LOCUS       AP012162               28572 bp    DNA     circular BCT 07-OCT-2016
DEFINITION  Komagataeibacter medellinensis NBRC 3288 plasmid pGXY030 DNA,
            complete sequence.
ACCESSION   AP012162
VERSION     AP012162.1
DBLINK      BioProject:PRJDA64985
            BioSample:SAMD00060987
KEYWORDS    .
SOURCE      Komagataeibacter medellinensis NBRC 3288
  ORGANISM  Komagataeibacter medellinensis NBRC 3288
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Acetobacteraceae; Komagataeibacter.
REFERENCE   1  (bases 1 to 28572)
  AUTHORS   
  CONSRTM   Gluconacetobacter xylinus genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (13-APR-2011) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Bioresource
            Information Center (NBIC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Ogino,H., Azuma,Y., Hosoyama,A., Nakazawa,H., Matsutani,M.,
            Hasegawa,A., Otsuyama,K., Matsushita,K., Fujita,N. and Shirai,M.
  TITLE     Complete Genome Sequence of NBRC 3288, a Unique
            Cellulose-Nonproducing Strain of Gluconacetobacter xylinus
            Isolated from Vinegar
  JOURNAL   J. Bacteriol. 193, 6997-6998 (2011)
COMMENT     ##Genome-Assembly-Data-START##
            Genome Coverage       :: 8x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            This work was done by Gluconacetobacter xylinus genome sequencing
            consortium
            including Department of Microbiology and Immunology, Yamaguchi
            University School of Medicine,
            National Institute of Technology and Evaluation,
            Genetic Resources Technology, Faculty of Agriculture, Kyushu
            University,
            Department of Biological Chemistry, Faculty of Agriculture,
            Yamaguchi University and
            Mizkan Group Corporation Central Research Institute.
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps
            and the genomic and proteomic data of the microorganisms
            analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..28572
                     /db_xref="NBRC:3288"
                     /db_xref="taxon:634177"
                     /mol_type="genomic DNA"
                     /organism="Komagataeibacter medellinensis NBRC 3288"
                     /plasmid="pGXY030"
                     /strain="NBRC 3288"
     CDS             1..1056
                     /codon_start=1
                     /locus_tag="GLX_31410"
                     /product="plasmid replication initiator"
                     /protein_id="BAK85302.1"
                     /transl_table=11
                     /translation="MVSETPNLPVVHEALLPERHPQHDLFICDVADAVLKDVMPQMEH
                     PFYSLSKKPETSVRRYEHNGQWLEITPSVKGLATIYDKDILIYCISQIMAKLKAGEKV
                     SQRVRISSRDLLIFTNRGTAGKDYKALIEALDRLEGTRIRTNIVTGDEEQVDGFGLID
                     ASSIRRKLGLDGRLLHCEIKLSDWVFNAIKSNDVLTLHRDYFRLRKPLERRVYELARK
                     HCGQQAVWKASLEILLKKSGSQSPEKLFRQMIKNLAASDHLPDYRVEFDSQKDMVTFI
                     NRGTMKAAEPAAEAWMGALDPDIYGDARNIAPGWDVHHLEREWRMWLGDNEIAPKNPE
                     RHFIKFCETWFAKRGQP"
     CDS             complement(1096..1353)
                     /codon_start=1
                     /locus_tag="GLX_31420"
                     /product="hypothetical protein"
                     /protein_id="BAK85303.1"
                     /transl_table=11
                     /translation="MSRFAGLKKTVAPSVVEPAAQTVVEKARPRNPREGKRAVVGYFS
                     PAVSKGLHQLALDTDTTIQGLIGEAIDDLMRKHGRHPFGER"
     CDS             complement(1381..2040)
                     /codon_start=1
                     /locus_tag="GLX_31430"
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="BAK85304.1"
                     /transl_table=11
                     /translation="MKTIAIISQKGGAGKTTLALHLATSASAAGYVSLILDTDPQATA
                     SSWKAWRGDVEPDVVDCAAHALLSRKLEQASELGAELSIIDTPPHADIMAREACRVAD
                     FLLIPCRPRAFDMDAVRTTAELVRASGKPAFVIFTAGPPRAPQVYKEAAEVVAQFGIP
                     VAPVVLPERAVFHHSVGSGRTAQEAEPESKAAADIALLWNWVCDQVNMPSHKQDDTKT
                     R"
     CDS             complement(2222..2509)
                     /codon_start=1
                     /locus_tag="GLX_31440"
                     /product="DNA resolvase"
                     /protein_id="BAK85305.1"
                     /transl_table=11
                     /translation="MTFDLATPHGRMLATVLAGIAEFERDLISERVKSGLAAARARGK
                     VLGRQKGERPKSDRLAPKVLALVAEKRSYRWIARDLGISKNTVAAIVQRER"
     CDS             complement(2595..3209)
                     /codon_start=1
                     /locus_tag="GLX_31450"
                     /product="DNA resolvase"
                     /protein_id="BAK85306.1"
                     /transl_table=11
                     /translation="MLIGYARVSKADGSQSLDLQHDALRAAGIEPGNIYDDRASGSRD
                     DRPGLAACLKSLRDGDVLVVWKLDRLGRSLAHLVNTVKDLSDRRIGLRVLTGKGAQID
                     TTTASGRMVFGIFATLAEFERDLIRERTMAGLAAARARGRKGGRKFALTKAQVRLAQA
                     AMAQRDTSVSDLCKELGIERVTLYRYVGPKGELRDYGKRVLSLA"
     CDS             complement(3660..4304)
                     /codon_start=1
                     /locus_tag="GLX_31460"
                     /product="cation transporter MgtC/SapB"
                     /protein_id="BAK85307.1"
                     /transl_table=11
                     /translation="MSFSEFIIDTLLPLVAAATVGLTLGFERELARKPAGLRTQFLIT
                     LGTAIFVLAGRSIPGMETGRVAANVVTGLGFLGAGVILQHRGTVRGLTTAALIWVNGA
                     LGLAAATQEYVLAGVGVGLALAALRVLALIEKRLGEKWQILEYQITTYENESVVQAIH
                     DALSKCRLQEGPLAYERQDGVTRMHISFCDTPTRHREFLEQLRKMSDVTDVRVL"
     CDS             complement(4508..4972)
                     /codon_start=1
                     /locus_tag="GLX_31470"
                     /note="protein synonym:Mercuric resistance protein MerD
                     protein"
                     /product="transcriptional regulator MerR family"
                     /protein_id="BAK85308.1"
                     /transl_table=11
                     /translation="MIAYNPVDIGFAARGSNSGERMPCRQRREVSDAPYTASRLAHDA
                     GVSVHIVRDYVLRGLLRPARRTQSGHRLYDDHALERMRFVRTLFEAGVGLDELTRLCH
                     ALDGGGGDAIEFLLCLRARLAARRAALDVLDGHLEQMISAIGADTAKESARA"
     CDS             complement(4969..5610)
                     /codon_start=1
                     /locus_tag="GLX_31480"
                     /product="organomercurial lyase MerB protein"
                     /protein_id="BAK85309.1"
                     /transl_table=11
                     /translation="MKESVMSPTTYIEHFPLISRSQDSAELLVALLRELAKGRPVSRT
                     TLAGILNWPDERIAAVLAQTASTEYDDDGNIIGHGLTLRETAHSFEIDGRRLYAWCAL
                     DTLMFPALLGCTARVSSRCAATGAPVSLTVSPNEIRAVEPADVAVSLVPPQETNDVRR
                     SFCCHVHFFASTHVAQDWASKRPGLTIIGVREAFCVGQELNRQLLHPPHRATP"
     CDS             complement(5607..7037)
                     /codon_start=1
                     /locus_tag="GLX_31490"
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="BAK85310.1"
                     /transl_table=11
                     /translation="MSDCCTTEGSRKGGYDLAVIGAGSAGFSAAITAADQGANVALIG
                     HGTIGGTCVNVGCVPSKTMIRAAEALHGVRAAQRFPGLVGEASVANWPALVAAKDELV
                     TSLRQKKYIDLLPEYNGVAYLEGAARLNGQGVMVNGAAISAGKIIIATGSSPALPDIP
                     GIEEVPYLTSTTALELGALPRSLLVIGGGYIGCELAQMFARFGVAVTLITRRRLLPEA
                     EPEISEALTGYLRDEGITVRTGLTYRGIARTAAGVELSITTDGAQQVIAAEQVLVATG
                     RAPNTDGLGLVEAGIAQADNGSVVVDDRMRTSRPDVYAAGDVTGRDQFVYMAAYGAKL
                     AAHNALNGDDLVYDNTVMPWVTFTDPQVAGVGLSERAAQAAGFETKTSIVALDQVPRA
                     LAARDTRGLIKLVADKTSDRLLGGQIVAPEGADSIQTMVLAIKHGMTTKALGETIFPY
                     LTTVEGLKLAAQGFGKDVAKLSCCAG"
     CDS             complement(7040..7288)
                     /codon_start=1
                     /locus_tag="GLX_31500"
                     /product="hypothetical protein"
                     /protein_id="BAK85311.1"
                     /transl_table=11
                     /translation="MKDATLLKTGIAGSLIAVICCATPLLVVLLGAIGLSAWLGWIDY
                     VLMPALAFFVALTGYGLWRRQRAADCCATETQTNKENS"
     CDS             complement(7299..7631)
                     /codon_start=1
                     /gene="merP"
                     /locus_tag="GLX_31510"
                     /note="protein synonym:Mercuric transport protein
                     periplasmic component MerP"
                     /product="heavy metal transport/detoxification protein"
                     /protein_id="BAK85312.1"
                     /transl_table=11
                     /translation="MKRPLLIALGAAALGAAGLLSAPTISPLAAQAAPAQAAAVQKTT
                     FSIENMTCAMCPVTVTKAMKGVAGVKSVTVDFAAKTATVIYDPATATVAAIAAASTNA
                     GYPARPAG"
     CDS             complement(7659..8090)
                     /codon_start=1
                     /gene="merT"
                     /locus_tag="GLX_31520"
                     /product="mercuric transport protein MerT"
                     /protein_id="BAK85313.1"
                     /transl_table=11
                     /translation="MKWNSNREASRMDRANMQMQVLEQPKATASRRPGWFAAGGVVGA
                     ILASTCCIAPLLLLMLGVSGAWMGNLTALEPYKPYAAAVALVFIGLGFRQVYFKPKGA
                     CAEDSYCARPQASRITKSALWLATVLVLLALTISWWAPLFY"
     CDS             8136..8549
                     /codon_start=1
                     /locus_tag="GLX_31530"
                     /product="transcriptional regulator"
                     /protein_id="BAK85314.1"
                     /transl_table=11
                     /translation="MSDHVFGKGMQRADLAKLTGCNLETIRYYEKIGMMPDPPRTASG
                     YRIYGEDHVSRLRFILRGRELGFSLDEVRGLLALVEGGAQTCAEVKERTERHLADVRA
                     KIADLRRIEKVLTQTAAQCSGDMVPDCPIIEVLAS"
     CDS             complement(8642..9211)
                     /codon_start=1
                     /locus_tag="GLX_31540"
                     /product="DNA resolvase"
                     /protein_id="BAK85315.1"
                     /transl_table=11
                     /translation="MSDILGYARVSTGDQDVAGQTIRLEKAGAIKVFTDVMSGKSMDR
                     PGLVELLAYARKGDTLAVVRLDRLGRSLAELLATVEKLRAQGVALLSLEEKIDTSSAA
                     GELIFHVFGAIAHFERRLISERTKDGIAAARAKGKRPGRQPLDMARVDAAIKLVEARI
                     SPTEAARQLGIGRSTIYREMRRLGIERPA"
     CDS             9210..12320
                     /codon_start=1
                     /locus_tag="GLX_31550"
                     /product="transposase"
                     /protein_id="BAK85316.1"
                     /transl_table=11
                     /translation="MPASPKRSFCGRSEARPLHPTHIRPHTMSLYSCLSIVAIDLLWT
                     GIGMTKRKHQLLTESERGQILAIPTDRDHLARLYTFEPADIEIIGARRERRNRLGVAL
                     QLALLRHPGIALAQLIRDRGAIPHDLAAFVAEQLGLRVTDLADYAARDQTMTDHAREL
                     AARLGLRGPTRADIPFMIEAAAKTAWATDKGMTIASGVVTALREARILLPSISTIERA
                     SSAGRARARKQAAYALIADLSTEQVQALDQLFDDAGGMSQLAFLKTIPVAAKPDHIRQ
                     ILDRLRQVRKIGISREVAGRIHADRLRQYVTEGRASPAYMTERYIPSRRRATLVAFLL
                     DLEERLTDSALEMADKLIGSIFTRAKNAQTRNYATTSKNVARLMLIFRRTIDTLTDAV
                     DTGEDPIEALDASVGWNTLLRARPEVATIAETASLDPLTVAADRYATLRKFAPDLLEA
                     LQFRAGKGSAKTIAAIEILRTLNKSGKRDLPSDAPMPFRKEWRKIVVGDDGKINRRLW
                     EIATIAHLRNKLRSGDVWVERSAGYRRFDSYLLSVPKAKPIVSALGLPPTAGEWLEQR
                     GRELDWRLKKFAQRLKRDALEGVRYRDARLQISPVRAIATPDAEALADRLDAMMPRIR
                     ITELLHEVARETGFLAAFTNLRTGEPCPNENALLATILADATNLGLSRMAAASQGVTR
                     DQLLWTHDAYIRDDSYRAALAVLINAHHRLPFSRVWGDGTTSSSDGQFFRGAKRGASG
                     GDINARYGVDHGFSFYTHNSDQRAPYHVNVISAATHEAPYVLDGLTSHGTDLKIAEHY
                     TDTGGATDHVFALCAMLGFRFCPRLRDFPDRRLATIAPVAAYPSLTPLLGKRIRSDII
                     AEQWDDVLRLVGSIKAGHVAPSVMLRKLAAYERQLQLDVALQEIGKIERTLFMLDWLE
                     NPDLRRRCHAGLNNSEQRHALTQAIYTFRQGRIIDRSHEAQKYRASGLNLVIAAIVYW
                     NTIYMDAAAQHLRSTSVAVPDDLLAHTSPVGWEHIAFSGDFLWDRAAASNGRKALNLP
                     PDSRVA"
     CDS             12548..13459
                     /codon_start=1
                     /locus_tag="GLX_31560"
                     /note="fragment"
                     /product="transposase"
                     /protein_id="BAK85317.1"
                     /transl_table=11
                     /translation="MRDWIAREAEAATSNEDLARRFVAECRRTRTILPGFSTIERLCA
                     DALVKAERRIEDRIAHRITPALSENLAHLLENTVDGRITRFVWLRQFEVGANSAAANR
                     LMDRLEYLHKFDLPADLLDGVPAHRVTRLRRQGERYYADGMRDLPEGRRLAILAVCTM
                     EWRSSLADVIVETHDRIIGRLYRVSERLCSTKIADEKAAVRDTLKSFAEIGGALLGAQ
                     DDGASLDGIITTGPGWERFRTLVATASALTNVLAADPLSRVLDGYHRFRLYAPRMLRL
                     LDMQAAPIAKPLLTAIALLQSGIKSDH"
     CDS             13574..14170
                     /codon_start=1
                     /locus_tag="GLX_31570"
                     /product="DNA resolvase"
                     /protein_id="BAK85318.1"
                     /transl_table=11
                     /translation="MTHTLIGYARCSTDKQDLAVQQQELLKLGVAADRIYTDKGFTGT
                     NRERPGLDQALAAVRSGDTLVVPKLDRLARSVPDARAIGDSLTARGVKLQLGSSIHDP
                     SDPMGRLFFNILATFAEFEADLIRMRTREGMAVARAKGKLRGKKPKLSDRQQKELRRM
                     YDTGDYSISDLAEVFSISRPTVYRALSRTASTFLLGSL"
     CDS             complement(14130..15182)
                     /codon_start=1
                     /locus_tag="GLX_31580"
                     /note="fragment"
                     /product="type II restriction enzyme, methylase subunit"
                     /protein_id="BAK85319.1"
                     /transl_table=11
                     /translation="MWGILKQHLHTHLADRFGFFLPLAGITTVQKIKNNPIDVKATSR
                     LNRLYVELLKENPDWATEERRHDMNHFMARLIFCFFAEDTGIFLNNLFTRTIQTMTEG
                     ATDQTHEVMAELFRTMDLDTRNDDREKGGVKSWARDFPYVNGNLFSGTTDCPKFNKLA
                     RTYLLRAGELNWAQINPDIFGSMIQAVADEGERGALGMHYTSVPNIRKVLNPLFLDGL
                     REELEKAGQNTQKLHALKERLSGIRVFDPACGSGNFLVIAYKDMREIQSEIDDRLKIE
                     RAERKSVIPLANFYGIEIRDFAVEIARLSLLIAEFQSDEIHIDQKQARLNGVTTRKCT
                     LRTLRVNPTRTLRLFC"
     CDS             complement(15219..16064)
                     /codon_start=1
                     /locus_tag="GLX_31590"
                     /product="transposase"
                     /protein_id="BAK85320.1"
                     /transl_table=11
                     /translation="MMSVTERIRQSLLALHMARALETLDHTLGRLEKGEISAIEAIDD
                     LLAEELNLREGRRISVALRTARLMPIKTIESFDFSFQPSLDRHRITALAQLEFINRAE
                     VLHFLGPPGTGKSHLATAIGVAAVRAGRSVYRCSLAELLEALTRAEREGRLAEKIRFY
                     TRASLLIVDEIGYLPITPGGANLFFQLVNARYEKGAMILTSNRGFAEWGEVFGDPVVA
                     TALLDRLLHHAVVVHIEGASYRLRQHADLIPEHTRAHANLMPPAAPKRRGRPPKHGAI
                     DHLNG"
     CDS             complement(16061..17311)
                     /codon_start=1
                     /locus_tag="GLX_31600"
                     /product="transposase"
                     /protein_id="BAK85321.1"
                     /transl_table=11
                     /translation="MIGLREVVLIQELKRQGLSISAIARQTGLDRKTVKKYLANGLET
                     PAYAPRKPVASAAEPYRTYLLERMASYPGLSSRRLHREIRDMGYDGAYSSLTEYLRQI
                     RPPLPRPYERRFETGAGVQAQVDFAEFQTVFTGEPGIVRKVWLFSMVLGHSRWLWGRF
                     CPNQGLETVMRCHIAAFEAMAGCCTEILYDRMKTAVIGEDDAGVVTYNASLVALLAHY
                     GSAPRACQPYRAKTKGKVERPFRYIRQDFFLGRSFHDLDDLNAQFDVWRADIANARAH
                     ATTGRIVQEHFAQEQPHLHPLPALRYDAVLSVERRISREGMVAVAGNYYSVPDTARRR
                     VVEIQHHTHEVLIFEEGKLIARHPVLEGKNRKRIEPGHRKAPPVQHAEMLPTTPAVPI
                     LQRPLAFYGAVGERLANINAKGTA"
     CDS             complement(17451..17798)
                     /codon_start=1
                     /locus_tag="GLX_31610"
                     /note="fragment"
                     /product="type II restriction enzyme, methylase subunit"
                     /protein_id="BAK85322.1"
                     /transl_table=11
                     /translation="MNPVEIEEAVSQIAEAPFNPGEFPFEFLQAFGNRDVTIKRLRKD
                     NRSDVPGAVLQRNNIHLAVCPEGQVAQTLNLLRESPKTQSAKARFLLATDGVTFEAED
                     RTEDEHITDVFTL"
     CDS             complement(17838..18932)
                     /codon_start=1
                     /locus_tag="GLX_31620"
                     /product="cell filamentation cAMP-inducing protein Fic"
                     /protein_id="BAK85323.1"
                     /transl_table=11
                     /translation="MLTPTYLIRPLPPQTDIETVPVLRALVAANKALAELKGRAATIP
                     NQGILIDTLALQEAKASSEIENIVTTQDELFQADLFPEGPDSVAAKEVALYRDALHLG
                     FQQLKETDGLILNKGLIAIFQRLKKREDGFRNTPGTALKNERTGEVVFVPPQDGREII
                     GHMSDLERFVNDDGLCDLDPLIKMALIHHQFESIHPFPDGNGRVGRILNVLYLTRTGL
                     LDIPILYLSRYITRHKDEYYRLLQKARDEGAWEAWILYMLRAVAETSRITLELIEGMR
                     AQMATMKQRMRTELPKIYSQELLNNLFRHPYTKIEYVQTDLNIARQTAGKYLDQLSEK
                     GLLSKHRSGRSNYYINAPLVRLFLEVSGGA"
     CDS             complement(19048..19731)
                     /codon_start=1
                     /locus_tag="GLX_31630"
                     /product="hypothetical protein"
                     /protein_id="BAK85324.1"
                     /transl_table=11
                     /translation="MENVMSETDPAERAFADLCAEMTVLRRSVEALPQAWRDNRPPDY
                     TEDLARVVKAMNAVGARMEAIEANPTLKMTPQAYGQGIRQAGISASQEMQAAFQKAIG
                     EVQGERRVLANIIGQSRQQDRQNWWLLGVGLACLVVGIGLSPVLAYLLPSSIGTRVAS
                     FIVGEKDRWNSGAMMMAVSNPEGWQRVREDSQLVEANRDRIAACQKAASGQEKTQKPC
                     VIIVSAEQE"
     CDS             complement(19732..20001)
                     /codon_start=1
                     /locus_tag="GLX_31640"
                     /product="addiction module toxin Txe/YoeB"
                     /protein_id="BAK85325.1"
                     /transl_table=11
                     /translation="MKVIFHEDGWEDYLSWFQSDNAVLEKINALIEDVRRHPFQGIGK
                     PEPLKGQLSGWWSRRITGEHRLVYRVQGRAGEDQRIEIAQCRFHY"
     CDS             complement(19998..20273)
                     /codon_start=1
                     /locus_tag="GLX_31650"
                     /product="prevent-host-death protein"
                     /protein_id="BAK85326.1"
                     /transl_table=11
                     /translation="MTYVSYTDLRQNLAHYLDEAVNSRAPIVVTRKTGKGSVVLMSEE
                     EFSGWQETVHLLSSPRNAERLLRSIRDIEHGAATEHDLLEPQGEPSA"
     CDS             complement(20499..20636)
                     /codon_start=1
                     /locus_tag="GLX_31660"
                     /product="plasmid stabilization protein"
                     /protein_id="BAK85327.1"
                     /transl_table=11
                     /translation="MQKKEAAVRLGSLLGAIGREVGVRDQDIAVLQTRDQTPAEAMSF
                     E"
     CDS             complement(20662..21054)
                     /codon_start=1
                     /locus_tag="GLX_31670"
                     /product="PilT protein domain protein"
                     /protein_id="BAK85328.1"
                     /transl_table=11
                     /translation="MILVDSSVWIDFFRGTVTPQVEVLDRLLGEEPVAIGDLMMTEVL
                     QGFANERDFNKARRMLGALDLVEIGGRDVMIEAARYFRDLRARGITIRKTIDTLIATR
                     CIVSGYRLLYSDRDFDPFVTHLGLERVV"
     CDS             complement(21051..21245)
                     /codon_start=1
                     /locus_tag="GLX_31680"
                     /product="hypothetical protein"
                     /protein_id="BAK85329.1"
                     /transl_table=11
                     /translation="MRTNIIIDDTLMTDALKASGVKTKKEAVELGLRTLIKLNQQRQL
                     RSMKGRLEWRGDLDAMRSDV"
     CDS             complement(21300..22364)
                     /codon_start=1
                     /locus_tag="GLX_31690"
                     /product="conjugal transfer protein"
                     /protein_id="BAK85330.1"
                     /transl_table=11
                     /translation="MTVDRAHVLATGSMDRHGAYVALSRHRGSVSVHWGRDDVGDRDG
                     LVRRLSRERLKDTTLDYPHVRDRDAGFARRRGLHVPESEIVVEREKAASGPRQDRQAE
                     GVPMPEPASAQQKRGMFDGLDLSVRSGRRTAEKDVSAGMDAGAGKGESGVEREAPVSP
                     FAGLRLPRVRREQVPAGMDGLVPGSDPLHQAVERYARAWVDAERMVRQELPVLEHQKK
                     ALFEAGRDLERVRRGGEADLRAALKHQPEIRQALYGLEGPARARKLLEGLEHEDRVRK
                     SPDLRAARFVKAWDGLSREQQGVALKELKRDAQLESILREKSRELGIRKGSTLDHGLH
                     PHQREQALSRSRSRGMDMGM"
     CDS             23412..24119
                     /codon_start=1
                     /locus_tag="GLX_31700"
                     /product="hypothetical protein"
                     /protein_id="BAK85331.1"
                     /transl_table=11
                     /translation="MPLGLPHRERCFFQTLLDPDHRARGEPLPPVPVFPERDQLRTCL
                     HPNHDSTELRGIRRMPVHEPRQVLTGECALLSGQRLQRHMRLGQQPLAIASRDLQMVS
                     DPLRVLAPLFPTHAGRTDLVLRLKIDPLCHERPMIDPHIQVQFSQPFIGERRPSPPPC
                     QQEFFVIPRAFFRAEPLLVHKPRGQHHMRMGLRLTVLTNIPMHIEIGNYAAFHELLPH
                     EIPCQCDPLRLGHFARD"
     CDS             24486..24845
                     /codon_start=1
                     /gene="traC"
                     /locus_tag="GLX_31710"
                     /product="conjugal transfer protein TraC"
                     /protein_id="BAK85332.1"
                     /transl_table=11
                     /translation="MSDAVLGCVIEYGTDQQNRGSKMRRPRDIDAELKALQEKAKQLK
                     AQRTIQLGELVEATGADTLSIEALAGVLLAAIEQADGKPEAVARWTERGTAFFQGGAK
                     KGVRKGTGNDQNGASHT"
     CDS             24826..25176
                     /codon_start=1
                     /locus_tag="GLX_31720"
                     /product="conjugal transfer protein TraG/DotL/TrbC/IcmO"
                     /protein_id="BAK85333.1"
                     /transl_table=11
                     /translation="MELLTLERRIRKQTALIHRHLARKARTDMRDWAKARRERTHHLI
                     EVGGLVQKAGLVDLTDDDRATLLGAFLDIAGQLRGGNEITPDNLKTRWRRAGLHAFDR
                     DREHDRAADGNNHD"
     CDS             25169..25675
                     /codon_start=1
                     /locus_tag="GLX_31730"
                     /product="transcriptional regulator Ros/MucR family"
                     /protein_id="BAK85334.1"
                     /transl_table=11
                     /translation="MTDHETRSSETDTLRELTTRIVAAYVSSNTVPVDTLPDLIATVF
                     QGLGSLEQTTIETPDLVPAVPVKKSVFPDYIICLEDGKKLKVLKRHLQSAYGMTPKQY
                     REKWGLPESYPMTAPSYAARRSALAQENGLGRAARTAPDVIAPTAEDQVPVTHVPEKK
                     RGRRPKLA"
     CDS             complement(25729..25983)
                     /codon_start=1
                     /locus_tag="GLX_31740"
                     /product="hypothetical protein"
                     /protein_id="BAK85335.1"
                     /transl_table=11
                     /translation="MSRTYHHSRKHGRDHRWANRPDRCGYGGSRDASESPNWYSHLHD
                     IRLGRHHDRHVARLIIKGDLDPVEAVFPYTGTRRPHEYYW"
     CDS             complement(26069..26332)
                     /codon_start=1
                     /locus_tag="GLX_31750"
                     /product="hypothetical protein"
                     /protein_id="BAK85336.1"
                     /transl_table=11
                     /translation="MSYKNRSMPSLHSDEAAEDFVATADLTQYDLSGFKPMRFEIEPK
                     AAALNMRLPASLLDAVKARAKAKGIPYTRYVRMLLETDVAQTR"
     CDS             complement(26348..26734)
                     /codon_start=1
                     /locus_tag="GLX_31760"
                     /product="pilus retraction motor protein"
                     /protein_id="BAK85337.1"
                     /transl_table=11
                     /translation="MRILLDTHLLLWAAGEPDKLSARARTLMEDPGNDLVFSAASLWE
                     ITIKTGLGRADFQVDPHLLRRGLIENGYEELPITSQHALAVGQLPDVHRDPFDRILVA
                     QATVEGLLLLTHDPLVKAYPGPIEAV"
     CDS             complement(26731..26976)
                     /codon_start=1
                     /locus_tag="GLX_31770"
                     /product="prevent-host-death protein Phd"
                     /protein_id="BAK85338.1"
                     /transl_table=11
                     /translation="MRTVNIHEAKTHLSRLIDAAMKGESFIIAKAGRPMVRVSPITAP
                     EELQQRRLGFLAGKIRVPEDFDRMGQDDIVSLFDGPA"
     CDS             complement(27103..27498)
                     /codon_start=1
                     /locus_tag="GLX_31780"
                     /product="death-on-curing protein"
                     /protein_id="BAK85339.1"
                     /transl_table=11
                     /translation="MTAFVWIDERDTLILHDRLLGVHGGASGVRDAGLLKSALARPQQ
                     HAAYADPLDPVHLAAVYTAGIVKNHPFIDGNKRTGFVLGVLFLELNGYRFTAAQEDAA
                     NAVLALAAGQMDELGYAAFLTANVASERV"
     CDS             complement(27495..27722)
                     /codon_start=1
                     /locus_tag="GLX_31790"
                     /product="transcriptional regulator"
                     /protein_id="BAK85340.1"
                     /transl_table=11
                     /translation="MVELKVRKFGNSLGVVLPKEVISRLNTQDGAPLYLTEAPEGGYR
                     LVPYDPDFETKMTKAEDIMRRYRDTLHVLAQ"
BASE COUNT         5847 a         8986 c         8007 g         5732 t
ORIGIN      
        1 atggtatctg aaaccccgaa tctgcctgtt gttcatgagg ccctcctgcc ggagcgtcat
       61 ccgcagcatg acttattcat ctgcgacgtg gcagatgccg tgcttaagga cgtgatgccg
      121 caaatggagc atccgttcta ttccctgtcg aaaaaacccg aaacttccgt tcgtcgctat
      181 gaacataacg ggcaatggct ggaaatcacg ccaagcgtga agggtcttgc tacaatctac
      241 gataaggata ttctgattta ctgtatttcg cagatcatgg cgaaactaaa ggccggggaa
      301 aaagtatcgc aacgggtgag gatcagcagc cgcgacttac tcatcttcac caatcgcgga
      361 acggcaggta aggactacaa agccctcatc gaagccctcg accgccttga aggcacacgt
      421 atccgcacta acattgttac aggcgacgaa gaacaggtgg acggttttgg cctgatcgac
      481 gcttcatcca tccgccgcaa acttggcctc gacggtcgcc tattgcattg cgagatcaag
      541 ctgtcggatt gggtctttaa cgcaattaag agcaatgatg ttctgacact gcatcgtgat
      601 tatttccggc tacgcaaacc gctggaacga cgcgtttatg aactcgctcg caaacattgc
      661 ggtcagcaag cggtatggaa agcctctctt gagatcctac tgaaaaaatc aggctctcaa
      721 agcccagaaa aattattccg acagatgata aagaacctcg ctgcaagcga tcatctaccg
      781 gattaccgtg tcgaattcga ttctcagaaa gacatggtaa cattcatcaa tcgcggcaca
      841 atgaaagctg ccgagccagc agccgaggct tggatgggtg cgctcgatcc tgatatttac
      901 ggggatgctc ggaacatcgc gccagggtgg gatgtgcatc atctcgaaag agaatggcgc
      961 atgtggctgg gtgataacga gatcgctccg aagaaccctg agcggcattt catcaaattc
     1021 tgcgagacgt ggtttgctaa gcgtggtcaa ccctgattgt acaaatatac gagcataatc
     1081 tatctaaata gataatcagc gctctccaaa aggatgacga ccgtgcttac gcatcaagtc
     1141 atcaatggcc tccccgatca aaccctgaat agttgtatca gtatcaagcg caagttgatg
     1201 tagtcccttg ctaactgctg gagaaaaata ccccaccaca gcccgcttac cttctctcgg
     1261 attacgtggg cgggctttct ctaccaccgt ttgcgctgcc ggttccacaa ccgatggcgc
     1321 gaccgtcttt ttgagaccag caaaccgact catgccgtat atcctcaact tagaaaattg
     1381 ctaacgcgtt tttgtgtcat cttgtttgtg tgatggcatg ttaacttgat cacacaccca
     1441 attccacaac agtgctatat cagcagcagc cttgctttcc ggctctgctt cctgcgcggt
     1501 acgaccggaa ccaacgctat gatgaaaaac tgcacgctca ggcaaaacaa caggagcaac
     1561 agggatacca aactgcgcca caacctcggc cgcctcctta taaacttggg gcgcacgagg
     1621 aggacccgca gtaaaaatca cgaaggcagg cttgccactg gctcgcacaa gttccgccgt
     1681 tgttctaaca gcgtccatat cgaaagcacg tggtctgcat ggaattaaca agaaatcagc
     1741 gacacgacac gcctcacgcg ccataatatc ggcatgtggg ggggtatcta ttatcgatag
     1801 ttctgcgccc agttcggacg cttgttccag ctttcttgat aacaaggcgt gcgccgcaca
     1861 atccaccaca tcaggctcga catccccccg ccatgctttc catgaacttg cagtcgcttg
     1921 gggatcggta tcgaggatca gagaaacgta tccagcggca ctggcactag tagccaagtg
     1981 tagggcaagc gtcgtcttcc cagcgcctcc cttctgacta atgatcgcga ttgttttcat
     2041 gtcaccatgt ttctgcgtta acacattaac aaattaccat gttattttga taactcaata
     2101 tcttcctcaa aaaaatcgac gatctaatcg aacccaatat tccgtatgtc tcagaccgat
     2161 gccgttagca cccatataat gctatcatgt ttatgtatta acatataaac acagtgacgt
     2221 gttatctttc ccgctgcaca atggcagcga cagtgttctt gctgattccc agatcgcggg
     2281 cgatccaccg ataactccgc ttttcggcca ccaacgccag aaccttcgga gccagacggt
     2341 cagacttcgg ccgctctcct ttctgtcggc cgagaacctt ccctcgcgcc ctggcggcgg
     2401 ccagaccgga cttcacccgc tcgctgatca gatcccgctc gaactctgca atcccggcca
     2461 gaaccgtcgc cagcatccgt ccatgtggtg ttgccagatc gaacgtcatc cccgttatgg
     2521 cgatcaggga aacacgatag ctctccagct cctgaagcgt ggagatgggg tcgtttgcgg
     2581 gagggggcga aatcctacgc taagctgaga acgcgcttcc cataatccct gagctcgccc
     2641 ttcggtccga catatctgta tagagtgacg cgctcgatcc cgagttcctt gcacagatcg
     2701 gaaacagacg tgtcgcgctg cgccatggcg gcctgggcga gacgcacctg tgctttggtc
     2761 agggcgaatt ttcgccctcc ctttcgtccg cgcgctctgg ctgcggcaag gccagccatg
     2821 gtgcgctcgc ggatcagatc ccgctcgaac tcggccagag tggcaaagat accgaacacc
     2881 atgcggccgg atgcggtcgt ggtgtcgatc tgagcgcctt ttccggtcag cacacgcagg
     2941 ccgatcctgc ggtctgacag atccttcacg gtgttgacca ggtgggcgag cgagcgcccg
     3001 aggcgatcga gtttccagac caccagcaca tcgccgtcgc gcaaggattt gaggcatgca
     3061 gctaagccgg gccgatcatc gcggctaccg gatgcacgat catcataaat attacctggc
     3121 tcgataccgg cggcacgcag ggcgtcgtgc tggaggtcga gggattggga accatcggct
     3181 ttggagacgc gggcatatcc gatcagcatg tttcttaaac gttggtttga agcggtgacg
     3241 aacatgagca cataagcttg cactattgtg tatcttaacc agcatcgcaa tcaaactatc
     3301 tcaaacctta ccttggaaag aataaggagc atgtatgccg cgtcgcgtga ccctgaccga
     3361 tcgacagcgc gaggcgctgt ttcacttacc ggtcgatcaa ggtgatctgc tgcggcacta
     3421 tacccttagc gatgaggatc tcgggcatat ccgccagcgc cggcgcgccc acaaccgttt
     3481 cggcttcgcg ctgcaactgt gcgtcctgcg ctacccgggc cgggtactca cccctggcgg
     3541 agggcacagc gtggaaagta cgccagacaa cgctaagtga gaacgttcgg agaaccgtcg
     3601 atcggggaag gggcgggcct ccatcgagta accgcgatca acctgatcac agcctgacgt
     3661 cacagcaccc tgacatctgt gacgtctgac atcttgcgga gctgctccaa gaattcacgg
     3721 tgccgcgtgg gagtgtcgca gaacgagata tgcatccggg ttaccccgtc ctgtcgttcg
     3781 tatgcaagcg gaccttcctg taatcggcat ttgctgagag cgtcgtggat ggcttggaca
     3841 acgctctcgt tctcatatgt tgtaatttga tattcgagga tttgccactt ttcgcctaag
     3901 cgtttttcga tgagcgcaag cacgcgcagc gcggccagcg ccagaccgac gcctacgccc
     3961 gccaacacat actcctgcgt ggcggcagca aggcccaacg cgccgttcac ccagataaga
     4021 gcggcggtcg tcaacccgcg cacggtgccg cgatgctgca atataactcc cgcacccaga
     4081 aacccgaggc ccgtcaccac atttgccgcg acccgtccgg tttccatccc cggaattgag
     4141 cgcccagcca ggacgaatat ggccgtgccc aacgtgatca gaaactgtgt ccgaaggcct
     4201 gcgggtttgc gcgccagttc acgctcgaag cccagtgtca ggccgaccgt cgcggcggcg
     4261 acaagcggca gcaatgtgtc gatgatgaac tcagaaaacg acattgtcac agcaggaacg
     4321 gggggcggaa atcaaacgcg gcgcgacgag agatgatgcg ccgcatcgcc gccgcgaaca
     4381 ggcgatcgcc cgggcggggg cacgggtatg atcgcctatg gtcagcgatg cggcgctggc
     4441 cgggcgcaat tgcggcgacc cgcccggcca aaggcggcag tggaaggatg attcggaagc
     4501 agggttgtca ggcacgggcg gattctttgg cggtgtcggc accgatggcg gaaatcattt
     4561 gctccagatg cccgtccagc acgtccaggg ccgcgcgccg cgcggcaagt cgtgcccgca
     4621 ggcatagcag aaattcgatg gcatcgccgc cgccgccgtc cagagcgtga cacagcctgg
     4681 tcagttcatc gaggccgacg cccgcctcga acaaggtgcg cacgaagcgc atccgctcca
     4741 gcgcatgatc gtcatagaga cggtgaccgc tctgcgtgcg gcgcgccggg cgcagcagcc
     4801 cgcgcagcac atagtcgcgc acaatatgta cgctcactcc ggcatcatgg gccagacggg
     4861 acgctgtgta gggggcatcg gacacctccc tcctctgtcg gcagggcatg cgctccccgg
     4921 agttcgatcc gcgcgctgca aatccgatgt caactgggtt gtatgcgatc atggcgttgc
     4981 ccggtgtggc gggtgcaaca gctgtcgatt cagctcctgg cccacacaaa aagcctcccg
     5041 aacgccgatg atggtcaacc ccggacgctt ggaggcccag tcttgcgcca catgggtaga
     5101 agcaaagaaa tggacgtggc agcagaagga ccgacgaacg tcgttcgttt cctgcggcgg
     5161 caccaacgac accgccacgt cggcgggttc aacagcccgt atctcgtttg gtgacacggt
     5221 aagcgaaacg ggcgctccgg tggcagcgca acgcgatgag acgcgggctg tacagccgag
     5281 cagcgccgga aacatcaatg tatccaaagc gcaccaggcg tagaggcggc ggccgtcgat
     5341 ctcgaaggaa tgcgccgttt cgcgtagggt gaggccgtgg ccgatgatgt ttccgtcatc
     5401 atcatattcg gtactggcgg tttgcgcgag cacggcggcg atgcgctcat caggccagtt
     5461 gagaatcccg gcaagcgtgg ttcgcgatac cgggcgcccc ttggcgagtt cccgcaacag
     5521 cgcgacgagg agttccgcgg aatcttgaga ccgactgatc aacgggaaat gctcgatata
     5581 tgtagtgggg ctcatgacgc tctctttcat cctgcgcagc aggacagttt tgccacatcc
     5641 ttgccgaagc cctgtgcggc gagtttcagg ccctcgaccg tggtgagata gggaaagatc
     5701 gtctcgccca gcgccttcgt cgtcatgccg tgtttgatcg cgagcaccat ggtctggatg
     5761 ctgtcggctc cctcgggcgc gacgatttga ccgcccagca ggcgatcgga cgttttgtca
     5821 gcgaccagct tgatcaaccc ccgtgtgtcg cgagcggcca gtgcccgcgg cacctggtcg
     5881 agggcgacga tcgaggtctt ggtctcgaag cccgctgcct gcgctgccct ttcgctcagt
     5941 cccacgcccg ccacctgtgg gtcggtaaac gtgacccagg gcatgaccgt attgtcgtag
     6001 acgaggtcgt cgccgttcag cgcgttgtgc gcggcgagct tcgcgccata ggccgccata
     6061 tagacaaact gatcgcgacc ggtgacgtcg ccggccgcat agacatccgg tctcgaggtg
     6121 cgcatccggt cgtccacgac cacactgccg ttgtcggctt gggcgatgcc cgcttcgaca
     6181 aggccgaggc catcggtatt cggcgcccgt ccggtggcta cgagcacctg ctcggcggcg
     6241 atcacctgct gtgcgccgtc ggtggtgata ctcagctcga cgccggcagc cgtgcgcgcg
     6301 attccgcgat aagttagtcc ggtccggacg gtaatgccct cgtcgcggag atagccggtc
     6361 agcgcctcgg agatttccgg ctcggcctcc ggcagcaagc ggcggcgggt gatgagcgtc
     6421 accgccacgc cgaagcgcgc gaacatctgc gccagttcgc agccgatata gccgccgccg
     6481 atgacgagca atgagcgcgg tagcgcgcca agttccaggg cagtcgtgct ggtgagataa
     6541 ggcacctcct caatgccggg aatgtccggc agggccggcg aggagccggt cgcgatgatg
     6601 atcttgcccg ctgaaatcgc ggcgccattc accatcacgc cctgcccgtt cagacgcgcc
     6661 gcgccttcca gataggcaac gccgttgtac tcgggcagca ggtcaatata tttcttctgc
     6721 cgcaagctgg tgaccagctc gtccttggcc gcgacgagcg cgggccagtt ggccacgctt
     6781 gcttccccga ccaggccggg aaagcgttgc gcggcccgca caccatgcag cgcctcggcc
     6841 gcgcggatca tcgtcttcga cggcacgcag ccgacattga cgcaggtgcc gccgatggtg
     6901 ccgtggccga tcagcgcgac attggcgccc tgatcggcgg cggtgatcgc ggccgagaat
     6961 ccggccgatc cggcgccgat gacggcaagg tcgtagccgc ccttacggct tccttcggtg
     7021 gtgcagcagt ctgacatgtt cagctatttt ccttgttcgt ttgtgtttca gtcgcacagc
     7081 aatctgcggc gcgttgtcgg cgccagaggc catagccggt gagcgcgaca aagaaggcga
     7141 gcgccggcat gaggacataa tcgatccagc ccagccaggc cgacaacccg atcgcgccga
     7201 gcaggacaac cagcaaaggc gtggcgcagc agatcacagc aatgagcgag ccggcgatgc
     7261 cggtcttcag aagcgttgcg tccttcatgc tgcggtcctc atcccgccgg gcgggccgga
     7321 tagccggcat tggtggacgc ggcggcaatg gctgcgacgg tggcggtcgc cgggtcataa
     7381 atgaccgtcg ccgtcttggc ggcgaagtcg acagtgacgg acttcactcc ggcgacgcct
     7441 ttcatcgcct ttgtcactgt caccgggcac atggcgcacg tcatgttttc gatgctgaac
     7501 gttgtcttct ggaccgcggc ggcttgcgcg ggggcagctt gcgcggcgag cggtgaaatc
     7561 gtcggcgccg agagaaggcc ggcggcgccc agggccgccg cgccgagcgc gatgagaagg
     7621 gggcgtttca tatgggtttc tcctatgggg tagcgtgatc agtagaacag cggcgcccac
     7681 cagctgattg tcagggcaag gaggaccaga accgtggcca gccacagcgc cgacttggtg
     7741 atgcgcgagg cttgcggccg agcgcagtag gaatcttccg cgcaggcccc cttcggcttg
     7801 aaatagacct gccggaatcc gagcccgata aagacgagcg ctacggcggc ggcgtagggc
     7861 ttgtagggtt caagggccgt gaggttgccc atccaggcgc cggaaacgcc gagcatcaac
     7921 aagagaagcg gcgcgatgca gcacgtcgag gcgaggatcg ctccgaccac accgcccgcc
     7981 gcgaaccatc ctggccggcg gctcgccgtt gcctttggct gctcaagaac ctgcatttgc
     8041 atattagcgc gatccatgcg actcgcctct cgattgctat tccacttcat gctacgctct
     8101 gtaggtacta cagacttaag aggttttttg gaccgatgag cgatcacgtt ttcgggaagg
     8161 gaatgcagcg cgctgacttg gccaagctta cgggctgcaa tctggaaacc atccgctatt
     8221 acgagaaaat cggtatgatg ccggacccgc cgcgcacggc ctccggctac cgcatttatg
     8281 gcgaggacca cgtatcccgc ctgcgcttca tcttgcgcgg ccgcgaactc ggcttttcgc
     8341 tcgacgaagt acgcggcctg cttgccctcg tcgagggcgg cgcgcagacc tgcgcagagg
     8401 tcaaggagcg cactgagcgg catctggccg atgtgcgcgc gaagatcgcc gatctcaggc
     8461 gcatcgagaa agtgctgacc cagaccgccg cgcaatgctc cggcgatatg gtgccggact
     8521 gcccgatcat cgaggtgctc gcctcatgac ccgctgagcg ttaggatttc gtgttctccc
     8581 gcaaactacc ccttcttgcg caacagcgga acgactgcaa ttctccaccc taccccgccg
     8641 atcaggcggg gcgctcgata cccaatctgc gcatttcccg gtagatggtt gatcggccga
     8701 taccgagctg ccttgcggct tccgttggcg atatccgggc ttccaccagt ttgatggcgg
     8761 catcgaccct ggccatgtcg aggggctgac ggccaggccg ctttcccttg gcgcgggcag
     8821 cagcgatgcc atctttcgtc cgttcggaga tcaggcgccg ctcgaaatgg gcgatggccc
     8881 cgaacacatg gaagatcagt tcgccagcgg ccgacgacgt gtcgatcttc tcctcaaggc
     8941 tcagcaacgc cacgccctgg gcgcgcagct tctcgaccgt agcgagaagc tcggcgagcg
     9001 agcgtccgag ccgatcgagg cgcaccacgg ccagcgtgtc gcccttgcgg gcgtaggcga
     9061 gaagttcgac gaggccggga cgatccatgc tcttgccgga catgacgtcg gtgaacacct
     9121 taatggcacc ggctttctcg agacgtatgg tctgccccgc cacatcctga tcgccggtgc
     9181 tgacacgggc atagcccaga atatcgctca tgccggcgtc tcccaaacgg tcgttctgtg
     9241 gacgctctga agcgcgaccg cttcacccca cccatatccg tccacatact atgtctcttt
     9301 actcatgcct gtccatagtc gcaattgacc ttttgtggac aggaatcggc atgacaaagc
     9361 gcaagcatca actcttgacc gaaagcgagc gcggccagat cctcgcgatc ccgaccgatc
     9421 gtgaccatct ggcccggctc tataccttcg agcctgcgga cattgagatc atcggcgcgc
     9481 ggcgggagcg acggaaccgg ttgggcgtcg cgctgcagct cgcccttttg cggcatccgg
     9541 gcatcgccct cgcgcaattg atacgcgaca ggggagcgat accccatgat ctcgccgctt
     9601 tcgtcgcgga gcagcttggc ctgcgcgtaa ctgatctggc cgactatgcc gcacgggatc
     9661 aaacgatgac ggaccatgcc cgcgagctgg cggcgcgcct aggccttcgg gggccgaccc
     9721 gcgccgatat cccctttatg atagaagcgg ccgcgaaaac ggcatgggca accgacaagg
     9781 ggatgacgat cgcaagcggc gtcgtcaccg cccttcgcga ggcccggatt ctgctaccgt
     9841 ccatctccac catcgagcgc gccagcagcg cggggcgtgc gcgtgcccgc aagcaggctg
     9901 cctacgccct gattgccgat ctcagcactg aacaggtcca agcccttgac cagctctttg
     9961 acgacgccgg cggcatgagc cagctcgcat tcctcaagac catccctgtc gctgccaagc
    10021 ccgatcatat ccgccagatt ctcgaccgct tgcggcaagt gcgaaagatc ggcatctccc
    10081 gggaggtggc tggtcgcatc catgcggacc gacttcggca atatgtcacg gaaggccgcg
    10141 cttcgcctgc ctatatgacc gagcgatata ttccctcccg gcggcgcgcc acgctggttg
    10201 ccttcctgct cgatcttgaa gaacggctga ccgacagcgc cctagagatg gcggacaagc
    10261 tgatcggcag catcttcacc cgcgcgaaga acgcccaaac gcgcaactat gccaccacgt
    10321 cgaagaacgt ggcgcgactg atgctgatct ttcgcaggac gatcgacacg ctcaccgatg
    10381 cggtcgatac cggcgaagac cctatagagg ccctggacgc ctcggtcggg tggaacaccc
    10441 tcctgagggc caggccggaa gtggcgacga tcgcggaaac cgccagcctc gacccactga
    10501 cggtcgcggc cgatcgctat gcgacgttgc gcaagttcgc ccccgacctg cttgaagcgc
    10561 tccagttcag ggccggaaag ggcagcgcga aaacgatcgc cgccattgaa atactgcgca
    10621 ccctcaacaa gtcgggcaag cgcgatctgc cctccgacgc tccgatgcct ttccgcaagg
    10681 aatggcggaa aatcgttgtg ggcgatgacg gcaagatcaa ccggcggctc tgggaaatcg
    10741 cgacgatcgc gcatcttcgc aacaagctgc gttccgggga tgtctgggtg gagcgatcgg
    10801 cgggataccg ccggttcgac agctacctgc tgagcgtacc gaaggcgaag ccgatcgtgt
    10861 cggctcttgg cctgccaccc acagccggcg aatggctcga acagcggggc cgcgaactgg
    10921 actggcggct gaagaaattt gcccagcgcc tgaagcgcga cgctctggag ggtgtgcgat
    10981 accgcgacgc ccgcctccag atatcgccgg tacgcgcgat cgcgacgccc gacgccgaag
    11041 cgctggccga ccggctcgat gccatgatgc cacgtatccg catcaccgag ctgctgcatg
    11101 aggtggcgcg ggaaaccggc tttcttgcgg cgttcaccaa cctgcgcacc ggcgagccgt
    11161 gtcccaatga aaacgcgctg ctcgccacga tcctcgccga tgcgaccaat ctcggcctgt
    11221 cgcgcatggc ggcggcgagc cagggcgtca cgcgcgatca gctcctgtgg acccatgacg
    11281 cctatatccg cgacgacagc taccgcgcgg cgctcgccgt cctcatcaat gcgcaccacc
    11341 gcctgccatt ctcgcgggtc tggggcgatg gcaccacgtc cagttccgat ggccagttct
    11401 tcaggggcgc gaagcgcggc gcatcggggg gcgacatcaa cgcccgctat ggcgtcgatc
    11461 atggcttcag cttctacacc cataattccg atcagcgcgc gccttaccac gtcaacgtga
    11521 tctcagcggc gacgcatgag gcgccctatg tcctcgacgg cctcaccagc cacggcaccg
    11581 atctgaaaat cgccgagcat tacaccgaca cgggcggggc gaccgatcat gtctttgccc
    11641 tgtgcgccat gcttggattt cgcttctgcc cgcgcctgcg cgactttccc gaccgacggc
    11701 tcgcgacgat cgcgccggtt gcagcttatc cgtccctcac cccgctattg ggaaagcgca
    11761 tccggtccga catcatcgct gagcaatggg acgacgtgct gcgcctcgta gggtcgatca
    11821 aggccggaca cgtggcgccg tcggtcatgc tgcgaaagct cgccgcctat gagcggcagc
    11881 tccagctcga cgtcgcgcta caggaaatcg gcaaaatcga gcggacgctg ttcatgctgg
    11941 attggctgga aaatcccgat ctacgccggc gatgccatgc cggcctcaac aacagcgagc
    12001 agcgccatgc cctgacgcag gcgatctaca cattccgcca gggtcggatc atcgaccgca
    12061 gtcatgaggc acagaaatat cgcgcatccg gcctcaacct ggtcatcgcc gcgatcgtct
    12121 attggaacac gatctacatg gatgccgctg cccaacatct ccggtcaaca tcggtcgcgg
    12181 tgcctgatga tctgcttgcc catacctccc ctgttggctg ggagcatatt gctttctccg
    12241 gcgatttcct ctgggataga gccgctgctt ccaatggccg caaggccctc aatctgccgc
    12301 cggatagccg cgtcgcctaa gcgttccctg actgttcgtc cttagcgttg tctggcgtac
    12361 tttccacgct acgccctctg gcgagctgat cccggcacag gtatcggatt tcatcgcggc
    12421 ccagctcggg ctgagccgtg acgatctact cctctatgcc gcgcgcgagg agacccggca
    12481 tgagcatctg gcggacctac gccggatcta cggctatcgc tccttttcgg ggcggggcgc
    12541 acgggatttg cgcgattgga tcgctcggga agccgaggcg gcgacatcga atgaggatct
    12601 tgcccgtcgc ttcgttgcag agtgtcgccg cacccgcaca atccttcccg gtttctcaac
    12661 gattgagcgc ctttgtgccg atgcactggt caaggccgaa cgcaggatcg aagatcgtat
    12721 cgcccatcgc ataacaccag ccctgagcga gaatttggct catctgttag agaatacggt
    12781 ggatggtcgc atcacccgct tcgtatggct gcgacagttc gaagttggcg caaattcggc
    12841 ggcggccaat cggctgatgg atcgactgga atatctccac aagttcgatc ttccggcaga
    12901 tttgctggac ggcgttcccg cgcatcgtgt gacccgcctt cgccggcagg gcgagcgcta
    12961 ttacgccgac ggcatgcgcg atctgcccga aggcaggcgg cttgcaatcc tcgctgtctg
    13021 caccatggaa tggcggtcat ctctggctga tgtcatcgtg gagacccacg atcgcatcat
    13081 aggccgtctc tatcgggtct ccgaacgcct ttgcagcacc aagatcgccg acgaaaaggc
    13141 ggccgttcgg gacacgctga agtcttttgc tgaaatcggt ggtgctttgc ttggagcgca
    13201 ggacgatggc gcatccctgg acgggataat caccaccggt ccaggctggg aacggttcag
    13261 aacccttgtc gccacggcct ctgcgttgac caatgtgctc gctgccgacc cgctcagccg
    13321 tgtgctggac ggctatcatc gcttccgcct ctatgcgccc aggatgctgc gcctgctcga
    13381 catgcaggcg gcgccgattg ccaagcctct tctgacagct atcgcgctgc tacagagcgg
    13441 gatcaaatcc gatcattgaa cggacgatca ctggttcacc tgccaaggca gaaaaacagc
    13501 cgaaagccga gtctcatata gatggtacca tattttttgc attgatgggg cgttatacgt
    13561 tacactttcc cgcatgacgc acacattgat cggctatgcc cgatgctcga cggacaaaca
    13621 ggacctcgcg gtccagcagc aggaacttct caaactcggt gtcgctgccg atcgcatcta
    13681 cacggacaaa ggctttactg gcacgaaccg ggagcgaccc ggccttgatc aagcccttgc
    13741 ggctgttcgc agtggcgata ctttggtcgt gccaaagctt gatcggctgg cccgatctgt
    13801 ccctgacgcg cgagccattg gcgatagtct gacagcccgt ggtgtgaagc ttcaacttgg
    13861 gagcagcatt cacgatccgt cagatccgat gggtagactg tttttcaaca tcttggcgac
    13921 tttcgcggag tttgaagccg atctgatccg gatgcgcacc cgcgaaggca tggcggtcgc
    13981 ccgcgccaaa ggcaagctac gcgggaaaaa acctaagctc tctgaccggc agcagaagga
    14041 gcttcgccgg atgtatgata ccggcgatta ctccatcagc gatctagccg aagtcttttc
    14101 catctctcgt ccgacagtct atcgagctct cagcagaaca gcctcaacgt tcttgttggg
    14161 ttcactctaa gcgtacgtaa agtacacttt cgtgtcgtga ccccattcag gcgggcctgt
    14221 ttctggtcga tatggatttc gtcactctgg aattctgcga tcagaagcga caatcgcgcg
    14281 atttccaccg caaaatcacg gatctcaatc ccatagaaat tggccagagg aatgaccgat
    14341 ttccgttccg cccgctctat cttcagtcga tcatcaatct cgctctgaat ttcccgcatg
    14401 tccttatagg caatcacgag aaaattgccc gatccacagg ccggatcgaa tacccgaatg
    14461 ccggacagac gctccttgag ggcatgtagc ttctgggtat tctggcctgc cttttccagt
    14521 tcctcacgca gaccatccag aaacagcgga ttgagcactt tgcggatgtt gggcacgctg
    14581 gtgtagtgca tccccagcgc accgcgctct ccttcatcgg ccacggcctg gatcatggac
    14641 ccgaagatat ccgggttaat ctgcgcccag ttcagctccc cggcacgcag aagataggtg
    14701 cgggccagtt tgttaaattt cgggcagtcc gttgtcccgg aaaacaggtt cccgtttaca
    14761 tacgggaaat ccctggccca ggatttgacc ccgccctttt cacgatcgtc attgcgcgta
    14821 tccagatcca tcgtccggaa cagctcggcc atgacctcat gcgtctgatc cgtggcccct
    14881 tccgtcatgg tctgaatagt tctggtgaac agattgttca ggaagatccc ggtatcctcg
    14941 gcaaaaaagc agaagatgag acgcgccatg aaatggttca tgtcatggcg gcgttcttcc
    15001 gtcgcccagt caggattttc cttcagaagc tcaacataaa gacggttcag gcgtgacgtg
    15061 gccttcacat cgattgggtt gttcttgatc ttctgaacgg tcgtaatgcc cgccaggggc
    15121 aggaaaaacc caaaccgatc agccagatgc gtgtgtaaat gctgtttcaa aattccccac
    15181 atgtgctgtc ggaaaattcc ccagcacgga tatggtgatc agccattgag gtgatcgata
    15241 gctccatgct ttgggggcct accgcggcgc tttggcgctg ccggtggcat cagattggcg
    15301 tgggcccgtg tatgctcggg gatcagatcg gcatgctggc gcaggcgata gctggcacct
    15361 tcgatgtgga cgacgacagc atggtgaagt agccggtcga gcagcgcggt ggcgacgacc
    15421 gggtcgccga agacctcgcc ccactcggca aaaccgcgat tggaggtcag gatcatcgct
    15481 cccttttcgt agcgggcatt gaccagctgg aagaagaggt tggcaccacc tggcgtgatt
    15541 ggcaggtagc caatttcatc gacgatcagc agcgaagccc gcgtgtagaa gcgaattttc
    15601 tcggccagac gcccctcgcg ttcggctctg gtgagcgcct cgagcagttc tgccagagag
    15661 cagcgataga cgctgcgtcc ggccctgacg gcggccacgc cgatggctgt ggccagatgg
    15721 gattttccgg tgcctggcgg gcccagaaaa tgcaacacct cggcccgatt gatgaactcg
    15781 agctgggcca gcgcggtgat gcgatgcctg tcgagtgaag gctggaacga gaagtcgaag
    15841 ctctcgatag ttttgatcgg catgaggcgg gcggtgcgca gtgctacgct gatgcgccgt
    15901 ccctcgcgca ggttcagttc ttcggccagc agatcgtcga tggcctcgat ggcgctgatc
    15961 tcgccctttt ccagcctgcc cagcgtgtga tcaagcgttt cgagggcgcg tgccatatgg
    16021 agagccagca ggctttgtcg gatgcgttcg gtgacagaca tcatgcggtc cctttggcat
    16081 tgatgttggc caggcgttca cccaccgcgc cgtagaaagc cagaggacgc tggaggatcg
    16141 gcaccgccgg tgtcgtcggc aacatctcgg cgtgttgaac cggtggggcc ttgcggtggc
    16201 ctggctcgat ccgcttacgg tttttgcctt ccagcacggg atgccgggcg atgagtttcc
    16261 cttcctcgaa gatcaggact tcatgtgtat ggtgctggat ctcgaccacg cgacggcggg
    16321 cagtgtcagg cacactgtaa taattgccgg ccaccgccac catcccctcg cggctgatcc
    16381 gccgctcgac gctcagaaca gcatcgtagc gcagggcagg caatggatgc agatggggct
    16441 gctcctgtgc aaaatgctcc tgcacgatcc gcccggtggt ggcatgtgcc cgcgcgttgg
    16501 cgatatccgc gcgccagacg tcgaactggg cgttgaggtc atcgagatca tggaagctgc
    16561 ggccaaggaa gaagtcctga cggatgtagc ggaagggtcg ctcgaccttg cccttggtct
    16621 tggcgcgata gggctggcag gctctggggg cgctgccata atgggccaga agcgccacca
    16681 gcgaggcatt gtaggtcacc acgcccgcat catcctcacc gatgacagcg gtcttcatgc
    16741 gatcgtagag aatttccgtg cagcagcccg ccatcgcctc gaaggcggcg atgtggcaac
    16801 gcatcactgt ttccagaccc tggttcgggc agaaacgtcc ccacagccag cgactgtgcc
    16861 ccagcaccat gctgaacaac cagaccttgc gcacgatgcc tggctcgccg gtgaagactg
    16921 tctggaattc cgcaaaatcg acctgcgcct gaacgccggc tccggtctcg aagcgccgct
    16981 cataaggcct gggcagcggg gggcggattt gccggagata ttccgtcagc gatgaatagg
    17041 caccgtcata tcccatgtcg cgaatttcac gatgcagcct gcgcgatgaa agtccgggat
    17101 aacttgccat ccgctccaac agataggttc gataaggttc tgctgcgctg gccaccggtt
    17161 tacgcggtgc ataggctgga gtctccagcc cattggccag atacttcttc actgtcttgc
    17221 gatcgagccc tgtctggcgc gcgatggcgc tgatgctgag cccctgtctt ttgagttcct
    17281 ggatcaaaac gacctccctg agtcctatca cctgctcgcc cttcctttgg catcagcagg
    17341 gataaatgtg ccgcgtgatc gtcatggggg catgccccca tgacgatcac gcacagtcct
    17401 caaactgggg aattttcaac cagcacattt ggggagatta caaccagcac tcacagcgtg
    17461 aacacatctg taatgtgctc atcttccgtg cggtcttccg cttcaaacgt caccccatcc
    17521 gtggccagca gaaaccgtgc cttggccgac tgggtcttgg ggctttcccg gagcagattc
    17581 agggtctggg caacctggcc ttccggacag acggccagat ggatgttgtt gcgctgaagc
    17641 accgctccgg gaacgtccga gcggttatcc ttgcggagcc gcttgatcgt gacatcgcgg
    17701 tttccgaacg cttgcaggaa ctcgaaagga aattccccgg gattaaaagg tgcctcggca
    17761 atctgggaga cagcttcttc aatctcaacg ggattcatgc gtaaaattcc atacgttcga
    17821 aaaatagatc atacacctca tgcgccacct gacacctcca ggaagaggcg gaccagaggt
    17881 gcgttgatat aataattgct ccgccctgaa cggtgcttgg acagcaaacc tttctctgag
    17941 agctggtcga gatacttccc tgccgtctga cgcgcgatgt tcagatctgt ctggacatac
    18001 tcgattttcg tgtaagggtg tcggaacagg ttatttagca actcctggct gtaaattttg
    18061 ggcagttccg tgcgcatccg ctgcttcatg gtggccatct gcgcccgcat gccttcaatc
    18121 agctccagag tgatcctgga tgtctcggcc acggcacgca gcatgtagag gatccacgct
    18181 tcccatgcgc cttcatcccg cgccttctgc aacagacgat aatattcatc cttgtgccgt
    18241 gtgatgtagc gcgacaggta gaggatcggg atatccagaa ggccggtccg ggtcagatat
    18301 aacacgttca ggatccgccc gacgcggcca ttcccatcgg ggaaaggatg gatgctctca
    18361 aactgatggt ggatcagggc catcttgatg agcggatcca gatcacagag cccgtcatca
    18421 ttcacgaacc gctccagatc cgacatatgc ccgataatct cccgcccgtc ctgcggcggc
    18481 acaaaaacca cttcccccgt gcgctcgttc ttcaaggccg ttcccggggt gtttcgaaac
    18541 ccatcttccc gcttcttgag cctctggaaa atcgcgatca gccccttgtt caggatcaac
    18601 ccgtcggttt ccttcagctg ctgaaaccca agatgcagcg catcgcgata cagggcgacc
    18661 tccttggccg ccactgagtc cggcccctca ggaaacagat cggcctgaaa gagctcatcc
    18721 tgggtggtga cgatattctc gatttccgag gacgccttgg cttcctgcaa agccagcgta
    18781 tcaatcagga tcccctgatt gggaatagtt gccgcccgcc ccttcagttc cgccagagcc
    18841 ttattagccg cgaccagcgc cctgagaacc ggaaccgttt ctatgtccgt ctgaggcggc
    18901 aaaggtcgaa taaggtaggt tggcgttaac atgacatcct gacgtggtag caatatgtgt
    18961 tttttctaac acgtcagaat gatccgtcaa agaaatccgg tttctttgac atgtcatatt
    19021 ctgctgtcgg cttttatccc ctgaagacta ttcctgctct gccgaaacaa tgatgacaca
    19081 gggtttctga gttttttcct gacccgatgc cgctttctgg caggctgcga tcctgtctct
    19141 gttggcctca accagctggc tgtcctcacg tacacgttgc cagccttcag gattgctgac
    19201 tgccatcatc atggccccag agttccagcg atctttctcc ccgacaataa aggatgccac
    19261 ccgcgtcccg atagaagaag gcaggagata cgccagcaca ggcgataacc cgatccctac
    19321 aacaagacat gcaagaccca cccctaacag ccaccagttc tgacgatcct gctgacggga
    19381 ctgaccaatg atattggcaa gaacccgacg ttccccctga acctcaccta tcgctttctg
    19441 aaacgctgcc tgcatctcct gactggcaga aatcccggcc tgacgaatcc cttgcccata
    19501 cgcctggggc gtcatcttca gcgtcggatt ggcctcaatc gcctccattc gtgcaccgac
    19561 tgcattcata gccttcacga cacgggccag atcctctgtg taatccggag gccgattgtc
    19621 ccgccatgcc tgcggcaacg cttccacgct gcgccggagc accgtcattt cagcgcacag
    19681 atcggcaaat gcgcgctcag ccggatctgt ctcactcatg acgttctcca ttcagtaatg
    19741 aaaccggcac tgggcaatct cgattcgctg atcctctccc gcgcgcccct gaacccggta
    19801 gaccagacga tgttctcccg taatccgtcg ggaccaccac ccagaaagct gccccttcag
    19861 gggttccggc ttccctatcc cctgaaacgg atgccgacgc acatcctcga tcagggcatt
    19921 gatcttctca agaaccgcat tgtctgactg aaaccacgaa agataatcct cccagccatc
    19981 ttcatgaaaa atgactttca cgctgacggt tcaccctgag gctccagaag atcatgctcg
    20041 gttgccgccc cgtgctcgat gtcacgaatg ctccgcaaca gcctctccgc gttgcgtggg
    20101 ctgctcagga gatgcacggt ttcctgccag ccggagaatt cttcttccga catcagcacg
    20161 acactgcctt tcccggtctt gcgggtcacg acaatcggcg cacggctgtt cactgcttcg
    20221 tccagataat gcgccaggtt ctggcgcagg tcggtatagg aaacataggt catgatcgat
    20281 cctccatgtc caccataacg tacagttttc tgtacgtctc ctgttttgca tctccctctc
    20341 gataccgcgt ggtctggagc gagacacggc cagcccccac agattgaaaa cccgcacacc
    20401 tgccgcctcg aaaggcgaca cgtcgtggct ggccagaaca cgctgctccg agacgggcct
    20461 cctcatctcc atgatcacgt tggtatcaag cagcaggatc attcgaagga cattgcctcg
    20521 gccggggtct gatcgcgggt ctgcaagacc gcgatatcct gatcacgcac accgacctca
    20581 cgaccgatgg cccccagaag cgatcctagc cgaacggccg cttctttttt ctgcatgtcc
    20641 tctccagtca ccgcgccgaa atcagacaac ccgttccagc cccagatgtg tcacaaacgg
    20701 gtcaaagtcc cggtcactgt aaagaagccg atacccgctt acgatgcatc gtgtggcaat
    20761 cagggtatca atggtcttcc gaatggtgat gcctctggcg cgcagatcac gaaaatatcg
    20821 tgccgcctcg atcatgacat cacgtccccc gatctctacc agatccaggg caccaagcat
    20881 ccgccgtgcc ttgttgaaat cccgctcatt cgcaaatccc tgaagaactt ccgtcatcat
    20941 cagatcccca atggcgacag gttcttctcc cagaagccgg tccagaacct caacctgtgg
    21001 cgtaaccgta cctcggaaaa aatcgatcca gaccgatgaa tcgaccagaa tcatacgtcg
    21061 gaacgcatgg cgtcgagatc accccgccac tccagcctgc ccttcatgga acgcagttgc
    21121 cgctgctgat tcaacttgat cagcgtccgc aatccgagtt cgacggcttc tttcttggtt
    21181 ttgacgccag acgccttcag cgcatctgtc atgagggtat cgtcaataat gatgttggtt
    21241 cgcatgatgt gtatctccag tgaaaattat acacatcaac atctcctctc tcaagcagat
    21301 tacatcccca tatccatacc gcgcgacctg gagcgtgaga gggcctgctc ccgctgatgg
    21361 ggatgcaacc cgtgatcaag cgtcgatccc ttccggatgc ccagctcgcg gcttttctcc
    21421 cgcagaatgg actcaagctg cgcatcccgc ttcagctctt tcagcgccac accctgctgc
    21481 tcccggctca gcccgtccca ggccttcaca aaccgcgctg cccgcagatc cggactcttc
    21541 cgcaccctgt cctcatgctc cagcccctcg agcaatttgc gcgcccgtgc cggaccttcc
    21601 agaccatata gcgcctgccg gatctccggc tgatgcttca gcgcagccct cagatccgcc
    21661 tcaccgccac gccggacccg ctccagatcc cgaccggctt caaacagcgc cttcttctga
    21721 tgctccagca ccggcagctc ctgccgaacc atgcgctcgg catccaccca ggcccgcgca
    21781 taccgctcca ccgcctgatg cagcgggtca ctccccggca ccaacccgtc catccccgcc
    21841 ggcacctgct cacgccgcac acggggcagc ctcaatcccg caaagggaga gacaggagcc
    21901 tcacgctcaa ccccactctc ccccttaccg gccccggcat ccatcccggc tgacacgtct
    21961 ttttccgctg tgcgacgacc agaccgcacg gacaggtcca gtccatcgaa catcccgcgt
    22021 ttttgctgtg ccgacgcagg ctctggcata ggcacacctt cggcctgcct gtcctgccgg
    22081 gggccagagg cggccttctc acgctccacc acgatctcgc tctcggggac atgcagcccg
    22141 cgccgacgcg caaacccggc atcccgatcc cggacatgcg ggtaatccag cgtggtgtcc
    22201 ttcagccgct cgcgcgacag tcgccgcacc agcccgtccc ggtcgcccac atcatcacga
    22261 ccccaatgga cagacacgct cccccgatgg cgcgacagcg ccacataggc cccatgccgg
    22321 tccatgctcc ccgtcgccag cacatgcgcc cggtccaccg tcacaccctg cgctttgtgg
    22381 atggtggcgg catagccatg atccagcgcg tcatactccc acatccgcac ggacacgatc
    22441 cggccagtcc caacgccatc aggaccatca agctgcacag aaagcatgat ccgatcctca
    22501 tccatgccat acagcccacg caccgtgccc agcgtgccgt tcttcacccc caggtcccga
    22561 tcattacgca ggaaatacac cctgtcctca tgcgcaaaac gcctctcccc ctgaaccgtc
    22621 atcaccgaca gttcgacatc agcgtccagc tcacccgcct cccgccggat ctcgcgtgcc
    22681 gcctcgttca gcgcccgcac atcgacacgc cgatgcgcca gcatgatctg gctgtcttct
    22741 ggcgcggcct gccgggcttc ctcccacccg gccaccaccc cggcgcgcgc ctcttccagc
    22801 gtgtcatgtc cgcgcaccag gccagccgcc tcatagcgtc ccagcgccct atccgtccgc
    22861 ccggtcgcaa gctccttcgt agccgcctgc tgccagcctt cacgctgccg gcgtacggtg
    22921 gtgatttcca ccgacccgac ccgctcggcc accgcccgga acgcaccacc ggcctcgatc
    22981 gcctgcaact gctcgggatc acccaccagc accaccttgg ccccggcttc gcgggcgaca
    23041 gacagaaccc gctccatctg ccgtgacccc accatgccgg cctcgtccac caccaacacg
    23101 tccccgcgct ccagcaggtc gaacccacgc tcccacgccc gctccaggga cgccagcgtc
    23161 cggctctcaa tcccggaccc cgcttccagc ccttccgccg cgatccccga cagcgccgcc
    23221 ccgcgcaccc gatacccggc ctcttcccat gccgcacggg ccacacccag catggtgctc
    23281 ttccccgtcc cggcataccc gaccaccacg gacaggtcgc gggacttcgt gacctcgccc
    23341 accgccagcg cctgctcctc cccgagcccg gaacgctgca tcgcggcctg acggaccgcc
    23401 agcggcaccg catgcccctg ggactgcccc atcgcgagcg atgcttcttc cagacgctgc
    23461 tcgaccccga tcatcgcgcg cgtggagaac cgctcccgcc cgtgcccgtc tttcccgagc
    23521 gcgaccagct ccggacatgc ctccacccga accatgacag cactgaactg cgcggcatcc
    23581 gccgtatgcc ggtccacgaa ccgcgccagg tcctgacggg tgaatgtgct ctgctgtcgg
    23641 gtcagcgcct ccagcgccac atgcggctcg gccagcaacc tctcgccatt gcgtcgcgcg
    23701 atctccagat ggtcagcgac ccgctccgcg tcctcgcccc gctcttcccg acgcatgccg
    23761 gccggaccga tcttgttctg cggctcaaga tcgatcccct gtgccacgaa cgaccgatga
    23821 tcgatccgca catccaggtc cagttcagcc agccgttcat tggcgagcga cgcccatcgc
    23881 ccccgccatg tcagcaggag ttctttgtca ttccacgagc gttctttcgc gccgaacccc
    23941 ttctcgtcca caaaccgcgt ggacagcatc acatgcgcat ggggcttcgc ctgaccgtcc
    24001 tcaccaatat cccaatgcac attgagatcg gcaactatgc cgcgttccac gaactgctcc
    24061 cgcacgaaat cccgtgccag tgcgatcccc tgcgcctggg tcatttcgcg cgggattgaa
    24121 aactccacct cgcgggcaag ctgggcatcc ttgcgcttct cgatcgcctc gacctcgttc
    24181 catagggtcg cacgatcaag aaaccgttcc ggcgcgccat cgggcagcag gatctcggaa
    24241 tgcaccacgc cgctcttgtt ggaaaagtca tggtcgcgat ccagccgcac atcatgcagg
    24301 cgggacgctg cgcgataggc tgccgccgct acggcgctac ggccggtggc acggctgatg
    24361 acctttgcat gcaggtgata gatcgccatg gacgcgatct tatcacatcc cttaagcgca
    24421 cgtcacgaag tgacgtataa gcgcgcactc acattttatt gcgccataaa ggttgattac
    24481 tctggatgag tgacgcggtt ctcggctgtg tgatagagta tggcacagac cagcagaaca
    24541 ggggatcaaa aatgcgcagg ccacgggaca ttgatgcgga actgaaggcg cttcaggaaa
    24601 aggcgaagca gcttaaggcg caaagaacca tccagctcgg tgaactggtc gaggcgacgg
    24661 gagccgatac cctgtcgatc gaggcgctgg ccggtgtact ccttgcggct atcgagcagg
    24721 cggacggcaa acccgaagcc gtcgcgaggt ggaccgaacg ggggacggcg ttctttcagg
    24781 gaggggcaaa aaagggtgtc cggaaaggaa ccggaaacga tcagaatgga gcttctcaca
    24841 cttgaaagac ggatcaggaa gcagacagcc ctgatccatc gccatttggc acgaaaggca
    24901 cgcaccgaca tgcgcgattg ggcgaaggcg cgacgggaac gcacccatca tctgatcgaa
    24961 gtgggcggtt tggtccagaa ggcaggacta gtcgatttga ccgatgatga ccgcgctacc
    25021 ctgctcggag cctttctgga tattgcgggg cagcttcggg gtggtaatga gattactcca
    25081 gacaacctga aaacacgctg gaggcgtgcg gggcttcatg ccttcgacag ggaccgggaa
    25141 catgacaggg cagcagacgg aaacaaccat gactgaccac gaaacacgat catccgaaac
    25201 ggacacactg cgggaactga caacccgtat tgttgcagcc tatgtcagca gtaatacggt
    25261 tccggtggac actctgcctg acctcattgc cacggtgttt caggggcttg gcagcctgga
    25321 acagacgacg atcgaaacac cggatctggt gccggccgtg cctgtaaaaa aatcggtctt
    25381 tccggattac atcatctgcc tggaggacgg gaaaaagctg aaggtgctca agcgtcatct
    25441 ccagtccgcc tatggcatga cgccaaaaca gtatcgggag aagtggggcc tcccggaaag
    25501 ctacccgatg accgccccat cttacgcagc ccgacgctct gccctggcac aggagaacgg
    25561 actggggcgg gcagccagga ccgcacctga tgttatagcc cccacggctg aagatcaggt
    25621 gccggtcacg catgtaccgg aaaaaaaacg tggacgcagg ccaaaactgg cctgaaaatc
    25681 cagacggaaa cagaacgcgg gaacgacctc tcattcccgc gctgaagatt accagtaata
    25741 ttcgtggggg cgtcgtgttc cggtatacgg aaagaccgcc tccacaggat caaggtcgcc
    25801 ctttatgatc aggcgggcaa catgtcggtc atgatgacga ccaagacgaa tgtcgtgcag
    25861 atggctgtac cagtttggag attcagaggc atcacgtgag cctccataac cacagcgatc
    25921 cggccgattg gcccagcgat ggtcccggcc gtgttttcgg ctgtgatgat aggtgcgaga
    25981 catggggagc tttccctcca tgacgcgcgg agtgatttcc gagcgtacct acatcgcccg
    26041 atctcctctg ttctggccgg aatacgcttt accgcgtctg tgcgacatcg gtttccagca
    26101 gcatccggac atagcgcgtg taagggatgc cctttgcctt cgccctggct ttcacggcgt
    26161 ccagcaggga cgctggcagg cgcatgttga gggcagccgc cttgggttcg atctcaaagc
    26221 gcatgggttt gaaaccggac agatcatatt gggttagatc ggcggtcgcg acgaaatcct
    26281 cggccgcttc gtcactgtgc agcgagggca tggacctatt tttgtagctc atactggtcg
    26341 atctccttca gactgcttcg atcgggcctg gataagcctt taccagcgga tcatgggtca
    26401 gcagaagcaa tccttccacc gtggcctgtg ccacaaggat ccgatcaaaa ggatcccgat
    26461 gcacatctgg cagttgtccg actgccaagg cgtgctggct ggtgatcggt aactcctcat
    26521 aaccgttttc gatcagaccg cgtcgcagca gatgaggatc gacctggaag tctgcccgtc
    26581 ccagcccggt cttaatggtg atctcccaga gactggccgc actgaagacc agatcattgc
    26641 ccggatcttc catcagggtt ctcgcccgtg ctgacagctt atctggctct ccggctgccc
    26701 agagcagcag atgggtatcc agaagaatcc tcatgccgga ccgtcgaaca gagacacaat
    26761 atcgtcctgt cccatgcgat caaaatcttc gggcacccgg atttttccag caagaaaccc
    26821 cagacgccgt tgctgtaact cttcaggagc cgtaatcggg ctgacccgca ccatcggccg
    26881 gccggctttg gcaatgatga agctttcccc tttcatggcc gcgtcaatca gccgggacag
    26941 atgggtcttg gcttcgtgga tgttgaccgt gcgcatggcg aaagcctcct gagtttactc
    27001 aaaaaaagac ttagccatat tagtctggtc catcaagaca aatgtcgcca gaaccacctc
    27061 aggaaacgaa aaaagcacac tcatcgcgtt cctcgtctac cgtcatactc tttcggatgc
    27121 gacattggcg gtcaggaatg ctgcatagcc cagttcgtcc atctgacctg ctgccagcgc
    27181 gagaaccgca tttgctgcat cttcctgggc tgccgtgaaa cgatagccgt tcagttccaa
    27241 aaacagcaca ccgagcacaa agcccgtacg cttgttcccg tcgatgaaag gatggttttt
    27301 gacgataccc gccgtataga cggccgccag atgcactgga tccagcggat ccgcataggc
    27361 cgcatgctgc tgtggccggg caagcgcgga tttcagaaga cctgcatccc gtacgccgga
    27421 agcgccacca tgcaccccca acagccgatc atgcaggatc aaggtatccc gttcgtctat
    27481 ccagacgaag gctgtcattg agccagaaca tgcagcgtat cacggtaacg ccgcataata
    27541 tcttcagcct ttgtcatttt ggtttcgaag tcaggatcat agggcacgag ccgatatccg
    27601 ccttctggtg cttcggtcag gtacaggggc gcgccatcct gggtgttcag ccgtgagatc
    27661 acttccttgg gtagtacgac cccgagtgag tttccgaatt ttcgcacttt cagctcgacc
    27721 atagtgaatc ccctcaatgt tattaccaat gtaataactg tttgcggttt cagcaaccat
    27781 catgcatttt tctgacgtgc tcaggcgaat aggcaatggt cagcctatca agccccgcag
    27841 ggcactatgg atggccgcac aggccacaac acccgttaca gacacccaaa cagccacgac
    27901 atctgataac gcctgtacgg ccatcctatg gcgtctagcg ggcatgttgc gacacgtgag
    27961 ctgctgaatg atcgcctgaa ctccgatgtg tcttgagcag tttatggttt tgcccggttc
    28021 ttctgatgtt gcaggcgttg ggtgagcgct gaacgggaga gccccatagg gcgtcgaagg
    28081 cgccaacgtg gatgaggaag gtgctctggt ggagagacga tgcgtttccg catcgtcaga
    28141 tcatgacttt gcgccgtagg cgtgtccgtt cagtgcaggc ccaaagggcc gagcaggggg
    28201 atgccggggg gagatcgcgc tatgcgcgac tggggcggcc gtaggccgcg agccggcggg
    28261 ggcggagccc ccaagaggcg gtgtttgggt tcaatttggt tggaaatttt tgaggtttgt
    28321 gagttatcca cagatcaaat ggttagagag gtgttaaata ggtgttagat tctgtgttaa
    28381 gcgattctag catccactta acacattgat ataaaaacgg aatttctggt ttttttctcg
    28441 gtttggtatt taaaaccccg aatctcggta tttaaaaccc cgaatctcgg tatttaaaac
    28501 cccgaatctc ggtttcggta tttaaaaccc cgaatcactt gacgcaggta tttaaaaccc
    28561 cgaactttag gc
//