAQVLVRPNQPVEAGTPLFTLDETTLRSRAEVLGKEVAVADAELLAASQRAF
                     DNPQSKSELTLLQGRVQQRRAELAAVQAQLRRTQVVAPRAGVAVFSDPNDWLGKPVST
                     GERIMHVADPTQPAMQIQLAVADAIALEPGAEVTLFLTAYPLSPLKGKILETSYQAKP
                     SDDGVVAYRLLASIDEHAEHARLGLHGTAKLYGGRVMLGYYLLRRPLASLRAWSGW"
     CDS             complement(700995..701756)
                     /codon_start=1
                     /locus_tag="PP4_06030"
                     /product="hypothetical protein"
                     /protein_id="BAN52456.1"
                     /transl_table=11
                     /translation="MISTINAPRYLLLMVALSSVGVHAEGEATDQAPQMIRVLLAAEL
                     ETTLSSQMSGTLGELKTRFGEHVAKGASLARFNCNEAQARGKVAVAELAMARQNLEAK
                     KQLRKLDAVGDIEVAAANTEVQKADGARAMGEAQMSYCQVLAPFSGHVAKVYVKPYQT
                     VSAGTPLFDLVSDGALKVRLNVPSSQLKDLSPGLPLQVSVHETGKTYPAKVSVINARV
                     DAVAQTVELEARFDQRYPELIAGMSGTARFDHERE"
     CDS             703234..705090
                     /codon_start=1
                     /locus_tag="PP4_06040"
                     /product="putative sensory box protein"
                     /protein_id="BAN52457.1"
                     /transl_table=11
                     /translation="MTLRTKLLWQFAPPLLLVLGLTFFATHNVLLERLDKQDERLLVS
                     EAKRVRALLNNLFERDADRLEQLAESLPRPIASAFPLPSHILNRTDFDFLALVTPTGQ
                     RSAWRTMAPVFSDTGNSKPLSFESLQSEVSSQLGRLSSSMASASSPQLMVVHRQPFIL
                     ATVDVGPPSARETLFAGRFLDAERNDGLERQLGAVLQWETGGVQSVASPADGEFISIG
                     NRQISDERHQRIDLIFHNSLGEPQVQLQLHRERHLYSEGIQQLKLLMGAMFAIISLAW
                     LVIYLALDVTLLRRISALNREFLAVGADSASGRLSDSGHDELGMLAQEANRTLDRLEQ
                     SEARGRIILDGMEDGYFELDSHARIQSMNPAFCKMLCYSAADVTGNTFAALQPQEHGS
                     RPSSRVVFDTEPGAPLSARLQRADGTVGYYETRFTRITDAAGNVIGYRGILHDVSEHV
                     QYQQALLDMAYRDALTGLGNRKAFHEQLERLLDAQRLPLGVVFLDLDRFKQVNDRFGH
                     DVGDALLVCMAERLRNAMRKQDTAYRLGGDEFTAILPAIDEAAAGALAERLLAVLSAP
                     VRVGGKLIDFVTPSIGLAFAPAHASSANMLVKAADQAMYQAKQQRGRVCLAN"
     CDS             705953..707173
                     /codon_start=1
                     /locus_tag="PP4_06050"
                     /product="putative glycosyltransferase"
                     /protein_id="BAN52458.1"
                     /transl_table=11
                     /translation="MIEDPYMLFTRIPVVVDEQGGLFTDPLWVKDIELHLTYIENFGM
                     CCPVERGGNVDGLQSISHLDVKWLYGLRKDYGLSSVLKNFFPNFITVINACKHARIVH
                     SDGAGWAFPLSFYLLPLKPLFRFQWVIVIESSFWMLAQGQARTLRAIIEHHVHTLLLK
                     CCLKLANARIFTQSFYKEYFLGSNNSRTLINPASWLDKKFMASPEAVRHRFEVRRSRT
                     LNVLYPSRLVLDKGVLVVLEAIEQLKTEDVDITVTLMGDGDLKEHCRRFAAEKRGGVE
                     VRFQDAVDYGKDFFRIIAQHDWLLVPTLKQEQPRIIFDAFSQGVPVIGSDTSGVLDIT
                     SKHNALTFETGNPSSLADRIRHAARHPELALEMGLAGLDYATGKTHLQMHQVREEFLK
                     SSLTPSASPRAPND"
     CDS             complement(707189..708145)
                     /codon_start=1
                     /locus_tag="PP4_06060"
                     /product="putative transmembrane sensor"
                     /protein_id="BAN52459.1"
                     /transl_table=11
                     /translation="MTNGTATPDDAIAQHVLAQAASWLMLMQEGPLLPAQQLELERWR
                     LASDEHERAWKRAQRLLSRLGSLPPTLARHTLQRPPGRRAVLRGLALLMGAAPLGWWG
                     WRSQVGRFASDYHTAVGERRHARLADGTQIILNTDSVLQLLFDSAQRLLHLRRGEVYI
                     VTAADPRPLMVQTVHGQLLALGTRFSVRQLADETLLEVYEGAVQVRPESTSVAGVENI
                     IRAGQQVRFTRERLGLVGEVRETSLAWQRGLLVADDMPLQQWAQALMRYADQRLECDP
                     ALSELRVSGTFPVDDMPLALAMLAQTYGLQVRQAGGRLVISR"
     CDS             complement(708138..708677)
                     /codon_start=1
                     /gene="fecI"
                     /locus_tag="PP4_06070"
                     /product="putative RNA polymerase sigma factor FecI"
                     /protein_id="BAN52460.1"
                     /transl_table=11
                     /translation="MNAPFSPPDSTEPCSIETLYIENHAWLRNWLAYRLRSWGRGVAD
                     DLAQDTFLRVLASREGARVEPIRQPRAYLTRIANCVLVSWRRRQSLEQAWLEALLLLP
                     EPEYPSPELQCVILETLHEIDAVLHKLRPRARQAFLMATLDGMKHKDIAVALNIALPT
                     VKKYIHDGYLTCLTQMPDD"
     CDS             708993..711806
                     /codon_start=1
                     /locus_tag="PP4_06080"
                     /product="putative TonB-dependent receptor"
                     /protein_id="BAN52461.1"
                     /transl_table=11
                     /translation="MAEDAHKAALTATRLDDATLRDYNIAQGPLGAALGSFSSQAGLL
                     LSYEPALIRGRTAPALKGRYTVSEGMQRLLANTGLRLVPSATGTYVLMAQGTAARAAA
                     ELSPTMVEAAAQGPEVETYRAPRSSVHLTSDQIDRFGRVSAGDLLNGIPGVQVGDTRN
                     GGALDVNIRGIQGQSRVAVKVDGSEQALDVYRGYGGTQQRSYIDPDLISSLTVNKGPS
                     TKSGAIGGTVEMQTIGVQDILVDGNQVGVRLKGDFWDNGVAPAHRSASSRDESLTAPP
                     RDSRGSLFGSEAESGSAAFAFTTERLDVVAAYAHRNQGNYFSGKKGQDRYRIHDEDGR
                     EQPSVAMTYNAGEEVLNSSSKTDSYLLKATWRIADDHTLDLGYRRYDGRTAEIMPSDI
                     YRFGTAGIYQYPLGEVKIDTYTARYHYLPAGNPWVDLTSNLWMTDAKTSTLSSAWTAP
                     ASQLFRSDRSWTRQDNRRIGGDLNNVSRFETTHGDFKLDLGGAFQLEDLQPQKSVLIT
                     QHDIDANRTLRDASRQEFNFNGKLEYQPIEQLTLWGGGRYSHFRTRDNTVLATARRQD
                     REVRYISASGPKGWGSMTWFPDQNGQYTDATDPRLNNGIVFGNSNEPFNGVRFNDFGA
                     TSVEVGTEGISSVVTGYDHSPQGSSSGGGFSPAFGINVELMPDTFFYVTYTQGLRLPS
                     LFETSQGTQQVSPGKSLKPERSQSWEIGVSALRDNLLTEHDSAAVKLAYFDNVIKNYI
                     TRYYDPSPGLWGLMTFSNTDSFSTRGLELQSHYDAGRVFTDLSATYYLKTETCDADFA
                     GKLRATANPYQKTENTPNCTPGSFMGSYTNTQNPPRFSANLTGGVRFLDEALTVGGRV
                     TYTSGPTSTLDKPWQSGATTPQIEYRSVALFDLFLKYKLLENTEVNASLQNLTDRYYL
                     DPLAQSFMPAPGRTLRVGVVTRF"
     CDS             complement(712095..712796)
                     /codon_start=1
                     /locus_tag="PP4_06090"
                     /product="hypothetical protein"
                     /protein_id="BAN52462.1"
                     /transl_table=11
                     /translation="MNTSGDRLKALLHECGLSASDFAAQRSVTPQHVNNWFNRGVPLA
                     RLDEMADLFCVHRRWLRTGEGPKHPNPIQRNHAPRQAPANPPSPLSAHRARELRVPFY
                     ELRNGLLAPVASKHLRLPAKALKGLGVHAHHAICLAMPASNMVPLIPQEAILAVDLGM
                     TRVIEGETYALLHNGVLRVNNLSLGPQGTLYLHSHDRRNYAVERYTCAQRQAQGLEII
                     GWVFHWSHFRQQRPG"
     CDS             complement(712982..713509)
                     /codon_start=1
                     /EC_number="3.6.1.1"
                     /gene="ppa"
                     /locus_tag="PP4_06100"
                     /product="inorganic pyrophosphatase"
                     /protein_id="BAN52463.1"
                     /transl_table=11
                     /translation="MSYSKIPAGKDLPNDIYVAIEIPANHAPIKYEIDKDSDTLFVDR
                     FMATPMFYPANYGFIPNTLADDGDPLDVLVVTPYPVAPGSVIRARPVGILNMTDDGGG
                     DAKVIAVPHDKLSQLYVDVKEYTDLPALLIQQIEHFFANYKDLEKGKWVKIEGWDGAD
                     AARAAITKSVAAYKG"
     CDS             complement(713603..714418)
                     /codon_start=1
                     /locus_tag="PP4_06110"
                     /product="hypothetical protein"
                     /protein_id="BAN52464.1"
                     /transl_table=11
                     /translation="MWSFSAWRRKRALARYPIEPKQWQAVRERLPMLDGISDDEDHWL
                     REACILFLLDKHLTCLPGVEPDDEQRLLLAAQAQLPLLHLGELNWYQGFHEIILYPDD
                     FKSPQRHRDASGVEHVWDGEHSGEAWQQGPIILAWNGVLASGGWEAYNLVIHELAHKL
                     DMLNGDANGLPPLHSGMPVDEWATAMQQAYDDLNRQLDNNPDAETAIDPYAAENPAEF
                     FAVTSEYFFSAPDLLHQAYPRVYHQLSQFYRQDPLARLLRLQAEHPEYRESHA"
     CDS             complement(714439..715095)
                     /codon_start=1
                     /locus_tag="PP4_06120"
                     /product="hypothetical protein"
                     /protein_id="BAN52465.1"
                     /transl_table=11
                     /translation="MLYMDFNPLDLILHLDAYLDLLVTNYGPWIYAILFTVIFCETGL
                     VVMPFLPGDSLLFIAGAVAAGGGMDPVLLAGLLMAAAILGDSTNYVIGRTAGERLFNN
                     PNSKIFRRDYLQRTHEFYERHGGKTVTLARFLPILRTFAPFVAGIAHMHYPRFLGFSV
                     AGSILWVGGLVTLGYFFGNVPFIKQHLSLMVVGIIILSLVPMILGLLRGRLGRAAKAH
                     "
     CDS             complement(715356..715814)
                     /codon_start=1
                     /locus_tag="PP4_06130"
                     /product="putative acetyltransferase"
                     /protein_id="BAN52466.1"
                     /transl_table=11
                     /translation="MRIIKATLEHLDLLTPLFVKYREFYGQLPYPDSSRSFLEKRLKR
                     DESVIYLALPDDDDGKLMGFCQLYPSFSSLSLKRVWILNDIYVAEDSRRMLVADHLMR
                     EAKKMAKETNAVRMRVSTSANNEVAHKTYESIGFREDTEFKSYILPISQD"
     CDS             complement(715923..716747)
                     /codon_start=1
                     /EC_number="4.3.1.7"
                     /gene="eutC"
                     /locus_tag="PP4_06140"
                     /product="ethanolamine ammonia-lyase small subunit"
                     /protein_id="BAN52467.1"
                     /transl_table=11
                     /translation="MTMDHRTPTPDNPWLALRNLTPARIALGRAGTSLPTGAQLDFQF
                     AHAQARDAVHLAFDHAGLATQLGDRGRESLVLHSAATDRHQYLQRPDLGRRLNEESIA
                     TLRQHAQANPGGVDLAIVVADGLSALAVHRHTLPFLVRFEEQAAADGWTSAPVVLVQQ
                     GRVAVADEVGELLGARMTVMLIGERPGLSSPDSLGLYFTYGPKVGLTDAYRNCISNIR
                     LEGLSYGMAAHRLLYLMREACRRQLSGVNLKDEAEVHSLESEHTGNQKGNFLLGKE"
     CDS             complement(716750..718144)
                     /codon_start=1
                     /EC_number="4.3.1.7"
                     /gene="eutB"
                     /locus_tag="PP4_06150"
                     /product="ethanolamine ammonia-lyase large subunit"
                     /protein_id="BAN52468.1"
                     /transl_table=11
                     /translation="MASFVHTVGHLVYRFDSLKDVMAKASPARSGDFLAGVAASNDGE
                     RVAAQMALANIPLTHFLNEALIPYEADEVTRLIIDTHDAQAFAPVSHLTVGGLRDWLL
                     SEEANEDSLRALAPGLTPEMAAAVSKIMRVQDLVLVAQKIRVVTRFRGTMGLRGRLST
                     RLQPNHPTDEPAGIAASILDGLLYGNGDAMIGINPATDSIASICALLEMLDAIIQRYD
                     IPTQACVLTHVTTSIEAINRGVPLDLVFQSIAGTEAANAGFGINLNVLQEGYEAGLSL
                     KRGTLGQNLMYFETGQGSALSANAHHGVDQQTCETRAYAVARHFKPFLVNTVVGFIGP
                     EYLYNGKQIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGVAGINF
                     IMGIPGSDDIMLNYQTTSFHDALYARQTLGLKPGPEFEAWLARTGIFTQADGRVRFGD
                     NLPPAFRQALAQLA"
     CDS             complement(718191..719639)
                     /codon_start=1
                     /locus_tag="PP4_06160"
                     /product="putative amino acid transporter"
                     /protein_id="BAN52469.1"
                     /transl_table=11
                     /translation="MPSDHSAGSPAGSSVDFEKVGSDYFQQRELKKGAAGWVLLVGLG
                     VAYVISGDYAGWNFGLAQGGWGGMFLATLLMATMYLCMCFSLAELSSMIPTAGGGYGF
                     ARSAFGPWGGFLTGTAILIEYAIAPAAIAVFIGAYCESLFGIGGWVIYLAFYTVFIGI
                     HIFGVGEALKLMFIITAVAAIALAVFLVSMVPHFDAANLFDIAKTDAVGASSFLPFGY
                     VGVWAAIPYAIWFFLAVEGVPLAAEETKNPKRDLPRGLIGAMLVLLAFALLILVVGPG
                     GAGSEALKASGNPLVEALSKAYGGSTWMGGFVNLVGLAGLIASFFSIIYAYSRQIFAL
                     SRAGYLPRKLSETNKSKAPVLALIIPGIIGFALSLTGQGDLLILVAVFGATLSYVLMM
                     AAHITLRIRRPKMERPYRTPGGIFTSGVALVLACIAVVAGFLVDPRVVIGAAVIYAVL
                     IAYFAFYSRHHLVAGTPEEEFAAIQQAEEALH"
     CDS             complement(719865..721385)
                     /codon_start=1
                     /gene="hdhA"
                     /locus_tag="PP4_06170"
                     /product="hydrazone dehydrogenase"
                     /protein_id="BAN52470.1"
                     /transl_table=11
                     /translation="MRYAHPGTDGAKVSFKNRYGNYIGGEFVAPVKGQYFENTSPVNG
                     KLIAEFPRSTAEDIDKALDAAHAAADAWGRTSVQDRSNVLLKIADRIEQNLELLAITE
                     TWDNGKPVRETLNADIPLAVDHFRYFAGCIRAQEGGAAEINEGTVAYHIHEPLGVVGQ
                     IIPWNFPILMAAWKLAPALAAGNCVVLKPAEQTPLGITVLLEVIGDLLPPGVLNVVQG
                     YGREAGEALATSKRIAKIAFTGSTPVGSHIMKCAAENIIPSTVELGGKSPNVYFEDIM
                     QAEPSFIEKAAEGMVLAFFNQGEVCTCPSRALVQESIYPQFMEVVMKKVLQIKRGDPL
                     DTDTMVGAQASQQQFEKILSYLQIAQEEGAELLTGGKVEKLEGSLATGYYIQPTLLKG
                     NNKMRVFQEEIFGPVVSVTTFKDEAEALAIANDTEFGLGAGVWTRDINRAYRMGRGIK
                     AGRVWTNCYHLYPAHAAFGGYKKSGVGRETHKMMLDHYQQTKNLLVSYDINPLGFF"
     CDS             721641..723710
                     /codon_start=1
                     /locus_tag="PP4_06180"
                     /product="putative transcriptional regulator"
                     /protein_id="BAN52471.1"
                     /transl_table=11
                     /translation="MQSNHFSRHAQQVHTVAHGGAGEGGSDPSIARSWLRCLEDYHLD
                     PAVIAAPVVLEHGRLLESRERLRQVLQIADPEMNSLHQQLSGAGHAVLLTDARGVILN
                     CVSAPTERRSFERAGLWLGADWSEAREGTNGIGTCLVERQALTIHQNEHFRGRHTGLT
                     CSASPVFDPHGELLAVLDVSSARPDVSRQSQFHTMALVNLSAKMIESCYFLRHFEQQW
                     LLRFHLQAESVGLFSEGLLAFDGDGRICAANQSALNLLGTVRGGVLGKPMQRFFACSH
                     DELFNRAMPAGSTVWPLHTLDGRQVFASLRGQARTPVWSVPTAYRQPVREVEPAICLL
                     DPALQNDFRRCVRVFERDVPLLLRGETGCGKEAFAQAVHQASERRGKPFVAINCASIP
                     ESLIESELFGYRGGSFTGARKEGMRGKLLQADGGTMLLDEIGDMPLALQTRLLRVLEE
                     RQVVPIGGEPQAVDVRIVSATHRHLLERVEQGSFREDLYYRLNGLEVALPAVRDRSDK
                     AQLLDFLLRQEAQGHRVELEPSARQALLDFTWPGNVRQMRNVLRTLVALCEDARIMFS
                     DLPAVVREGSALDRRQASSHPDHTGFKPFVNPRGSGLPVAGPEQALEGSCTYRVNRAF
                     EADAAPVGAGLPAIGSAALKEAERHALLATLEAKHWHLTRVAEHLGISRNTLYRKLRK
                     HGITRAD"
     CDS             723777..725126
                     /codon_start=1
                     /gene="mpl"
                     /locus_tag="PP4_06190"
                     /product="UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="BAN52472.1"
                     /transl_table=11
                     /translation="MHIHILGICGTFMGSLAVLAKELGHRVTGSDANVYPPMSTQLEA
                     QGIELTQGYDPAQLDPAPDLVVIGNAMSRGNPAVEYVLNKGLPYVSGPQWLADHVLQG
                     RWVLAVAGTHGKTTTSSMLAWVLEHAGMSPGFLIGGVPQNFSVSARLGDTPFFVVEAD
                     EYDSAFFDKRSKFVHYHPRTAILNNLEFDHADIFPDLASIERQFHHLVRTIPGEGLVI
                     HPTTEHALERVIGMGCWTPVQTTGEGGQWQARLLSPDGSRFEVLFEGEAQGVVDWAMT
                     GQHNVANALATLAAARHVGVVPAMGIEGLSAFKSVKRRMEKVAEVQGVTIYDDFAHHP
                     TAIATTLDGLRKRVGEAPVIAVIEPRSNSMKLGAHRDGLPESVNDADQVIWYAPANLG
                     WDLAATAAKCKVSSVVADSLDAIIERVKGQARPGTHVVIMSNGGFGGLHGKLAEALK"
     CDS             725123..725752
                     /codon_start=1
                     /locus_tag="PP4_06200"
                     /product="putative aromatic acid decarboxylase"
                     /protein_id="BAN52473.1"
                     /transl_table=11
                     /translation="MSGPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQL
                     VMATETDVVLPAKPQAMQAFLTEYTGAADRQIRVYGKEDWMSPVASGSGAPAAMVVVP
                     CSTGTLSAIATGACNNLIERAADVTLKERRQLILVPREAPFSTIHLENMLKLSQMGAV
                     ILPAAPGFYHQPQTIDDLVDFVVARILNLLAIPQDMLPRWGEHHFGVDD"
     CDS             725764..726036
                     /codon_start=1
                     /locus_tag="PP4_06210"
                     /product="hypothetical protein"
                     /protein_id="BAN52474.1"
                     /transl_table=11
                     /translation="MGVAALVMLGGCATVRTLDAAKPGAPVVYAGTRLDLYVINGGCC
                     PRDHYGADAPAYPRLDLPGSMVLDTLLLPLSLLTAAGVGFQATGGL"
     CDS             complement(726144..726788)
                     /codon_start=1
                     /locus_tag="PP4_06220"
                     /product="hypothetical protein"
                     /protein_id="BAN52475.1"
                     /transl_table=11
                     /translation="MYLTPQHVLLAGATGLTGEHLLDRLLNEPTITRVLAPTRRPLAE
                     HPHLENPVGDPAVFLPQLAGRVDIAYCCLGTTLKQAGSESAFRAVDLDMVVAFSKRAR
                     EMGARHLLVVSALGADPKSSIFYNRVKGEMEEALKAQDWPQLTIVRPSLLLGERIEPR
                     LAEQLVSPFSRLIPGKYRGIEACTLARALWRLALEEEDGVRIVESDELRKLGKI"
     CDS             complement(726816..728549)
                     /codon_start=1
                     /locus_tag="PP4_06230"
                     /product="peptidase C13 family protein"
                     /protein_id="BAN52476.1"
                     /transl_table=11
                     /translation="MRPLLPITLVLLLAACGDGESLLAPDARLPDGGRYRGQVVDGLL
                     QGEGRIDYPNGSWYAGGFKDGQWHGQGEWHGQNGEVYRGQFAEGLFQGLGDLTTPGSH
                     YGGTFKHGRRDGEGTLKQADQTYRGQFKDDLYDGAGELELADGSRYQGLFAKGKPNGA
                     GVRSDASGNQFSGRFVNGQLQGSGTYDSVDGEQYIGEFKDNRLEGRGRYENADGDVWI
                     GEFKDGALMGEGELLGSDGSHYKGEFVDWRLSGRGSLQLADGSIYVGGFLNDAYHGHG
                     QLTLPSGQVEGGTWANGVRVRDQKGKLLPDPLDLALLNQGRLLEESLARVPRSTPPIQ
                     LYSLVVAGDGQQSVFLREADYVSNMLKVRFGARGQVTLVNHRDHMATRPMATRENLTR
                     AASTLAERSGPEDLVFIYLTSHGSQDHQLVLDQPRLQLADLSADELATALAPLKDRDK
                     VIVISACYSGGYIAPLKDDRTVIMTAARADRVSFGCSEEADFTYFGDALFAEALNQTD
                     DLKQAFELARSSVAEREQREGFEASEPQLWAPPAVLEHWQHLRRQQAEEALRNAAQAN
                     VGAQAKTPGSH"
     CDS             complement(728793..729881)
                     /codon_start=1
                     /locus_tag="PP4_06240"
                     /product="2,3-butanediol dehydrogenase"
                     /protein_id="BAN52477.1"
                     /transl_table=11
                     /translation="MNDLSHNHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCG
                     ICGSDLHEYVAGPVFIPVEAPHPLTGIQGQCILGHEFCGQIAKLGEGVEGFAVGDPVA
                     ADACQHCGTCYYCTHGLYNICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAG
                     ALIEPLAVGMHAVKKAGSLLGQTVVVVGAGTIGLCTIMCAKAAGAAKVIALEMSSARK
                     AKAKEVGASVVLDPSQCDALEEIRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKC
                     VLVGIFEEASEFNFFELVSTEKQVLGALAYNGEFADVIAFIADGRLDIRPLVTGRIGL
                     EQIVELGFEELVNNKEENVKIIVSPGVR"
     CDS             complement(729910..731016)
                     /codon_start=1
                     /gene="acoC"
                     /locus_tag="PP4_06250"
                     /product="acetoin dehydrogenase E2 component"
                     /protein_id="BAN52478.1"
                     /transl_table=11
                     /translation="MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEINKGDEVLDVETD
                     KISSSVEAPFSGVLRRQVAKPDETLPVGALLAVVVEGEAEEAEIDALVQRFQAEFVAE
                     GGADQAQGPAPQKAEVGGRLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERR
                     VIALDLPGHGESAKALQRGDLDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARL
                     APQRVASLSLVASAGLGEAINGQYLQGFVAAANRNALKPQMVQLFADPALVTRQMLED
                     MLKFKRLEGVDDALRQLASAIADGDRQRHDLRGVLGQHPALVVWGGKDAIIPASHAEG
                     LEAEVLVLPEAGHMVQMEAAEQVNQQLLAFLRKH"
     CDS             complement(731013..732035)
                     /codon_start=1
                     /gene="acoB"
                     /locus_tag="PP4_06260"
                     /product="acetoin dehydrogenase E1 component beta subunit"
                     /protein_id="BAN52479.1"
                     /transl_table=11
                     /translation="MARKISYQQAINEALAQEMRRDSTVFIIGEDVAGGAGAPGEEDA
                     WGGVLGVTKGLYHQFPGRVLDAPLSEIGYVGAAVGAATQGLRPVCELMFVDFAGCCLD
                     QILNQAAKFRYMFGGKAVTPLVMRTMYGAGLRAAAQHSQMLTSLWTHIPGLKVVCPSS
                     PYDAKGLLIQAIRDNDPVIFCEHKLLYSMQGEVPEEVYTVPFGEANFLRDGDDVTLVT
                     YGRMVHVALEAANNLARQGIDCEVLDLRTTSPLDEDSILESVEKTGRLVVIDEANPRC
                     SMATDISALVAQKAFGALKGPIEMVTAPHTPVPFSDALEDLYIPDAAKIEAAVRKVIE
                     AARSAA"
     CDS             complement(732069..733046)
                     /codon_start=1
                     /gene="acoA"
                     /locus_tag="PP4_06270"
                     /product="acetoin dehydrogenase E1 component alpha
                     subunit"
                     /protein_id="BAN52480.1"
                     /transl_table=11
                     /translation="MSNQLSTEQLLHAYEVMRTIRAFEERLHVEFATGEIPGFVHLYA
                     GEEASAAGVMAHLRDSDCIASTHRGHGHCIAKGVDVYGMMAEIYGKKTGVCGGKGGSM
                     HIADLEKGMLGANGIVGAGAPLVAGAALAAKLKGRDDVSVAFFGDGASNEGAVFEAMN
                     MASIMNLPCIFVAENNGYAEATASNWSVACDHIADRAAGFGMPGVTIDGFDFFAVYEA
                     AGAAIERARAGQGPSLIEVKLSRYYGHFEGDAQTYRAPDEVKNLRESRDCLMQFRNKT
                     TRAGLLTAEQLDAIDARIEDLIEDAVRRAKSDPKPQPADLLTDVYVSYP"
     CDS             complement(733069..734124)
                     /codon_start=1
                     /gene="acoX"
                     /locus_tag="PP4_06280"
                     /product="acetoin catabolism protein AcoX"
                     /protein_id="BAN52481.1"
                     /transl_table=11
                     /translation="MPLPAPTVGIIANPASGRDLRRLTANAGLYSSTDKASAIQRLLA
                     AFGATGIGQVLLPSDMTGIAAAVLKASQGPGAREQHWPAIEILDLPLTQTVADTRLAT
                     RRMVERGVAMIAVLGGDGTHKAVAAEAGDIPLLTLSTGTNNAFPELREATSAGLAGGL
                     LASGQVPASIGLRRNKRLLVKVPEQQLAEWALVEVAVSPQRFIGARALSRSEDLSEVF
                     ACFAEPHAIGLSALCGLWCPVSRQDPHGAWVRLNPAAEQALLAPLAPGLLQGCGITAS
                     GPLTPGVAHRLSLASGTLALDGEREIEFAEHDTPTITLDHQGPLSVDVEAVLAHAARH
                     HLLAVPRGHRLHPANPR"
     CDS             734408..736261
                     /codon_start=1
                     /gene="acoR"
                     /locus_tag="PP4_06290"
                     /product="transcriptional regulator AcoR"
                     /protein_id="BAN52482.1"
                     /transl_table=11
                     /translation="MLAANSRAHVDCVSRVLKNADRLPQAPVPALILDSWRRSMELYR
                     LDPGSQQGPRILSQSLLNECRERAELFLRIASDAVARLHERVRGADYCVLLTDAQGRT
                     IDYRVESAIRNDCRKAGLYLGTCWSEGEEGTCGVAAVLTSKAPVTVHKRDHFRAAFIG
                     LTCTAAPVFDPLGELLGVVDVSALQSPDDRRSQHLIRQLVEQTAREIENAFFMHSAQG
                     HWVMRAHGTPGYVESQPDYLLAWDADGRLQAINSLARQRLVQHLGRLPEHIGELFDMG
                     QLRRVNTSSAQRLPGLGGLYGRVSAPQQRQRAQPLQQAQDARIEHHLRLATRVKDCNL
                     AVLVQGETGAGKEVFARQLHQQSQRRDGPFVTLNCAAIPENLIESELFGYVAGAFTGA
                     SSKGMQGLLQQADGGTLFLDEIGDMPLNLQTRLLRVLAEGEVAPLGAARRERVDIQVI
                     CATHRDLAKMVAEGRFREDLYFRLANARFELPPLREREDRLGLIHQLLAEEAQACSVE
                     VVLADAALQSLLLYRWPGNLRQLRQVLRYACAVSEGGQVQLQDLPQEVRGDAVVSVES
                     GVSCPARQLLLDALIRHRWKPADAARALGISRATLYRRVHEHCIEMPRMKG"
     CDS             complement(736435..737790)
                     /codon_start=1
                     /gene="accC"
                     /locus_tag="PP4_06300"
                     /product="acetyl-CoA carboxylase biotin carboxylase
                     subunit"
                     /protein_id="BAN52483.1"
                     /transl_table=11
                     /translation="MSGKLEKVLIANRGEIALRILRACKELGIKTVAVHSTADRELMH
                     LGLADESVCIGPASSKDSYLHIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVEKSG
                     FAFIGPKADTIRLMGDKVSAKDAMIKSGVPTVPGSDGPLPEDEEVALAIARDVGYPVI
                     IKAAGGGGGRGMRVVHKEEDLISSAKLTRTEAGAAFGNPMVYLEKFLTNPRHVEVQVL
                     SDGQGNAIHLGDRDCSLQRRHQKVLEEAPAPGIDEKARQEVFKRCVDACIEIGYRGAG
                     TFEFLYENGRFYFIEMNTRVQVEHPVSEMVTGIDIVKEMLSIAAGNKLSFRQEDVVIR
                     GHSLECRINAEDPKKFIPSPGKVKHFHAPGGNGVRVDSHLYSGYSVPPNYDSLIGKLI
                     TYGKDRDEAMARMRNALDEIVVDGIKTNIPLHRDLVRDEGFCKGGVNIHYLEHKLANE
                     H"
     CDS             complement(737808..738269)
                     /codon_start=1
                     /gene="accB"
                     /locus_tag="PP4_06310"
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein"
                     /protein_id="BAN52484.1"
                     /transl_table=11
                     /translation="MDIRKVKKLIELLEESGIDELEIKEGEESVRISRHSKTPAAQQF
                     YAPAPMAAAPAAAPVAAAAPVAEAAAAAPALKGTVIRSPMVGTFYRKPSPTSPNFAEV
                     GQSVKKGDTLCIVEAMKMMNHIEADVGGVIDAILVEDGQPVEFDQPLFTVV"
     CDS             complement(738370..738825)
                     /codon_start=1
                     /EC_number="4.2.1.10"
                     /gene="aroQ"
                     /locus_tag="PP4_06320"
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="BAN52485.1"
                     /transl_table=11
                     /translation="MATLLVLHGPNLNLLGTREPGHYGAVTLAQINQDLEQRARAAGH
                     HLQYLQSNAEYELIDRIHAARNEGVDFILINPAAFTHTSVALRDALLAVSIPFIEVHL
                     SNVHKREPFRHHSYFSDVAVGVICGLGASGYRLALESALEQLAANAQPK"
     CDS             complement(739005..740777)
                     /codon_start=1
                     /EC_number="1.8.1.8"
                     /gene="dipZ"
                     /locus_tag="PP4_06330"
                     /product="thiol--disulfide interchange protein DipZ"
                     /protein_id="BAN52486.1"
                     /transl_table=11
                     /translation="MRRLFFLLFLLLASPAFATGLLDNRPSATLGAASLANNADFLPV
                     HEAFKLSLVQADAQTVKLRFVATEGYYLYRHRFQFRTEPADIALGTPNIPKGEAKHDE
                     FFGDVEVYHGVLDIELPRTDPRAFTLLVGYQGCADKGLCYPPETARLSIDGEGGANAP
                     ATAEHGWNWKSLLLFFLAGVGLTFTPCVLPMLPILSGVVLRGQVGGLRGLSLSLAYVL
                     PMAASFAALGALMGLFGAGLNLQARLQSAWVLVPFALFFVLFALAMFGLFELKLPQAL
                     SNRLNNVANHTRGGSLLGAAVLGVLSSLLVSPCVSAPLAGALLYISASGDALGGALKL
                     FALGLGMGAPLLLVATGGAAWLPKSGPWMNTVKNAIGVLLLGLAIGLLSRVLPGPVTL
                     LLVGFLAAGVALFLGALEFVVKTARQRLAQLLGLALLVYALACWYGALSGQGDPLRPL
                     PVATLAATGSSQAAQADAWQTITTPSALDAALAQAKAAGQPVLLDWYADWCISCKVIE
                     HEVLNASQVQTQLTGFKLLRFDITESSAEQRKLLDRYQLFGPPALLFFAANGSEITAD
                     RVIGEINAGDFAQILTRVRGKVGL"
     CDS             complement(741009..742970)
                     /codon_start=1
                     /gene="ctpL"
                     /locus_tag="PP4_06340"
                     /product="methyl-accepting chemotaxis transducer CtpL"
                     /protein_id="BAN52487.1"
                     /transl_table=11
                     /translation="MRLKWLTNFNTLLLVTVCLALGVTLWWSQRALERPYQMMERYLG
                     LSQQFQNQAARNIQAYLGSGDALRHAAAMEANQQLQASLSEWPAELAGKLRPSLDNLQ
                     AFTANELLAAGKLAGDPQALLLQAEREMGANFEQLAGYARDSGSADANRYLLPLLDAS
                     VHLGRLSLARDKLISSGRPELADEVERELQLIRTQAQAIDSLPLLGVTRAAESGADDF
                     AAMMGLETQASAQQEDIAVGLKRELQSLLSRYPAELQRTREQIERRVALAASTHQRLE
                     AVQQAIAALEPEVRGEHARIAAEVRLIQGLMIGLILLIALLIDTLQRRLTRTLTSLAP
                     ALSRWAEGDFAQAISLGKTNRELHDIQESLNRLRQYLVELVGTIRHNAEQVAGSSHAL
                     AGMSAALHDGAERQAGDTGQIRDALGELEATIQQVAGDASAAADASRDAGRAVEQGQA
                     VIGQSLSGLRELVDEVQGNARMIEQLADESATIGGVLTVIRSIAEQTNLLALNAAIEA
                     ARAGEMGRGFAVVADEVRSLAQRTTGATGEIQALIDRLQQAAKSSVAGMRAQLEHAEA
                     TANQAQAADGALDEIVCAIRTISDTAVRIADVTAQQSGAVSEIRDHSERIHALGEDNL
                     QRIGEGREQGEQLLSLGGELNRAVRAFRV"
     CDS             complement(743214..744569)
                     /codon_start=1
                     /locus_tag="PP4_06350"
                     /product="putative two-component response regulator"
                     /protein_id="BAN52488.1"
                     /transl_table=11
                     /translation="MSQAVEPSPQCPTQQVTRSGLRKDDPLDPLLLPLRKPVYILLQD
                     HERAQRLAQQLEFFGLVVQALPSAAAFLASINEYPPSAIIMDVDFTGAGQGLLLAAQV
                     QQGLVLPVPLLFFSHHEADTPTRLAAVRAGGQDFLTGSLEASSLLEKVELLTNATPHD
                     PLRVLIIDDSRTQALHTERVLASAGMVTRSLTDPIRTMAELADFQPDLIILDLYMPAC
                     TGPELAKVIRHSDRYVSVPIIYLSAEDDLDKQLDAMSEGGDDFLTKPFRSRHLITTVR
                     NRAARARHLKARMVRDSLTGLYNHTHILQLLEDCSFRARREQQPLSFAMLDIDHFKKI
                     NDRHGHPMGDRVIKSLALFLKQRLRKTDFIGRYGGEEFAIVMPNTALDAAHKVLDEIR
                     RRFAEILYPAQPRDLQCTFSAGVVQLDEVLDALTMASAADEALYRAKHAGRNCVVRVE
                     P"
     CDS             744818..745885
                     /codon_start=1
                     /locus_tag="PP4_06360"
                     /product="hypothetical protein"
                     /protein_id="BAN52489.1"
                     /transl_table=11
                     /translation="MLDWKNREAKAEPRERVDGRGAAARSYLGGLWSRALGTLIGLYL
                     LVCIGLGWYWSQEPELFPVQQNAQSAAERGGQQMVVGYTTIETLKTVAGTLLNKPGGY
                     ISNDRFPPGLWMDNMPSWEYGVLVQVRDLSRALRKDFARSQSQSTEDADLAKAEPRFN
                     FDNKSWILPSSESEFEEGIKSLSRYQTRLAAGDKGAIFYTRADNLNNWLGDVATRLGS
                     LSQRLSASVGRVKLNTTLKTESVVAGQAPQVDEELVETPWLQIDNVFYEARGQAWALS
                     HLLRAIEVDFADVLAKKNATVSVRQIIRELEASQEPLWSPMVLNGSGFGMWANHSLVM
                     ANYISRANAAVIDLRQLLSQG"
     CDS             745888..746424
                     /codon_start=1
                     /locus_tag="PP4_06370"
                     /product="putative hydrolase"
                     /protein_id="BAN52490.1"
                     /transl_table=11
                     /translation="MAISPNEAAHRAASDRELVSWVDEADQVLGALPRAELRERGLIG
                     RCTFILLFNSAGELCVHRRTLSKALYPGYWDVAAGGMVTAGEGYADSAARELAEELGI
                     EGVELRFHERFYFDQPDNRLWCAVYSAVSDAPLRLQPEEVIEARFIGLEQAEQESLSK
                     PYCPDSLAALQRYKVSQG"
     CDS             746720..747091
                     /codon_start=1
                     /locus_tag="PP4_06380"
                     /product="putative translation initiation factor"
                     /protein_id="BAN52491.1"
                     /transl_table=11
                     /translation="MAKKASSFSALGGLVYSTDAGRHCPDCGQPVDACSCKQQIIPEG
                     DGIARVRRESKGRGGKTVTTVTGVPLPPDQLKDLATTLKRRCGTGGALKDGVIEIQGD
                     HVELLIGELTKQGFKAKKSGG"
     CDS             747243..749156
                     /codon_start=1
                     /EC_number="4.1.1.19"
                     /gene="speA"
                     /locus_tag="PP4_06390"
                     /product="biosynthetic arginine decarboxylase"
                     /protein_id="BAN52492.1"
                     /transl_table=11
                     /translation="MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINEAGRVEVR
                     PNGPDSAPIDLYEQVDELRQSGLSLPLLVRFPDILQDRVRQLTGAFDANIARLEYQSQ
                     YTALYPIKVNQQEAVVENIIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDR
                     EFIRLALMGQKLGHNVFIVIEKESEVALVIDEAAELKVKPQVGLRVRLSSLASSKWAD
                     TGGEKSKFGLSAAQLISVVQRFRDAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRY
                     YGELRALGLPVDHIDVGGGLGVDYDGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQG
                     LPHPHIFSESGRSLTAHHAMLVIQVTDVEKHNDDVPTIENKEALPETVQWLADLLGPT
                     DIEMVTETYWRATHYMGDVAAQYADGKISLSEKALAEQCYFAVCRRLHNSLKARQRSH
                     RQVLDELNDKLADKYICNFSVFQSLPDTWAIGQVLPIIPLHRLDEEPLRRAVLQDLTC
                     DSDGKINQYVDEQSIETSMPVHALKDGEDYLLGVFLVGAYQEILGDMHNLFGDTDSVN
                     IYQNADGSVYHAGIETHDTIEDMLRYVHLSPEELMTHYRDKVASAKITARERTQYLDA
                     LRLGLTRSSYLSS"
     CDS             749337..749792
                     /codon_start=1
                     /locus_tag="PP4_06400"
                     /product="hypothetical protein"
                     /protein_id="BAN52493.1"
                     /transl_table=11
                     /translation="MDLHGNHRLRQGRFSEPGRLYLLTTITRDRLPLFRNLLFARTVI
                     QQLRLSDHEGGCRSLAWVLMPDHLHWLIELGPTSLGNLMCAFKSRSSCALYRKGLDRR
                     HIWQPGFYDRALRKEEDVKAAARYIIANPIRAGLVRRAGEYPHWDCVWL"
     CDS             complement(749866..751203)
                     /codon_start=1
                     /gene="dinF"
                     /locus_tag="PP4_06410"
                     /product="putative MATE family transporter DinF"
                     /protein_id="BAN52494.1"
                     /transl_table=11
                     /translation="MSQLSADWRHRPTHHKVWALAAPMILSNISVPLVALVDSTVIGH
                     LPHAHQLGAVAVGATLFTFMVGLMGFLRMGSTGFAAQAAGRGDGAALRQVLVQGLLLA
                     VGFAVLIGLLAIPFSQLALHAMQPSAALQQSTEDFFHTRLLGLPAALASYALVGWFLG
                     TQNARAPLAILLTTNLLNIVLNLWFVLGLDWGVLGSARASVIAEWSAALLGLALTRPA
                     LRAYPGQVAWAALKRWQAWRPLLAVNRDIFLRSLALQLVFLLITVQGARLGESTVAAN
                     ALLLNGLLLTAYALDGLAHAVEALCGHAIGARDRDTLRRSLVVACGWSLITSLGFAGL
                     FLLGGHLFIDLQTDIDSVRTAAYPYLPYLALLPLIAVWSYLLDGLFIGATRAREMRNA
                     MLVSVLIALPVAVGMSGFGNHGLWLAFLGFMGLRAVTLGWVGWRLQQKGEWIA"
     CDS             751483..756384
                     /codon_start=1
                     /locus_tag="PP4_06420"
                     /product="hypothetical protein"
                     /protein_id="BAN52495.1"
                     /transl_table=11
                     /translation="MFNKGLLLACALALLSACDSSTPDKPAPVEKPVATAPVETQAPK
                     REDPAVLAKRYEGRELSVLDVSEVQLDGAATLSISFSAPLDAKQDFATKVHLVDTVKG
                     KLDGAWELSDNQMELRLRHLEPQRKLVLTVDKGVLAVNGNQLDSESVTQLETRDMQPT
                     IGFASRGSLLPTRLAEGLPVIALNVDKVDVEFFRVKPEMLSTFLASWGRNSSLYYYQS
                     KETLDMAELVYSGRFDLNPARNTRETVLLPIAGIKPLQDPGVYLAVMRASGTYDYSQP
                     ATLFTLSDIGVSAHRYRDRIDVFAQALEGGKALNGVNLEIHDEKGKLLAQASTDGKGH
                     AQLPITPKADTLIATQGVHTTLLRLNTAALDLAEFDITGPQSNPLQFFIFGPRDLYRP
                     GETVLLNGLLRDQDGKPVKAQPVSVEVRRPDEQVSRKFVWEADSNGLYQYQLQLANEA
                     PTGRWQLLLDLGGGRKQVYEFLVEDFLPERLALELKGSSTPLSPEEDARIQVNGRYLY
                     GAPAAGNRLSGQAYVRPLREAVPALPGYQFGSVTETELNQDLELDEVTLDQAGKAVVD
                     IESRWAEARSPLQLTVQASLQESGGRPITRRLEQPIWPAERLPGLRGLFDGEETDSDG
                     PVEFEFLVADRDGNKLAANDLKVRLIRERRDYYWNYSQSDGWSYAYNEKFLTQNEETV
                     SVKAGSTAKLSFQVEWGPYRVEVEDPQTGLVSSERFWAGYRAQDNAEGGAVRPDQVKL
                     ALDKPSYADGATAKVTVTPPAAGSGYLMIESSDGPLWWQEIEVPAEGKTFDVQLDKAW
                     ARHDLYISALVIRPGERKANATPKRSVGVLHLPLDRAERKLAVSLQAPEKMRPKQPLT
                     VKVKAANADGSVPKQVHVLLSAVDVGILNITDFKTPDPFASLFGRKAYGADQLDIYGQ
                     LIEAGQGRLASLAFGGDAAMAKGGKRPNTTVTIVAQQSLPVTLDDKGEGQATVDIPDF
                     NGELRLMAQAWTEEHFGMAEGKTVVAAPLIAELSAPRFLAGGDRTSLALDLANLSGRA
                     QQLNVEITTEGQLSLATNAVQTVALAEGQRSTLMIPVQAQGGLGQGKVHVRVTGLQLP
                     NEPTTAFEREWTLGVRPAYPAMLKHYRVALKDQPWTLPEADLAAFEPAGLEASLALSS
                     RPPLNLAEQIRALEAYPYGCLEQTTSGLYPSLYADADSLKRLGIKGEPADVRKRKIEM
                     GIEHLLGMQRYNGSFGLWSSDSEEEYWLTAYVTDFLLRARDQGYGVPAEALKKASERL
                     LRYLQERNLIEVDYSENADHTRFAVQAYAALVLSRSQQAPLGALRGLFERRADARSGL
                     PLVQLAVALDKMGDKPRAEQALQAGLGISRGKGWMADYGSALRDQALILALLQESNLA
                     SSQVDQRLFALSDELAANRWLSTQERNALFLAGRGLLGKPEGKWQARLDSAGEVREFN
                     NAEAGMKLEGPLLASPLSVQNEGSETLYQQLTLSGYPRQAPAAGGNGMQIRREYLGMN
                     GQPLDLHNLRSGDLVLVHLALKAEDRVPDALVVDLLPAGLELENQNLAQSAASLDNAS
                     SAVKEWRESMQNASVVHQEYRDDRYVAALKLDSYGTTHLLYLARAVTPGTYRVPPPQV
                     ESMYRPNLQAVGDGQGEMTVKAR"
     CDS             complement(756547..756840)
                     /codon_start=1
                     /locus_tag="PP4_06430"
                     /product="hypothetical protein"
                     /protein_id="BAN52496.1"
                     /transl_table=11
                     /translation="MHVEGFFEWLGQALGSVIRFIVDALSGLFNLLANAGGNFIDGLA
                     RTLGTDTSLISILAVIIGLMLLYSAIRAFMRASIILGIIWLVLGLWVMSWVIH"
     CDS             756918..759260
                     /codon_start=1
                     /gene="pbpC"
                     /locus_tag="PP4_06440"
                     /product="penicillin-binding protein 1C"
                     /protein_id="BAN52497.1"
                     /transl_table=11
                     /translation="MPSLARVARLLRATLIGLLVLCGLLWLADRLWPLPLPGDDLARV
                     VLAEDGTPLWRFADAEGVWRYPVSPDQVSPLYLQALLTYEDRWFYRHPGVNPLALARA
                     AWLNLRGGRVVSGGSTLSMQVARLLDPHDRTLAGKLRQLWRTAQLEWHLSKREILQIY
                     LDRAPFGGTLQGVAAASWAYLGKSPMHLSPAEAALLAVLPQAPSRLRPDRHPERAQRA
                     RDKVLQRLAEYQVWPAQQIREAAEEPLVLAPRQEPALAPLLARRLNSADSPPLIRTTL
                     DAALQRRLEDLLLGWRARLPERTSAAILVVEAQSMAVRAYLGSIELADARRFGHVDMV
                     RSLRSPGSTLKPFLYGMALDDGLIHSESLLQDVPRRYGDYRPGNFSMGFSGPVSASSA
                     LALSLNLPAVQLLEAYGPKRFAAQLRMAGMPLALPPLAEPNLSLILGGAGSRLEDLVG
                     GYAALARGGNSARVRLQPQDPLVERRLLSPGAAWIIRRILSGQARPDRDPHAELVQRP
                     QLAWKTGTSYGFRDAWSIGVGPRYLIGVWIGRPDGTPVPGQFGLASAAPLMLQVHDLL
                     SNRDSQRGISVPVERVPANVGVAAICWPLGQPMSKQDPNCRRQRFAWTLDGTTPPTLQ
                     AADQPLGLGLRESVWVNDLGLRVDGSCPSAKARDIALWPAPLEPWLPRVERRAARLPA
                     IDPACPPQVPASAPPLSIVGVRPGDNLRRPATSSEPLQLHVSALGGGGRRWWFLNGQP
                     LGETLGQDSLLVRLPQAGQAEVSALDESGETARVAFQVSE"
     CDS             759353..761017
                     /codon_start=1
                     /locus_tag="PP4_06450"
                     /product="hypothetical protein"
                     /protein_id="BAN52498.1"
                     /transl_table=11
                     /translation="MRPLAVPLLLLPWAFLAHAESLPGFLDSHEYERRLPDTNLPVDA
                     YRPASPNLRMPRPNAESQAWAPADTRMVLHKVRFEGGTVFPLSDLREHYQPLIGHSIT
                     LGELQQYTERLTERYRQDGYLLSYAYLPPQDVAEGRVNVVLVEGYIRDYRVEGDIGPA
                     GGYLQQLLTQLEAERPLTRETLERYLGLAERLPGVSIEAELAMAQTADGAARLTVRAQ
                     RKPFSAAVTLADSSRDDAQALLTATSNAQTRFAEQFKASLLLPPGDDQVHYQRLDYSQ
                     YLDAAGSQLLLSASRYRSDPGTRIRLDDGRDMTRERDSERYAVGLRQPVVVRPNEWMA
                     VQGHLYAVSEHVEDQLDGEPSLRDYDTSVRALSFEGDWRKVEGGRLRIVSAGVYQGLD
                     YLGARSDADYDLDFLRLRLSGLQSDTLAGNWQGVASGALYWSDDRLPDSERAGFGGLH
                     FGRGYPRDQADGDKGWGVAYELNYSLRGNGLALVQPYAAVDVAQAWHNRGPVDDAHLA
                     SAALGVRLGDGRYLNVALEVAKPLADVALDSLDRGPRLILSLGFQM"
     CDS             complement(761058..761831)
                     /codon_start=1
                     /locus_tag="PP4_06460"
                     /product="putative two-component response regulator"
                     /protein_id="BAN52499.1"
                     /transl_table=11
                     /translation="MSRPFSEMKLLVVDDQPVIVEQLCEFLETQGYHCLPAHSTDEAI
                     QRYLADEAIGLIICDLHMPERDGIELVRALKEVTGPRMFEAIMLTGRADKQDVIRALR
                     EGFADYYQKPMNLDELLEGVRRQEEALQERQRNFRALGGLNQRLQDLADSVDELYQDL
                     EKARGQGTHRRATDVEESESELPAAFEKLSPRQLEVARLVSKGKTNYQIACELGITEN
                     TVKLYVSQVLRLTHMHNRTQLALALTPSSSPVHLRFTTH"
     CDS             complement(761958..762428)
                     /codon_start=1
                     /locus_tag="PP4_06470"
                     /product="hypothetical protein"
                     /protein_id="BAN52500.1"
                     /transl_table=11
                     /translation="MQSIVLLLWLALCSEQDVRQRQISDLLTLGVAAGALFWLFATGH
                     SWIGADASDAGWALAIVMLLTLPGYMLGRFGADDVKLMGALALATSPHYVLGTFIGAG
                     VSVLVWLLTRRRLWTLLNPKVKKRLQALTEEMGDKQAFVPYVLAGFLLTAVWIQ"
     CDS             762488..762757
                     /codon_start=1
                     /locus_tag="PP4_06480"
                     /product="hypothetical protein"
                     /protein_id="BAN52501.1"
                     /transl_table=11
                     /translation="MKIDKNLRTSGQEREKGVAGMDFVVAVTDLAGGAAVFRIAISVG
                     AGSPANTGGAGAMHRVACFADEPAPTESAASIKAAFECYFLLPGG"
     CDS             complement(762733..763302)
                     /codon_start=1
                     /locus_tag="PP4_06490"
                     /product="hypothetical protein"
                     /protein_id="BAN52502.1"
                     /transl_table=11
                     /translation="MLRRLVLLSFALLLAACSSNNVQQDFDASRDFAAYRSWAWQEPG
                     LQYRPDDPRIKSDLTEQRIRQAVADQLDQRGLRPVQAGARPDLGVRAYLIVEQRQQQI
                     TTNYGGGWGGYWGGYWGGPMYNETRSVDYKVATIQIDMFDGRDGKLVWRGSAEQIMNN
                     YPPSPEERNSAIHNTVTKVLANYPPGSKK"
     CDS             complement(763322..763957)
                     /codon_start=1
                     /locus_tag="PP4_06500"
                     /product="hypothetical protein"
                     /protein_id="BAN52503.1"
                     /transl_table=11
                     /translation="MPYRLLCLALLPFALAACQGSNPYVASSRPLPPAPAQAATTFDA
                     SAYPAPARDYGHYRSWSWRNGQLPSGSANADPAQLADAVSGALDQHGLRPARGASGDL
                     LVSADMRLEKRLRQVRDYDTYDPYYGPYPYGGVGYGGYRHGYGGYASVPIVRTYEVEV
                     MVVRIDLYDARSGQPVWSASAESGSDKDSPRERESALRDSVHKALSGYPPS"
     CDS             complement(763979..764728)
                     /codon_start=1
                     /locus_tag="PP4_06510"
                     /product="putative methyltransferase"
                     /protein_id="BAN52504.1"
                     /transl_table=11
                     /translation="MNDRHFDELATRFAEKIYGGAKGAIRLAVLQADLAEALPDRPLR
                     ILDIGAGLGHMALWLAQRGHHLTLAEPAAPMLDGARARFAEAGQTATFIQAPWQDLLG
                     QLTEPYDLVLCHAVLEWLSEPESILPVLHQLTAPSGWLSLAFYNRDALVYRNLLKGHF
                     RKLRSNRLEGEKQSLTPQKPLDPRELKAQLDPMWQVETESGVRVFHDYMPKEFQAKAE
                     LLDLLEMELAYRRHPGFAGLGRYLHWVCRPR"
     CDS             complement(764725..765030)
                     /codon_start=1
                     /locus_tag="PP4_06520"
                     /product="hypothetical protein"
                     /protein_id="BAN52505.1"
                     /transl_table=11
                     /translation="MNLQEITQRLHQIRDNNDWRGFHSPKNLAMAASVEMAELVEIFQ
                     WLSEDQSRQLPADKLAHAGQEVGDVVLYLLLLCSELGLDMDQVVRAKLADSERRFAR"
     CDS             complement(765205..766056)
                     /codon_start=1
                     /locus_tag="PP4_06530"
                     /product="putative 3-hydroxyacyl-thioester hydratase"
                     /protein_id="BAN52506.1"
                     /transl_table=11
                     /translation="MSRNWHDLQSPAARASLYLRAASKRSISGDRLPDDGLRCFIPVK
                     PGNLAAYRRLCHFTDDGRLPGTYPHVMAFTLQLQLMTAPNFPFPLLGLVHLHNRIEVL
                     RPLGGLEGLRFAVYAHNLQAHAKGGTFDLVTEADDGIGLLWRETSRMLVRGLKLEGQA
                     GEPADDEPEPLPEATRWYADSDIGRRYAKVCGDYNPIHLSATSARLFGFPTAIAHGMW
                     SKAMALAALRGHLPHSGYAFEVDFRKPVRLPSEVVLSASEAGPEGALRLDGHGGVLHM
                     VGRWAPL"
     CDS             complement(766059..767411)
                     /codon_start=1
                     /locus_tag="PP4_06540"
                     /product="putative 3-oxoacyl-[acyl-carrier-protein]
                     reductase"
                     /protein_id="BAN52507.1"
                     /transl_table=11
                     /translation="MSDRYLGFANSNLGRRLVDALGLPRPAPLERWQAGRLRPVEGAL
                     VLGGGPLAGQVEAIAPRLTDALYSFNANHLQAEAWVAGLGPKIKAVVFDASHLSDSDA
                     LKQLREFFQPLLRSLAPSAHVVVLGRAPESLEAPLASVAQRALEGFSRSLAKELLNGA
                     TAQLLYVAPGAEDQLEGALRFFLSPKSAFISGQVLRLEACTSQVGDWTRPLAGRRALV
                     TGAARGIGAAIAETLARDGADVLLLDVPQASQDLDALAARLGGKALPLDICASDAATQ
                     LLAALPDGIDIVVHNAGITRDKTLANMTPEYWDAVMAVNLKAPQVLTQALYDNGALGE
                     NARITLLASVSGIAGNRGQANYAASKAGLIGLAQAWAPRLAEHGGSINAVAPGFIETH
                     MTAAMPMGLREAGRRLSSLGQGGRPQDVAEAIAWLSQPGSGAVNGQVLRVCGQALMGA
                     "
     CDS             767531..768808
                     /codon_start=1
                     /locus_tag="PP4_06550"
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="BAN52508.1"
                     /transl_table=11
                     /translation="MRSPRRVAILGGNRIPFARSNGAYATASNQAMLTVALEGLIERY
                     RLHGLRLGEVVAGAVLKHSRDMNLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVA
                     NKIALGQIDCGVAGGVDTTSDAPIAVNEGLRHILLQANRGKSLGERLKPFLKLRPHHL
                     KPELPRNGEPRTGLSMGEHCERMAQTWRISRAEQDELALLSHQKLVAAYAEGWQEDLL
                     TPFLSLTRDNNLRPDLSLEQLARLKPAFDRSGQGTLTAGNSTPLTDGASVVLLGTEEW
                     AAQQGLQVLAYLVDGETAAVDFVTGREGLLMAPVYAVPRLLARNGLTLQDFDYYEIHE
                     AFAAQVLCTLKAWEDADYCRERLGLDAPFGAIDRSKLNVKGSSLAAGHPFAATGGRIL
                     ANLAKLLATAGKGRGLISICAAGGQGVTVIVER"
     CDS             768929..769708
                     /codon_start=1
                     /locus_tag="PP4_06560"
                     /product="putative AraC family transcriptional regulator"
                     /protein_id="BAN52509.1"
                     /transl_table=11
                     /translation="MPIIGHPRAIPALDHLPRPLYARAESLGAGSWTTRHQHDWVQFS
                     YAISGVLAVYTRDGSYFAPPQWGVWIPADAEHEVLTSMQAEMRSLYVRRDACPWAPEQ
                     CRVLEVTPLARELIKQFCLFPADYPEYDSAEARLVAVLLDQLRTLPEVGFSLPLPRHP
                     GLLALCNGLIAAPDQSQTLQQWARELGCSEKTLMRMFQRETGLSFRNWRQRMRLLSSL
                     ALLEAGENVTEAALGCGYDSTSAYIAAFKQLFGATPGELKL"
     CDS             complement(769837..771780)
                     /codon_start=1
                     /locus_tag="PP4_06570"
                     /product="putative methyl-accepting chemotaxis transducer"
                     /protein_id="BAN52510.1"
                     /transl_table=11
                     /translation="MSIKQKLTWAFAVIAGLPIVLVATLVVLNLRGEARDGFLDGSSR
                     EIRQVSNAMNIFFQGINQNVEYMASQPMVAATGSELNKYMSAAPSYELGEQAGKLLDF
                     MTRLANAHPSYAYLSYGVNDGGYTGWPAGQKFVNYDPRTRPWYQLAMANPGKTVRTGA
                     YYWAADDAVLVSTVRAVANQLGNPGGVVNIDVSLKGLTEIVKQIKLGESGYLMLVESN
                     GNVMVDPRDAAHNFKQLASFGDGYAALAKAGKGLVEVELNGVRYMANVYPDEQLGWTF
                     IGLIEQSEVMQTTTRLTWLIGGIAVVLAALFAVVGAGFAKLIVRPINSVTSGLEDIAQ
                     GEGDLTRNLEIRGRDETAQLASWFNQFLGAIRSLIQHIGAAAGKILSTSSSSTRVSSD
                     MAEAAGRQREAVDMVSTAFHEMVATANEVARSCSQAAQSADSGQQQAREGQQQIDAAV
                     QSVDRLSHEIEQSAQSIQQLERDSNAIQSILGTIRSIAEQTNLLALNAAIEAARAGEQ
                     GRGFAVVADEVRALAKRTADSTAEIDGLLGNLASRTAEVADQMHASLEVSQQSVSRIG
                     LARDSFGQIRESVDVIRDMNTQIATAAEEQHQVAEDINRHISQIHGDAQLVAELAQAA
                     RQDSESLAGLSNELDSLVRRFRT"
     CDS             complement(771947..772357)
                     /codon_start=1
                     /gene="cueR"
                     /locus_tag="PP4_06580"
                     /product="MerR family transcriptional regulator CueR"
                     /protein_id="BAN52511.1"
                     /transl_table=11
                     /translation="MNIGQAARRSGLSTKMIRYYESIGLLKPATRSDSGYRLYQAEDL
                     HSLAFIKRSRDLGFSLEEVGKLLTLWQDRQRASADVKALAMQHIDELNRRIEELVSLR
                     DTLGELVSHCQGDDRPDCPILKDLANGAAGSCCH"
     CDS             complement(772354..774753)
                     /codon_start=1
                     /gene="copA"
                     /locus_tag="PP4_06590"
                     /product="copper-translocating P-type ATPase"
                     /protein_id="BAN52512.1"
                     /transl_table=11
                     /translation="MPASTTYDLPISGMTCASCAGRVERALRKVTGAEQVSVNLATEQ
                     ARVQAPANSLPALVDAVREAGYGVPTRTVELQIGGMTCASCVGRVERALGKLPGVEQV
                     SVNLASERAHLEVLAAVDDNLLIDTVHKAGYSASLPQTANGDQSAAQRRLRNERLAVG
                     AALLLALPLVLPMLVQPFGLHWMLPAWAQFLLATPVQFILGARFYVAAWKAVRAGAGN
                     MDLLVALGTSAGYGLSLYQWAQAPAGMAPHLYFEASAVVIALVLLGKYLESRAKRQTA
                     SAIRALEALRPERALRVVDGQEQDVAIAQLRLGDLVLVKPGERFPVDGVVEDGSSHAD
                     EALISGESLPVPKQPGDSVTGGAINGEGRLLVRTQALGTETVLARIIRLVEDAQAAKA
                     PIQKLVDRVSQVFVPAVLVLALITLIGWWLAGAPLETALINAVAVLVIACPCALGLAT
                     PAAIMAGTGVAARHGILIKDAEALERAHAVNRVVFDKTGTLTSGSPRVVHSQAQLGNS
                     ADLHRLAGALQRGSEHPLAKAVLDACAEQKLDVPSVTDSQSLTGRGIAGCVEGRELAL
                     GNRRLLDESALQPGDLAAKAQAWEAEGRTLSWLIERGTQPRVLGLFAFGDSLKPGAAQ
                     AINTLHAQHISSHLLTGDNRGSAKVVADALGIDDVHAEVLPADKAATVAALKLDGVVA
                     MVGDGINDAPALAAADIGIAMGGGTDVAMQAAGITLMRGDPRLVPAALEISRKTYAKI
                     RQNLFWAFIYNLIGIPLAALGYLNPVLAGAAMALSSVSVVSNALWLKAWKPTSTNEEA
                     P"
     CDS             complement(774806..775192)
                     /codon_start=1
                     /locus_tag="PP4_06600"
                     /product="hypothetical protein"
                     /protein_id="BAN52513.1"
                     /transl_table=11
                     /translation="MFRAALGVVGLLSALAAVPPASAEGNSDYSVLIISRERLEVATN
                     CEIGVYLNDQLSGRVFQEQSTSFNLPPGPVDVRLRLLPGQMPGCAAGVEDQRSTRLNL
                     QAGQINKYRIAMGHYGLELKRAGLGY"
     CDS             775338..775535
                     /codon_start=1
                     /locus_tag="PP4_06610"
                     /product="hypothetical protein"
                     /