LOCUS       AP012159             3136818 bp    DNA     circular BCT 07-OCT-2016
DEFINITION  Komagataeibacter medellinensis NBRC 3288 DNA, complete genome.
ACCESSION   AP012159
VERSION     AP012159.1
DBLINK      BioProject:PRJDA64985
            BioSample:SAMD00060987
KEYWORDS    .
SOURCE      Komagataeibacter medellinensis NBRC 3288
  ORGANISM  Komagataeibacter medellinensis NBRC 3288
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Acetobacteraceae; Komagataeibacter.
REFERENCE   1  (bases 1 to 3136818)
  AUTHORS   
  CONSRTM   Gluconacetobacter xylinus genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (13-APR-2011) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Bioresource
            Information Center (NBIC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Ogino,H., Azuma,Y., Hosoyama,A., Nakazawa,H., Matsutani,M.,
            Hasegawa,A., Otsuyama,K., Matsushita,K., Fujita,N. and Shirai,M.
  TITLE     Complete Genome Sequence of NBRC 3288, a Unique
            Cellulose-Nonproducing Strain of Gluconacetobacter xylinus
            Isolated from Vinegar
  JOURNAL   J. Bacteriol. 193, 6997-6998 (2011)
COMMENT     ##Genome-Assembly-Data-START##
            Genome Coverage       :: 8x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            This work was done by Gluconacetobacter xylinus genome sequencing
            consortium
            including Department of Microbiology and Immunology, Yamaguchi
            University School of Medicine,
            National Institute of Technology and Evaluation,
            Genetic Resources Technology, Faculty of Agriculture, Kyushu
            University,
            Department of Biological Chemistry, Faculty of Agriculture,
            Yamaguchi University and
            Mizkan Group Corporation Central Research Institute.
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps
            and the genomic and proteomic data of the microorganisms
            analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..3136818
                     /db_xref="NBRC:3288"
                     /db_xref="taxon:634177"
                     /mol_type="genomic DNA"
                     /organism="Komagataeibacter medellinensis NBRC 3288"
                     /strain="NBRC 3288"
     CDS             127..1590
                     /codon_start=1
                     /gene="dnaA"
                     /locus_tag="GLX_00010"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BAK82413.1"
                     /transl_table=11
                     /translation="MTGGLGGYDAVAEANAQKSVLAIHWSRICERLKAEVGEVEYRTW
                     LRQITVGPVEEDEITLYLPTRFLRDWVRGQYGDRLGTLWNAEVPAIRRVELQVARPAA
                     DAAQAAPEEAPATPSARTAPSGKSAPRPAVAPVAEEPRPAEVRTDLAAPLDQRFTFDT
                     FVVGKPNEFAYACARRVAEQPSSPGFNPLFLYGGVGLGKTHLMHSIGAELVREGRVSV
                     AYMSAEKFMYRFIAAIRSQSTMEFKEQLRSVDVLMIDDLQFLIGKDNTQEEFFHTFNA
                     LVDAGRQIVVSADKSPSDLSGLEDRLRTRLGCGMVADIHATTFELRISILEAKATASG
                     VVVPAKVLEFLAHKITSNVRELEGALNRLIAHANLFGRPVTLEATQDVLHDILKAHDR
                     RVTIEEIQRKVAEHWNIRLTDMSSARRARAVARPRQVAMYLAKQLTSRSLPEIGRKFG
                     NRDHTTVIHAVSRVTGLMAEDPAFAEDVELLRRMLES"
     CDS             1707..2831
                     /codon_start=1
                     /locus_tag="GLX_00020"
                     /product="DNA polymerase III beta subunit"
                     /protein_id="BAK82414.1"
                     /transl_table=11
                     /translation="MKLKADRVTLLKALAHIQSVAEKRNTIPILANVLINVVNGAMTL
                     TATDMEIAVVEGIAAETQRDGAVTAPASVLYEIVRKLPDGAQVELDHAGGDAPLGLRA
                     GRFATSLNVLDVDDFPSMMAGALPHEFSMPAQVLRGLIDRTRFAISTEETRYYLNGIF
                     LHVAEGEAGPVLRAVATDGHRLARVETELPPGSAGMPGVIVPRKTVAELRKLLDEGPE
                     QVAVALSDTRIQFSIGNITLTSKLIDGTFPEYERVIPHGNNKILRVGKKIFSDAVSRV
                     AAISQERSRPVKLSMAHNLLTLSAASQDQGTATEELDENHVSYDAPAIEIGFQARYLN
                     DITDQVEREVEFAFSDSSAPTIVRDVDSPSALYVLMPMRV"
     CDS             2858..3982
                     /codon_start=1
                     /locus_tag="GLX_00030"
                     /product="DNA replication and repair protein"
                     /protein_id="BAK82415.1"
                     /transl_table=11
                     /translation="MAFVNRLVLTDFRNYRHLSWRPRQPVSVITGPNGSGKTNLLEAV
                     SLLVPGRGLRGARMDELPRHGATLWGVAADVADMMGPEAQPVPLATGADPLRPVRRAF
                     RVDGQTLRSRDGISECFAAVWLTPQMDRLFQEGATGRRRFLDRLVLALEPGHAREVAA
                     HDRAMQQRNRVLAQHAADPHWLAALERTMARHAVAATAARMEMVARLNTDEQAVLDGF
                     PAARLAMDCVIAAQLVDTPALAVEDWLAGCIASTRAVDRQRGGSRFGAHRADLHMADR
                     LTSRPAAQSSTGQQKALLLGIVLSHARILTDCRGRPPVLLLDEPLVHLDTMRRDALFR
                     ALSRMHTGVMLTGTDIEQFAPLRGSAEFVTPGEGNLASGA"
     CDS             3995..6541
                     /codon_start=1
                     /locus_tag="GLX_00040"
                     /product="DNA gyrase subunit B"
                     /protein_id="BAK82416.1"
                     /transl_table=11
                     /translation="MLVTWAGSGYNAFCYFIVIRCGASAGMTDQSSPDQKHDAEVVGS
                     MPPAADYDAASISVLRGLDAVRKRPGMYIGDTDDGSGLHHMAFEIIDNAVDEAQAGFA
                     TCCTVTLNGDGSVTVRDDGRGIPTDMHHEEGVSAAEVVLTKLHAGGKFNQNSYKVSGG
                     LHGVGAAVVNALSEWMEVRIWRDGSEHVIRFQHGERDEPLRLVGKSDEPRGTQVTFKP
                     SVQTFAKVEFEFAILERRLRELAFLNSGLKIILRDERHDPAREEGFHYEGGLCAFVEW
                     LDQGKTAIVEPPITGSLQNDENGIKVEFALTWNDSFHETMLCFTNNIPQRDGGAHLAG
                     FRQALTRVVGRYAEANATKKDSHALNGEDMREGLTAVLSVKVPDPKFSSQTKDKLVSS
                     EVQPVVHAAAADMISHWFETHPKEARLIVAKVMDAAAAREAARRARELTRRKGVLDIS
                     SLPGKLADCQERDPSKCELFLVEGDSAGGTAKQGRDRRFQAILPLKGKILNVERARFD
                     RMLGSAEIGTLITALGTGIGRGDVEHGGFSIEKLRYHRIVIMTDADVDGSHIRTLLLT
                     FFFRQMPELIEKGYLYIAQPPLYRAKRGNDERYLKDDAALETYLLDKALANAALRYAD
                     GREITGEPMRAEVLFIRDVTRALSRLSARVPVWVLEQAAIAGVLCPDPQATPERIVDL
                     QGRLDAVSPAAERGWKVAVSDSGLEMARSVRGVGEVYRLEATTLRSAEVRWLAERHAR
                     LVSDFAQPVNLVLDGAPQPFNGPASLYERILAQGRKGLSINRFKGLGEMNDEQLWETT
                     LDPAMRTLLQVKVGDIENAAQVFSTLMGDVVEPRRDFIVGNALKVANLDV"
     CDS             complement(6548..7228)
                     /codon_start=1
                     /locus_tag="GLX_00050"
                     /product="phosphoglycolate phosphatase"
                     /protein_id="BAK82417.1"
                     /transl_table=11
                     /translation="MMTASPPRLAVFDMDGTLIDSLPDLAACASRLLVHYSLPPITPD
                     LVRPMIGDGVAVLVRRLLAHAGPSAAGIDPTEATTRYMADYTPHSTDLSRPFPGTEAV
                     LESLRADGWHMAVCTNKPVAAARHILQALDLEKWFVAVGGGDSFSARKPDPCHLLGTI
                     ELAGGDPRRAIMTGDHRNDVACAMAAHIPAIFARWGYGRPEMEAGATVGADSIAEVAR
                     LAGELIPA"
     CDS             7291..8709
                     /codon_start=1
                     /locus_tag="GLX_00060"
                     /product="UDP-N-acetylglucosamine
                     diphosphorylase/glucosamine-1-phosphate
                     N-acetyltransferase"
                     /protein_id="BAK82418.1"
                     /transl_table=11
                     /translation="MHKGLTRYTGAEYPHTAMNTKTDTVVSAPASRLSTAIILAAGRG
                     TRMKSERPKVMHLLAGRPMLHYLVENAGKVFDRIVVVVGPDMDDVAALAAPHAVVVQH
                     DRLGTGHAARQAEAAFGEGDVAVLYGDNPLISPDTMRALLAQRRQDGTGLALLAMEPA
                     DPAKYGRVVMCDGQVERIVEWADATPAERAIGLCNAGVLCADAADFRRWLDEINNDNA
                     QGEYYLGDVVARAVADGRSVRAVVAPEDELRGINSRAELAQAEACVQTRLRLAAMNGG
                     TTLVAPDTVFLCADTVLEPDTVVHPHVVFGPGVHVRRGTEIHAFSHVEGAVVGPDAQI
                     GPYARLRPGTDVGAKARVGNFVELKATTLGAGAKANHLTYLGNATVGGGANIGAGTIT
                     CNYDGVFKHATEIGADSFIGSDSVLVAPVRVGARALTAAGSVITHDIPDGAMAVGRAR
                     QANKAGYADMFRDRLKKKKEQG"
     CDS             8709..10532
                     /codon_start=1
                     /locus_tag="GLX_00070"
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase (isomerising)"
                     /protein_id="BAK82419.1"
                     /transl_table=11
                     /translation="MCGIVGVVGSNQATPVILDALRRLEYRGYDSAGIATLEHGLVER
                     RRAAGKLDHLASLLARVPLPGVTGIGHTRWATHGAPTENNAHPHGTERVSVVHNGIIE
                     NFEVLRRELEAAGQVFSTDTDSETIAQLVDYHLQRGLSPREAAHECLKRLEGAYALAM
                     IFAGHDGMVIGARHGAPLVVGFGENEMFFGSDSLALAPLTRRIAYLDDGDWAVITPQG
                     AEFFDMAGNPVERPVRLTALIAASVGKDGYRHYMEKELHEHPVVIGQTLQRLIDPATR
                     RVVMPELPFDLAAIPRAVVTACGSAFYAGMIGRYWIEQYARLPVDIDVASEMRYRNPP
                     LAQGGLGLLISQSGETADTLAALRGMRAAGQHIVSVLNVEQSTMARESDAVLGTVAGP
                     EISVASTKAFTAQLSVLACLTIALARARGLMDGTMEEAMVTALLDLPSKATEVFERHD
                     EIRRMATIVAEARDVLYLGRGAMFPVALEGALKLKEITYIHAEAYAAGEMKHGPISLI
                     DSSVPVVATVPSGPLFDKTLSNLQEARARGGRLLVFTDMEGAPRLREIAECVVAIPTV
                     DEFVAPILQTIPVQILAYEVALLKGTDVDQPRNLAKSVTVE"
     CDS             10590..11591
                     /codon_start=1
                     /gene="thiO"
                     /locus_tag="GLX_00080"
                     /product="thiamine biosynthesis oxidoreductase ThiO"
                     /protein_id="BAK82420.1"
                     /transl_table=11
                     /translation="MQHMAAQTALPPGMGPSVLVRGAGVSGLTAAVTLAERGARVHVH
                     ESGPRVGSGASWKAGGMLAPWCEAESATTEVTEQSLSSLGWWDAHVPGVVRNGTLVLA
                     PARDVGEIARFGRRTSHFTTIGEDEIAALEPDLADRFSRALFFAGEGHVDPRRALAAL
                     ADRLVRLGGRISFNVPVDTPADGYDWVVSCTGIAAREQMADMRGVRGEMLLLRCPDIG
                     LRRPVRMLHPRIPIYIVPRADHVYMVGATMIESENAGPMTLRSMVEMLGAVYALHPAF
                     GEAEILETGTGLRPSYPDNMPAVRREGRHIHINGMYRHGFLLSPVRAAEAADIVFGA"
     CDS             11614..11820
                     /codon_start=1
                     /locus_tag="GLX_00090"
                     /product="thiamine biosynthesis protein"
                     /protein_id="BAK82421.1"
                     /transl_table=11
                     /translation="MDMQIMVNDERRDVVAVTLAAVLTELGYAATSRVATAVDGRFVP
                     AGQRAGMALHEGARVEILAPMQGG"
     CDS             11826..12596
                     /codon_start=1
                     /locus_tag="GLX_00100"
                     /product="thiazole synthase"
                     /protein_id="BAK82422.1"
                     /transl_table=11
                     /translation="MTLFYGTELTSRLMLGTAQYPSPEILSDAVRRAGAGVVTVSLRR
                     EAAGSRAGEAFWNLIRELDVPVLPNTAGCHSAREAVTTAQMAREVFGTDWIKLEVIGE
                     SDTLQPDMFALVEAARILTEDGFKVFPYMTEDLVGAERLLRAGCEVLMPWGAPIGSGK
                     GLNNLFGLRALRAHFPDVPLVVDAGIGVPSHAAQAMELGYDAVLINTAVAKAGNPAEM
                     ARAFAMAVEAGRIAYQADPMEERDMAVPSTPVIGQAML"
     CDS             12593..13213
                     /codon_start=1
                     /locus_tag="GLX_00110"
                     /product="thiamine phosphate pyrophosphorylase"
                     /protein_id="BAK82423.1"
                     /transl_table=11
                     /translation="MSAPLPSRIYPVVDSAQWVARLGQAGARLIQLRLKDRTADALRH
                     EIREGIRHARAHGVTLVLNDYWQAAIEEGMDYIHLGQEDLDTADLSAIRAAGIRLGVS
                     THDEHELERALSVAPDYVALGPVWPTTLKKMPWAPQGTARLTVWKQRIGAIPLVAIGG
                     VTLARAPLCLAAGADCVSAVSDFIRMPDPAAQVRAWLEATAGPATV"
     CDS             13439..16063
                     /codon_start=1
                     /locus_tag="GLX_00120"
                     /product="Na+/H+ antiporter"
                     /protein_id="BAK82424.1"
                     /transl_table=11
                     /translation="MEIAGLAAILMAIAVLLVVVSAVQPLARRLELSETVLLAIVGIV
                     IGGAADLVLRNSHLDIFSGAAQTLLDFPLNSEAFLLIFLPILVFQGALGIDVRRLAHE
                     TATVLLLAVVAVAVSTAAIGFALYPFAGMPLAVCLLLGSIVATTDPSAVAGIFKEIGA
                     ASRLTRLVEGEALLNDAAAISIFTILLGSITSHHKIMLGGAMLEFFVSFIGALIIGVV
                     FGRLTLMLIPALGAAPAAEVTLTVALPYLAYIVCDEFLGFSGVVATAASGLTISIYGP
                     STFRPQTWRFLNELWQQLVFWAGSLVFVLASMLVPRLLVGMTKWDCVLILLAAGAGLL
                     ARGAVVFGMLPVLAATKLSPPVPTPFKVTMVWGGLRGAITLALALAVTENEHVSSSIA
                     HFIGIIATGFVLITLFVNGLSLRYLVLFLKLDQLPLIDQALRHQILAIGLGEVRDQTR
                     EVAGELGFSPNVTTTVVDVLDRRVHSEEQANTFDTALGDRQRVTLALIVIANRERSIL
                     LDMFRIQGLSRRVMETLLRSAEAMVDGARLEGRFGYVRALRRRLRPSLRFRVAQVIHH
                     RFNFDMPLMYCMMERFEMLMIGYFVSLSLTRFMRQRMEPTLGSRISEIVGEVLGRQCK
                     LLDEALQTLRLHYHGYSEALENRMLRQIALRLEEEKYDTLMADSLLSEELHRELHKDV
                     EHRREQLDFRLKFNIRAGIESRIHNFPLFEGVPDGVLHDVAMKMSIHFSSPGERLYRK
                     GQKVRTVYFISAGLAETHYPKHDVRFGAGAVLGGEEALKDERVTATSRSLQFGHFMTM
                     SARNFRKLVEDYPRIGENLERLTQARNKGELPDAQLLPQDGQDAPENPPSYDAIDLAI
                     APVSRALPVRQDNQASDA"
     CDS             complement(16479..19217)
                     /codon_start=1
                     /locus_tag="GLX_00130"
                     /product="hypothetical protein"
                     /protein_id="BAK82425.1"
                     /transl_table=11
                     /translation="MTVGQNSPQTSGGLPQRLARARQQAHRVLWAERLWPLMLPAADA
                     AMGVALLGLTRLPQHLPDSLHALLLGGCVAGTVYITGRLWRRLRPPTPAETDRRVEQA
                     SGLTGQPLRTLQDHPANAPTPEITYLWHLHLQRTKAALDHLRGGWPRLGLPDGRWWAA
                     TPLLALLLAGGMAWNGAHAPSRILAAFIPGVDDADTPAPQINAWITLPDYAPGAPVFL
                     DATHGTATVPAGAQLSVTLNGLAGQPALRMRGAQQPAIGPHAFHALGNDSWNTQATLL
                     ASGQITLRGRGRTLARWTLHITPNPAPDVAWGKDPGSQEGEWRTRLPYHVAQPYGIAS
                     LHAELVMPDSPHDVLDVPIALNGQPRKADDMATPDLSQNPWAGEDVTARLVATSNSGM
                     SATSAPVHLRIGARVFNNPLAKAILDIRKRVALHRENRVQAGRELLSLGQADTMLTHH
                     VGLLVALTSTAAILGSDDVTDDYAINQATGRLWFLALDIEHNRRDMDNAQADFGVQTA
                     QEAVRQQLEHMREMGPKGQGPDQQAELQHRMQALKDAISRKMQALAQQAMRDHSAMPA
                     IPEMTSRGEQNLAQMMQQLQEDAAGGHNADAMQKLQQMEDIAEGMRNATPQDMVELAR
                     QMQARQQAMELRRALRDLVSRQAQLLDHAQLRMDQDQRQRDQEAASHQTDMDADGADL
                     STMSTADLLRQLGISQPGGAPQPQSAAPPPATSMTPEARTAQQHADRAVQHALARAVH
                     ELQREFKQLGGKDMPALDKAQTDMKAVRAALGAGRDPDAASAEKKVLADLQQGSQQMR
                     KSMRSQSAQGAMTVFLPMLSHENGKGSHGSGGNHPASEDDEDDTDQQAEGSGDRDPLG
                     RKTGGTHAGMDNDTHLPDKASRERAREIEQELRRRDADRTRPPEELEYLDRLLRAF"
     CDS             complement(19214..20596)
                     /codon_start=1
                     /locus_tag="GLX_00140"
                     /product="diaminopimelate decarboxylase"
                     /protein_id="BAK82426.1"
                     /transl_table=11
                     /translation="MHSIMAEAPPPCHGQDPSVAALLAVRPALSMHAMDGLVLEDVPL
                     NAIADALGTPTWVMSAGTLRARYRHLAAAFRATGQAVSIHFAVKANDHLAVLRVLAAE
                     GAGADVVSGGELRRAMAAGIPAGRIVFSGVGKTVVEMQAALRVGIAQINVESAEELEL
                     LSIVAQAEGLEAPVALRINPDVDAGTHAKITTGLATNKFGIPYNRAVELYAHAASLPG
                     IRPVGLAMHIGSQIVRMQPYRTAYARLAALVHAIRARGLKVDVLDCGGGLGISYRDET
                     EGAPEALAAAIHTELGGLDTHLAIEPGRWLAGPAGVLLSTVILRKRGYDGMPPFLVLD
                     AAMNDLMRPSLYDAWHGIIPLAATTAAAKEEQVHVVGPVCESGDTFGHDRTLPHMEAG
                     ARVALLDCGAYGMVMSSTYNARPLAAQVMVDGSRWAVIRERQTVEELWAADSIPQWVN
                     QTLLPSGGGL"
     CDS             20663..21061
                     /codon_start=1
                     /locus_tag="GLX_00150"
                     /product="cytidine deaminase"
                     /protein_id="BAK82427.1"
                     /transl_table=11
                     /translation="MDITPLVKSAIDARGRAYAPYSRFQVGAALETEDGRVFAGCNVE
                     NAAYPEGTCAEAGAIAAMVMAGGRQIRRIVVCGGGDTACTPCGGCRQKIREFAVPQTP
                     VTMVSANGSVLLVRTLAELLPDSFGPENLA"
     CDS             complement(21178..21336)
                     /codon_start=1
                     /locus_tag="GLX_00160"
                     /product="hypothetical protein"
                     /protein_id="BAK82428.1"
                     /transl_table=11
                     /translation="MKARTRLRALVLIAAGMLVLTTTLGACGRIGPPHQPSSSPRDYY
                     RTYPSPDR"
     CDS             complement(21333..22763)
                     /codon_start=1
                     /locus_tag="GLX_00170"
                     /product="argininosuccinate lyase"
                     /protein_id="BAK82429.1"
                     /transl_table=11
                     /translation="MPGNAKTPTDQDAHKANAQWGGRFAGGPAAIMQDINASIGFDKA
                     LWRQDIAGSKAHAAMLAKTGIIPAADAAAITEGLEQIGSEIAAGTFEFSTALEDIHMN
                     IEARLSDRIGEAGKRLHTARSRNDQVATDFRLWVRDAMDGLDQQAASLQRALARRALE
                     HAATPMPGFTHLQTAQPVTFGHHLMAYVEMLARDRGRLADARRRLNESPLGSAALAGT
                     SFPIDRDMTAHALGFDRPTANSLDAVSDRDFALEYLSALSIMAMHLSRLAEEIVIWCS
                     APFSFIRLSDAFTTGSSIMPQKRNPDAAELVRAKGGRITGALVGLLTVMKGLPLAYAK
                     DMQEDKEPVFAATDAASLSLAAMDGMIRDLSVNTQQMRAYAGSGFSTATDLADWLVRV
                     LKVPFRTAHHVTGRLVGKAEAKGVGLADLTLEEMQAEEAGITADIFSVLTVDSSIASR
                     TSYGGTAADNVRAQATRWLDTLGTAS"
     CDS             22994..23827
                     /codon_start=1
                     /locus_tag="GLX_00180"
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="BAK82430.1"
                     /transl_table=11
                     /translation="MQHAALAQEPSRLLTRDDPAPVIQFGTSVMDGGFPPPGLPFVLV
                     SDHAGCAIPAALGDMGVSAHDRARHIACDLGMAETGRLLAQHLDCLLIEQTYSRLVID
                     CNRAPGHPTSIVRHSDGTSVPANTDISAAQEGCRVEEIFLPYHQQIGDEISMRLEAGL
                     PVVLVSLHSFTDCMNGQDRPWHTGVLHNRNPAFGLRVRDLLAAEEGLVVGSNEPYALT
                     DASDYTVPVHAEGRGLPYLEIEIRQDLVATPQGQAEWAQRLARILPQAWQEFSHQVHA
                     R"
     CDS             23858..24760
                     /codon_start=1
                     /locus_tag="GLX_00190"
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="BAK82431.1"
                     /transl_table=11
                     /translation="MVNTGDTVPGRDRPRIDGHTLLAGVIGWPVAHSRSPLMHNWWLA
                     QCGVNGAYVPLPVAPDQFDTAVRGLQAAGFRGVNVTIPHKESAYRIVDRLHRSAQRSG
                     SVNTLVFSSDGRIEGYSTDGDGFVANVEAHGVAVKGGSALLLGAGGAARAIAASLLDR
                     GVRVVVANRTRARADALAASLAGVEAIDWAQAGSALPGSTMLVNTTSIGMEGAAQAQF
                     PLDLAQADPELVVCDIVYVPRQTALLKWAAANGLRTVDGLGMLIHQAGLGFEKWFGVA
                     PGIGPDVEALLDADLHRPAAGGAG"
     CDS             24763..25392
                     /codon_start=1
                     /locus_tag="GLX_00200"
                     /product="dephospho-CoA kinase"
                     /protein_id="BAK82432.1"
                     /transl_table=11
                     /translation="MRVLGLTGGIGMGKSTTAQLLVRAGVRLFDADAAVRALQAPHGA
                     ALPAIGRLVPGCVRDGVLDRAALRAAALASPAVMHGLEAIIHPLVRRARQRFLERARR
                     DGCRWVVLDIPLLFETGSDRLCNRVVVVSAPASIQRMRVLRRGTMTPAQINAVLARQM
                     PDDQRRRRADVVIETGLSRHETVRQIQRLLRAMREGSPAAWAAAEGIRA"
     CDS             25389..26069
                     /codon_start=1
                     /locus_tag="GLX_00210"
                     /product="DNA polymerase III exonuclease epsilon subunit"
                     /protein_id="BAK82433.1"
                     /transl_table=11
                     /translation="MKRTILFDTETTGLDPLKGDRVIEIAALELVGDLPTGRNFHVLI
                     DPERDVPEEASRVHGFTRADLEGKPKFAEVAAGFLEFVGNDPLIAHNARFDFGFLNAE
                     LARAKQPVLDMGRMVDTLDMARERFPGMPNSLDALCRRFSIDLSERTTHNALLDCKLL
                     AAVYLELTGGRQRGLSLAVEEGGGGIATYEYTRPAGLAGVCVKPDAAEIAAHQAFVEK
                     LPDALWAD"
     CDS             26140..28509
                     /codon_start=1
                     /locus_tag="GLX_00220"
                     /product="two component hybrid sensor histidine kinase
                     and regulator"
                     /protein_id="BAK82434.1"
                     /transl_table=11
                     /translation="MDVLNRKRALSTDEIVDPSIAPSDQIRRFLFHIGIPVAGVVSAI
                     AIIAGVGWHSYRTVRTGALTLTHDLLVSQQDYIAKEVSSFLMPASAGAIVARDMLEHG
                     VPEVEQKIFTGYSSTMLRNVQQIQSFYIADSDGNFSTLEHGDNNQDITITTLHDVGTP
                     KASFTHQLRDPNGKVLKQWETSAGTYDPRAHAWFIDTVKAGQLAWTHPYVVEVTKQIT
                     ITAAVPYKGLNGKTYVYAINMSLNHLNNFLNSLRIGESGNAILLDQNGHVVAGHGMAE
                     TQARAHGDSDKMTLDPDHFPVMTKAFDQYRVHGYGARTVTVKNKKYVTITAQLPVGKD
                     SWVLLLVAPEDDFSRFAMADGRQNLLFFVLVVLMASGFGLLLFLQARRADRMRGQIAQ
                     SRAVASYESHALQSVASYPDLFNPEDNALVLTESLAEQAHARRAAIWRILHDGHTLMC
                     IDSYDRQQDVHSGGFEMSTTDMKSFFDSVSHGDALVVDDAAKDERAVAFYRVYMRSFG
                     SKALFCSPILGSSGPVGVITLEDAPRASLVSHFVDMIAGVTAARFSAQHYTAVAAAKE
                     ELESEPTTEEAQRDPSQGFLLRPGALSMHGQEGAPDLASVEGYYPAVAIMVISLSDVV
                     MTAQNDPTSNIKLLDSMATMLQDIAHQCGLYSIRMLGHRVVCVAGWSRTPDKGAVYRI
                     ANAALMMRENTLAALSQADLDPVFRIGIDVGPVYGGMLGKDPQAFNLWGDAMGMAEMM
                     AQGAPDVGTIQVSEDVYLDLRQYFLFRERGRFFIPGAGLTRTYVLAGRR"
     CDS             28506..29399
                     /codon_start=1
                     /locus_tag="GLX_00230"
                     /product="ABC transporter permease protein"
                     /protein_id="BAK82435.1"
                     /transl_table=11
                     /translation="MTDTPPIMAGEDAGQVRGMAPPSGPDHTGRLAVLLQRFAPWLAA
                     IGRLMRHQVRFTLLLVGAGWGTLRESLRPNSWRRPVIYEFRATLRQVVSGGFLSIVIT
                     ATLTGLMVVSQAAYWLGYAGMAQMTGSILVSVLVREIAPILVGIILMGRSGMLSLTEI
                     GMMVLGGEVRGLQARGIDPFLALVMPRTFAFTVGGFTLGMIFAVVSLLMGFVVAHANG
                     AITSSVWTFFFNVLVAMTTWDYLIIPLKFVLVGFFVGLGACISGLTVSSTDTMATIMP
                     RGFARGIMLVLVVNILFMLDF"
     CDS             29402..30097
                     /codon_start=1
                     /locus_tag="GLX_00240"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAK82436.1"
                     /transl_table=11
                     /translation="MTANAPLLELRDVMPSFEESGLMPAPYNLRIMPGECAVIDCRDV
                     ERAALFADLCTGMISLTQGSVKFMGLDWSALHDRQLNALRGRIGRISRHGGWLDMFGT
                     HLNIMLPHLYHTTDPFEHVVQHATELGHRFGLPGLPISAPDRLSAADLARAACVRAFM
                     GRPALLVLEDISDMLPEETVLPFLEMLTTARDRGCGVLWLVRSAAAWRDYRKAVNIHM
                     RLLDEGLFSMRVV"
     CDS             30097..31047
                     /codon_start=1
                     /locus_tag="GLX_00250"
                     /product="ABC transporter substrate-binding periplasmic
                     protein"
                     /protein_id="BAK82437.1"
                     /transl_table=11
                     /translation="MVQKQQSDGIRQLVRVRYADEWVGILVLLALVILFGAVIEAGVL
                     RDWLTPAGRLRIVLPEDGVSGLSVGDDLEVMGIHAGTVRRVRINPSGGMYAIAEIDPD
                     IEPYIRHDSTAIIRKRFVVAGASYIDISRGVGEKLDWSYAVLGATNAPNPADTITQTF
                     SDIRDRVIPVLDNAQHMMAILDATITDMHAGKGSIGRLMTNDDLIRQAEQMITSLNAT
                     ISQLTPIEKQLGTVMERANASMSNVQKATGDLSNATPAITRNLKDATQQLPVLMVQAQ
                     TTVSSLQKLVDQMRGLWILGGSGNKVKTGHARLSPQKVQP"
     CDS             31044..31931
                     /codon_start=1
                     /locus_tag="GLX_00260"
                     /product="hypothetical protein"
                     /protein_id="BAK82438.1"
                     /transl_table=11
                     /translation="MKMKKEYLALGLALTLAECGGGGGQAVSPGDTTLAQDMDTGRDA
                     VGLERLAVAEQQYRAAGQRALARDDVTAIGDAGYNLATVQLNENKPTDALTTITATRS
                     ALATRGQTADDAGLDLVQAGALHRLGRENEAAAAAVRAAAGQDTDVTEKAQLVRGLIA
                     DDSGDHATLASVAAYFATLTGKVPDSWTADAREVEARNLLATAGSSQTAWQDAMQAAT
                     IRQTHVDYRDMARALGVAARAADRSGNTQAAAQLYVRASQSARQAGDTVAADRWAKQA
                     GSAAAVDPFVEPAAPARKK"
     CDS             complement(32265..33725)
                     /codon_start=1
                     /locus_tag="GLX_00270"
                     /product="sulfate transporter"
                     /protein_id="BAK82439.1"
                     /transl_table=11
                     /translation="MSALTRYRQEWFGNISRDTLAGMVGTFALIPEVIAFSFVAGVDP
                     AVGLYASFVISVVIALTGGRPGMISGAAGSVALVAAALVRAHGVQYLLAATLLCGLLQ
                     VVFGILRLHVLMRYVSRPVRTGFVNALAILIFSAQMPHMLHVTWHTYAMIALGLAIIY
                     SVPRFFSTIPSPLICIVVLTVVSILYPMPLHTVADLGHLPDSLPHLVWPDVPFSPATL
                     GIIAPYALAMASVGVLESMMTARVVDDLTETHSSKQRECVGLGVANIAVGLFGGIAGC
                     GMIGQTVGNLRYGGRGRLSTFMAGTFLLLLMVALRPWVAQVPVAALVAIMIMVSASTF
                     SWSSLRDLAHHPRTTSVIMLATVAVVVGTHDLAAGVAVGVLLNGLFFAFQVSSMLTVT
                     CTLSADGTARNYIVNGQVFFASSDSFADAFDLHDTARHITIDLTHAHLWDMTAAGMLE
                     ELVEKMKIQGMQVQIIGLNSATSTLLSRHTRLQGLP"
     CDS             complement(33757..34284)
                     /codon_start=1
                     /locus_tag="GLX_00280"
                     /product="hypothetical protein"
                     /protein_id="BAK82440.1"
                     /transl_table=11
                     /translation="MFELVFTRRFSMAHRLLAGESERCALPHGHNEYVRVSLRATQPG
                     ALDGRTNMVLPFQRAKSVWHQFIDNHVDHALQLAQDDPLLGWFMQHEPQRARRILVTP
                     GDPTTELLACLLMAKLNAFLAADGGVLTCALIEIDETPTNTIRYSGDPLAMLPQPRPA
                     GQCWWRRADMTITDT"
     CDS             complement(34277..35014)
                     /codon_start=1
                     /gene="queC"
                     /locus_tag="GLX_00290"
                     /product="queuosine biosynthesis protein QueC"
                     /protein_id="BAK82441.1"
                     /transl_table=11
                     /translation="MSVSPPPSIPAREAALVLFSGGQDSATCLAWALARFGRVETLGF
                     DYGQRHAVELECRDTLRRGMASEKPHWAQRLGADHTLDLAALGHVSDTALTREAEITL
                     NENGLPNTFVPGRNLIFLTFAAALAARRNIRHIITGVCETDYSGYPDCRDDTIKSLQV
                     TLNLGMASHYVLHTPLMWLDKAQTWELAQTLGGEALVGLINRESHSCYLGTRGTLHAW
                     GHGCGTCPACQLRQAGWERFAEKSRHV"
     CDS             complement(35016..35651)
                     /codon_start=1
                     /locus_tag="GLX_00300"
                     /product="hypothetical protein"
                     /protein_id="BAK82442.1"
                     /transl_table=11
                     /translation="MSYTVKEIFPTLQGEGAHAGRTAVFCRFAGCNLWSGLERDRAQA
                     ACRFCDTDFIGTDGPGGGRFTTADTLADAIATHWPAPDRKAAFVVFTGGEPLLQLDGA
                     LVAAMHARGFEIAVETNGTLPAPAGIDWICVSPKAGTPLVQTHGHELKLVYPQPDLLP
                     EQVAGLDFRQFWLQPMDNAARDYNTRATVDYCLHHPQWRLSLQTHKLIGIP"
     CDS             complement(35736..36806)
                     /codon_start=1
                     /locus_tag="GLX_00310"
                     /product="biotin synthase"
                     /protein_id="BAK82443.1"
                     /transl_table=11
                     /translation="MAQPVPFSTFIIATGARPMPDGSSPDTLPHVGPTSLPAVRTDWT
                     RDEVAALMALPFPDLIYRAQTVHRARFDPTEMQISTLLSIKTGGCPEDCAYCPQSAMH
                     EDGGVKASRLMAVEEVLKEARAAKAAGAARFCMGAAWRSPKEHDLETVCAMIEGVKAL
                     GLESCVTLGMLDNTQAHRLKDAGLDYYNHNIDTSPEYYGDIISTRTFQDRLDTLENVR
                     DAGINVCCGGIVGMGEDSTDRAGMIATLASLPRHPESVPINMLVRVEGTPLAERTGET
                     VDPIEFVRTIAAARITMPTSRVRLAAGREDMTDEAQTLCFLAGANSIFYGERLLTTPN
                     PAALRDRQLLDRLGMHTSHQQG"
     CDS             complement(36894..37766)
                     /codon_start=1
                     /locus_tag="GLX_00320"
                     /product="succinyl-CoA synthetase alpha subunit"
                     /protein_id="BAK82444.1"
                     /transl_table=11
                     /translation="MSILVNKSTRVITQGFTGAQGTFHTEQAIAYGTRMVGGVTPGKG
                     GSQHLGLPVFDTVAQAREATGAEASVIYVPPAGAADAILEAIAAGIPLIVCITEGIPV
                     QDMVRVRAALECSDSLLIGPNCPGIITPDECKIGIMPGPIHRRGHVGIVSRSGTLTYE
                     AVAQTSAIGQGQSTCVGIGGDPVKGMDFTDVLERMIADPDTHSIVMIGEIGGTSEIDG
                     AELIRASGTRKPVVGFIAGATAPPGRRMGHAGAVITGGHETASAKIEAMREAGIHISH
                     SPAELGVTLARVLG"
     CDS             complement(37771..38970)
                     /codon_start=1
                     /locus_tag="GLX_00330"
                     /product="succinyl-CoA synthetase beta subunit"
                     /protein_id="BAK82445.1"
                     /transl_table=11
                     /translation="MNIHEYQAKALLRSYGMPVPEGRAATSAAQALDAARSLAAPVTV
                     VKAQIHAGGRGAGHFASNPEGRGGVRLARSLDEVSEAAGAMLGEILVTKQTGPAGRMV
                     RTLYIESGCDIARELYFSMLVDRVSGQIVIVASPDGGMEIEEVAARTPERILKEYIDP
                     AKGLCDYQSRDLAVRLGLTGREIRAFQNIVRSAYNAFTDLDAAIVEINPLVVTGAGDL
                     LALDAKMSFDENALFRHPELAKLRDEHEEDPREREAAGYGLAYVGLDGNIGCMVNGAG
                     LAMATMDIIKMEGEEPANFLDVGGGASKERVAAAFRILIGDPKVRGILVNIFGGIMRC
                     DVIAEAIIAASHETGLNVPLVVRLAGTNVERGKALLAESGLTIIPADDLGDAARKIVS
                     AVRHAGA"
     CDS             39157..39981
                     /codon_start=1
                     /locus_tag="GLX_00340"
                     /product="hypothetical protein"
                     /protein_id="BAK82446.1"
                     /transl_table=11
                     /translation="MKHWRIEQMNWERFDPQRVDPDTVPLVKAASVVERNGLDYARYL
                     KNVFADDPAFQQAVDNWADEEVQHGDALGRWAMLADPAWDYMAAFERYRQSYRLELDV
                     AASIRGSRTGELIARCMVETGTSSFYTALGDATDEPVLKAICRQIAADEYRHFKLFYD
                     HMNRYLRRERLGVWQRARIALGRVTESEDDELASAYHTTNDPVGLPYDHQRCIAAYMS
                     RALRFYQPRHAARVTGMILKTIGWTPHGRLHALIARVLYRLLMMRQRRFARVMTTV"
     CDS             40023..40682
                     /codon_start=1
                     /locus_tag="GLX_00350"
                     /product="hypothetical protein"
                     /protein_id="BAK82447.1"
                     /transl_table=11
                     /translation="MKIHGMMVQDMKTRGTLLLAAAGCLALAGTARADVPATAAAPGP
                     AGADSSSDAQISDATRAERLMASQVGLRNFTAAGFHPGMVRHIVLLRFLPTITDAQRA
                     EVVRRFMALGLVSRREDGSPVVSAIETGAQMSGEGADEGLQQAFIVTFRSEGDRNYYV
                     GRPVVTDPAYFDPAHEAFKKFAAPYLVSVVVFDYALSTTHPRRDVPVRTGGTQVPRQQ
                     G"
     CDS             40716..41474
                     /codon_start=1
                     /locus_tag="GLX_00360"
                     /product="ABC transporter glycine/betaine transporter
                     substrate-binding periplasmic protein"
                     /protein_id="BAK82448.1"
                     /transl_table=11
                     /translation="MTTVTLGHLDNTVQQASAAAVARVLEAYDLEVEYVAAPRDAMEE
                     HMRRGDVDLFVSAWLPDVDAGFVASGLGMESFGQLYRPTFGFCIPEAAATGITSLAEL
                     AAAGCPVGREIVAPDSVIDLVRQVVAAYNLTEAGYTIATRPDAQASDHAAHVLENSLP
                     EIIPVWQPSFVHYGQRVITLEDPKEACGQEQEARILIRSAIRPEMDTDLLDELDELTL
                     GNKVVSALDHAMRTEGMSAEDAAEAWQRGKLLPR"
     CDS             41484..42758
                     /codon_start=1
                     /locus_tag="GLX_00370"
                     /product="methyltransferase"
                     /protein_id="BAK82449.1"
                     /transl_table=11
                     /translation="MTMHEDDGPPAPDARDAGLKAQYEHYPYPARDPREEKSRLLIGS
                     PSHLREIDYWVFGATRPQSTALRVLVAGCGTGDGAIMLATHMARAGRGGEVLCLDRSS
                     VALGIARARAEVRGLTNMRFVQGDLANLAAVAPGPFDYIDCCGVLHHLPDPDAGLAAL
                     EGVLAPGGGMGIMVYAPYGRTGVYMLQDALERLAPVADAPKQRLDVARRVMRHLPATA
                     WLRQNGNFGDHLSGGEAGLYDLLLNPRDRAYDITAFHAFLERAGLAAACLMEPARYDP
                     ALLLPDPRLRERIAALPERVREAVAEDVAGNMATHVAYVRRASEPVMRADARAPDAVP
                     IMREIPGIELARMMGPDDRLPFAFGTLQVTIALPPQARGILPLIDGERTLADIAAIME
                     TRGLSASRFARVWDQMFTTLESLNRVLLRAPR"
     CDS             42764..43306
                     /codon_start=1
                     /locus_tag="GLX_00380"
                     /product="hypothetical protein"
                     /protein_id="BAK82450.1"
                     /transl_table=11
                     /translation="MTQRRETGLPVVIFGAKLRPDGTPGRTVRLRVAAAHAFGLRQGG
                     VVYVPTGGPSRPSGMTEASVMARLLLDGGAAAGSVLVEDTAPDTLASVIACTRLLRAR
                     GYGGVVAVASSAYHLPRCLVLMRMMGWRVQRVPPPKVAAARGWRKRWFWRLREGAALP
                     WDMLLLAIWRLRYGRGGFAP"
     CDS             43370..44356
                     /codon_start=1
                     /locus_tag="GLX_00390"
                     /product="malonyl-CoA-[acyl-carrier-protein] transacylase"
                     /protein_id="BAK82451.1"
                     /transl_table=11
                     /translation="MEDMPVQAFVFPGQGSQSVGMGRDLAEAFAPAREVFQEVDDALE
                     QHLSTLMFEGPMEDLTRTDNAQPALMAVSLAVLRVLEREGGLDLKRDVALVAGHSLGE
                     YSALAAAGALGIAQTARLLRLRGNAMQKAVPPGEGGMAALIGADMDMERAASLCAEAA
                     TFTDETGKTCKEVLEVANDNGGGQVVVAGQMAAIDRVIALAKAQGVKRALKLPVSAPF
                     HCSMMASAADAMRAALADTDIAPPVVPVVANVTAAKVSDPATIRDLLVRQVTGTVRWR
                     ESVDAMVAMGADSFVEIGSGKVLAGLVRRINGDVATRSVGTPADIEAYLAAR"
     CDS             44433..45188
                     /codon_start=1
                     /locus_tag="GLX_00400"
                     /product="oxidoreductase"
                     /protein_id="BAK82452.1"
                     /transl_table=11
                     /translation="MFRLDGKVALVTGASGGIGREIARALHAQGASVVLSGTRQGVLE
                     DVAAEIGAQDGAGRVHVCAADLSDPAAADALVASAEEKAGAPLAILVNNAGLTRDTLA
                     IRMKDEDWSRVLDVDLAAPFRLCRAALKGMLRRRAGRIVNIASVVGVTGNAGQANYAA
                     AKAGMIGMGKSLAQEAGSRGVTVNTVAPGFVQTAMTDVLPDAQKEKLVGAIPLGRMGQ
                     PQDIAPAVVYLASDEAGWITGTTIHVNGGMAMP"
     CDS             45449..45688
                     /codon_start=1
                     /locus_tag="GLX_00410"
                     /product="acyl carrier protein"
                     /protein_id="BAK82453.1"
                     /transl_table=11
                     /translation="MSEIADKVKKIVVEHLGVDESKVTPDASFIDDLGADSLDTVELV
                     MAFEEAFSVEIPEDAAEKITTVKDAIDYIEKQKAA"
     CDS             45760..47043
                     /codon_start=1
                     /locus_tag="GLX_00420"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
                     /protein_id="BAK82454.1"
                     /transl_table=11
                     /translation="MQSTGLTSGQRRVVVTGMGIVSPLGLGVERNWSRLVAGENGFGR
                     IASFDASDLPAQVAGEVPAGPTESGGLTLSDWIPVKDQKKMDRFIHLGLVAATEAVED
                     SGWKPESEEDRCRTGVMIGAGIGGLQTIYEASVTVKEGRARRLSPFFIPSALINLVSG
                     HVSIKYGFKGPNHSVVTACATGVHAIGDAARMIMLGDADVMVAGGAEAAVCPLGIAGF
                     CSAKALSTHFNDTPEKASRPWDRDRDGFVMGEGAGIVVLEEYEHAKARGAKIYAEVIG
                     YGMSGDAHHITAPAAGHEGAFRAMQNAVRSAGLTTADIQYVNAHGTSTMADDLELEAV
                     ERLFGDDARKLAMSSTKSATGHLLGAAGAVEAIYSILAIRDNVAPPTLNLDNPSRESV
                     IDRVAHTAQERKIDTILSNSFGFGGTNASVILRGV"
     CDS             47101..48099
                     /codon_start=1
                     /locus_tag="GLX_00430"
                     /product="aminodeoxychorismate lyase"
                     /protein_id="BAK82455.1"
                     /transl_table=11
                     /translation="MRRVLAALGGAFLLLVLSGLGIGFLGLKHYDAPGPLTEGRAVVI
                     PHGGTTQVMATLQDAGVLERDWSTQKVFDVATALTRVDGAFHAAELVFPAHGSIHQVL
                     LVLRHGKPVIHRLTIPEGLSSIQIAALLEQAPYMDGTFPFPDEGSVMPLTYDYEWGMP
                     RAQMLARMQHAMDRALDHAWEGRVADPAILNRHDLLVLASMIERETGSADERPMVARV
                     FLNRLHQGMRLQSDPTVVYGLNHGVGPLGHALSHADLLQPTPYNTYIILGLPPGPICS
                     PGMAALEAAAHPAQGDQLYFVANGHGGHNFATTLGDHNHNVSAFRAAKRAQSSVAQ"
     CDS             complement(48135..48950)
                     /codon_start=1
                     /locus_tag="GLX_00440"
                     /product="hypothetical protein"
                     /protein_id="BAK82456.1"
                     /transl_table=11
                     /translation="MRTFHFIRTSLATLALMMPLHGALAASMEEEQNLVDRATLTVRD
                     MFSTATANSKVTRYLAQSRGVIICPSVFRMSIAFGGGGGGCVFLTRDAHGSWSDPAFY
                     RMSSANFGLQLGMQDVEVMLFVMTDQGVQSLLDSQFKLSADVGTSFASSGSGLESGTA
                     GEHNTSIKGVQKSKGLFAGAALGGSKMRVNSAANRAYYNQIVGPEDIVVSMRVNNSGA
                     DPLRSALSEVLTTAQSKADKNGPATTTQASPAFQQPMATAPSGSVSSQNLPAQ"
     CDS             complement(49083..49871)
                     /codon_start=1
                     /locus_tag="GLX_00450"
                     /product="myo-inositol-1(or 4)-monophosphatase"
                     /protein_id="BAK82457.1"
                     /transl_table=11
                     /translation="MTQAILTRFEAARSIVRDAAALAMKMRPAPGGPQGTQKSAQDWL
                     TEADGAVESFISERIGTLFPEDGFQGEEEGRTRTGSLRWVVDPIDGTSNYARGRNRWC
                     VSLGLMDGDTPVAGIIEAPALGETYTAVRGHGAFLNGKRIKASPVTDTAASLIEMGWS
                     NRVPPGVFQQKIDAILNLGAMPRSGGSGAIALAEVACGRQDGYLEIRINLWDVAAALV
                     LLEEAGACVSPFLRDGGLNDGISILAAAPGIANAFSSAVGVSLK"
     CDS             complement(49900..50403)
                     /codon_start=1
                     /locus_tag="GLX_00460"
                     /product="hypothetical protein"
                     /protein_id="BAK82458.1"
                     /transl_table=11
                     /translation="MPDPLPAPHTQTAIRMGVSQMCRQHGWAVLHEFSLPDRRRADIM
                     ALTPQGHLVCIEIKSGLPDFRADRKWSDYLPWCDRMYFAVNQDFPRTVLPDTTGLIVA
                     ATDRGADGRPTCVDCAIIHHPPHTALAPARRRKLTLQFALQAAERLGRMEMPQLDQTL
                     RTALRVE"
     CDS             complement(50421..51194)
                     /codon_start=1
                     /locus_tag="GLX_00470"
                     /product="hypothetical protein"
                     /protein_id="BAK82459.1"
                     /transl_table=11
                     /translation="MSMGIHVLILAGSRAGRVDPMAQAAGISHKALLPVCGTPMISRV
                     ITALQSVGDIDTIAICIEQPDVLEGIVPAGVTFIPPAAGPSASVMKALDTLGTPLLVT
                     TADHALLEPGWVRSFVQAALESGSDVAAAVAMEESIMRDVPGTKRTMIRLADGAFSGC
                     NMFLFRTPAAAGVIRLWQKLETERKHPFRMARILGLSILLRFVFRRLTRADVCRRIGQ
                     LAHARVALIPLADGRAAVDVDKPADLELVTHLLSTASAT"
     CDS             complement(51191..51973)
                     /codon_start=1
                     /locus_tag="GLX_00480"
                     /product="fatty acid hydroxylase"
                     /protein_id="BAK82460.1"
                     /transl_table=11
                     /translation="MITNTLKNSSIRTGRSFDLGKMNLSQLWIAYLTYPTILLYFALI
                     LCSFTVMAYTYAAFVPVAVSIGAVMLVYPMVWYAIHRFILHGRFLYRMKWSASLWKRI
                     HFDHHQDPHLLDVLFGSPLNTIPTIAVVTIPIGYAIGGMPASAAAFGAGLTITCIYEF
                     FHCIQHLNYKPRMNWIQRMKQRHVLHHFHNENGNYGITSFVADRLFRSYYRDARGCPR
                     SPTVFNLGYDIKEAQHYPWVMEETGSPPRDRPDGANTTRNAA"
     CDS             complement(51970..53079)
                     /codon_start=1
                     /locus_tag="GLX_00490"
                     /product="transporter YjgP/YjgQ"
                     /protein_id="BAK82461.1"
                     /transl_table=11
                     /translation="MKHRLRLASGTVLLGYLSREMMGKVFATAIIVVSLMEILALLEQ
                     VTEIMHRHLGMSGVLYYAVMRLPLLFCNAMPIAMLIGALLALMQMTTSNEIAIMRAAG
                     LSTPGLIKLFLPTTIVLGILCGVVNDQVTPRTEQALAQWWNLTAPDALADPHNYWIRS
                     GNDLISIHFLGNGGSVLKDVMVYHRDRQSLLQKVTTLDSARYVHGHWYGTPARVLDVV
                     SPTRVDLLDIPPGQSTRLDWPITLTPGYITQLTTSFTQSISTMLAEENGSLPSSQSPS
                     FFLTEILGRIMLPVTFTVMLLLAVPVVYIPPRAGIRSWLPVWCLGAGLLFVVFQGLLR
                     ALGNAGTLPSLMAIFVGILIFILGVITVLLRIEER"
     CDS             complement(53076..54308)
                     /codon_start=1
                     /locus_tag="GLX_00500"
                     /product="transporter YjgP/YjgQ"
                     /protein_id="BAK82462.1"
                     /transl_table=11
                     /translation="MNRTSLQHRILDRLAPSTLDRYLLRQVVPPFSIALGVVMSALLL
                     ERLLVLFNLLAANGSSMKTFFALLSDLIPHYLGLALPAAMCVSVFSVIRRMSTNHEID
                     ALMASGVSLFRICRPFVVTGAIFGFLAFSLYGFIQPYARYDYRSAFYFASHAGWTPHL
                     QSKMFAISDDIVLTAENVDHAGSRMWNIFIRDATDKAHIRFITAQKGYIFNPADGSDI
                     RLDLVDGTIVTDSQDKQPSVTGFTRTTRLISGRSKLDDEAYRKRGETERELTVPELYY
                     GIRHGNPAISHSYMIAELNFRLARTTAIPFIPILACALAGVRKRQKNNPGLAIAAITL
                     VGFDHTLQMGMSFVANMHMSPLLVIWLPTLVFCLICVGVLIRQAGGLRILLERGPSMA
                     SRQLSADGLPRHMTERQA"
     CDS             complement(54305..55270)
                     /codon_start=1
                     /locus_tag="GLX_00510"
                     /product="metallophosphoesterase"
                     /protein_id="BAK82463.1"
                     /transl_table=11
                     /translation="MRITLMRRHAGRKEAILNPITIAHLSDPHLPTEMAPPRLADRLN
                     KRMFSYFSWRGHRRFVHRPEILARVMADITANHVNMIAVTGDLTNMGLPGECRNALRW
                     LEGMPASCTVIPGNHDTLVHADWQQTVGLWQPWMGKLPFPFVRRMGPVALIGVSSAVP
                     TPWFRATGTMGARQAARLRTILNETGRQGLCRIVMIHHPPVPGLAIPRKALRDPDNFA
                     DCIAHEGAEMVLHGHIHTATISSLPGPLGAVPVLGVASASARAHDPLRAAGWNRITVS
                     SGDKGYTLAVTRRFFPEDGEAVTTQETVFELLSPSRSFPGISTDS"
     CDS             55383..56363
                     /codon_start=1
                     /locus_tag="GLX_00520"
                     /product="diacylglycerol kinase"
                     /protein_id="BAK82464.1"
                     /transl_table=11
                     /translation="MTGCFALVYNPRSRRNMSDTSAYAPTARALLGGNFIDPADRSRL
                     DAHIADLASRNMECIVIDGGDGTVSDVLSAVHRHYAPDRLPAIAVLPSGNTNLIAGDV
                     GFGLRGTKALERLQQLAVSNRLRRNVRRRCGLVVQWPDSEDRPPVVGMFHGAAAFTRG
                     IELAHQPAILNNYSHEMAVIVSFLSSVGRLLTRRSRQEWMQGDPMTILAGAQTRLEGN
                     CFLFLSTTLQRLPYRIWPFWTGQDMRDDTINFLYVTGRPSQLAAAAWALLRGRQPAWL
                     RHNPDYSSGCEEQIEMHLNSDFVLDGEVFSPGATGRIILSATAPIDFIHA"
     CDS             56356..57345
                     /codon_start=1
                     /locus_tag="GLX_00530"
                     /product="hypothetical protein"
                     /protein_id="BAK82465.1"
                     /transl_table=11
                     /translation="MHEEGTYMPQPDPNSRLAAAGRIAHLLADELVQPVAPFVTDFVT
                     QLVGGVQPLGVVFYGSVLREMDPEGILDFYVIVEHLKDWRAGPVAREANRLLPPNVEY
                     HEILVDDRLIRAKVAILSIDQFRRMTGPASLDTTVWARFCQPVRLVWIRGSEAADAIL
                     SCIVRAVGQAGRWAAALGPESGTADEYWRALFAHTYGAELRVENGRRPRTLLAGREER
                     YRALLPDIWIADGLPFERSADMLTPRLTPGLRSRMREGWWLRGRVGRVLNISRLAKGA
                     FTFEGGARYIAWKIQRHSGIILPLGPFSERHPLICLPYLLWKLRQAGFFRRRG"
     CDS             complement(57329..58531)
                     /codon_start=1
                     /locus_tag="GLX_00540"
                     /product="serine palmitoyltransferase"
                     /protein_id="BAK82466.1"
                     /transl_table=11
                     /translation="MSIFSKYEGLASALKSVTAGGGRNPFNVVIEKPISSTVGLIEGR
                     ETLLFGTNNYLGLSQSPAAIEAAVAAAKAYGVGTTGSRIANGTQGLHRQLEERLSAFF
                     RRKHCMVFSTGYQANLGTISALAGKDDYLLLDADSHASIYDGSRLGHAQVIRFRHNDA
                     DDLHKRLRRLDGTPGAKLVVVEGIYSMMGDVVPMAEFAAVKRETGAWLLADEAHSVGV
                     MGKHGRGVAEADGVEDDVDFVVGTFSKSLGTVGGYCVSNHDGLDLIRLCSRPYMFTAS
                     LPPEVIAATMAALDELENRPELRVRLMDNARRLHAGLQAAGLRTGPQASPVVSVILDE
                     IPVAVAFWNRLLDLGVYVNLSLPPATPDQHPLLRTSVMATHTPEQIDRAVEIFATVAT
                     EMGLSRVA"
     CDS             complement(58538..58861)
                     /codon_start=1
                     /locus_tag="GLX_00550"
                     /product="acyl carrier protein"
                     /protein_id="BAK82467.1"
                     /transl_table=11
                     /translation="MDRGLVIHAVPLPAAGRTCHKDVGMSETVASVSALIVKTLLANP
                     KVPRDINGSSKIVEDLAFDSLAVMNFVMEIEDTLDVSVPLDRLADIRTIDDLAVCIVS
                     LKQAS"
     CDS             complement(58974..60770)
                     /codon_start=1
                     /locus_tag="GLX_00560"
                     /product="acyl-CoA synthetase"
                     /protein_id="BAK82468.1"
                     /transl_table=11
                     /translation="MNTAPSPFQALSVEVTLLEMISLPTPSDSGLPRRYGNFPTFPAA
                     LDYAAQGKSGFNIYSGKGVLLEALPYSTLREQAIETGQRLLSLGLEPGDRVAIVAESD
                     GDFARIFFGCQYAGLVPAPLPLPVAFGGREGYVATLRGMIEGAAASAVVIAEIIAGWT
                     DEITAGLDLKFSGTPARLLETPITIETLPVVQPEDLSYLQFSSGSTRFPMGIAVTQRS
                     GMANAHAIALNGLKVRETGDRCVSWLPLYHDMGLVGFFLTPLTCQLSVDMLPTREFAR
                     RPHVWLDLISRNRGTISYSPSFGYELCARRATSIELDLSSWRVAGIGGDMIRYHILED
                     FAQRFASAGFDSGAFTASYGMAEATLAISFAPLGSGIRTDTIDLRALETRGEAVPSND
                     PARALRTFVICGEVLPQHELEVRDSEGNVLTDRKIGTVFVRGPSLMQGYFRRPHETAR
                     VMDADGWLNTGDLGYMLDGQVVVTGRAKDLIIINGRNIWPQDLEWSAETEISTLRSRD
                     VAVFSVDEDEGEKIVALVQCRASSPEARETLKTDTANLFRRQHGVDVSIILVPPHTLP
                     QTSSGKLTRARAKAMLLSGAFQPLEASSVSVV"
     CDS             complement(60767..61900)
                     /codon_start=1
                     /locus_tag="GLX_00570"
                     /product="hypothetical protein"
                     /protein_id="BAK82469.1"
                     /transl_table=11
                     /translation="MSHILFPYLAQPHQEFHSLPIALEMAKLDPGTTIHIASLTAERD
                     SRIRSLSKLYPDARVVFDILKMPGWLRRHIQRHGPTPLSKIAVLFLNRNYFGKFQAIV
                     VPERTSLLLRNMGVSQPKLIWTRHGAGDRAIGFAHDVGKFDYILMAGHKVESRLIKNG
                     VLRKGHYATGIYAKFDMVRRLHARRASLFDNDRPTILYNPHFSLTLSSWSRFGMDIMA
                     YFARQTKYNLIFAPHYRLFDTNRAKGMKMLAPFTNLPHMIIDLGSNRSVDMTYTMGSD
                     LYLGDVSSQVSEFLINPRPCLFLNAHRTRWQGDPNYQSWTLGNVLENLDNLDHALDRA
                     FLSHANFLDRQKVYIYETFGFAAPQDTAAKGANSIIDFLRVIG"
     rRNA            62596..64088
                     /locus_tag="GLX_r0010"
                     /product="16S rRNA"
     tRNA            64262..64338
                     /locus_tag="GLX_t0010"
                     /product="tRNA-Ile"
     tRNA            64405..64480
                     /locus_tag="GLX_t0020"
                     /product="tRNA-Ala"
     rRNA            64859..67598
                     /locus_tag="GLX_r0020"
                     /product="23S rRNA"
     rRNA            67704..67823
                     /locus_tag="GLX_r0030"
                     /product="5S rRNA"
     tRNA            67842..67918
                     /locus_tag="GLX_t0030"
                     /product="tRNA-Met"
     CDS             68118..69197
                     /codon_start=1
                     /locus_tag="GLX_00580"
                     /product="transposase"
                     /protein_id="BAK82470.1"
                     /transl_table=11
                     /translation="MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEVFRPDLDRALA
                     YADGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLALSDRVPD
                     AKTVWLFRERLTEAGAIQKLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEK
                     VDLREGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPSTDLAIPFFGYKSH
                     ISIDRKFRLIRKWKATDAAASDGARLREGLLDKTNTASSVWADTAYRSKANEDFMDKE
                     GFVSKVHRKKPHLKPMPRHIQRSNAGKSVIRSRVEHVFADQKSQTGLFVRTVGITRAT
                     MRIGLANIVYNMRRFLFLERLNAAA"
     CDS             69476..71275
                     /codon_start=1
                     /locus_tag="GLX_00590"
                     /product="hypothetical protein"
                     /protein_id="BAK82471.1"
                     /transl_table=11
                     /translation="MPSENASIELRSINRLLVDEGGIPARYWIPAYQRGYRWDRLQVI
                     QLLDDIWEFIQDSEEKPRTSFYCLQPLVVRKLEDGRYEVVDGQQRLTTIFILLSHRSE
                     ILALLGKQCFSIDYETRDRAFLEEIDLDRSDENVDFYHIYQAWRAIEEWLAGRDRMHA
                     LKLLQHLLNDDEAGRNVKVIWYELAPNDDPIAAFTRLNIGKIPLTEAELVRALFLRRA
                     AQDDDTGNISLRIAYEWDQIEKRLQDNSVWYFLQNTDLDVTNRIGLIFQIAARMEGHA
                     LNREDYAVFSHFSDLLSAERSAEIEWRKVKDIFMALEEWYEDRYLFHVLGFVFNQTAG
                     RLPTITELLTDSQALSKHDFSKGLRNRVCRMVLGNDLSAASPDELEEEITNLCRTVDY
                     ANAPKVRSLLLLFNLATLLEDPRSNIRFQFDSFKQESWDIEHIRSVSDERPSRPREQD
                     EWLDHCLKFLRTTEEEDKQALAESIEGYLDPDSEQRSQESFEKIDGEILSFFKEATDG
                     PDHGLANLTLLDSRTNRGYRNAVFAVKRSILLKNDRSGIFVPLCTRNVFLKCYSRTVG
                     NVMFWTEQDGQDYLDAISRTLTQFFLGQTGASR"
     CDS             71272..73632
                     /codon_start=1
                     /locus_tag="GLX_00600"
                     /product="hypothetical protein"
                     /protein_id="BAK82472.1"
                     /transl_table=11
                     /translation="MTSRTTFSELIERHGRVEIPVIQRDYAQGRVDQHIVRDDFLKSL
                     YSALCLPKEDSTLPLDLDFVYGSVVNGSFQPLDGQQRLTTLFLLHWYLAWVDGCSEDF
                     RSRIVTSGRSRFSYEVRPSSRDFIDAFANYVPDIAAKKCQDIEGMITDQPWYFRSWRF
                     DPTIRAALSMLDRMHEVFQKTSGLYARLIDETTPAITFQLLDLEQFDLSDDLYIKMNA
                     RGKPLTPFETFKARFERHLENQFKDAMPDICNGTPIADFFSRRIDTRWSDFFWPFRDK
                     KTSTFDDAMMNLLRTVIMVTRDPEAAATSADLADLRSTARASSYTWFHDRGWLDQEMI
                     LALITLLDRWSAGSETFRCYLPDTRHLDEQAFFQDLLTKPTSFTFQQLAQLAGYTQFL
                     VHSTGEIDSTAFDAWMRVVSNLAINTDYNRPEDLRRSFAGLRDLTPWMNDILNHLASS
                     EGDVRGFSREQVAEERIKARLIGFGDGWPERLDRAERHSYFRGQIGFLLRCCGLKLDE
                     VDSELERLTTATANELVEPFDHYLACASQMFDDLVKHPTGSGRLWERALLAVGDFLPN
                     VGRNRSLLTTSYDEAWGWKRLLRNAATGGRPSHILQSLWDRLEGLGSYAADLAGIIET
                     ASEIDPWREAILATPSVYCYGAYRMMRFTDEGGIYLLKKTQMNGRHMELFTYCLHESL
                     VSELEPYGFSVSYYEATSTDDEPGLCCTSDYRGTEITFYLTLYQAPGQYQFYLYEPKE
                     PNGILREVLNELAFERDDENFWMLLGGLDDLRSQILKLAQLLKERN"
     CDS             complement(74000..74281)
                     /codon_start=1
                     /locus_tag="GLX_00610"
                     /note="fragment"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82473.1"
                     /transl_table=11
                     /translation="MGYHRIVSVVVPGFPDAPEIVRHSDLVTHVPRSCLANLSSDAVE
                     ISRLRLFQLPVNTPEIAISAMWHPKLDADPAHRWLRDIVHAVYREVFSC"
     CDS             complement(74465..75544)
                     /codon_start=1
                     /locus_tag="GLX_00620"
                     /product="transposase"
                     /protein_id="BAK82474.1"
                     /transl_table=11
                     /translation="MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEVFRPDLDRALA
                     YADGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLALSDRVPD
                     AKTVWLFRERLTEAGAIQKLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEK
                     VDLREGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPSTDLAIPFFGYKSH
                     ISIDRKFRLIRKWKATDAAASDGARLREGLLDKTNTASSVWADTAYRSKANEDFMDKE
                     GFVSKVHRKKPHLKPMPRHIQRSNAGKSVIRSRVEHVFADQKSQTGLFVRTVGITRAT
                     MRIGLANIVYNMRRFLFLERLNAAA"
     CDS             complement(75667..76560)
                     /codon_start=1
                     /locus_tag="GLX_00630"
                     /product="transposase OrfB"
                     /protein_id="BAK82475.1"
                     /transl_table=11
                     /translation="MSATVSPSSDRPYGLAAVCRIWNISRATLYRHRTPASARPEPRR
                     RSPIGPMPDAELVERIRATLSASPFHGEGHRKIWARLRVAGVRTSRRRTLRLMRENDL
                     LAPSWTGAPKGPRNHDGTIIPDTIDVMWGTDMTTIWTQEGQSAVFIAIDHHSGECTGI
                     HAARRGTRFEALEPIRQGVRRCFGVFAEKVAIGLSLRHDHGSQYMSDVFQNEIRFLGI
                     ESSPAFVRAPEGNGCAERFVRTLKENLLWVQTFETVEDLRQALLEFRDLYNKTWLLER
                     HGFMSPNAVRAKALANAAIAA"
     CDS             complement(76557..76919)
                     /codon_start=1
                     /locus_tag="GLX_00640"
                     /product="transposase"
                     /protein_id="BAK82476.1"
                     /transl_table=11
                     /translation="MCKGVTMTNDLKNDTKRPGHGGRMSRRRKKEAVLRLLRGEDLKM
                     VSRELGVTTATLSGWQDAFLSGGEARLATRQTDGETLESDRLKVKLGEVMIERELLRE
                     KIAALEGGRPLARRRSRP"
     CDS             complement(78156..78413)
                     /codon_start=1
                     /locus_tag="GLX_00650"
                     /product="hypothetical protein"
                     /protein_id="BAK82477.1"
                     /transl_table=11
                     /translation="MMIRSASILATVAAIALATPAFAQSHPDYCKSVSKVPSGEWKIN
                     SDTTVTVGGARVDLKPQSVYRGEIKINEQDVHNEFEKSCGK"
     CDS             78659..79180
                     /codon_start=1
                     /locus_tag="GLX_00660"
                     /product="transposase"
                     /protein_id="BAK82478.1"
                     /transl_table=11
                     /translation="MTDRLDGLYDEPRPGTPRSIGDDEIAETIRKTLEERPRDAMHWS
                     LCSMAQAVGYAPSTIHRIWKAFGLQPHRTETFKLSTDPLFVEKVRDIVGLYMAPLERA
                     LVLCVDEKSQIQALDRSQPMLPMRPVQVERRPHDYTRHGTTSLFAALDIATGPIIGKC
                     FSEAPVHGIPQIP"
     CDS             79197..79562
                     /codon_start=1
                     /locus_tag="GLX_00670"
                     /product="transposase"
                     /protein_id="BAK82479.1"
                     /transl_table=11
                     /translation="MPTDLDIHLVMDNYATHKTKLIRDWLAGRPRWHVHFTPTGASWI
                     NQVERFFALVTEKQIRRGIHRSTEALEADIRAFIVAHNEQPRPFKWTRSADDILQAVK
                     RFCLRTTKISKNSESGHYA"
     CDS             complement(79553..81013)
                     /codon_start=1
                     /locus_tag="GLX_00680"
                     /product="peptidase M20"
                     /protein_id="BAK82480.1"
                     /transl_table=11
                     /translation="MTDTWETITVNTSREDLIASAASLFDAGEYERRLRDLVAIQSTS
                     QDDAHSDDVQCYLTDAMVPWLERMGFTCTIYPNPQAGFGPILMARRIEDPALPSIITY
                     GHGDTVRGMDEQWSEGLHPWELTRVGNRLYGRGSADNKGQHLCNLLALEHVLAAQDGR
                     LGYNVKLVLEMSEERGSAGLDIFIRTHASELAADVFIASDGPRVAPDTPTVASGTRGN
                     FQFDLSVEARKGGVHSGHWGGITTDPALLVAQALCTICDNRGRICIPEWLPANGAPLT
                     PAMRTMLRDCPTDNTGDAAQAEDDWGEPGLSTAERRYAWTSFIVRAMISGSPASPQNA
                     VAPTASAACEIRYPPGLDVTTFLPALRRHLDAHGLQAVRIDNGIDRMPASATQSGSPW
                     PTWVAASIARSTGARVQVLPSISGGMPGYAFADHLDVPLIWVPHGHNACKQHGPDEHI
                     LTTVARQGLLAFVGLWHDLKHVDFHWELTQPDTIQA"
     CDS             complement(81032..81409)
                     /codon_start=1
                     /locus_tag="GLX_00690"
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="BAK82481.1"
                     /transl_table=11
                     /translation="MTDKLLETGRQIRGEVIGEALSERALQAATDFDRPFQELALRYC
                     WGEIWGSEGLSRPTRSIINIAMLAAMGKPNELRIHVRGALHNGVTRKEIQEVLLQVCI
                     YAGVPAAGEAFRVAREVFEEEKK"
     CDS             complement(81483..82973)
                     /codon_start=1
                     /locus_tag="GLX_00700"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAK82482.1"
                     /transl_table=11
                     /translation="MDIPRFLEQVLPAPCLAGRTLWINGQWEAASSGLQFESENPATT
                     KVVFSLAKGDVQDTHRAVSAAKAAARNWAMTEGRARTGMLLRVASLIRTHGTTLGLLD
                     TIDSGRPISQTTGAAIESVASLFEYYAGLTDKIHGAAIPMGADRSGVVEREPLGVVGA
                     ISPWNYPLLNAATKIAPIVACGNTVVLKPAEQTSLSAMFLATLLHNAGVPNGVVNIVT
                     GLGTQAGAALVEHPDVRLVSFTGSTTTGRHIASQAGRGLKPVVLELGGKSPLIVFADA
                     DIKQAAEAAVFSTFMNMGQTCTACNRVIVASSVKRQFVEHCQQAARRLRIGNPQDPAT
                     QIGPIVSRAQFQRVTDLTQDVDSIALDIPGYLPPEKGYFFRPMIVEHFDPDSPFARAE
                     IFGPVMSIHEFTDTPQAWQIANDTEYGLAASVWTTSLSIAEQARRHIEAGIVWINCVH
                     ALNPNLPVCGHKNSGIGMEYGLEAISQYTRVKSTVTMFGGWTSPFA"
     CDS             complement(83031..84359)
                     /codon_start=1
                     /locus_tag="GLX_00710"
                     /product="hypothetical protein"
                     /protein_id="BAK82483.1"
                     /transl_table=11
                     /translation="MTTDQTVQNGPVNLLKAWRLHLWVFILTCVAEMIGSVSVPLGFA
                     TITIFPLVWGMLFGAAVGLVSTRVATPVSLRRPDVQAATIVIQAAVIMFVAKQSLLVG
                     PLIPKLLSSGWALCFQEIGHFFGTVLLALPLALLLGIKREAIGSTFSVGREQNLAIIG
                     ERYGLNSPEGRGVMAEYITGTVLGALCVSIVASCIASSRLFNPLALAMASGVGSGSMM
                     AAAAGAVAAYAPARDTTEILGFAAASNLITTTVGTYFTLLVSLPFTVFLYRVLEPRIG
                     RFRQGAARVTPTTAGTIVQEDGPLPFSSLVLITATVSIMTLLLGNWITYDVAPWAAMT
                     GALCIILTGLAGEGLHRLVPLRIPSVLWVTMLGMALTAPYWPGARWFAACTQHVNFLA
                     IVTPLLTYAGISLTRDIPAFRQLGWRIVVVSLSANAGTFIFAALIAQFFI"
     CDS             complement(84426..85316)
                     /codon_start=1
                     /locus_tag="GLX_00720"
                     /product="hypothetical protein"
                     /protein_id="BAK82484.1"
                     /transl_table=11
                     /translation="MTAALHIDHPLVVVNDIETTAASFRALGFNTAPTGYHPWGTSTS
                     LVMFPRSAIEIMSIHDTSLLDSHAIGSFAFGRHMAQALSEREGITLAALYSEDAAADR
                     RRLEANGLPCQGRVDFRRRVRIPGHDWDEAVVSLEIFYDPALPRASNFLCQQHRPELI
                     WVPQWMQHPNGATGFASHTYAAVDPDRLADRFRRIFGNATTHRTDTGYRIETGRGHIH
                     IRPPGQWSREIGLPDEPMIAPADAACIAMEVIVPDLLLLRDLLDRNGVTYVEEADGIS
                     ITGFAPYGNTIIRFVRSPGQ"
     CDS             complement(85330..86067)
                     /codon_start=1
                     /locus_tag="GLX_00730"
                     /product="serine O-acetyltransferase"
                     /protein_id="BAK82485.1"
                     /transl_table=11
                     /translation="MTTAWDTLCNTLGRAEPALCGAGGAIITLPAGLAARLAAFTQPV
                     WLNAQTWQSVLHDLFSRNSNLAELVMEDLTAIAGRNLEEGGLVATWIGGRGFHALFAH
                     RAIHALWQENRQELAQALKASLYTTGCDIHPAARFGRRIFLDHAVGTVIGETATIGDD
                     VSLWHGVTLGSTLMEEGDRHPKIGPGAVIGAGAIILGNITIGRGAIVAAGSVVLHAVP
                     PWRLVAGNPAALKTGYVHPFGMKPEQD"
     CDS             complement(86073..86954)
                     /codon_start=1
                     /locus_tag="GLX_00740"
                     /product="3-hydroxyisobutyrate dehydrogenase"
                     /protein_id="BAK82486.1"
                     /transl_table=11
                     /translation="MAQSPKIAVVGLGNMGLPMAALLAHRQFDITGFDVSSERVALAV
                     QENVPCTHDLTGLLQDADIIIASLPNDSVVEKVFLQPDGLLARTDRRAIVIDTSTVSP
                     GTTRHIATLMRRAGHGWLDAPVSGGATGARDGKLTMMVGGTDADLADVRTVTDVLAAR
                     VLHVGSSGAGNVAKLVNNMLVAAHMLTAAEALRLGQAAGVQAGDLLKVINASTGRSAV
                     SENTFPRWVLNDSFDSGFSAGLMRKDVALALSLARDVHASLPLSTEVERLWNACRKTC
                     PDSADFTRVGSSETQPA"
     CDS             complement(87098..88111)
                     /codon_start=1
                     /locus_tag="GLX_00750"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82487.1"
                     /transl_table=11
                     /translation="MPRHGSRIHAMPCPQPETTRPRPKEWTQTMVTTWDIDTRLLRYF
                     LTVVTEGSIRGAADKLNIAASAISRQIGEFEVRCGTPLLERKPRGVVPTQAGAALADY
                     ARMQIEDGERFLNYLRRLRGLQDGAIRIACGEGFNGDLIENALVPFVQAHKESTFHLI
                     QAGTMEIVDAVLEGRVDIGLAYDPPRMVGIQSVVSARQSLHAIMQPSHPLAQVSQVHL
                     KDLVDIPLALPTDSYGIRALLRRVEASSGVLLVPSIQCATLDMLRRLALSGVAVTFLP
                     PFTVFHELTTGELAAVPLAEPFAGEASAHLIIRSQRRLSMPMEHLLDIISSRVRAFQP
                     DPS"
     CDS             complement(88125..89537)
                     /codon_start=1
                     /locus_tag="GLX_00760"
                     /product="aminobenzoyl-glutamate utilization protein"
                     /protein_id="BAK82488.1"
                     /transl_table=11
                     /translation="MKNADQIWSNVDALGKDFSSFADRIWETPELAYDEYRSVDTQQD
                     MLERSGFRITRNLAGIPTSVMGEAGEDGPVIAFLGEFDALPGLSQQAGVATCSPLPGN
                     GNGHACGHNLLGGAAMLAATALKNWMAENGIAGRVRYYGCPAEEGGAAKTYMVRDGVF
                     SDVDFAVSWHPGSMAGVFYPASLANMRIDFTFHGRSSHAAAAPHLGRSALDAAELLNI
                     GTNYLREHMPSTARVHYAYLDAGGEAPNVVQSKVTIRYLVRADNLAELRSLAERVRKI
                     AHGAAMMTETRVEESVVSAVSNLLGNAPLEDAMYASLVRLGPPQYDKEDYDFAREIQK
                     TLTPADIRSAYLAVGLPPRDDTPLCDQISPMGFVPPPFGSTDVGDVSWAVPTVQAWGA
                     TSAIGTQLHSWQMTAQGKSGIAHKGMIHVAKAMAATARDVLMDPALLERIKAFHADHL
                     AREPYVCPLPDNVTPPIQDR"
     CDS             complement(89576..90784)
                     /codon_start=1
                     /locus_tag="GLX_00770"
                     /product="acetylornithine deacetylase"
                     /protein_id="BAK82489.1"
                     /transl_table=11
                     /translation="MVSPLVYYCKITRCALAAMARDSRRQVTDMIEEHTLLNEIRSWV
                     EIESPTDCTAAVNHMMDRAQATARTGGLQSRRYPGTHGYGDHVLVHAPGDDLTRPGIL
                     VLSHLDTVHPPGTITHKLPFRVAGDLAYGPGIYDMKSGAVMALAALCSLVRRGQSMPL
                     PVRQLFVSDEEIGSISSRPLIEELARGARYALVTEPARPGGEIVTGRKGTARFTMQVT
                     GRPAHAGTHHAQGQSAIKELARQILDLEAMTDYAQDITINVGLIQGGTGANVVPETAV
                     AEIDMRMPDSATGLPTVNRILAAAPHNPETQVTITGGINRPGYSKDAAITALFSHAAQ
                     LAGRYGIELRDVSSGGGSDGNFTAAMGVPTLDGLGPIGAGAHTLHEHIRIPSLIPRTL
                     LFRDLLATLA"
     CDS             complement(90805..91284)
                     /codon_start=1
                     /locus_tag="GLX_00780"
                     /product="transcriptional regulator AsnC family"
                     /protein_id="BAK82490.1"
                     /transl_table=11
                     /translation="MKETTEERSLDKADRKILRFLQKDGRMANADLAVKANISAATCH
                     RRIQMLLKAGFIRSVRALLDPAMLDLGSLVLVGVVLDRSTPESFAAFEQAIRTIPAVL
                     DCHLVAGDFDYFLKIRVKDMTDFNRLHGSKLLALPGVRQTRTFFVMKEVVDNAPLDI"
     CDS             complement(91349..92644)
                     /codon_start=1
                     /locus_tag="GLX_00790"
                     /product="major facilitator superfamily
                     alpha-ketoglutarate/sugar transporter"
                     /protein_id="BAK82491.1"
                     /transl_table=11
                     /translation="MGEHILHNRSRKTHNIVAATIGNTLEFYDFTVYAAFSTFLSQAY
                     FPTGNPHLMLLLSTVIFGIGFLSRPIGAMVMGAYADRYGRKQAMTLTIWLMALGSLMI
                     GVLPGYATLGLAAPLLLTLARLIQGFSAGGEMGSTTAFLVESSARDRVGLAASWQIAT
                     QNIGSIISGLGGIGLGACLSNTQLAGWGWRLPFLFGAIIAPVGFWIRRNVDETLHVGQ
                     TLHSMGTVISHLLTQMPGRIALCIMLVAGNTVAQYFFLYGTIFSIHDLHFPAAFSISI
                     NIALGVVGFPGALLGGYLADRYGPFRIVLVTRFLLCVLLVPAFMLLLAHPTPAVFTIV
                     IMFLMSFHAVSTGACICLLPAMFPMKVRTLGTGLSYALGVTIFGGTAQPIFTMMIANT
                     GNNLSWIYYVVGMLCISSLSLIFLWRMPGTRTTVACADR"
     CDS             92980..94140
                     /codon_start=1
                     /locus_tag="GLX_00800"
                     /product="peptidase M20D, amidohydrolase"
                     /protein_id="BAK82492.1"
                     /transl_table=11
                     /translation="MAVLEKIETYRKQLIAIRQDFHEHPELGMEEYRTSDTVADLLQE
                     WGITVHRNIGGTGIVGVLKNGTSTRSIGLRADMDALPMEELGNLAYRSVNAGRMHACG
                     HDGHTTMLLGAARYLAETRRFDGTVNFIFQPAEEGRGGAAAMLRDGLFEDFPCQSIFG
                     MHNWPGLAVGRCAINAGALWAGGGFFEITVKGRGAHGARPERAIDPMLCACHVVTALQ
                     SIVSRNVPPYKEAVISVTRIEGGHASNVIPDSVTIGGTLRCLDPALLQDMRARMHGVA
                     TGVASAFGATAEVEFPVEFLPVINDPTCTELMVAAAGDICGTENINPAMEPVMTSEDF
                     SYMLERVPGAYLCLGNGDTQMLHHPEYNFNDEALVFGASILSRLAERALPVG"
     CDS             complement(94171..95514)
                     /codon_start=1
                     /locus_tag="GLX_00810"
                     /product="gluconate permease"
                     /protein_id="BAK82493.1"
                     /transl_table=11
                     /translation="MTEMSLTYALITGIVAIGLIIVLIARFNINSLLVLFGVAIALLL
                     AAGDTPAQAVASFQHGAGNALGSIGFLLAFGTMFGKLIAQSGAADTVALSVMARCGAR
                     NLHWAMAGIGMIVGLPIFFDVGFILLAPLAFIAAQESRKPVLFAILPLMASLSIAHAV
                     MPPHPAIMQAIGIYHANLLENIALGLLIMVPTAIISGPLFTQFIMRHIGPIDTSPMEA
                     EFLSRTALSIRPSLGRSLLCILLPFLLIGCGQMLTNLSTQGWLHMLGQFLGETNVSLI
                     ISLMVTVLLLCLPNGMTTRQVAHALHTCLAPTGFVILLVGAGGGFGQAVIDSGISRTL
                     TTAALSAHVPPLLLAYLSAVIVRLATGSATVATGTAANLLAPAMAEMHGVSPELLVLA
                     TGAGSIAFGPVNDPVFWQLKEYLGLSLSQTFIVWSGTETLISVIILLFTLGLSIL"
     CDS             complement(95556..97037)
                     /codon_start=1
                     /locus_tag="GLX_00820"
                     /product="hypothetical protein"
                     /protein_id="BAK82494.1"
                     /transl_table=11
                     /translation="MRVFVASLATETNTFSPIPTDLNAFKSAFYAPPGQHPPTPTLCS
                     AVVPALRARQQADGFELVEGTCTWAEPGGLVKRQTYEGLRNEILGQLKAAMPVDAVVM
                     GLHGAMVAQGYDDCEGDLLSHIRACVGPDVVIGATFDPHSHLTPLRVSCLNIMNAFLE
                     FPHTDFMVRAEQVIDLVLRAVRHQIRPIISTFDCRMIDVLPTSQQPLRGFVDRIRAMQ
                     GHDGVLSVSLIHGFLAGNVADLGTQIVVVTDNDARKGQHLAHELGMEVFGFRGSTRMH
                     TLQPAQAIARAQTAIADPAITAPIVLADIWDNPGGGVAGDGTLLVADLLRAGIDNMAI
                     ATIWDPVAVSFCEAAGKGARLHLRFGGKSGPGGGDPIDADIEVLEVVDQAWQSFGESQ
                     VPLGASAVIRIAGTRNDIILNTNRTQCFEPDIFSNLGIDPLGKDVLVVKSTNHFYAGF
                     IGIASEILYVDAGTHYPSDPLRTHYTKLSRKIWPIVENPHDLK"
     CDS             complement(97091..97459)
                     /codon_start=1
                     /locus_tag="GLX_00830"
                     /product="translation initiation inhibitor"
                     /protein_id="BAK82495.1"
                     /transl_table=11
                     /translation="MMKKVFGKAAVPLSMAVRAGDYVYISGQVPVVDGKVVEGGIEAQ
                     TAAVLDHVTAVLETAGCTMSDVVKTFAILTSASDFKAFNKVYATYFPVEPPARTTVEA
                     GLMAADIMVEIEAIAYRPIG"
     CDS             complement(97497..98564)
                     /codon_start=1
                     /locus_tag="GLX_00840"
                     /product="metal-activated pyridoxal enzyme"
                     /protein_id="BAK82496.1"
                     /transl_table=11
                     /translation="MSISIDKLDTPAVLVDIDKAFSNINKAQHYANTHGFSLRPHIKT
                     HKLPYFAHQQVKAGAVGITCQKLTEAEIMAQAGLSDILLTYNIIGAHKLGRMVNLARQ
                     VTLSVVADNIPVVEGYDRVTAGTDIAPLRVFVECDTGGGRCGVQTVDEALTITRRIMS
                     APNLQFAGLMTYPAAGKQAQSDQWLGQAKAVFEAAGLPIPAITVGGTPDLWTAGDMQN
                     MSEYRPGTYIYMDRSQVAVGAATLDECALTVLATVISRPTETRAIIDAGTKTLTSDLL
                     GQDGYGHIIDHEESRITALSEEHGTISAGADATLPGIGEKVRIIPNHACVVTNMFDHV
                     YLVSNGKVVDRLPVAARGGVS"
     CDS             complement(98744..99730)
                     /codon_start=1
                     /locus_tag="GLX_00850"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82497.1"
                     /transl_table=11
                     /translation="MKAMLDVWSRGSNISATSWDLDGRILQYFFTVIAEGSIRGAAER
                     LNVAASAVNRQIGDLEYRCDLKLFERKPRGVIPTTAGRALADFVRIQHEYSERLLNYF
                     CILHRQHERSCASAARKVWPRISSTISCRFSSRRFPAPACRYRAGQQPKSPVCCWKAV
                     PMIGLTYDLVPCQGIRSVLCASQPISIIVHAGHEWLEHIRIRPRHLAARPLVLLSKNH
                     ALRRRLPQMETNASVCFQPTLEAADINTLRSFVMSGQSISLLPHSAVRRQAEAGVLRT
                     IPLDNMPLCVTTHVVDRVQRRMDPMLKSLLGMLADHHPALQPPVDSVTRLSA"
     CDS             complement(99943..100953)
                     /codon_start=1
                     /locus_tag="GLX_00860"
                     /product="1-aminocyclopropane-1-carboxylate deaminase"
                     /protein_id="BAK82498.1"
                     /transl_table=11
                     /translation="MLSKFKRYPLTFGPTHIEKLSRMSEYLGGDVEIYAKREDCNSGL
                     AAGGNKLRKLEYIVPDAIDSGADTLVSIGGVQSNHTRLVAAVAAKIGMKCHVIQESWV
                     PHEDAVYDRVGNILMTRIMGAEAQLVDEGFDIGIRDSWLRALEDVKSKGGKPYAIPAG
                     ASVHKYGGLGYVGFAEEVRAQEAELGFKFDFIVVCTVTGSTHAGMVVGFAEDGRARNV
                     IGIDASFTPAQTKAQVLDIAQKTSALVGGKEIAGDDIVLIEDYAYPAYGVPSKETVEA
                     IRLSARLEAMITDPVYEGKSMQGLMDLVKKGFFPKGSKILYAHLGGAPALNGYSYTFR
                     NG"
     CDS             complement(101065..101424)
                     /codon_start=1
                     /locus_tag="GLX_00870"
                     /note="fragment"
                     /product="transcriptional regulator AsnC family"
                     /protein_id="BAK82499.1"
                     /transl_table=11
                     /translation="MSVYSYISFQRQDQAWLKEFETQISQRSEIMECYLMTGESDYML
                     RIVVHDIREFRDFMIGFLTALPNVSNLRSRFALSQIKYTTALSHCPDLAIRTLRRTKK
                     CHAIILHKLCFYELYIL"
     CDS             complement(101470..101628)
                     /codon_start=1
                     /locus_tag="GLX_00880"
                     /note="fragment"
                     /product="transcriptional regulator AsnC family"
                     /protein_id="BAK82500.1"
                     /transl_table=11
                     /translation="MTDNRFDLDGTSRQILRELQKNASLTNQELSERVGISPSPAGGG
                     YRNCAVRA"
     CDS             101764..102777
                     /codon_start=1
                     /locus_tag="GLX_00890"
                     /product="drug/metabolite transporter"
                     /protein_id="BAK82501.1"
                     /transl_table=11
                     /translation="MQGSSTNKNPVSFPFCPDGGGAWCHGAAMGAELARHENMRNACA
                     TAMAGGSVFCAGWCHAAHRPAVSEGITLPKRSDLPIVFSVGGLQMMAFTALGLVAMQH
                     TNAGRAALLAYNHAAVGHAAGMAVHGAFMEQRPGHRQVMALCVGLSGIVLICSPIGMD
                     WSRPGALQANCILLAASMCWSVVIVRHHKWTSSPLALAPWQMLLATIVLSVRAWVKEG
                     PPSHIVWSGELAGLLLFIGPLATSVCFVISCEFRCRVSTFSMSSITLAVPVIGLFASM
                     VFLHEVMTPVLGIGLALIIAGGVLSARTPARDGRRVLHRHGPPGCVDSRHVWPGTVGK
                     SRA"
     CDS             complement(102845..104305)
                     /codon_start=1
                     /locus_tag="GLX_00900"
                     /product="hypothetical protein"
                     /protein_id="BAK82502.1"
                     /transl_table=11
                     /translation="MKYFIATLGTETNTFSPIPTGRTAFMGARDWFRTDGSLQATTAA
                     TLPLRTWRARAQADGHEVVESICAFAQPAGLTLRAVYEELREMILDDLRRAMPVDVVL
                     LSMHGAMIAVDYDDCEGDLLAHIRAITGPRTVIGAELDLHCHLTETMRENASLIITYK
                     EYPHDDIVERAQELYDLATRTIRGEIHPVIAYYDCRMLAIWRTPYEPVRSFVDRMQTY
                     EGHDGILSVSFAHGFPWADIPDVGAKMMVIADGDEAAAAALARRLGREIWDMRDSTVA
                     SYVSLPDAIGMIRDNDSSKLIVIADVSDNAGGGAPSDNTIILRALLDAGVDNVAVGCI
                     WDPAAVALCIEAGEGATFDLRLGGKCGVTSGNPIDMCVTVRRCIRPLLQTGLSNGQAT
                     LGDSVWLHTAGIDIVVTSNRQQTFAPDAFTNCGISLDKAALVVKSAQHFYNAFAAIAE
                     RIIFVAVPGCVMPDMNGLSLPRRTIPMWPHVEDPFA"
     CDS             complement(104321..105307)
                     /codon_start=1
                     /locus_tag="GLX_00910"
                     /product="cobalamin biosynthesis protein"
                     /protein_id="BAK82503.1"
                     /transl_table=11
                     /translation="MTAVSPPPGTRTGAVPVIVIGGFLGAGKTTFINRIINSFPTRKL
                     SAVVNDFGAIDIDADLINLGREQVIPLRNGCICCSLQGDMLSTIRYLLAQPVRPDGII
                     IECSGVSQIGDVKTALLDAVFWKEAALDSVICVADGQDILEDPAYFAQSLRAEQFRDG
                     DFIILSKMEQMPPEQRQTVRERVLAHGKRAEFVLDNTAVAQMENLLFSFSFDHTAPLR
                     KTTGLRASDAAPGQPFASLAWESDRPIAFDIFQQVIGAHASTLLRAKGILYASHAPHT
                     PAVFQMVGNRVTMGAGHDPEMGAHRSRIVFIGYEGQINLKTLRADMDRCVAE"
     CDS             complement(105304..106794)
                     /codon_start=1
                     /locus_tag="GLX_00920"
                     /product="D-glutamate deacylase"
                     /protein_id="BAK82504.1"
                     /transl_table=11
                     /translation="MYDIVLRNGRLIDPETRLDVIGDVAINNSAIVQVGKVDGTGQRE
                     IDATGLVIAPGFIDIHAHGQSLAADRMQAFDGVTTTLEFEIGSLPVGLWYEQQAQTTR
                     LLNYGISVSWVAARIAVMTEQDINHPPLTLMGRSIGDRRWVDDVATDAQVGAITAMME
                     QGLREGGIGIGIPNAYLPGAGVKEVSQICSLAARYDVPTYTHISFSSNIDPRSSVEAY
                     TRLIGYAGSTGAHMHICHFNSTSLMDIERCAELVRNAQAQGLRITVEAYPYGTASTVI
                     GAPFFADPAFPQRTGQGYDALQRLDNGQHMTSREDVLRASAEKADNLVLWHFLDVESN
                     QRHRDLLDMSVLYPGGIIASDAMPWTMPDGSTYMGDAWPLPDEAVAHPRSSGTFTRFL
                     RVYMNERKAVSLMDAMAKCSWLPATIIEYAAPTMRRKGRLQVGCDADICVFDADTISD
                     RAEFTAMNRPAVGVKYLLVNGQPVIEAGELVTSASAGQPVRGRYRA"
     CDS             complement(106861..108183)
                     /codon_start=1
                     /locus_tag="GLX_00930"
                     /product="enzyme of poly-gamma-glutamate biosynthesis
                     (capsule formation)-like"
                     /protein_id="BAK82505.1"
                     /transl_table=11
                     /translation="MRIALTGDSILLRRLNSLEDETLLPLFDLIRGADVAFTNLEVLP
                     NDFRGDPALESGGSHFGAPSWVIDELCDAGFDLFATATNHSLDYSISGLRAAMEAMQA
                     RELLYAGVGDCLEAARRPTYCTRPQGTVAMTSCTSSFATGQEAASQTDGMQGRPGPSA
                     LHFDTMHTITPGHFTTLRDIAVSLGLETLRERTIQLGFAFPPTDPSVLPIGGLNFRAG
                     EQARITTRPNARDLADMARWVEEARMTSDRVIVSIHAHEVGYNPAGQLDPEIPAEFLR
                     TFAHAMIDAGADIVAGHGPHLLRGLEIYRDRPIFYSLGNFIGQNELVPRLPHDSYLRF
                     RADPDLTPAKVYQQRTQNDTKGFPAETRFWETVMPICEFDENGLKSIRIYPVSLGLGM
                     ERHRRGVPFLATGAHAHSIEDRFTQLSGAMGTTLARDAEGILSYVRPS"
     CDS             complement(108278..110659)
                     /codon_start=1
                     /locus_tag="GLX_00940"
                     /product="TonB-dependent receptor"
                     /protein_id="BAK82506.1"
                     /transl_table=11
                     /translation="MLLATAFGWTGYDLQHSAVAANTQPAHTTAQRPHRDTPQHAASA
                     HTTAAATTLQSRAAPETISVRRNRAFQFSAAQHEPDSTSHISAATLIEQHVQTVNDLQ
                     RLVPNLTIQTEGGSTSASYYLRGIGLEDYTQNNMSSVMTYFDDVAYPISSMSTGQMFD
                     VSAVAVEPGPVGTEHGMADTGGEVRIDSNAPTKEFHYGASEDIASYARSKTNTYVSGS
                     ITHNLQYRIAGQMLEGGGYFHNRNTGQTVGNANMGALRGRLAWQPDSKTNIDLIANWS
                     QDESQSGYGFVLSDPYSSSTYGAQPRDQNIYNTGWSLNPNFAHLVGISPNSVPNNHNV
                     TWSIILKGSRDLGFAKLKSITSFAQQQRHEYNDRDAMDLRSGDTYFVGESNVFSQELR
                     LEGRPMFNDRFKWTIGTYYNRTRTFGANWFDMTGTNPSDPFIRDSYHNQPAETFDQFA
                     NLSYKIIPSVRVNFGLNHETDTRQIVDDTVVQYYGATNTNKMLMNGSPFPTFGAITNQ
                     FSGRVGIDWRINHDVMVYASIKRGVKPGGFTTNTTVSEVQLKPFKPEWVLAYEIGVKS
                     EFFKHRLRINAAMFYDDYHDKQILGQIVMPGQLNMGLNPTPGIYGSYINAPKSTIWGT
                     EVQIQAHPIRGLSLTQNIGWERGTYDDFQEVNQQAVQAYFAQTQTYKSFTTNYNGADM
                     GIPKLTLNGSVSYQTRPLLHNAYTLTFEGNYSYRGAQGWQPRATGVYVIPAYFLMGAS
                     ITFKPRNGQWYVNAYASNLLNRHYILSETFATVDQVGYAGAPRFVGGRFGCDF"
     CDS             111290..112627
                     /codon_start=1
                     /locus_tag="GLX_00950"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAK82507.1"
                     /transl_table=11
                     /translation="MADPSRSSMNATEQDMLGRIYRKMDMRIVTILLIAYLLDCVDRL
                     NIGFAQKNISEHLGMNSSDYGMAAGIFFIGYVLFEIPSNLMLPRVGARRTFARIMVLW
                     GGTSACMGLLHDKNMFYILRFMLGMFEAGFAPACMFYLGLWYPPSRLATVLSVQQTAS
                     PLAGVMAGPLSGWLISSMDHVGGVDGWRWMFMLEGLPSIIMGVVVFFVLPDRPEDARW
                     LDDRERIVLKRDSTPVPTAVYYASFRAVLRSPVIYVLSLAYFCLICGIYTVNFWLPNI
                     IRNAGVQSELQTGLFSAIPYAVCTVAIIIWARRSDRTGERRLHSTLPAAFGALALFIT
                     AFVGGSLFLSLVIVSIAISLIFSAYIIFWTVPCEMLKGPGAVGGFALVNSIGLMGGFC
                     SPIIIGHLTTWTGSLAAGLVCMGLIVATGSLLLFLSVPRGPARQHKPITAVAA"
     CDS             complement(112624..113097)
                     /codon_start=1
                     /locus_tag="GLX_00960"
                     /note="fragment"
                     /product="transposase"
                     /protein_id="BAK82508.1"
                     /transl_table=11
                     /translation="MTQFVDKANRRTAWEFLEYLLHIVPYQVHTILTDNGILFAEQPR
                     NRGTAWPRSMRFDMICEANGIEHRLTKPNHPWTNGQVARMNRTIKEATVKRFHYDSHE
                     ELRTHLDDFIAAYNFGRRFKTLQGLTPYEYICKIWTSEPERFIINPIHQIPGLNS"
     CDS             113606..114565
                     /codon_start=1
                     /locus_tag="GLX_00970"
                     /product="transposase"
                     /protein_id="BAK82509.1"
                     /transl_table=11
                     /translation="MSAQIFIGIDVSRDWLDSFCLPGKQRFRCQNSPDGHARLFEILQ
                     SMPDDLKVGFEATGGQEWALWRVLIRKGINAVQLPPAQIKAFAFSMGKRAKTDQIDAE
                     LIARFMVFRSEAGRTLPDEKLQLLRALTVRRAQMVDARKRLSAQISARRKQDVSAELE
                     DMDNSLKAFLESQISELEQRIEGVIAQGKELSAKAELLRSIPGIGPVSVAMLLAEMPE
                     LGRMTATEAAAMTGLAPMAHDSGAMRGKRVISGGRRSLRHVLFQAGLAAACHNPVLKA
                     VAKRMKERGKPHKLVIVAIARRLVTIANAVLKTGVPWRISSAA"
     CDS             complement(114600..115487)
                     /codon_start=1
                     /locus_tag="GLX_00980"
                     /note="protein synonym:SIS"
                     /product="sugar isomerase"
                     /protein_id="BAK82510.1"
                     /transl_table=11
                     /translation="MNQKKSSSLNQRIMDALEHLTPGERRLATVIRELHGDISSYAAN
                     ELAERAQVSNATAARFFKRLGYDSYTVARAQARAQVNWAPPSLRQEERLRNGSQSDNT
                     LAAYIKADISNLTYTLEKIPDRAMHRAVSMIVAAPRIWITGFRNSTSLALYARALLVL
                     LKTDVRLIAQNGMSAGDDVATMQPDDLLIVIGFRRQPQLVRNILIEAGNIGMQSILVT
                     DLHSAPLTTLVTVSLLTFSDSPGIFDSYSAGTTVINALCSMVERAMGTETTERLARIE
                     ALYRQVDNLHGESENTNTV"
     CDS             115623..116834
                     /codon_start=1
                     /locus_tag="GLX_00990"
                     /product="diaminopropionate ammonia-lyase"
                     /protein_id="BAK82511.1"
                     /transl_table=11
                     /translation="MTDPYTGMIVDAHHADQRGTGSYPATLARALNSHFTADALAIIS
                     QWPGYTPTPLLALSGMAADAGVGSVLYKHEASRFGLGSFKALGGGYAVFRLLAQRIEE
                     ETGHVPQVADLLAGCYRDITRKVTVTCATDGNHGRSVAWGASLFGCNSVIFVHGTVTR
                     QRAEEIARLGARIVRDPGNYDDAVRAANAAGEANGWLVVSDTSYEGYMTVPLDVMRGY
                     GVLLHETLAQLGNRQPTHVFLQGGVGGFAAAIISGLWEHYGESCPRIIIVEPENAACL
                     LLSARNGRPSVVSGLHDTIMAGLACGEPSLVAWPYVEGAVSNYLAIPDEAVRVAIRQL
                     AQGRGQPPVIAGESGAAGLAGFLVAATDAPVRQTLGLDGQSCVLLIGTEGATDVQMWE
                     SITGRRLEQPT"
     CDS             116831..118063
                     /codon_start=1
                     /locus_tag="GLX_01000"
                     /product="allantoate amidohydrolase"
                     /protein_id="BAK82512.1"
                     /transl_table=11
                     /translation="MTASTLGVNPTRLLERIVSLGACGALPGGGVSRLALTDADAQGR
                     AELLRQMRELDMEIRIDPIGNIFGIYAGVEDAVVMMGSHIDTVSTGGLYDGALGVIAG
                     LEVVACLKDEGIRPRHPVVVAAFTNEEGARYAPDMLGSLVYSGAMDVDDAYRITGCDG
                     SVLGEELRRIGHCGTQSGPRNIHAYVELHIEQGPVLEDQGLNIGIVTGVQGISWTEVT
                     VEGRSAHAGTTPARLRHDAGLAAAYITMGLSDMVAAMGPAQLATVGALTLTPNLVNVV
                     ASRAVMTVDMRNPDNTALCAAEATLAKLMGEAKARYGVNVSHRTLARFEPVPFTPALV
                     DTIEATACQMGLSCMRLYSGAGHDAQMIAPVAPAAMIFVPSVAGISHNIREYTHPDDI
                     MNGANLLLRVVTDQAGLA"
     CDS             118083..118988
                     /codon_start=1
                     /locus_tag="GLX_01010"
                     /product="N-carbamoyl-D-amino acid hydrolase"
                     /protein_id="BAK82513.1"
                     /transl_table=11
                     /translation="MSREIIVAAAQMGPIARHETRPQVVVRMLALLEKAAGQGANLVV
                     YPELALTTFFPRWFMADQAEIDMFFETEMPSVEVAPLFARARELGIAMNFGYAEKTVI
                     DGVTHRFNTAILVDPEGNICLKYYKIHLPGHPEHEPWRQFQHLEKRYFELGKDSYSCT
                     DVLGGRMSLAICNDRRWPETYREVSLRGAEMLLIGYNTPLHYPLAPEHDHLQSFHNHL
                     CMQAGAYQNGLWVVGVGKTGIEEGVAMLGQSCIIAPTGEIVALASTTGDEVVTACCDL
                     DRCQELRENIFNFSKNRRPDMYTMI"
     CDS             119281..120771
                     /codon_start=1
                     /locus_tag="GLX_01020"
                     /product="amidase"
                     /protein_id="BAK82514.1"
                     /transl_table=11
                     /translation="MTSLCDVSAIGLCQMMRAGDVSAREVLDSCLERIEEINPAINAI
                     VAMDVQAARTQADRADKTLRAGEEVGPLCGLPVGIKDTHVTAHLRTTFGSPIYASYVP
                     EHDQGIVHRLRAAGAVIVGKTNTPEWAAGANSRNPVYGATGNPFNPLLSAAGSSGGSG
                     AALACGMLPLCTGSDTGGSLRNPAAFNGIVGMRPSPGLVANERRPQGWFPLSVDGPMA
                     RNVADTALMLSVITSDSCEDPLAYTLPTGAVRAVPQHYTPTEPAITGRLRLAVTEDFG
                     FAPTENLVRRAFRARLPAIGALFGSMTQAHPDCTQADEAFSIQRASMFLSAHHERYVS
                     HFDQIGPNIRANIEEGLKYTLHDQARAAVQQTRIYRSYQAFFQDHDILISPAITLSPR
                     PWTELYPAEIDGKKTRSYYHWLALAYAVTLAGHPAISIPVGLDEAGMPFGLQIVGPRG
                     GDVLLLQVALAVEQALASDPVLCRPLPDLDALRRAPPIAQYPGFFG"
     CDS             120852..122114
                     /codon_start=1
                     /locus_tag="GLX_01030"
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="BAK82515.1"
                     /transl_table=11
                     /translation="MGMMKASVIVLGAGMVGTSTAYHLRQQGLEVVLVDARQPGLETS
                     YGNAGVIQREAVEPYPFPRSVGKLLKVGLGLDNTVHYTPSALPGLASRLLRYWWNSRP
                     SAYGDIAGAYSALIRHALDEHLPMIERAGASDQIIKDTGMYIMYRSARELTAEAAIAR
                     QKAQQYGLKLDVLNGTELASAQPMLKCSMAGALHWRDPWSIHGPGRLVGRYAELFGRD
                     GGHFTIGHAQTLRRDGAGWQIGTADGVVQAEHVVIALGPWAREVLQQFGYNVPLFVKR
                     GYHREYGAVKNCPDAPLLDTHTGTMLAPMGDGVLRITTGADFSRFGAPPSLRQLTRCC
                     HHAGEMLDLGGSRPKAGPWLGNRPCMPDMLPVIGPAPRHRGMWFHFGHGHQGITLGPV
                     TGRMLAERIAGKTPFINMTPYLPERLNL"
     CDS             122164..123432
                     /codon_start=1
                     /locus_tag="GLX_01040"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAK82516.1"
                     /transl_table=11
                     /translation="MGSVMPFNSKNPVSKWWVFALLYAAWCLSFLDRSAMNMAAPVIV
                     GDLHISPARQGMVLGIFYLGYSFMQIPGGWMSDRYGPKWIVIVALVVWSVFTMMTGLT
                     WSFLSLIGVRILFGLGEGIFPGASVKSIYQYFVSKERGSTTAFLMSSNFVGSMIAPFI
                     IIPLIYYMGWRALFVVMSGVGMLLAAVYALSVPARVKSSDTAVGVPVNWHTIATLFRL
                     RETWRLFGIFFCISLVNKGLDTWMPSYLLRECGISLKSAGFLLSAPYLSAGIATALGG
                     WVLMRYFRDRERMFMNVNIMLLCLALGGMYCASTVNQVIVCEVLVYFFKSFVFSTIMF
                     LPSRTMPPVFIGLGISIVNFGGQTAGFVSAPLIGVILGFTKSYSIVFLCLVGAAVGAM
                     VINMAYGRLALYPARGEDRQPRGSNTFPIT"
     CDS             123543..123812
                     /codon_start=1
                     /locus_tag="GLX_01050"
                     /product="transposase"
                     /protein_id="BAK82517.1"
                     /transl_table=11
                     /translation="MKHTEDFKREAVRIALSSGLSCTRIAADLGIGKSTLGKWIVDYR
                     PTGLTSEHQGDLARENERLRLENWILREERESLKKATQFFASQKP"
     CDS             complement(123853..124083)
                     /codon_start=1
                     /locus_tag="GLX_01060"
                     /product="transposase"
                     /protein_id="BAK82518.1"
                     /transl_table=11
                     /translation="MPRNVSLIFLPSRAPELNPVENIWQFLRANWLSNTVFDGIKHII
                     DAACSAWNNLADLPETIQSIGLRKWDHTGQSL"
     CDS             124102..124473
                     /codon_start=1
                     /locus_tag="GLX_01070"
                     /product="hypothetical protein"
                     /protein_id="BAK82519.1"
                     /transl_table=11
                     /translation="MPSGAIEQDNRVDVSCHATRDFLDMQLQASRAGEWERQASGLAA
                     RRADRPELPGIVVALVGRLAWPLVAPGPLPDDAVLLADPGLVLKPDLYRLSLLQMAGV
                     GARDAREVFLNASMTAGSCPG"
     CDS             complement(124537..125760)
                     /codon_start=1
                     /locus_tag="GLX_01080"
                     /product="transposase"
                     /protein_id="BAK82520.1"
                     /transl_table=11
                     /translation="MSIDKDLLDRLMEGRSPGDLFGKSGILSELTKALAERALNTEMT
                     LHLDEERADGASAEDNQPPNRRNGNSQKTVTTQSGKVVLDIPRDRNGTFDPMLIAKYQ
                     RRFPEFDRKIISMYARGLTTREIQGHIEEIYGVEASPSLISAITDAVMEEVAAWQNRP
                     LEPCYPIVFMDAIRVNIRSDGTVSNKAVFVALAILPDGTRDVLGLWFQANEGAKFWAK
                     VLSDLRNRGVQDILIAVVDGLKGFPQAIEAVFPRTRIQTCIVHLLRHSMSFASYKDRK
                     AIATALKAIYTAVDATEAEAALGGFEESDLGRQYPAIAPSWRRAWNEVIPFLDYPPEV
                     RRLIYTTNAIEALNSKIRRAVRTRGHFPSEEAAAKLIYLALNATSAQWKRSVREWYAV
                     RCQLAIMFDDRFPMA"
     CDS             complement(125787..125969)
                     /codon_start=1
                     /locus_tag="GLX_01090"
                     /product="hypothetical protein"
                     /protein_id="BAK82521.1"
                     /transl_table=11
                     /translation="MIGAGWLEHHPGNGFDVADPAQKRGLALAGVGDTNGITAGVTGS
                     VEMILGWDYPEFCAVR"
     CDS             126093..126713
                     /codon_start=1
                     /locus_tag="GLX_01100"
                     /note="fragment"
                     /product="transposase"
                     /protein_id="BAK82522.1"
                     /transl_table=11
                     /translation="MLARYGALLEPVARPVRTDLQNRLAELVAARRSLMRDRTATLNR
                     LKTLTIGLLQRHARHRLRQIEAQVTSLNAATDALVAEDAHLSRRRDVLVSIPGLGTVT
                     THALLADMPELGMMREGQAASLAGMAPIARQSGAWRGRSFIQGGRATVRQALYMPAIV
                     AMRFNPELKRVYDRLIAKGKHARIAITAIMRKLIVLANALFHKDRL"
     CDS             complement(126792..128240)
                     /codon_start=1
                     /locus_tag="GLX_01110"
                     /product="transcriptional regulator"
                     /protein_id="BAK82523.1"
                     /transl_table=11
                     /translation="MKKAATKTFTGSRIRHQRHRVGMTQSALAQRLGISASYLNQIEH
                     DARPLPITLLGALCTLFSVGADYFSDTEETRGIQAVREILADPVFDMDAIRLDSIHAA
                     MRVAPDLCAQFVRLYRAYLLRQEHAEAALIGGGSASSRAMQHDGPDRVEPYEAVNDWV
                     QAQRNYFDEIDRCAEQQFEMMRLDEGSPGEQLARYLLDHHGIRTEIDLNLSQKGLMWH
                     IDRRQRILFLSRLAPSESSTFWMAQALGQIEHQSLFARVVRRSRLKESEARGLARVYL
                     TNYFAGALLLPYEQFRVTAHEVRHDLELLQRHFGVSFEQACHRLSTMQRPGHEGIPFY
                     FLKTDIAGNILKSFSANRFTQSRFGGPCPLWNIFRAFSTPQQVQVQLSQTTDGAVYLN
                     IARTVGRNSISYLDRPRLTAVVLGCSITDAPQIVYSAGLDLKDPRMIIPIGPGCRACT
                     REHCHHRALPMVGHRVDVDNEGRGIAPYRTAL"
     CDS             128486..129538
                     /codon_start=1
                     /locus_tag="GLX_01120"
                     /product="acetyl-CoA synthetase"
                     /protein_id="BAK82524.1"
                     /transl_table=11
                     /translation="MPYRIPAFACCDAIRKQSFLPVYSSLFPGRWMWAQPDRLRNRTM
                     ISMNYENSAFRSVPRTGAALPQQPRTAGKHRFRPLPDHGRRALNVSALCVDRHLGDCP
                     DRAAVIIRTNVGEGAVCYRELHERVCRLANALKDQGVQRGDRVAIHLPLMVESIVALL
                     ACARIGAVHVVLDMELDAHSMAERLMECGAVAVLTGDGIGDASGPVPLKATLDSALEF
                     AGTRVRAHLVLVTAINGAEITMTPGRDHYYNAMVDWYEPDFPPEAMCRDDPLFVLYSS
                     GGRNGVCAVTHTVGDYRRMASDAMEMAYPYTDADVPSGLLSMAWNAGQTPLLMGLLAH
                     GGTIVTTKEALMTLPS"
     CDS             129823..130830
                     /codon_start=1
                     /locus_tag="GLX_01130"
                     /product="oxidoreductase"
                     /protein_id="BAK82525.1"
                     /transl_table=11
                     /translation="MNEHIGWALVGASNVARQWIVDAIRVQNDSSIVTVLSSSDERGA
                     KFANENAIPAHVTDIGAILADDRVNAVYISTTNQFHHVQTIAAAAAGKHVLCEKPLAL
                     RVTDAHDMIAACRKAGVVLGINHHLRCNAMHQELRRLLAEGVIGRLNAVRVFHANFLA
                     HALHGWRINDAGGGGLILDSTIHDIDTLRFLIGSNPTHVMAMTQSGRLAHDGMEDGIM
                     VIMRFPGDVLVQIHGSYTVPFSEGGMEFYGSDGVLVGRDCMSQRPAGRLFIRNADGER
                     EIPIHHHNLYHYALATFSAAVRGRGQPAATGEDGLAALTIALAIRESALTGRQIEVDI
                     P"
     CDS             130827..132227
                     /codon_start=1
                     /locus_tag="GLX_01140"
                     /product="major facilitator superfamily
                     alpha-ketoglutarate/sugar transporter"
                     /protein_id="BAK82526.1"
                     /transl_table=11
                     /translation="MTQAAFGAVGTDGRIIRGTGATRMALSVSELRRAAWTCSLGSAL
                     EYYDFALYSLASALVFGPLFFPSASPVTSLIASFATYFVGFAVRPVGGIIFGTLGDNI
                     GRKKVLLITVTLMGLASTGIGLIPTYQTIGVWAPVLLVIARVLQGLGAGAEQAGAAVM
                     MTEYAPAGHRGFYASLPFLGIQIGTIIAAIVYCGLLFGVTDITHSWVWRVPFLVSAVI
                     LVVALYMRLKLKESPTFEKIQRKTQEEHEALAVVIRTSWRTIVAGIGVRMAENGGSSI
                     YQVLAISYIVNTMGLPGLWGTSALITAAVVGGFTVPIAGLLSDRFGRIKVYRSFAILQ
                     GITAFPVWYAFSTGRPLLAVLALSMGLGITTWGMFGTQAAMLPEMFGARHRYMAVSMS
                     REVSAVIAGGVTPLVGSFIIRWVAAFHPDAVHPGQMAWLPIAGYVILLSMTTIATTFF
                     IPECRNRDLLEQNDIL"
     CDS             132256..133017
                     /codon_start=1
                     /locus_tag="GLX_01150"
                     /product="2-oxopent-4-enoate hydratase"
                     /protein_id="BAK82527.1"
                     /transl_table=11
                     /translation="MTDVVSTDVVHLLLAVRKGKTLPPAHVDDRLVPLSIEEAYRIQD
                     EVAQHLGPIVGWKVGAQTPSSEPFCAPIHASTLFSDGATVPHGLCRHLGVEAEIAYRF
                     AQALPPRERDWTRDEVMDRIGTIHPVIEILDTRFETPGSQHKFLHTADQQSHGALIVG
                     PGSAEWQKYNPVEEHVRLSINDETVVEHVGGNSAGDPLRLLVWLANHASRRNLGIDAG
                     SIVTTGSTTGTIFVDHGARVSASFSGIGSVHTILA"
     CDS             133036..133965
                     /codon_start=1
                     /locus_tag="GLX_01160"
                     /product="D-isomer-specific 2-hydroxyacid dehydrogenase"
                     /protein_id="BAK82528.1"
                     /transl_table=11
                     /translation="MKPEILLIEPMMPEVEKQLDAAYTVHRFTSVEQLKTIAPNIRAI
                     ATGGATGVPASVMNSLPALEIIAINGIGTDAVDLKEAQRRHIHVTTTPGVLTDDVADM
                     ALGLILSLLRGLPESDRYVRDGAWGHSPAPALGHKVTGKKLGIIGMGQVGRAIARRAQ
                     AFAMPISYTDLKDFGLDEYHFVPDLKTLALDSEILVIAASGGPGSRHLVNRDILDAVG
                     AHGVVVNVARGSVVDEQALVQALEEGALGGAALDVFEHEPNVPTALMHSNRTVLQPHR
                     ASATVETRLEMGNLVVRNLAAHFAGQSLPTAVI"
     CDS             134268..135758
                     /codon_start=1
                     /locus_tag="GLX_01170"
                     /product="porin B carbohydrate-selective"
                     /protein_id="BAK82529.1"
                     /transl_table=11
                     /translation="MVAFFAMRKNTCCHGWYFVKTTLIFGVLVIISSVQALAQTFQDN
                     SNSDARLRVATPLMANPSSKPVVPPFSRPEALFTNPFGMTSWLRSRGVALTMDNTNEY
                     TDALSAPTADHPNYRQGSSNAGQVNTALHINWDKILGLKGFATHTLFTSRYGTTANRM
                     MGDWLAHSSEIYGGGGNVVVHLVTAYGEENLLGGRVSIAGGRLTEMSEFSASSLFCNF
                     QNNSFCGRPKAAIDNQYITSYPAGEWGFRVRGRPSRYIYIQAGVYFAERGIYANNQHR
                     TGFHFNSSNIVGQLAPIELGWEPVMGSKHELPGHYKIGGQLISAPNPDNYYDVNGQPY
                     ALSGRTVRNHQQTWSTWLEADQKILHHPYSNSEGGLTVMGGVIYNDPRTSLRNYETYV
                     AFVDRGFIKSRPYDAFGMVMTYVKIAPGVSDTDILDLSMVPVKTAPNHATGTQGHATI
                     FETNYQIHVMRGVVLAPDFQVYFHPNAQRNLKNVEFIGFKSQIQIM"
     CDS             complement(135869..136141)
                     /codon_start=1
                     /locus_tag="GLX_01180"
                     /product="transposase"
                     /protein_id="BAK82530.1"
                     /transl_table=11
                     /translation="MAQWLLADRGYDADWFRDALEEKGIRPCIPGRRSRGKPVKYDKR
                     KYKRRNRIEIMFGRLKDWRRVATRYDRCPNVFFSAICLAATVIFWL"
     CDS             complement(136279..136626)
                     /codon_start=1
                     /locus_tag="GLX_01190"
                     /product="transposase"
                     /protein_id="BAK82531.1"
                     /transl_table=11
                     /translation="MSDLFWLTDEQMERLRPFFPKSHGKPRVDDRRVLSGIIFVNRNG
                     MRWRDAPREYGPHKTLYNRWKRWSDMGIFMRMMDGLSAAKAEPQTIMIDATYLKAHRT
                     ASSLRLKKGIQAA"
     CDS             136826..137119
                     /codon_start=1
                     /locus_tag="GLX_01200"
                     /product="hypothetical protein"
                     /protein_id="BAK82532.1"
                     /transl_table=11
                     /translation="MVIRIFFFAMLYCVNIPSVIAKNEKNVPEDVISFFHDADICQYL
                     AGEWDSNLPQKRKKELSNEMNKTCSNIYKRQEHFKKKYIRNKFIMQKLNSYEF"
     CDS             137200..137670
                     /codon_start=1
                     /locus_tag="GLX_01210"
                     /product="transposase"
                     /protein_id="BAK82533.1"
                     /transl_table=11
                     /translation="MWTVENRARYDRSQLRYPSDLTEEEWSLIAPLIPAARRGGNKWT
                     VDIREVMNGLMYVFGTGCQWRAIPKDLPPRSTVNYYFCRWQHDGTLNRLHHALYILCR
                     EQAGREASPTAAIIDSQSVKNAEKGGGASIRPALTPARGSRARSGMSSSIRRAC"
     CDS             137670..138038
                     /codon_start=1
                     /locus_tag="GLX_01220"
                     /product="transposase"
                     /protein_id="BAK82534.1"
                     /transl_table=11
                     /translation="MEATVHATDIQDRDGGVMLMATLFGLYPFLLKLYANAGYQGAKF
                     QQGLAHVCHSVNVEIVRRCDVGKFVVLPKRWIVERTIAWLNRCRRLSRDWECLNCNAL
                     VFLRWASVRMMLRRLCNHTS"
     CDS             138724..139944
                     /codon_start=1
                     /locus_tag="GLX_01230"
                     /product="flavohemoprotein"
                     /protein_id="BAK82535.1"
                     /transl_table=11
                     /translation="MSAPLDENTRSIILATVPALKAHGLAITTEMYKRLLATPAIRDL
                     FNLSHQQDGEQPKALALAVLCYAEHINDLGALSSMVERIAEKHVGLNILPEHYPYVAT
                     ALLGAIGHVLGDAATPEILDAWGKAYWFLADILIGREKQIYDGNESMPGGWKGWRAFR
                     IRARQNETATIVSFDLVPKDGGALFRHKAGQYLSFKLDVPEHGSQRRNYSISSAPGAD
                     HYRISVRRQDGGVASTWLHDSVKEGDILQVANPAGDFFLNDADSNPVVFLTAGVGLTP
                     VISMMGELAQTRTNRHIHYIHGAETRALTAFVPQIDDLAKSDRVKADFFYSKEQAPVQ
                     DGTPGVTTHAGRITPAWLLQTLDRTATYYICGPDSFMRDMVEALKSAKLPATQIRYEF
                     FGSAADPELVLSAA"
     CDS             complement(140679..141278)
                     /codon_start=1
                     /locus_tag="GLX_01240"
                     /product="transposase"
                     /protein_id="BAK82536.1"
                     /transl_table=11
                     /translation="MRSSCPPGKPGDRPRTADMREVVNAMLYLASGGCAWCLLSKCFP
                     PASTVRRSFYEWRDTRLLEVMNTVLIMNLREIEGRNASLRVGVIDSLSVKTTESGGIS
                     GYDADKKVKGRKRHIMTDTCGFPIFLLVHASDIQDRYGAVELLAAIRKRFPWLRHVFA
                     NGNYAGDKLRPMLANMRRWTMEIIRRSDTEKDCTILPHR"
     CDS             complement(141497..142081)
                     /codon_start=1
                     /locus_tag="GLX_01250"
                     /product="hypothetical protein"
                     /protein_id="BAK82537.1"
                     /transl_table=11
                     /translation="MTVSTPDTQNTDKFFKPFYTVGHSTHSLPDFIAILRHYNITMIV
                     DVRAFPYSRRNRDFDGSRLVSELAVYDIGYCHIPELGGRRPRSKTVCIETNAFWRVQS
                     FHNYADYALGEIFHQGLAKLLELGRQNTVAIMCAEVLWWRCHRRIISDYLLENNQKVF
                     HILSLENVVQAQITPDAVIAKKGLITYPLSISGG"
     CDS             142816..143868
                     /codon_start=1
                     /locus_tag="GLX_01260"
                     /product="transposase"
                     /protein_id="BAK82538.1"
                     /transl_table=11
                     /translation="MCGAVIICSKRSPRMSIDKDLLDRLMEGRSPGDLFGKSGILSEL
                     TKALAERALNTEMTLHLDEERADGASAEDNQPPNRRNGNSQKTVTTQSGKVVLDIPRD
                     RNGTFDPMLIAKYQRRFPEFDRKIISMYARGLTTREIQGHIEEIYGVEASPSLISAIT
                     DAVMEEVAAWQNRPLEPCYPIVFMDAIRVNIRSDGTVSNKAVFVALAILPDGTRDVLG
                     LWFQANEGAKFWAKVLSDLRNRGVQDILIAVVDGLKGFPQAIEAVFPRTRIQTCIVHL
                     LRHSMSFASYKDRKASPQLSRQSIQQWTPQRPRQPSAGSKKAIWADNTRPSRPVGAGH
                     GMRSFRSSIILQKCAG"
     CDS             143856..144080
                     /codon_start=1
                     /locus_tag="GLX_01270"
                     /product="transposase"
                     /protein_id="BAK82539.1"
                     /transl_table=11
                     /translation="MRRLIYTTNAIEALNSKIRRAVRTRGHFPSEEAAAKLIYLALNA
                     TSAQWKRSVREWYAVRCQLAIMFDDRFPMA"
     CDS             complement(144557..144904)
                     /codon_start=1
                     /locus_tag="GLX_01280"
                     /product="transposase"
                     /protein_id="BAK82540.1"
                     /transl_table=11
                     /translation="MSDLFWLTDEQMERLRPFFPKSHGKPRVDDRRVLSGIIFVNRNG
                     MRWRDAPREYGPHKTLYNRWKRWGDMGIFMRMMDGLSAAQAEPQTIMIDATYLKAHRT
                     ASSLRLKKGIQAA"
     CDS             145414..146847
                     /codon_start=1
                     /locus_tag="GLX_01290"
                     /product="cytochrome bd ubiquinol oxidase subunit I"
                     /protein_id="BAK82541.1"
                     /transl_table=11
                     /translation="MQYAHDPALLLARFQFAFTVGVHIIFPAFSIGLAAYLAVLEGLW
                     LRTGRPVFLDLYRYWIKVFSIVFGMGVVSGLVMSYEFGTNWSIFSKKAGPITGVLLSY
                     EVMTAFFLEAGFLGVMLFGMNKVGRKLHFAATCCVSVGTLISMTWILSSNSWMQTPRG
                     YTIDPATGRFMPADWLAIIFNPSFPFRLVHMGLAAFLSVAFIVGATGAWHMLKARKAG
                     KISSEPVRVMFSMAMWMAAIVAPLQILAGDAHGLNTLKYQPVKIAAMEGDWVSEDHAP
                     ELLFGIPNMKTEHTDYAIRLPLAGSLILTHSLNGKVPGMKDFPRDQRPPSPVIFFSFR
                     IMVALGMLMMLVGLWSLWLRRNSTLFTNPVFHRVALCMAPAGFLALLCGWVTTEVGRQ
                     PWTVYGLLRTSDSVSPVALSSMAFSMTAFVVVYVLVFGSGLGILARMLSHAPQEGEHD
                     TPPDHATEILATRMHPGVIDPSAGKGA"
     CDS             146851..147870
                     /codon_start=1
                     /locus_tag="GLX_01300"
                     /product="cytochrome bd ubiquinol oxidase subunit II"
                     /protein_id="BAK82542.1"
                     /transl_table=11
                     /translation="MMDFAYWLPIVWAVILVVAISIYVVLDGFDLGIGMLFALERHPG
                     RRDVMVNTIAPVWDGNETWMVLGGAVLYGVFPGAYATLLPAFYLPIVLMLLALIFRGV
                     AFEFRVMTRGRGREGMWNAGFMAGSALAAFCQGAILGGVVQGIKVVDGAFAGGPLDWL
                     TPFSILCGLSVMCGYALLGATWLIWRTTGVLEASCRRWAARLAVGLFIGIVAVSLWTP
                     LLHAPYLRRWTDWPNIAFVAPVPVLVVVLAVLFVMGLRRGHSKGPFLCALGWFFLCLS
                     GLGITVWPYAVPPGLTLWDVSSPPSSQFFQLIGTAILLPIILTYTIYSYHVFRGKVTE
                     TDGYH"
     CDS             148062..148574
                     /codon_start=1
                     /locus_tag="GLX_01310"
                     /product="hypothetical protein"
                     /protein_id="BAK82543.1"
                     /transl_table=11
                     /translation="MLFDFERDFAGSLRCIPMIARQKLDIVGIKLSLRQWSRFTREER
                     GQLADLPCETVPEQATYRALVVHLIATRSDEPLRQLATRGLEDWRNADRMPDAVKTQA
                     QADGIAPPTAVQWATLRPLQRFALVKLARSKHENENFVPAMREFGLLHDVGAFSNQTA
                     VPRAHTRLPT"
     CDS             148598..150901
                     /codon_start=1
                     /locus_tag="GLX_01320"
                     /product="formate dehydrogenase alpha subunit"
                     /protein_id="BAK82544.1"
                     /transl_table=11
                     /translation="MSNEKTPEYKPYHHPAGGWGAAGATAKVLMEQSVLVKGSRGLLS
                     MNQPGGFKCPSCAFPDPDHRKTLEFCENGAKALAHEATKGRVTREFFEKYTVTELMQK
                     SDYWLEMQGRLTEPMRYDAQSDRYVPVAWDDAFALIGQHLRALDSPHQAEFYTSGRTA
                     NETAFLYSIFVREFGTNNFPDCSNMCHEPTSRGLPPAIGIGKGTIVMGDFEHAEAIFV
                     VGQNTGTNSPRMMTNLVEARKRGVPIVLINPMPERALIRFTEPQDMLQMGTFGSTPIS
                     SEFVHVRIGGDLAIFKGMMKALFEAEARGETVLDLDFIHEHTAGLDAVRDDAIGCSWG
                     EITQISGITEAQIRKIADIYMKSNATIICYGMGLTQHQEGSRLIQQVANLLLLRGNFG
                     KPGAGIAPIRGHSNVQGDRTVGIDEKPTDAYLDRVRDAFGFEPPREHGHHVLEAVEAM
                     EAGTAKVFFGMGGNFIRAVPDTDRSYAAMRNLNLTVGVATKLNRGHLVHGKDALILPV
                     VARSEIIRTEAGEQFVTIEDAMANVTASRGVFEPVTGHVRPETEIVCRMAMATLPNSR
                     TPWADYMVDYTLIRDKIAEVYPEIYANFSERIKNPHGFHLDIPPRRRVWNTPNGKANF
                     LVLPGLEVNMPVKDAAMLRLATIRSHDQYNTTIYSNSDRYRGVYNTRLVIFMNKDDMA
                     ERGLANGDVIGLETYSDDGIRRYVDGLHVLDYPMPRGAIAGYYPELNPLLPLDYFDEI
                     SGTPAAKSIPVKVVESVASAPPIQIAG"
     CDS             150916..152001
                     /codon_start=1
                     /locus_tag="GLX_01330"
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="BAK82545.1"
                     /transl_table=11
                     /translation="MDADNNSRLGSPVPPVDRLGRPLRDLRISVMDRCNFRCPYCMPE
                     ATYHEAFRFLGPEERLDFNEIERVARVAAELGVTKIRLTGGEPLLRPGLPDLVSQLRV
                     LPGIEDIALTTNGVLLPRFAPALLQAGLRRVTVSLDSLDPVVFAHMSGGRSDLSTVME
                     GINAAGAAGFEGGVKINTVVQRGVNDAGVPDILARFRNTGITVRLIEYMDVGNRNGWD
                     RTDVVPSDELRARITALWPLEPLPPRYRGEVARRYRYVDGAGEIGFVSSVSAPFCGAC
                     SRARLSSDGKLYTCLFATTGTDLRGLLRQNVCNVKIDECLRTTLSRIWYHRTDRYSEE
                     RTHRPALWADRKKTFPQEKIEMHYIGG"
     CDS             152047..152670
                     /codon_start=1
                     /gene="mobA"
                     /locus_tag="GLX_01340"
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein A"
                     /protein_id="BAK82546.1"
                     /transl_table=11
                     /translation="MTALLYGLVLAGGESRRMGQDKATLPYGGRPQLARAFDLLERHV
                     GRCFVSIRPDQQPDPLRASYPCIMDRRETKGVLGGGPMVGVLSAHVVYPDVAWLVVAC
                     DLPMLDDTTLATLVHGRDTTLAATAYVSESDGLPEPLCTIWEPATLAAMNRQAVNRTI
                     RLRQMLAGPAVRLLEINKTGALQNVNAPDERDRVMKFLGYSEQEVRR"
     CDS             152705..153049
                     /codon_start=1
                     /locus_tag="GLX_01350"
                     /product="hypothetical protein"
                     /protein_id="BAK82547.1"
                     /transl_table=11
                     /translation="MKLERRTNFVMPMVLRLNLPTCVLRSIRYLLHGISRCAKVIMLP
                     LFRRRQANERHHHGRDADGFSTLRRVILVAEAGGFCSFEGWARYTNAGRAVSGIDYSV
                     FGSLTLAEGHHD"
     CDS             153251..154117
                     /codon_start=1
                     /locus_tag="GLX_01360"
                     /product="formate dehydrogenase family accessory protein"
                     /protein_id="BAK82548.1"
                     /transl_table=11
                     /translation="MGAMPHPLAIKRPISMREATVMPDLFYPLDVSSLSRPNEKFNLN
                     VAEEVPVSLLFNGIFPYGTMMMTPADLKDFAYGYCITEQIIDGVADIRSVNIAEADDG
                     LTLDIFIKGKALTQLMRRNVRMQAGHSSCGICGSESVPEYNAVAATPLGEGAHLSVAA
                     IRNALHELRQWQTLNAATRMVHAAAWADKNGNIHMIREDVGRHNALDKLIGARACHLE
                     VFHEGFCLLTSRYSFEMALKTVRAGIAIVVAISAPTYRAFQTAETMNQTLIAIARRDE
                     QTLFCGGKRLIE"
     CDS             154248..155174
                     /codon_start=1
                     /locus_tag="GLX_01370"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82549.1"
                     /transl_table=11
                     /translation="MFLKQLYYLREIDRFRSFSKAAVACNVSQPSLSRAIRVMEEELG
                     VVIVDRKQKVFGLTPEGTQILKWGHEILHGVAEIQNVVSLSHQKLAGVIKIGVIPTAV
                     HIIPLLMDAVKEHIGDFICDVLVLANAEIIEKLNIKQLDIGIMYCDECPKASVFAMYE
                     LYKEKQVLAGTAAYDFPAGDDVSWETAGQFPLALLSRSMRCRQFIDVGFQTAGVKPIV
                     RLETTSLELIHAAIMKGTHTTILPISSFPLRVPPRGRLQIRRLSGFSAGSIGLVRLYE
                     SPLASFVAEVWKIIIKIDFEEQLDDLCRQESW"
     CDS             155435..156013
                     /codon_start=1
                     /locus_tag="GLX_01380"
                     /product="transposase"
                     /protein_id="BAK82550.1"
                     /transl_table=11
                     /translation="MDAFKKLPDNPEVLHRPSVARQTDRNLVSGRSAERAKERRRPVK
                     GPNGEPDQRYAQRLAFRGNLSCTAQDRRSRSPVYRHGQHAPTSRRDCALCGPGSLCRR
                     FLFDHAPWHTTAKLRLPRNISLIFLPSHAPELNQVENVWQFLRANWLANTVFNDIDHI
                     INVACNAWNNLVALPKTIRSISLRKWAHKGQK"
     CDS             complement(156077..156586)
                     /codon_start=1
                     /locus_tag="GLX_01390"
                     /product="endoribonuclease L-PSP"
                     /protein_id="BAK82551.1"
                     /transl_table=11
                     /translation="MFDLKKTVIALVILSSMAGAVPTYAYDGIVRHSAGKFPIASSIE
                     VPTGASTIYLSGMGAPVQDRKADPHTLAAYGDTQTQTYAALLRIQDELKKLGLGMGDV
                     VQMHIYMAEDPKLGKLDFDGMMKAYTQFYGTDRQPDLPVRSAFGVAHLANPGWLVEIE
                     VTAVRMPKK"
     CDS             complement(156592..157014)
                     /codon_start=1
                     /locus_tag="GLX_01400"
                     /product="cytochrome c precursor"
                     /protein_id="BAK82552.1"
                     /transl_table=11
                     /translation="MRKFLLFFIFAVLLLLVPVGPVQADSASSVEGQVQPLNTGEDVY
                     RHICQGCHMPDGKGAVGAGAQFPAFANNAKLQSSGYPVYVIMNGYGGMPWFSGMLKDD
                     QIASVVNYIRTHFGNHYTDVVTTTDVAAQRPIVKQKEQ"
     CDS             complement(157014..158615)
                     /codon_start=1
                     /locus_tag="GLX_01410"
                     /product="amine oxidase flavin-containing"
                     /protein_id="BAK82553.1"
                     /transl_table=11
                     /translation="MTNAHPRKVPTRRQLLTRIGTLAGSAALYQAMTSLGHAQGTDFT
                     SPPVLSGAKRGTRVLVLGAGLAGMLSAYELRKAGYHVQVLEFQNRAGGRNISLRGGDT
                     VTELGGATQKVSFASGNYINPGPWRIPYHHQGLLHYCREFGVELEPFVELNHNSWLHS
                     STAFDGKPVRYREFAADFHGFTAELLGKAIEQHKLDDMVSVDEQEHVMTAMRQWGCLN
                     SNLNWTKGIISSETRGYEKAPGGGINGAPVPSEPFARKDVMRSGLWTWLAFHERLDMQ
                     TTMFQPVGGMDMIGKGFNRQVHDLITLNCKVTSIHQDDKGVKVTYNDMSHGGAIREAE
                     ADYCVCTIPLPILSQLDVKVSAPLRAAIMAVPYASSVKLGLEFKRRFWEEDDQIYGGI
                     SFTDQPISQISYPSHGYFSRGPAVLLGGYMFGPTAYDFAGMTPQERIEHALTQGEILH
                     KQYRKEFSNGVSFAWSRVPWAMGCCSMWSEQARKTHYKALCTMDNRIVLAGEHASYVG
                     CWQEGAILSALDAITQLHSRAQGAS"
     CDS             complement(158831..161416)
                     /codon_start=1
                     /locus_tag="GLX_01420"
                     /product="TonB-dependent outer membrane siderophore
                     receptor"
                     /protein_id="BAK82554.1"
                     /transl_table=11
                     /translation="MNRRTSFLITTICSFVSLGAVAATPSGNSVTKEQNPEKNGTVRA
                     RRAPTAQTHTRAAQNLKQENNAGVNSSGVETINVSTGTHTVNRKARDSISPVSVVSAA
                     TLRRSGQMNLADALTRTYASINVSTMGADAGALTSAIRMRGLNPNEVLVLVDGKRRHT
                     TANLYADSGPDSGSTPVDLNMLPANAIDHIEVLEDGAAAMYGSDAIAGVVNIITKKQD
                     HGLNLSGQTGANAYNGDGWGYQLNADGGMKLGQDGFLHISGQMYHTDHFVANNARDHR
                     LLGSQPADAGTATYTGVNAGKISTRSNKIMSTPEETRENLAIEWGKQFTPGINFYGLI
                     TYAHRHAESYENYRTPTVGGSCEACAAIAPYGFSPLETMEENDFAATLGLKGDNFMGF
                     NWDISSTYGEDIDKVGNKNTLNTSYVTAYGSSPRKARAESYSMVQWTNNVDFRRHFKI
                     GDVVPMTLAFGAEERMESYNITAGNPVSYLGGGTQGYAGISPGSAGTWYRDIWAWYLD
                     GDFRLTKKWELDFAGRLEHYTDVGNTENGKISTRYNFTKRIAIRGTISTGFRAPTLAE
                     SHFSAVNVSPTGASGLLAADSSAAQSIGATKLKPERSTSVSGGIVLEPVDGFHVEADV
                     YQINMRDRIVQDTNFGGSIPYGNTTQGEVAAQAIAQLASLPTGFTGYNDVYADYFTNG
                     ASTRTQGVDIKADYMFRFHQYGNLALSMSIDLNRTRLHHNGADLNLSNIAAITTDYPR
                     SKIILNAYYTYKNWDFNIRQTRYGQTSDMMQYQDWGPAALQYSNNALQQFINTPHWLT
                     DIEIGVRFKKNWHMAIGANNVFNVRPRMVPQALNALGAMPYDEDSAQIPMYGGYYYGR
                     LNANF"
     CDS             complement(161884..162237)
                     /codon_start=1
                     /locus_tag="GLX_01430"
                     /product="transposase"
                     /protein_id="BAK82555.1"
                     /transl_table=11
                     /translation="MARTSELTIKRREPKKGASFEKRDHRETPGRSRGSYGTKVCVIA
                     DGHGKAFGFALAPGQAHELPLAPVMLDSLPATPLWVVADRGYASNAFRERIWDMGARL
                     TIPAKRYDGAVACPK"
     CDS             162838..163137
                     /codon_start=1
                     /locus_tag="GLX_01440"
                     /product="transposase"
                     /protein_id="BAK82556.1"
                     /transl_table=11
                     /translation="MKHTEDFKREAVRIALSSGLLRMRIAADPGIGKSTLGKWIVDYR
                     PTGLTSEPQGDLARENERLRLENRILREERESLKKLPSSLRAKSHEVRLHPWASA"
     CDS             163345..163470
                     /codon_start=1
                     /locus_tag="GLX_01450"
                     /product="transposase"
                     /protein_id="BAK82557.1"
                     /transl_table=11
                     /translation="MIGWAVKDRMKKDLAIRTLDMAVRLRDPVPCCIVHSDRGSQ"
     CDS             164073..165707
                     /codon_start=1
                     /locus_tag="GLX_01460"
                     /product="glycogen/starch synthase"
                     /protein_id="BAK82558.1"
                     /transl_table=11
                     /translation="MVSTAIPFRLPVRLLSVSAEMFPFVKTGGLGDVTGSLPHALAPY
                     GVKVTTLLPGYPAVMAALRERKKLAYRPDILGHAATLWSGRAQDLDLLVFDAPTLFDR
                     PGNPYLCPDGLDWPDNGIRFAAFSRMAADIAQGQVAAFQPDLVQAHDWQAGLVAAYLY
                     HDRRAQVVPGRVVPVVQTIHNLAFQGRFPVADLARFGLPPEALSVEGCECYGAISFLK
                     AGLYHADRITTVSPTYAHEIQTPEGGMGLDGLLRHRGELLEGILNGIDTATWNPASDR
                     AVHFPYMVGDTVGRAPNKRALQAEFGLAADPDAFVIGIVSRLTAQKGIDVLAAAMPRL
                     LVANTQVIVVGEGDREIERSLAVLQRQFPRRVACHLNYSEELGHRVPAGADVLLIPSR
                     FEPCGLTQLGALRYGAVPIASRVGGLADTIVDANPAAMARGGGTGFLFSPVDEETLVS
                     AVNRARLLYRRQRATWRQLQLNGAGYDVSWNAKAAHYVALFAELLGVDLSVPAMSNVI
                     MLSSGRIPTADRLRESRRRHIARRAPRLSHPVAVPH"
     CDS             165778..167997
                     /codon_start=1
                     /locus_tag="GLX_01470"
                     /product="glycogen branching enzyme"
                     /protein_id="BAK82559.1"
                     /transl_table=11
                     /translation="MRIRQDEAHYHLPPGVDDLVHGRSSDPFSILGRHNMGKVDVVRV
                     MYHDAARVRLVIERARGGAVERPMRRMGDTGLHIGTIAAGARYHLKITWADAVEETGD
                     PYSFGLLLDEETLRLFSEGRHAMLDRVMGAQPMVMEGMPGVRFAVWAPHARRVSVIGD
                     FNFWDGRRHPMRLRHEAGVWELFIPGLVAGERYKFEILTREGHILPQKADPYARFAER
                     PPATASVIAPAEDFAWSDGEWMARRGALQAHDAPLSIYELHVPSWRRPQGDPARIMSW
                     RELARELIPYVLGAGFTHVELMPVMEYPFGGSWGYQPLGLFAPSARHGTPADFASFVD
                     ACHGAGIGVILDWVPAHFPNDVHGLVCFDGCALYEHQDPREGVHRDWNTHIYNLGRHE
                     VRGFLIASALMWLRRYHIDGLRVDAVASMLYRDYSRREGEWIPNIHGGRENLEAVAFL
                     RQLNETVRATVPDAMMIAEESTAWSGVTRPVEYGGLGFSYKWNMGWMHDSLRFFARDP
                     LWRGFYLQDILFGLHYAFSEHFILCISHDEVTHGKGSLLARMPGDDWQRHANMRLYFA
                     FMWAHPGRKLIFMGTEFGQEGEWSHDGEPDWSSLVAPFKSGVAALVADLNHVYRTLPA
                     LHALDSDPAGFAWVIGDDTVNTVLSWLRLAPGHPPVLVVLNLTPVPRHGYRVGVPVGG
                     LWRECLNSDAASYGGSGVGNGGAVMATDQAAHGQPCSCVLTLPPLAALYLHPAGDGA"
     CDS             167994..170114
                     /codon_start=1
                     /gene="glgX"
                     /locus_tag="GLX_01480"
                     /product="glycogen debranching enzyme"
                     /protein_id="BAK82560.1"
                     /transl_table=11
                     /translation="MMRLPPRLSPGMPAPLGAHWNGLGVNFAVFSANAQQVDVCLFDP
                     RDRREIRRYRLPEYTNEVWHGYLPDAEPGLLYGFRAFGPYDPASGHRFNPHKLLLDPY
                     ARGLSGPLSWSDTQFGYRLHSPRADLSFDRRDSAAAMPRCVVVHDTYEWEDDVLPRVP
                     WEDTVIMEAHVKGLTMQREMASARPGTFRALCAPAMIAHLRRLGVTTIELLPIQCFMP
                     ERHLIERGLTNYWGYNTLAFFVPHAGYLASGSPHELRAAIRRLHRAGIEVVMDVVYNH
                     TCEGSELGPTLCYRGLDNATYYRLVPGNERHLINDTGCGNTLNLSHPRVLQMVLDSLR
                     YWAESYHIDGFRFDLATVLAREPYGFDQGSGFLDAIMQDPVLSSRKLIAEPWDPGPGG
                     YQFGNFPPGFAEWNDRFRDTTRRFWRGDARQQGDMAARIAGSGDLLDRRGRRPWSSIN
                     ILTTHDGFTLTDVVSYATRHNGANGEDGQDGAPENYSANWGVEGSASDAVILNLRGRV
                     QRAMMATLMLSHGTPMLLAGDEFGQTQGGNNNAYCQDNATSWLDWELAGTAAGRVMAS
                     FVARLAALRARHPSLRAARYMHGHHKPMPDLPDISWFRPDGDPIGAAQWADESFHFLG
                     VRRASTHEGGTVDVTYTVLNAHAEDLTAILPAPHGKWTLLLDTTRPDQPEMMLEHGVR
                     DIIVPARGLLLFAAVAAGEEGENA"
     CDS             170111..171892
                     /codon_start=1
                     /locus_tag="GLX_01490"
                     /product="malto-oligosyltrehalose trehalohydrolase"
                     /protein_id="BAK82561.1"
                     /transl_table=11
                     /translation="MSVHFHYCRHAGATLVDEGHTRFRLWAPSCSTVALEVEGHAPAP
                     MAARKGGWFECVYPCGAGARYRYRISPDLAVPDPASCYQPDDVHGPSEVMDPAKYDWQ
                     YPRWAGRPWHETVIYEVHVGLMGGYGGVARELPRLVALGITAIELMPLSEIPGGRNWG
                     YDGVLPFAPESAHGHPDELKDLIDRAHGLGLMVFLDVVYNHFGPDGNYLAAYAAPFFR
                     TDQPTPWGAAIDFRRDAVQTFFVDNALYWLMEFRFDGLRLDAVQAITERAWLVELPAR
                     IRAHVEPGRHVHLMVENENNDAGLLRAGYRAQWNDDAHNALHVLLTGEDESYYGNFVP
                     DPASALARVLAEGFAFQGEISPVSHTPRGSPSADLAPDHFIIFLQNHDQIGNRALGER
                     LSVLAAPQALCAAYGLVLLCPQIPLVFMGEEWGSCQPFLFFTSHTPELGQIVREGRRK
                     EFAGFSHFASEEKRHLIPDPNAPETFAASQLRVAEREARPHAQWMAMIQGLLALRHAE
                     IMPRLPGARAIGAQVIGARAVMARWRMGDGMVLGMALNLGSTPVERPDTLRGRCLHAV
                     LPQGTDLFCTMLPPDSVVVCLAETADE"
     CDS             171885..173978
                     /codon_start=1
                     /locus_tag="GLX_01500"
                     /product="4-alpha-glucanotransferase"
                     /protein_id="BAK82562.1"
                     /transl_table=11
                     /translation="MNNRDLADRARRAGLSVRWRDAAGQIHRVSNDSIRRLLTVMENH
                     GGTDRSPANLPAMVVAVAGQATILPNMGADAPATFRLVMEDGSRLEGQLRQLRGRLVL
                     PALTRCGYHRLEIGSAHTTLALSPPACPSIASRTTGGPVRPWGVGVQIHGLHMPGDGG
                     IGHFGALGGLARTTAGKGADVLAISPVHAMFAARPGQYSPYSPSSRLFLNPLLGDPHA
                     VFDTATIQRAEVRQGREWMATLRALEHAPLIEWEQATAHRYRLLRQLYEDRIAASPPD
                     DLLTFRHAGGRALEQHAIFETLHAHFTTRGARGGDWRCWPQAMRLPDSPEVARFAAAF
                     AHDVGFHVFMQWLAARSLAQAGTAARNAGMRIGLIADMAVGVDPTGSECWARQDQFLM
                     GAAIGAPPDMLSPLGQDWGLTTFSPHGLKASGYRAFIDTLRAGFAHGGGLRIDHVMAL
                     ERLWVIPQGGTSAEGAYLSFPVRDLMRLVALEATRANAVVIGEDLGTVTTTFRKAAKK
                     QGIMGMNVLFFERTAQGAYKSPAAWSRNAVAMTTTHDLATVAGWWQGIDLEWRIRLGQ
                     MAPGVDAASLQATREYDRAMLWAALVAASARRLRSLRAGRLAETPPPTPAGAAVVVDE
                     AISLVARTPCPLAVIALEDLLGLAEQPNLPGTTTGHPNWRRRYPGTVATVMSGADVRR
                     RINRLRAGRGGNGHE"
     CDS             173971..176715
                     /codon_start=1
                     /locus_tag="GLX_01510"
                     /product="1,4-alpha-D-glucan 1-alpha-D-glucosylmutase"
                     /protein_id="BAK82563.1"
                     /transl_table=11
                     /translation="MNSRTGARSMRATLRLQFRGGMTLDGACALVPQFARMGISHLYA
                     SPLCAARPGSTHGYDTIAYDRIDPELGGEAALLRLTDRLHAHGMGLILDIVPNHMAVD
                     AGNAWWLDVLAWGRASAHANWFDIEWHAPDPELHGKVLLPFLDRPVEDAITAGLLYLR
                     HDEDSGLFFIHHHEHRFPLCPAGYAGLLAKVHAPAPLLVAWTRVAMRAGPCAEVDAAL
                     AALRQWAGTDEGTQAMCRLATLHDATNVSGRRQLEELLAAQAWQPAFWREAATRINWR
                     RFFDITGLVGVCVEREEVFEAVHAYVFSLYQRGVVDGLRVDHVDGLDAPAAYCQRLRE
                     RLDILGPLRPERARPGGTVYVEKILVAGESLPTAWPVDGTTGYDFMDQVGAVLHDGAG
                     AVVLDRLWATCGPDAQPLDPIVKTARAQLLEHTFCAEFTHLSFLLERVLCGTAAACAL
                     HGLHDALCNLLVQFHPYRTYFGDEAMQDHTAGCAALQQAERAACAFLANGQHAVMSDM
                     VRFLEARPEQAPPVAVRHLQLAFEHLTAPLAAKSLEDTAFYRYGRLLSRNEVGSDPQH
                     LALPVAAFHAACAERAASYPHALLATATHDHKRGEDARARLTIISEAAEEWEALVQGW
                     FAHNGAGQGCGPDRIDELMLYQTLVGAWPLLPFGDEAARARFVQRITQWQTKALREAK
                     RHTGWTRPDEAYETACTRFVERLLDPARSTVFLRQLEGFVTRIAPAGALNGLAQTLLR
                     LCVPGVPDLYQGCDLWDFSLVDPDNRSAVDFAHRATLLEQATGFASAAATWRTGRIKQ
                     DMIRRILSFRQHYPGLFASGNYVPVVIGGADQAHAIAFLRQHDGMSLLVVAPRLPLGL
                     RVDADTLALGHTPDISIELPALSGPWHSLLGDVPPCVHAPFVRGGVPIACLVHDPRIA
                     "
     CDS             177628..178131
                     /codon_start=1
                     /locus_tag="GLX_01520"
                     /product="hypothetical protein"
                     /protein_id="BAK82564.1"
                     /transl_table=11
                     /translation="MLKAGTTQAEVDFFDSDFCQHQSFWKKRKVLFLTDMLFDLHNRT
                     FARQARRVTQECPLHRILVVSVHVPRRERKLRHVFNRLSLTRYKVDFQAADMGSRGKF
                     GNINAVISQVNLKQYDWVTVADDDVALPAHFLDTFIFLSEVMDLTISQLPHKYRSHAS
                     FTVNYLK"
     CDS             178298..178501
                     /codon_start=1
                     /locus_tag="GLX_01530"
                     /product="hypothetical protein"
                     /protein_id="BAK82565.1"
                     /transl_table=11
                     /translation="MQDYPSREAKAETRVLLSRHALQSDRRDLFHKTEILWHINVKLP
                     ELRCAPLRPGWMLSVVHGAVSMP"
     CDS             178712..181243
                     /codon_start=1
                     /locus_tag="GLX_01540"
                     /product="mechanosensitive ion channel small-conductance"
                     /protein_id="BAK82566.1"
                     /transl_table=11
                     /translation="MSQPHLPCRWPELSSRDGTGKMRYHTDTCHHGMGQDSLPVGVRP
                     AGAPSRWRGIVWVLLGLWVLVGTRAGYAADTAPAGMTREQAQQVLDVLNDPAKRAAFQ
                     NTLSAIASGLPTAQSAPQPAPVPVSTPKAASVSAQPDTLSSDIVQDASSLRGTLIIQA
                     QHFVALFGDLVFVVHWTHTIFADPDSRIILLDAVGRATLILLLALAAEHGCSLLLRRP
                     LLKITARAIATEQRLSLHAPPPQAVPPTPTPDAPGGDDTTVLQARQDDMQAQHATLRL
                     LARVPYSLLHLLIKLLPVGLFFALGTSFAYLLTTTQQARAVTITLANAYVVARVVYLL
                     METLFVPRSPAIRLCSASNQTAFMVTHWLNFLVAAPSVVVCLSTLGGVFDMPARGTEA
                     IIRSVVLVEHVLIAIFTWRMRNHVATALQPPARLLAQPFWMFVGRLVHLWWVPAMFFN
                     FALWLIWATHISGGYAWIIRTVILTTAVVILSRVVSVVVYNLQNRLFHISPALEARYP
                     GLQARVDYYYPVSRRILSFLMFFATAVIFLQALGLPAIYFLLHSKLGQKIIGVIGSVL
                     VAYTVAVITWEAANAGLQGQIARFENSSQTGRASRLRTVLPIIKTVLLALIIIIVAVT
                     TLSQIGINVAPLLTGAGIMGAAIAFGAQSLVKDFITGFFMLVENAIQVGDWVTAGGVS
                     GTVEHLSIRTLRLRSINGDLHIIPFSEVSSIANTSRDYNLVVVDFMIDLGQDTQQLSA
                     ILHEELEELRKEPRFAHLVLSEFKFLGIEQADGNGARFLGSIRTSPGAKWTVYRAYYS
                     RLAVRMNSEGIKFPIPSFLNLLDNPDGDRGLKVTLSDVRPPTPQA"
     CDS             complement(181406..182059)
                     /codon_start=1
                     /locus_tag="GLX_01550"
                     /product="hypothetical protein"
                     /protein_id="BAK82567.1"
                     /transl_table=11
                     /translation="MEHAPSTIHRIWTAFGLQLHRTETFKLSSNPFFVKKVRDIVGLY
                     VAPTEYALALCIDEKSQIQALDHSQHILQHFDARQCCSRCPAGRVLYPDKQAITGTVR
                     YNMRQPLLSRWKSSMSVANTLREAIEKKIVVGFTFNGKNYVGSPHALGESDGTAHVLI
                     YRGEDAHAKGIPPMGEWSTLPLSDMTDIKLLPGEAFHTGHPDTHAAKGLHKVDVRVA"
     CDS             complement(182120..182416)
                     /codon_start=1
                     /locus_tag="GLX_01560"
                     /product="transposase"
                     /protein_id="BAK82568.1"
                     /transl_table=11
                     /translation="MELTAVAIKLMVLKHQKLEALPRAHKTGQSFARRVRLVLAATNE
                     HENKAIRDLIGADINTVDKGCQRFVVDRLDGLYDEPRPGTPRLIGNEKIAETIH"
     CDS             complement(182467..183849)
                     /codon_start=1
                     /locus_tag="GLX_01570"
                     /product="manganese transporter"
                     /protein_id="BAK82569.1"
                     /transl_table=11
                     /translation="MIGLTDAMTPLGTPPTSARPAWRFANPADPERNSLPEVFASVRI
                     PGPGASWLRRFLAFVGPGYMVSVGYMDPGNWATDLQGGAQFGYTLLAVIMLSNFMAIL
                     LQALSARLGIATGRDLAQACRDHFPPALNIVLWLACELAIIACDLAEVIGTAVALQLL
                     FGLPLLAGTLISALDAFIVLLLMNRGFRYLEAFVIGLLTVIAVCFAVQVVAAQPPVAA
                     VLRGFLPSSAIITNSQMLYIAIGIIGATVMPHNLYLHSSIVQTRAYDRTMPGRREAIR
                     WATWDSTIALMLALFINAAILIVAAAAFHGNGHDGVAEIEDAYHLLSPVLGLGIASTL
                     FALALLAAGTNSTITGTLAGQIIMEGFLRLQIPHWARRMLTRGLAIVPVIIMIVFYGN
                     RGVGELLLASQVILSLQLPFAVIPLVIFVSDRHKMGAFTISRFMAMLSWLVALVIVLL
                     NLKLLYDTLF"
     CDS             complement(184198..184704)
                     /codon_start=1
                     /locus_tag="GLX_01580"
                     /note="fragment"
                     /product="transposase"
                     /protein_id="BAK82570.1"
                     /transl_table=11
                     /translation="MVRTSGLTIKRREPKKGASFEKRDHRETPGRSRGSYGTKVCVIA
                     DGHGKAFGFALAPGRLMNCLWHQSCLTAFPPLPCGSWRTGATRQTPFVNGYGTWEPGS
                     PFLRNDTMGRSPAPNESIGAGISLRTSGLASRDGALSQPDTKKQQRRSSRSSTSLPQQ
                     TGSSPNRP"
     CDS             185244..186602
                     /codon_start=1
                     /locus_tag="GLX_01590"
                     /product="hemolysin/magnesium/cobalt transporter HlyC"
                     /protein_id="BAK82571.1"
                     /transl_table=11
                     /translation="MSRDCFLGVVVILFFSGLIALVLLVALNIFISLSEISFAAARDV
                     RLRARAEAGDERATAFLRLRRNSGQVMTVLQICLNGVGVLGGMISSEMLAPSMADGLM
                     GWHLSRATAEMLASAFGFMLVTGMFVLFADLLPKRVAMNAPDKIALAVGWFPAAALRM
                     LYPIVWVFSKLSDATLRALKIPAASAVEPVTPEDLRAILAAGTASGVLLEQEHQMIQN
                     VLGLQDRSITSAMTPRDEIVFLDVQESMEVQKTKVRAKPYSRYPLCNGGLDTVIGSIR
                     AEDVLAAVVDPDPSGATNEGLPTGKAILRMRRDVLTVPETINLWDTLAQFDSHGVGFA
                     LVVNEYGLVVGLITFKDIMGALMGGLVNPFEEQLIVRRDANSWLIDGAASIGDVKREL
                     EALDLDENGPFDTIGGFVLHCLRRMARKADRVDTDGFRFEVVDVEGFRINQLLVTRLG
                     PQ"
     CDS             complement(187349..188299)
                     /codon_start=1
                     /gene="oxyR"
                     /locus_tag="GLX_01600"
                     /product="oxidative stress regulatory protein OxyR"
                     /protein_id="BAK82572.1"
                     /transl_table=11
                     /translation="MSSVHLSGLSLRDIEYVVAVDDLRNFSRAAERCGVSQGGLSEQV
                     RKLEALLGVVLFERSRRHVAPTPDGARLISMGRDVLTAARAMIEAARAQTGPLQGLLR
                     MGVIATLGPYYVPDLLPLLRRTYPELRLQLTDSLTGTMLDALRHDRLDMVFAALPVRG
                     EGFACAPLFDEPFVAAFPAGHPLARCGRLTMADLNGPDLLLLEDGHCLRDQALSLCGT
                     TSPQTQQRLATSLEMLWHMIGAGEGHSLIPRLALRHRGAWQDLITLTPLPGASRTIGL
                     VWRASDPRGAAFADFARFLRENVPDGCMPASTVPCGNDGT"
     CDS             188444..189007
                     /codon_start=1
                     /locus_tag="GLX_01610"
                     /product="peroxiredoxin"
                     /protein_id="BAK82573.1"
                     /transl_table=11
                     /translation="MARINSSLKPFETDAFHNGKFIKVSDADVKGKWSVFFFYPADFT
                     FVCPTELEDLADNYETFQKLGVEIYSVSTDKHFTHKAWHDTSPAISKIKYVMLGDPTG
                     HIARNFDVYIEEAGLADRGTFLIDPEGKIQYMEVTAGSIGRSAAELLDKIQAAQYVAS
                     HPGEVCPAKWKEGGATLTPSLDLVGKI"
     CDS             189085..190665
                     /codon_start=1
                     /locus_tag="GLX_01620"
                     /product="thioredoxin reductase"
                     /protein_id="BAK82574.1"
                     /transl_table=11
                     /translation="MLQDPIKAQLKGYLAGLAHPIVLEASLDDSAQSREMHELLHEVA
                     ALSDKVQVSEAGQATRRPSFVIKREGGRAGVTFAAIPMGHEFTSFVLALLQVGGHPPR
                     LSDDEIAQIKALPGPYHFETYVSLSCQNCPDVVQALNAMSVLNPNISNVTIDGALFQD
                     EVTAKNIMSVPQVYLNGAPFETGRADMEQLLAKLDADAPRRAAEKLKDIAPFDVLIIG
                     GGPAGASAAIYAARKGLRTGVVAERFGGQVMDTAGIENFISVPETDGPKLAAALEAHV
                     RAYDVEIISGQRAKELFPAALPGGLHSVALESGAILHARTVILATGAHWRHLGVPGEE
                     EYRNKGVAYCPHCDGPFYKGKRVAVAGGGNSGVEAAIDLAGIVAHVTLLQRGSYLKAD
                     KVLQDKLHSLPNVTVLTEALTTRIEGNGRNVTGLTYRGGDGADHHVDLEGVFVQIGLL
                     PNTDWLKTTLRLNDFGEIVVNDHRATSVPGVFAAGDATTTPYKQIVIAIGDGATAALS
                     AFDYLIRVPAPASRSVPA"
     CDS             190879..192270
                     /codon_start=1
                     /locus_tag="GLX_01630"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAK82575.1"
                     /transl_table=11
                     /translation="MAYKTVNPFTNETVATFPDLTDAELACKLDRAQETYREWSRLPF
                     ARRATVVGRAAELLRAHKNEYARYLTLEMGKLYRESLAEVELSADILQYYADNAEEFL
                     APQKLTEKSGRGDQAMVVSQPLGIVFAIEPWNFPYYQLARVVGPQFMAGNVVVVKHAS
                     NVPQSAAVFEQLFANAGAPEGLYTNLYATRDQLGAIIADDRVIGVALTGSEGAGAIVG
                     AQAGKALKKTTMELGGSDAFIVLDDADLEKSVKWAVWGRMNNGGQCCVAAKRIIVAEP
                     IADAFLDRFATELGKLVPGNPMDEKSGVPPLSSQAAADQLNEQVEQAVRHGAIAMRVG
                     PTPPNTGAFVQTTILTNVKPDNPVFHQELFGPVAMFFRVKDDDAAIQLANDNPYGLGG
                     SVFTSDTARGMRVAEQIETGMVYINHPTWTTSDLPFGGVKRSGFGRELSSMGIQEFVN
                     KKLIDVVPIDAAP"
     CDS             complement(192282..193817)
                     /codon_start=1
                     /locus_tag="GLX_01640"
                     /product="hypothetical protein"
                     /protein_id="BAK82576.1"
                     /transl_table=11
                     /translation="MTGGRVGVCISALIYCTSLPPAPALAVGQPAAPAAHHADMVMIG
                     DLERRTFQWFWDSADPRTGLVPDRAPSAQTFSSVASIGFGLTAYGIGVTRGYITRTQA
                     ITRTLTTLHYLLDGPQNDSADGAMGYRGFYYHFLNRATGLRYNHEIELSSIDTALLME
                     GVLFAQSFYDYHTPREAEIRDLADRLYRRVDWQWMKRPDNRLSMGWSPEHQFIPNYWE
                     GYSEGMMAYILGLAAPTHGLEPASWQAWLATNNQRWGNYYGQTFLNFAPLFGHQYSHA
                     WIDFRGVRDEWARGKQIDYFENSRRAVYAQRAYAMANPGKWQGYSATTWGLTACDGPG
                     EVTQKLDGRDRHFLSYSARGAGRDYTQDDGTIAPTAAAGSIAFAPEIVLPTLRDMKNH
                     YGQKIYGRYGFVDAFNPSFHSGQSYWTDSEYLGIDQGPILLMIENWRTGLVWNVMKRN
                     PYIRAGLERAGFEGGWLPAAPPAPAGGHDARTTQLAPLPATGGTASGQTGRRDGAASV
                     HPS"
     CDS             complement(193959..194783)
                     /codon_start=1
                     /locus_tag="GLX_01650"
                     /product="aromatic ring-opening dioxygenase catalytic
                     subunit"
                     /protein_id="BAK82577.1"
                     /transl_table=11
                     /translation="MAQQPATAAPHSIQPVMFLPHGGGPCFFMDWPDTWDHMAAHLRG
                     IAATLPCRPDGIVVVSGHWETGVPTVTSSPHPSLIYDYHGFPAHTYELRYPVPGSPTL
                     AAQVCHLLDKAGIPNAQDPTRGLDHGVFIPFLLAFPQADIPVVELSLQRDLLAGMELR
                     IGASLQPLRAQNVLIVGTGMTYHNLHHFMSSNPQFNTVSHDFDTWLTHAVEAQPDIRN
                     EALTHWTQAPGAHICHPRPEHLLPLVFAAGAAGQDRGVRDYSDTIMGKALSGFRFG"
     CDS             complement(194842..196092)
                     /codon_start=1
                     /locus_tag="GLX_01660"
                     /product="porin O/P phosphate-selective"
                     /protein_id="BAK82578.1"
                     /transl_table=11
                     /translation="MNTNLISPVTWRYQALSFRLRAGPAAAGLLACFYTTAQAQSVPA
                     LALHGVTIKPYATDQLDVGGFANAGPAHPGTGARAARLRNGVRIDIHKQVEIGAIWDF
                     GPAPAGPMRLFEGQVSYTGLRHFVFTAGIFKPSFGLESMAAQGDTVFVERSSISTITR
                     NLATGIEREAVQAESYGRRYHIAVSATAGTAGPGVDGNQRAMAFRVVGLPVRTRSLLL
                     HLGFSGEWIFHPASAHGAGPGLALSDNPELNPGTVSRYLNTGRIAVDAGGAFGVEGAL
                     SWRRLLVQAEGYDIMLHTRAPQYSHQPHFHGWYGMLAYTLNGRGRQWKGRSAAFSSPT
                     CNTAQTVMCNGYGVLEVAARYSQADLQSVGIQGGNQHTAALALNWWPTAIMRVTIQYE
                     YGQIRDGRIPEHFHGIMSLFQIKF"
     CDS             complement(196125..198056)
                     /codon_start=1
                     /locus_tag="GLX_01670"
                     /product="N-acyl-D-glutamate deacylase"
                     /protein_id="BAK82579.1"
                     /transl_table=11
                     /translation="MPDTIYRNAILFDGTGSTPVISDVAVSGGRISAIGPALEVEGEA
                     KEVDCTGLWLMPGLLDIHTHLDLELELSPELPEVVRHGTTTVVIGNCSIGVTYGNQRR
                     DGEDPIVDCFARVENMPKPVLAKVANTCTWSDSQGYLDHLGELALGANVVPLVPHSML
                     RIEVMGLQQSISRSPTRRERGRMELLLDAAMAQGYAGFSTDALPFHFLANDPHKKRKI
                     PTQYASYRELRQLTGVVRRYGRVWQATPPKDDIIEAMRAFLLTSGRLFGRPLKTTVLA
                     AIDLQTNRMAVRLCLMLSAILNSRLLEGIFRFQVLSGTFRVWSDGAINPLADEIPELC
                     ALNELELDDREGRARIMDDPQWIAAFRRMWMQGKTGWSLARLRRLLRQEETVLTRNLA
                     DMTVAECPLPQWNGENLQAPYDRLRRWQKSHGRRGAYDATEAAFFATFPNPVGDDASF
                     LLHLLRQWDTNLRWETTFANRNPATLASLLFNPQTLPGFNDSGAHLANIGFYDGNLRF
                     LKIAQQAGGMDTVANAVHRLTGLPAAFFNLNTGTIKVGAQADLCTIDPLALHAWEPEE
                     TYAFVHRAQFGCRQVINRPTGVVRHVMVGGKMAWTGTDYAPSFGQEALGRVMRAKDHP
                     LERAYSPPAPHTPGNGPQQ"
     CDS             198286..199206
                     /codon_start=1
                     /locus_tag="GLX_01680"
                     /product="Na+-dependent transporter"
                     /protein_id="BAK82580.1"
                     /transl_table=11
                     /translation="MPVLTRLFPLWAVLVSVAAVLWRAPFVALTPAITPLLAFIMFTM
                     GVTLRGSDFVRIARRPAPVLAGVVLHYLVMPLAAWVIAHLLHMPPMIMTGMVLVGCVS
                     SGTASNVMIYLSRGDVALSVSISTLSTLVGIVATPLLTRFYVSAGVSVDSWGLFCSIM
                     EIVALPVLGGVAVNTLCAPVIRRVEPALPLVAMVSIMAIIGSIVAGAAPALAAVGPLV
                     LVGVVLHNATGLLGGYWGGRLLGFDEAVCRTLALEVGMQNSGLAATLGRLYFSPLAAL
                     PGAVFSVWHNISGSALAALWAARPPRDQNV"
     CDS             complement(199233..199421)
                     /codon_start=1
                     /locus_tag="GLX_01690"
                     /product="hypothetical protein"
                     /protein_id="BAK82581.1"
                     /transl_table=11
                     /translation="MLTLLIIILLILAIGGGGYGFRSGWYGRPRGTGFNGLGLLPVVL
                     FIIVLFLLFYPPGTAPTP"
     CDS             199565..200581
                     /codon_start=1
                     /locus_tag="GLX_01700"
                     /product="hypothetical protein"
                     /protein_id="BAK82582.1"
                     /transl_table=11
                     /translation="MLVIPFSVLDLSLITRGHGPADAFRNTMDLARLAESLGCARYWL
                     AEHHGMPGIASAATAVLIGQVAAATRHIRVGAGGIMLPNHSPLVIAEQFGTLECLFPG
                     RIDLGLGRAPGSDPRTARALRRDPHAPERFAQDVEELLQYFEPAMDDTPHIVRAIPGA
                     GLRVPVWLLGSSLYSAVMAAQLGLPYAFASHFAPAQMEEAITLYRHRFIPSERCAKPH
                     VMLGINMVAADSAGEAAHLVTSLQQYFVALRRGRPIAFPPPVVDATGLWSGAEQAMLN
                     HALACTFAGTPTTIAHALGTFVQRYQPDELLLALPVHDHAQRRRALELAMALRLDLDM
                     PDRR"
     CDS             201142..201360
                     /codon_start=1
                     /locus_tag="GLX_01710"
                     /product="transposase"
                     /protein_id="BAK82583.1"
                     /transl_table=11
                     /translation="MGETRPSWTPSKNFLTLLNPHTGHLLRGKRIEIWLQDEARIGQK
                     NGVVRQEAKRATRQRYANACLFGAICPA"
     CDS             201422..201709
                     /codon_start=1
                     /locus_tag="GLX_01720"
                     /product="transposase"
                     /protein_id="BAK82584.1"
                     /transl_table=11
                     /translation="MGLRAVWPGELVPSFCLITRHGITTAKIRLSLNVGLIFLASRVP
                     AQNPVKNVWQFSSTPTGCINAACSAWNNLAAFPGTIRSIGRRKWCHKSQRR"
     CDS             complement(201853..202878)
                     /codon_start=1
                     /locus_tag="GLX_01730"
                     /product="pyruvate kinase"
                     /protein_id="BAK82585.1"
                     /transl_table=11
                     /translation="MELRSLPECSPPGIVATIGPVSANREMLLALDGAGMTMARLNGS
                     HNTSEWHRRTIRLIKETLPGIPVLLDIPGRKIRTIPLVHEPAFRTGDVIILTTDRQHD
                     GSIKIPVNFDQFHEFMMPGLEIHADDGHLSFTVEKVYGRDVHIRANVDGVLRSRKGVN
                     VPQARFERPLVTNHDREMMAFVQENDVDFVGISFVESAGHVAAIRDLITQERLGVVSK
                     LENQEGLDHMDEVIATSNMVMIDRGDLAVETSPELVCLFQKSILAAAQRQKTPVIVAT
                     ELLNTMIEHPYPTKAEISDITNAVLDGARFLMLSGETAIGSYPVEATSRLQRIGQAVS
                     TYIHQRS"
     CDS             complement(202856..203692)
                     /codon_start=1
                     /locus_tag="GLX_01740"
                     /product="sulfotransferase"
                     /protein_id="BAK82586.1"
                     /transl_table=11
                     /translation="MLSPLVHFMSGLPRSGSTLLAAILRQNPVVAEAGYISPVAPMIV
                     KLTSVMVEGEYQTEFDTKTRDRVLQGVLLNYYGKLSAPEGQQPMIIDNSRIWCTRLGL
                     ANALFPGSKVICCVRDPVWIIDSFERLIQKNPLLGSKIVPIERRGNLYSRIDYILAAD
                     GPFGFCWRAFNEAYHGDMAHNLIVVDYDRLVNDPAETMAILTDALQLPAWRYDFERVQ
                     FEEPVAFDQNLNSPGQHIVRERVGAIPRRLSIPPEISSRLAGGTFWRDPRKNPGGATI
                     IA"
     CDS             complement(203812..204525)
                     /codon_start=1
                     /locus_tag="GLX_01750"
                     /product="N-acylhomoserine lactone-dependent regulatory
                     protein"
                     /protein_id="BAK82587.1"
                     /transl_table=11
                     /translation="MIYLFENVIDLAAAMRQASEIDELNQSFRTLVARLGPFAHAAGT
                     IHKTRLGDRYLIDTTYPEQWLEHYVQNNYQKIDPVIDPVNHGLTPYDWNQVYIRNADQ
                     RKIMNEFRDIGFQSGHAIPLYLTPSMLLLVSVASPEKEIDFQTQALLQMIVGQYHTRY
                     CQLAKLLSHDDQPLVTEREQECLLWVAQGKDTIEIGSILSISDNTVKHHLKNLMQKLG
                     CHNRVQAVVRAIQLGLIHP"
     CDS             complement(206442..207188)
                     /codon_start=1
                     /locus_tag="GLX_01760"
                     /product="hypothetical protein"
                     /protein_id="BAK82588.1"
                     /transl_table=11
                     /translation="MLVCAWCQTAGLIQSVASGTRRSVFPMKSYRLALATTILLVGVS
                     TSAFASREERLMKMSEAEIQEKTMVVNQPWDQAIMIGQNRLPLKGSVDEGRAWLDAAI
                     LTKPSPLGKPGDALFYVGAGAWGKKAYTGSEFRDYAHMKYMDSTGPAFINVNQTNKNG
                     ECSETIVPHGGIVDGFLPRETIEMDCAHSVELLSPILRSTVEYIASLDHPWEFQFVAT
                     DGTAFTDIITPNEAKALLDRVDEEKAKMAK"
     CDS             complement(207586..208359)
                     /codon_start=1
                     /locus_tag="GLX_01770"
                     /product="CDP-diacylglycerol pyrophosphatase"
                     /protein_id="BAK82589.1"
                     /transl_table=11
                     /translation="MTRHRLSAIKSFSMPVAAAMVFWLAEVMAGHASENPDILWHIVH
                     ERCTIKPDEQGTVPCEETNVRAGYAVLKDHTGPAQYLLIPTQRVTGMEDPAIIKKDAP
                     DYFAYAWKQTERVNRHLAHPLPMDDMTLAINSAYGRTQNQLHIHVDCIRPDVKVALHW
                     ARPQLGTKWVALSLNGHGYRARLLPVLSGARPFQLLATDMADPASEMGQHTLVIAGMA
                     QADGRPGFVLLDDRIDLQHGDHASGEELQDHTCQIQNFP"
     CDS             complement(208386..210884)
                     /codon_start=1
                     /locus_tag="GLX_01780"
                     /product="TonB-dependent receptor"
                     /protein_id="BAK82590.1"
                     /transl_table=11
                     /translation="MGHACSNLVPIPEACVLEVILTVLLRVSMTSLLACSLLSGIGTN
                     DALARTLGNTATGKAKNLHPGKLATKTTTPMDGVAPVSAPEVIHVSSSHATGQREQPG
                     GGLLRVETAPKAIQTVSRDFISKQSPTTNVEQVLKMMPSANVNDQDPFGLQSGSMSVR
                     GLNQTEIGWTLDGMPMNDIGGGAFYANEVLEAEDLESVSLQPGSVNLDSPVISAAGGL
                     VSATMSNPTHKRGGLFDATFGSFGMKREFIRYNSGDIGNTGVRAMFSFGHTYADHWRG
                     PGHDEKFHYDLKVRKDFSNGSNTGITISYNDQINDSYLNPNYTQYNTTGYDTNYLSNY
                     AGVNSQGAQYYKLHANPFRNIIASAPTHIEVTPRFSIDDTAYFWFGQGNGTGASVLNA
                     NQTYYGDQKLSGVLPSDGSTLVLTPSNQEQIRSGNTLKFNYRLGSHHHITAGYWYEYA
                     NLEQFSPVGMVNQATGQPSNIWGTSGVYKMPNGQNYDYRNFLNLSQVNMLFVGDSMDY
                     FNKRLHIDVGFKEAMVTRRVYNDIPGTTYNRNLHSAEPLPQLGISWQFNKQHQIYIMG
                     ATNFKMPSNTSLVDQRNNTTGAISQMGGASNPEYSISEEIGYRYNGPLIIGSISFFNY
                     NFTNRQLTVDYYLNGASYSQSVNAGGQTSRGVDIQIGTRPLKYHLRPYASFEYLDARI
                     DNNLRAVGTYANGVQGTDYLATKGKTQVESPKVQAALGLDYDDGHFFAGAQIKYVGKQ
                     YSTMMNDNSIPQFITDNINFGYRFRTIGFMQTPKIQVNLSNLTNARFRSGVYTMQTNA
                     NATTGVNGSTIKGSSPAYYLQAPFTGVVTISTNF"
     CDS             212157..212516
                     /codon_start=1
                     /locus_tag="GLX_01790"
                     /product="transposase"
                     /protein_id="BAK82591.1"
                     /transl_table=11
                     /translation="MTQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLT
                     RQHLYQWRTSFRQRLSSPDQSVAFVPVASVTTPAVASGGDPDELAIVLRNGRSIRVTG
                     HPAEDLLARVIRIAETA"
     CDS             212513..212860
                     /codon_start=1
                     /locus_tag="GLX_01800"
                     /product="transposase"
                     /protein_id="BAK82592.1"
                     /transl_table=11
                     /translation="MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALF
                     AFRGRRGDRIKLLMWDGQGFCLYYKVLEKGRFPWPSPAEGVARLTTAQMAMLWEGMEW
                     RRPSWSAPPSRVA"
     CDS             212924..214534
                     /codon_start=1
                     /locus_tag="GLX_01810"
                     /product="transposase"
                     /protein_id="BAK82593.1"
                     /transl_table=11
                     /translation="MTSAPAVLPDDPDTLREMIVSLQTEVARLSASARAYEALVQSLK
                     IRIARLQKQKFGASSEKIDREIEQLELLLEDVKIAIAAADPSPDIREHDVSDDALSPP
                     RQRGKPKVSDTTPRERIVLDPGEACPACGGPLRLVGEDVTEILDFIAAKLKVVETARL
                     KKSCRHCETLVQPEAPSRPVPRGMAGTGLLAHILVSKFDDHIPLYRQNEIFARQGVDI
                     PRSTLIDWCGQAVAVLRPLTDLIRQDVVKADLLHADDTPIQVLDPRLRQAGKPRGVKE
                     GRIWSYLRDPRPWGGSDPPAVAYWFSPDRKGINPQTHLAQFRGILQADAYAGFRDLYK
                     PDATGTVHVREAACWAHLRRAFHDVWKGSDSTIAREALEQIGELYDIERQITGHPAPY
                     RLAVRQEQSRPRVTAFHAWCETQLARIPGKGELAKAIRYALNRWKAFTLFLEDGRVAI
                     DNNPAERAIRPVCVGRKNYLFAGSDTGGDNIADAMTLIESAKLSRLNPHDYLADVLAR
                     INEHKINRLHELLPWNWKPVNTLHRQAA"
     CDS             214959..215534
                     /codon_start=1
                     /locus_tag="GLX_01820"
                     /product="hypothetical protein"
                     /protein_id="BAK82594.1"
                     /transl_table=11
                     /translation="MTCSGSRQVSLLSVRRHHRDDRNSTFDRKQTHIMRRILHGSLYI
                     ACIFFLMVSPTWADSGTEGVCMTVQHGIRLHVDGMYGGYPHSVLRDAVLQGVACPSDE
                     AELHAFNLIAEPAPHLRISVTRPLGQGQQGSISARLFAKGRFVIGERMSLSPLARSQS
                     PFSVSSDINLMMARLWSDLASRISHDGPVIP"
     CDS             215546..216799
                     /codon_start=1
                     /locus_tag="GLX_01830"
                     /product="cobalt/zinc/cadmium resistance heavy metal
                     efflux pump protein"
                     /protein_id="BAK82595.1"
                     /transl_table=11
                     /translation="MKRVMRPILSVVMTGVLAWGALARAQVPRSGPSFHEAVGMAWAI
                     DPVRTELQVGHHSARARASAAGSWFAGGPTLSGEYMDDHMLGSNEGYTTYQGGVSVPL
                     WLPGQGSATQQVASAEAASLDEQLNVEHMALSIRVLDAGAAALIALTRVDVARALYDA
                     TARMATSTTRAVHGGELASVDGQMAQAAVENARNELALAQEEARNATAALEVLLGRPV
                     VPDLARYGAGDITHARFITPHDMEDNDPRIRVAHRNVEAAEANMKLARRSFMPNPEIG
                     VDAIHEKQYGSPWDDRVGLNFSIPLPSEVRNTPIMSEARNRLASATSQETQARRMVHL
                     EMMRVRERLIAATTTRQATRTATENMEKRAEAQERAWRLGEASLDTALAARQTAANTR
                     LASVRAEVEWHVASIRMLIATGIVP"
     CDS             216748..217947
                     /codon_start=1
                     /locus_tag="GLX_01840"
                     /product="major facilitator superfamily heavy
                     metal/cation efflux pump HlyD"
                     /protein_id="BAK82596.1"
                     /transl_table=11
                     /translation="MACRQHSHADRNRDRTMKRLTSALFILGLSCPPAHATDGALPPV
                     VKLDGAAVTNEGITIATAAPGTVAPALPVMSRVMPDTTRVVHIHPAGSGKVLAVLVQP
                     GTHVVRGQALLRYQDHSLHVARLQAVQMRAALTAAIAARSDAAAAVQRAKALAGESLS
                     MAELRRRQDALAQADATMRARQADVGTLGHRFAEEFNSSSEQGGQGTEDETSTLISPV
                     DGMVQAINTSVAGDVNPTMDVATVADLSRIWLVSDIPPDQAARIAPGGQQVTQAAGGP
                     FTSRIDTVDGMASPQTGLVQVISTVANPTGALVPGMVLDATLAQRDGVAGIVVPSEAI
                     QQIDGHSVVFVRVSETDYRPVVVDVALDDGTRAVLRSGLKGGEPVVGHGSFALRSVIG
                     LAGMDAD"
     CDS             217947..221021
                     /codon_start=1
                     /locus_tag="GLX_01850"
                     /product="RND superfamily multidrug efflux pump
                     acriflavin resistance protein"
                     /protein_id="BAK82597.1"
                     /transl_table=11
                     /translation="MARRYLETLLRARMLVLGGLFLLLAAGIMAVLGLPVEAVPDISP
                     KQVLVSVVAPGLATEEVEKLITFPVEASMTGIPGMTDLRSVSRGGVSVVYVQFADNTD
                     INLDRTRVNERMQQARSNISVPGITISMGPLATGMGEIMQFQIRGAGRSLMELNRIMN
                     WTVVPQMRLVPGVVDVNVNGGAEETYEVTLDPARLIGVNLSVGEVYRAVDENNAASGG
                     GWITHHAEQQSVVGRGLLGSLADFGNIAVRTNTDGSVLRLRDLGRITTGARTRLGAVT
                     RDGQGEIVIGVVMMESGASSNATLAAINHALPGIRQALPAGVTLEPYYTRATLTGQTI
                     ATVRDNLVMGAVLVVGVLVVVIGYWQAALVIASVIPVALVCAMAGMRQFGISANLLSL
                     GAIDFGMIVDGSLVVIEHILSRREEEPELEFTPLVVSSVQQVMRPVGFAILVIIMVYL
                     PILTLQGIEGHMFRPMAQTVIMALLASLAYCFICIPVLASLALGQVRPTGDTRLIAWL
                     RRPYTHMVTWGEAHPRTLFGGTIAVLVISAVLATRLGGEFIPQLDEGALAVTTTRLPS
                     ASLDTVLASVTKQEQILRSFPEVRTVVSNTGTSAIPTDPMGMNETDSFIFLNPSSTWK
                     TARTQAGLVAAMDDTLRRELPDALYSWSQPVQMRMDDLLSGVRTQIAVSIFGDDLTTL
                     AELGDRVVAAMSGVKGAADVAAAGDGTVPLIVADIDRTQAASRNVAVQDILDMVEAVG
                     GHIGTKPVIVDNAIISTQVRLDPKRVTSAAAIGALLVRRADGQGSVMLSQVAHVHEVD
                     GPPRISRDGVRRRMVVQANVRGRDLASYVAEAQARVMRDVKLPAGYTMQWDGQFRNLQ
                     SAVLRLEIVLPIALGLIFALLVVAFGAVRPALLVFINLPVAATGGIVALTLRGLPFSI
                     SAGIGFIALFGVAILNGVVLVSEIATLRVGGMAVAQAAFAAAESRFRPVMATALVASL
                     GFFPMAFSESAGAEVERPLASVVIGGLVTSTLLTLLVLPSLYARVMREKVRN"
     CDS             221021..221692
                     /codon_start=1
                     /locus_tag="GLX_01860"
                     /product="two component response regulator"
                     /protein_id="BAK82598.1"
                     /transl_table=11
                     /translation="MRILIVEDERDLGAAVQERVRLDGHAVDWFMTLEDARAAIATVD
                     YDFMLLDLGLPDGNGRSLLREIRSTSSDIAILITTAEDQISDRITGLSEGADDYIVKP
                     YDLNELVARIAAVARRYATPRRQVHYRIGEITIDRENRSVSRNGRVLDLTAREWAIME
                     LLSRSPGRIHSRQQIETALYALEHDVDSNTVEVFISRLRRKVGNAVIRTIRGRGYCLD
                     EKNGS"
     CDS             221689..223041
                     /codon_start=1
                     /locus_tag="GLX_01870"
                     /product="two component sensor histidine kinase"
                     /protein_id="BAK82599.1"
                     /transl_table=11
                     /translation="MKSWSLSTRIVSGVLLVVILGLLLLSTAVGGFTRYEVTERLDNS
                     LQEVSERLQAVVTARLHDQAAGSVALLPEVGPRTLAYQVMDGSGHVVLRSQNAPQDPF
                     VRDRQTGFANVPHFRVYMAAPITGKYRVIVGEPTFHRRETVRRAMLISIVPMLVFLPV
                     IWWLVRLIVRRALRPLDRLHDEMRARDSGNLQPIPPLDLPVELISIQSAVNTLLARLE
                     TALSTERAFAASAAHELRNPLGALLAQVQMLGRMVPESSDAGRRVDVIAGRTRQLGRT
                     VEKLLQFSRASSGVAFRRDRFDLLAVVHVLVDDLGHNPRDGRSLVLTTNGIGHVFVHG
                     DMDATGILMRNLLENALLHGNSGIPVQVVVRPDGSIDIANDCTALTPDTLSRLTSPFV
                     RGSTAAHGSGLGLAIASNIASQMDAGMQLRSPLVGSTRGLGVSLYFPNPEIVTIPDDT
                     "
     CDS             223090..223659
                     /codon_start=1
                     /locus_tag="GLX_01880"
                     /product="cytochrome B561"
                     /protein_id="BAK82600.1"
                     /transl_table=11
                     /translation="MSHRPSFQALRYDKPTILFHWVCAFIIILQFASANVWGLFRNPL
                     HHQLVVTHLTAGMMLSVLFPIRLMWRIGWGRHIQAADRWLDCVMARSVEYSLYGLVTL
                     EIALGYLWRWGNGQPMSFFALQLMPPFEKFSASTISLLHQLHQWNGWLIIFLATGHAL
                     AACFHYFILRDSIFQRMLMTGNASDEYGK"
     CDS             223649..224356
                     /codon_start=1
                     /locus_tag="GLX_01890"
                     /product="nodulin-related integral membrane protein"
                     /protein_id="BAK82601.1"
                     /transl_table=11
                     /translation="MANNTSVRPKEIHATSRLGWLRAAVLGANDGILSTSSLIIGVAS
                     ANATQASILLAGISSLVAGAMSMAAGEYVSVSSQADSEKADLAREKKELGCSWDAEVS
                     ELAGIYRQRGLDDILARKVALQLMKHDALGAHARDELGISEATAARPVQAAFASAGAF
                     SSGAILPVLAALLSPAGVVSWAVSAVSLTGLAVLGFVGARAGGASPWRPAIRVIFWGI
                     MAMVVTAAIGRIFGVRA"
     CDS             224911..225123
                     /codon_start=1
                     /locus_tag="GLX_01900"
                     /product="hypothetical protein"
                     /protein_id="BAK82602.1"
                     /transl_table=11
                     /translation="MDAFKKNFLTILKSCTGHLPRGKRIEIWFQDEARSGQKNGVVRQ
                     GAKRGARQHYAQRLAFRGNLEGSKNR"
     CDS             complement(225234..226313)
                     /codon_start=1
                     /locus_tag="GLX_01910"
                     /product="transposase"
                     /protein_id="BAK82603.1"
                     /transl_table=11
                     /translation="MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEVFRPDLDRALA
                     YADGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLALSDRVPD
                     AKTVWLFRERLTEAGAIQKLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEK
                     VDLREGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPSTDLAIPFFGYKSH
                     ISIDRKFRLIRKWKATDAAASDGARLREGLLDKTNTASSVWADTAYRSKANEDFMDKE
                     GFVSKVHRKKPHLKPMPRHIQRSNAGKSVIRSRVEHVFADQKSQTGLFVRTVGITRAT
                     MRIGLANIVYNMRRFLFLERLNAAA"
     CDS             complement(226291..226806)
                     /codon_start=1
                     /locus_tag="GLX_01920"
                     /product="hypothetical protein"
                     /protein_id="BAK82604.1"
                     /transl_table=11
                     /translation="MTINSGSEAEVTDYEALYRRIRRRYEREREVRMEAERIAEDGLS
                     QLYARNRQQTLMEAVAAQANSGQSVEDIVRFAFSQACEMGPWCMALAWLPDSKGSDRV
                     FRLASHLSGHENAAAGRALPIGSDDALLPSICSRLQMEGSKNPWFWPSVCDSLSSVMI
                     EGMAHEAAGLL"
     CDS             complement(226803..227333)
                     /codon_start=1
                     /locus_tag="GLX_01930"
                     /product="hypothetical protein"
                     /protein_id="BAK82605.1"
                     /transl_table=11
                     /translation="MKGIVFNILEEVVENNHGVEAWDTLLEAANVSGVYTSLGSYPDA
                     EMQALIVTASKHLGITPAELLHSFGRDAMPILKKRYPELFNTHPNSRSFILSVNSIIH
                     PEVRKLYPGAMCPYFHMKENDDGTLDMTYSSERHLIDLAQGFVLGAADVFGDKVEVER
                     FPPGSDKKNMLRVKWL"
     CDS             227759..228124
                     /codon_start=1
                     /locus_tag="GLX_01940"
                     /product="transposase"
                     /protein_id="BAK82606.1"
                     /transl_table=11
                     /translation="MRRYGLRDDQWERIKDILPGREGHVDGTPADNRLFVEAVLYRYR
                     AGIPWRDLPARFGDWKNIHRRLHRWCESGGIERIFCHLPADHDNEYMMINSIIVRAYE
                     HSVGVLKKRGLTDQAIGCL"
     CDS             complement(228430..228939)
                     /codon_start=1
                     /locus_tag="GLX_01950"
                     /product="transposase"
                     /protein_id="BAK82607.1"
                     /transl_table=11
                     /translation="MIALLHAEQKALTEPARKLFQEIVAHMRVLEQQIDDIEKQIVAA
                     VPDASTFRSGRQCAAWLGLTPKSHSSDSKERQVGISKDGDSYLVLEAMAVIRLARKES
                     AGQQWATKLLEKKAARVVSVALANKTARIVWAVLTTDNEYSRPECLIEYRDLPSSTDR
                     NDEGESAEW"
     CDS             complement(229180..230520)
                     /codon_start=1
                     /locus_tag="GLX_01960"
                     /product="major facilitator superfamily sugar transporter"
                     /protein_id="BAK82608.1"
                     /transl_table=11
                     /translation="MSSIITEVSLREKIAYGCGDLSSNLMWGMTSSYLMFYYTDIYGL
                     PVVAVGWILLAARIFDAFCDPAIGYIIDRKGGHIVPRLIRNLAVVFGLLGCLCFLPAP
                     FSSQGKILWAMLTYTAFGAIYSCINTPYGALGTMMTRSARDQVDLNAFRMMGCQGGQF
                     IVSLLTIPAITWLGGGASMLQRQHGMALYAMMLALTATLLWRYVGRVCITRYPPPPVR
                     HSPMAMLHTLTRNRSWWICNALVFLQFSGLAALYGFALYYAHIILRGSDELGSILLTV
                     ATIAGFTGAVICPHGVRLLGVVGTALTCLVTQVAAYILLVLAGSSIPFFFGAFVTLTL
                     AQGIASPLYYVLLTHAIDRGRQASPPNTAGVAYSINTLITKISMGITGFILAGFLSYG
                     HYAVGVSTYPAELQHWVMAGFVWLPMGAAALQLVFLALWPRGVVPRPKTACSLS"
     CDS             complement(230548..232239)
                     /codon_start=1
                     /locus_tag="GLX_01970"
                     /product="sorbitol dehydrogenase large subunit"
                     /protein_id="BAK82609.1"
                     /transl_table=11
                     /translation="MLLLHQEWNMTETRYDVIVVGSGAAGGIAAKTLTDEGLSVLVIE
                     AGRTLSDSDLKPPRGGKNDNIQLFPRIRATLSGQHIQSRVAFFRETLKHLFVNDRQHG
                     YTTPKDAPFLWIRGRQTGGRLHTFGRVLFRWSDHDFRGASKGDGGVDWPFSYADLAPW
                     YDRVETFLGIHGTRDGIETAPDGIMAQSTPLTPEERSFRTAVETRWPDRHVVPWRINP
                     HNGSPLSSALRAAMAGGRLTVRPDTVVCEVLTDPASGRVTGVSHADRTTGERGVSQAR
                     AVVVCASPIESIRLLLNSRSRLHPKGLGNSSSLLGHYFMDQCPSLMFGRWPTSCREGK
                     DEPLPTHTLFGTTGGLYVPRYENACEAHDPAFMRGYTFQGSIGRHPSEPGKDMPVTIM
                     GFGEMLPYHDNAITLDPQRRDRWGVPLPHIRCVPHANERAMLHRQIRDCADMIEACGG
                     QVDFWASPLGLREKGAGLYPDKPFPIRWFIRTMFPRSLTMGAAIHESGGARMGNDPAT
                     SVLNPFCQSWDVPNLFVTDASCFPTGGALGTTLTVMAVSMRACHHLAGALRAGRL"
     CDS             complement(232255..233352)
                     /codon_start=1
                     /locus_tag="GLX_01980"
                     /product="oxidoreductase"
                     /protein_id="BAK82610.1"
                     /transl_table=11
                     /translation="MKTWPVGMIGGAPGAFMGDVHRRALALSGQFSLVAGCLSRHPQQ
                     ALAAGRALGLAPERTYADWAQMARAEAARPDGIALAIIVTPNDTHLPVAAAFLAAGIP
                     VLCEKPLALTLEQAQHFASRFTAKANDMVMAYTYSGYAMVREARRLVQAGALGAIRNI
                     QVEYLQDWLGNADSNGGWRLDPQTGGAGGCLGDIGTHAFHLAEFVSGLQCQSLSARVS
                     RLVPGRAVPDDAQLQLRFSHAAIGSLWVSQVATGCGNGLRLRLYGEKAGLEWKQEQPD
                     TLALSTMDGRTTHTARGGSAVLTPSFLPRGHPEGYLEAFARLYSDTARLLGGLDAPLL
                     PRLAAGVRGLGFVEAALQSGARDGAWTMLRT"
     CDS             complement(233349..234413)
                     /codon_start=1
                     /locus_tag="GLX_01990"
                     /product="xylose isomerase domain protein"
                     /protein_id="BAK82611.1"
                     /transl_table=11
                     /translation="MKGPGLFVAQFIGAQAPFNTLSGLARWAGGLGYRALQLPTHLDH
                     IFNLAQAASSQDYCDAVRGTLAEHGLVISELSTHIQGQCVAVHPAYDLLFNRFAPLSV
                     RDCASSRTQWAVTQLGLAAQASARLGLKAHATFSGALAWPYLYPWPPRDNGLIDLAFS
                     ELAARWQPIVTAFEAVGVDLCFELHPGEDLHDGTSFERFAGLLGNPPRCAILYDPSHM
                     LLQQMDYLSFIDLYHDRIGAFHVKDAEFHPTGRQGVYGGFADWRDRAGRFRSPGDGHI
                     DFNGVFSRLTQYGYEGWAVLEWECCLKSATQGAREGASFIQRHMIEMTQQSFDDFAAS
                     PLSTQERQHCLGLSGTDNIP"
     CDS             complement(234410..235345)
                     /codon_start=1
                     /locus_tag="GLX_02000"
                     /product="xylose isomerase domain protein"
                     /protein_id="BAK82612.1"
                     /transl_table=11
                     /translation="MKIGTDLVTFYNPAFWRLTTQADITNLARADGRAFWTRILDSLH
                     EAGITGIEMTFPPFDQMGAVAAFGSEASLKHELGIRGLEVWSCFFAALDRMPAGHYAS
                     TESQILTEVDAAARFLCAMGGSVLVVGLPCRQTFLSTPSAFIDLAFAAPLCGLLNRMG
                     FAAARHSITLAIHTESHTVACAPRDVDLFMLLTDPRYVSLCPDPAHIILEGGDPVALI
                     TRHRERVVAMHWKDATRAMPVDTPIDTDIHTRHRAFFCELGDGRANFGQLAAQLGHAP
                     LRCGPILELDACAQPVPVLRRGIAFIRDLTERRTP"
     CDS             complement(235402..236478)
                     /codon_start=1
                     /locus_tag="GLX_02010"
                     /product="transcriptional regulator LacI family"
                     /protein_id="BAK82613.1"
                     /transl_table=11
                     /translation="MAKRVTLADLAEQTGLNISTVSRALSRPDRVSSETRRLVEKVAS
                     QLGYATNIAARNLSRGTSDTILVLASSFKGQAISPVFTQLLLGVCEEAKSQGLNVMLQ
                     QCLEQTISARDIIRYLQTGVADSALLVAAEQWLPPTDSETGEKILPIVSIFKDLTAAG
                     LTSVMTQETDGYTAIVDHLLARGHRQFAFVSGPEDIMHEQIRYRAVKQRLSAQGLDNA
                     LIRLKGGPFDMPSGQKAGQAFVALENRPSAVICCSDALALGFMHAVMESGLRVPQDVA
                     IAGFDGMDYTAFTTPSLTTVIQPAVELGRVAVQLLGDLHNGKITVPRLVALAPTFMAR
                     QSTCPPAKTDGKRLHSCFIAVCRD"
     CDS             236499..236714
                     /codon_start=1
                     /locus_tag="GLX_02020"
                     /product="hypothetical protein"
                     /protein_id="BAK82614.1"
                     /transl_table=11
                     /translation="MFNARCWAVKFSGRGAGSARVPEVDRIWCLRPDVERQNVDVPPK
                     SVEGRQCGTAIDPYHNARSVLALPSGI"
     CDS             236904..239054
                     /codon_start=1
                     /locus_tag="GLX_02030"
                     /product="phosphatase IIIC"
                     /protein_id="BAK82615.1"
                     /transl_table=11
                     /translation="MKFFTALRMVMNNQIAFIRARLQTGEWTFGLGAGKPLTTIMRFA
                     ADGCIQGYEHPNEARWDIMHDGLVIYNSKAIPMWKQVRTADDETIILQAVADPGVHFS
                     LRPTIQHNVPLSPARFLFPTDLSMTPAGITRVLLVGSCLTALYYEQFSRLYPDVHFDY
                     IPFNYAGSLPDCPPMGVETYNFQYIQIPLRSILTDRVIWAMRLGTPGFLDQVLEDGYG
                     IMDTMLDSALGYNKVHGLLTFVANFSVPQMNIVLSLAERHGAGDLSQVVRELNAYLAR
                     SIRKYNNVVLCDVDALGNSLGKQYFLDDMIYFYSHGASFFQEEWDRAPHNRIEAVPAL
                     DTFYESHQSALLAAVYEQAVSTYRTVRQVDQVKAVIFDLDNTLWRGQIAEDYRPDRQP
                     WPRTDGWPLGIWEAIHHLRARGILVAICSKNDMALVRERWESVVQPGFLSLDDFAAIR
                     INWQPKPENIHEICSLFNIKPKNVVFVDDNPVERESVRAALPGIRVIGSNPYLVRRIL
                     LWSAETQILHLTDESSRREVMVKGQIAREQVRSSITRTEFLGSLGTEVMISRIANGED
                     RHLGRVLELTNKTNQFNTTGVRWTNEKVTQFLFSGGLIFTFSVKDKFADYGLVGVVYV
                     QGNTIIQFLMSCRVMGMDIEYFVVDEIVKKIRSASKCKAVNAVMMKTKDNMPCQKLYK
                     SAGFDVVKNEKMDSILFSIKENENCISPSHITLK"
     CDS             239133..240872
                     /codon_start=1
                     /locus_tag="GLX_02040"
                     /product="hypothetical protein"
                     /protein_id="BAK82616.1"
                     /transl_table=11
                     /translation="MQEPKKEQALLLKTPYEVRSNIEHFFSSYDVIEIADLAEASEYP
                     QARILLCALELTHAADIDTASDFVARVCTRFPMVVFIEPSSDGRAYLAGLGYKSFHEN
                     YRENRMFGQINVGFFRKIGHSCGLYHIEHFGIEPTFDVRAWWIVPQTWLHDVDYRELA
                     ARPNHVFDETIFNMSAFVVRGFDAPKVSLGSDLELIESRLVQPHARAGGFLLDDFRHA
                     HDLGTQLYATPEDAISLLGGREIHAAVLLDSGATVHNETQAGIQMQWRGMSAPQWLDL
                     SVHELPDCVVGGSGFIFSGRKPVFGSDYLIPYIQTSLHQSVWEGMQKQHHEHVVPGIS
                     IMGFNHLYGNYYHFMAEAFNAVSLCLDILDGEDGEGTVSILTGTLDPLRRSYFNILLQ
                     GRHNVRLVEIARNEYVRTDRTLYCSRLLGRALPQPGLVAERVAFQKTLLEKTGLREIG
                     RTDRLVYISRQDTKARRILNEDALIDRLRSLGFEILVATGTSLADQIRIFREARLVVA
                     GHGAGVSNMLFAREGTALLELIQASYLNVGPMRLAQIAGCRYYSMLFFEDGPHNGWYV
                     DIDRVEWAIRQLL"
     CDS             complement(241148..241909)
                     /codon_start=1
                     /locus_tag="GLX_02050"
                     /product="transposase"
                     /protein_id="BAK82617.1"
                     /transl_table=11
                     /translation="MELETREYTAQTGRIIKAAQSGRLRNAGYLPMSGQILDATLVAA
                     PKQRNTNAEKVDLREGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPSTDL
                     AIPFFGYKSHISIDRKFRLIRKWKATDAAASDGARLREGLLDKTNTASSVWADTAYRS
                     KANEDFMDKEGFVSKVHRKKPHLKPMPRHIQRSNAGKSVIRSRVEHVFADQKSQTGLF
                     VRTVGITRATMRIGLANIVYNMRRFLFLERLNAAA"
     CDS             complement(241864..243474)
                     /codon_start=1
                     /locus_tag="GLX_02060"
                     /product="transposase"
                     /protein_id="BAK82618.1"
                     /transl_table=11
                     /translation="MTSAPAVLPDDPDTLREMIVSLQTEVARLSASARAYEALVQSLK
                     IRIARLQKQKFGASSEKIDREIEQLELLLEDVKIAIAAADPSPDIREHDVSDDALSPP
                     RQRGKPKVSDTTPRERIVLDPGEACPACGGPLRLVGEDVTEILDFIAAKLKVVETARL
                     KKSCRHCETLVQPEAPSRPVPRGMAGTGLLAHILVSKFDDHIPLYRQNEIFARQGVDI
                     PRSTLIDWCGQAVAVLRPLTDLIRQDVVKADLLHADDTPIQVLDPRLRQAGKPRGVKE
                     GRIWSYLRDPRPWGGSDPPAVAYWFSPDRKGINPQTHLAQFRGILQADAYAGFRDLYK
                     PDATGTVHVREAACWAHLRRAFHDVWKGSDSTIAREALEQIGELYDIERQITGHPAPY
                     RLAVRQEQSRPRVTAFHAWCETQLARIPGKGELAKAIRYALNRWKAFTLFLEDGRVAI
                     DNNPAERAIRPVCVGRKNYLFAGSDTGGDNIADAMTLIESAKLSRLNPHDYLADVLAR
                     INEHKINRLHELLPWNWKPVNTLHRQAA"
     CDS             complement(243538..243885)
                     /codon_start=1
                     /locus_tag="GLX_02070"
                     /product="transposase"
                     /protein_id="BAK82619.1"
                     /transl_table=11
                     /translation="MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALF
                     AFRGRRGDRIKLLMWDGQGFCLYYKVLEKGRFPWPSPAEGVARLTTAQMAMLWEGMEW
                     RRPSWSAPPSRVA"
     CDS             complement(243882..244241)
                     /codon_start=1
                     /locus_tag="GLX_02080"
                     /product="transposase"
                     /protein_id="BAK82620.1"
                     /transl_table=11
                     /translation="MTQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLT
                     RQHLYQWRTSFRQRLSSPDQSVAFVPVASVTTPAVASGGDPDELAIVLRNGRSIRVTG
                     HPAEDLLARVIRIAETA"
     CDS             complement(244318..244749)
                     /codon_start=1
                     /locus_tag="GLX_02090"
                     /product="transposase"
                     /protein_id="BAK82621.1"
                     /transl_table=11
                     /translation="MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEVFRPDLDRALA
                     YADGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLALSDRVPD
                     AKTVWLFRERLTEAGAIQKLFERFDATLRNAVTGRLRPPYD"
     CDS             complement(244899..245738)
                     /codon_start=1
                     /locus_tag="GLX_02100"
                     /product="major facilitator superfamily glycerol uptake
                     transporter"
                     /protein_id="BAK82622.1"
                     /transl_table=11
                     /translation="MNRAFLGELISEALAVFIIIAFGDAVAAMYLLYDPSPYLQSYWG
                     VCIVWGLGVTVAIYATGSVSGTHANPAVTLALATYRAFPWKKVLPYWGAQVVGGFVGA
                     GLVYALYYPVINHFNDVHQLTRTGGGGAGVFFTAPAPGISIWHAFSDEIILTAILVFG
                     IFAITEQYNEMAPGANFGALIIGFLVAAIGASMGYLEAWAINPARDLGPRLFAYVAGW
                     HEAALPAAGHYWWVPVVGPLIGGLLGATAYEHLIFPFLPAQLRAQKALQSKIEEESII
                     IGE"
     CDS             complement(245777..247276)
                     /codon_start=1
                     /locus_tag="GLX_02110"
                     /product="glycerol kinase"
                     /protein_id="BAK82623.1"
                     /transl_table=11
                     /translation="MAEYVGAIDQGTTSSRFMIFDRKGTVVSVAQKEHRQIYPQPGWV
                     EHDPIEILENTNEMIGAAMARANLGATSLVSVGITNQRETAVLWDRTTGLPLHNAIVW
                     QDTRVDQLVREYGSDGGQDRFRAITGLPLASYFAGLKLRWLLDNVEGARQKAESGQAL
                     FGTVDSWLSWNLTGGVNGGIHITDVTNASRTQLMNLRTCAWDEDMLRAFSIPAACLPR
                     IVPSSQVYGTITIPSLQGTKLAGILGDQQAALVGQTCFSPGEAKNTYGTGSFLLMNTG
                     TDPVQSKAGLLTTVAYQFGMEEPRYALEGSIAITGALVQWLRDNLKLFDLATQIEPLA
                     RSVADNGGIYIVPAFSGLYAPYWKENARGTIVGLTRYVTRAHFARATLEATAYQVRDV
                     VAAMEEDSGIVLTSLKTDGGMVANELLMQFQADILNVPVVRPKVVETTALGAAYAAGL
                     AVGYWENIDDLRANWVVDHTWQPTMPAEQRSRYLGWWKKAVQKSFDWAE"
     CDS             complement(247350..248849)
                     /codon_start=1
                     /locus_tag="GLX_02120"
                     /product="porin B carbohydrate-selective"
                     /protein_id="BAK82624.1"
                     /transl_table=11
                     /translation="MCVIKTCAKNENKSAIKWNIIPACIRSLVITLGMLFAGCTLTSA
                     VLAQTETAKTAFTTHYEPAAFPMTEMGQVAIGPLVPMLTASPHLFGTWGGIQPWLANR
                     GIFFNVTINEEYMGNVTGGKQRANVLAGQVAGALDIDWQRLAGVPSFWTHMLVINGHG
                     NSLSNAMGDSITNPEEIYGARGNVVAHLVDMYADKGFLRDRIILSVGVIPTGSFFNQD
                     YLACSFMNVSVCGNPAPSKYVPGGRDWPSGNLGAILRVRPTLRTYIMGGIFAVSPHAY
                     NGGISGWALGQDGLGKLSSQVEIGWSPSFGRHHLLGHYKIGYWYDNSRYPNLYADING
                     NSFQATGLPRRYESGMNAAWLMFNQMIHRSGDGLANGLIVIGGVDYTQGSQVAMRDHE
                     WIGLLQSGTPWGRPLDQIGAMFQYMEMGHTVALQQESSLALGLPYLPNQWGAVYGIQS
                     HENVWEAFYSIHVARGTAFQPDFQYLQRPGGTTTFHDAAVIGFQFTTNL"
     CDS             complement(249201..249749)
                     /codon_start=1
                     /locus_tag="GLX_02130"
                     /product="hypothetical protein"
                     /protein_id="BAK82625.1"
                     /transl_table=11
                     /translation="MLPPTDTDTARKAVPCISDGDMKMPVQDTMQQTGTPYVGEELRQ
                     KLIGTWELVSYKVEEKESGTFIPAMGPAPRGRVVFTADGWVAFNLEGSHRHPAKNDEE
                     RARLMKTLVAYIGRFRVEGNQWITHVQTAWAPEWVGTEQRRTVVVEDGHANVLTPWRR
                     MPNWAEGRLSRSIIRFRRAPAA"
     CDS             249849..250769
                     /codon_start=1
                     /locus_tag="GLX_02140"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82626.1"
                     /transl_table=11
                     /translation="MSYNEVGDLRFFSTLVDSGSLTAAARSLGTSPAAVSRRLARIEA
                     RLGSMLVIRNTRHFGLSETGRLYYERGLAIVADIDHLEEEISSSTRAPKGTLAIGAPV
                     ELGRRQIAPFIAAFSARHPGLNINLALASEGVYDVSDSLDVVLRLGLPDTPGAVVTRL
                     ASTMRVLCASPDYIRRRSLPGHPRELVRHDCLCLRRNKTMALLNRWAIGNDTETEVVT
                     VEPRLSTTNAEIIHDWALSGQGIAYKLLCDVYQDLEEGKLVRIFPDLQGEKIDLYAVL
                     PSRQHTRASIRAFMNELRPYIRTAGFMVQG"
     CDS             251283..252173
                     /codon_start=1
                     /locus_tag="GLX_02150"
                     /product="hypothetical protein"
                     /protein_id="BAK82627.1"
                     /transl_table=11
                     /translation="MRLRERSVWLYAMLSLTITSAVSDLAPRAQASDVTLGIIGPHEY
                     DLPVDFKPFNVLVQYGDGNAAGHSYNSLGQRKPMGGSHTWSGMTKYVHFRSFEAIPHV
                     GFAFELIQSESYSLADGTNYGGLGPTIVGPAAWFKPNKHSTFGIQTFMQTAVGTRDAT
                     SPNYWSNISSFIFDYEWKHFSFDGDAGTVAGAAKHVKGGHTYSPGVVFYTNLRFSWKA
                     THLFEPFFALDWQNVKGTYDRTAGQYLDDSNSREITLGAGAMFNISQHLSFTTRYSHS
                     VDGRNIPESNAYYVKFVYLW"
     CDS             252851..253234
                     /codon_start=1
                     /locus_tag="GLX_02160"
                     /product="transcriptional regulator"
                     /protein_id="BAK82628.1"
                     /transl_table=11
                     /translation="MLDTLQQSGCRIAEQLFREYHEDERILISWASGRLLCPPVAING
                     EGEVIGATHGTRIMIGWTADVLRTYPNLLDRLATENRVGFRRAEENVIRAALALAHEN
                     MTATVRNLGIGQAILYRKIKALGLR"
     CDS             253349..254299
                     /codon_start=1
                     /locus_tag="GLX_02170"
                     /product="drug/metabolite transporter integral membrane
                     protein"
                     /protein_id="BAK82629.1"
                     /transl_table=11
                     /translation="MSQMKFAFLTSGMMLAFAAYSSFSVSDAYSKLLAGQLDPFEVAF
                     SGGVFGFLIIPFIRRPSESYLDIFAPQHPGMWVVRAVATFAATAASVEAFMLLPMPEA
                     LSLMFLMPLFVTILSVTLLREKVSGWAWLSVILGFVGVLIVLRPGMRALHLGHLCALI
                     AAIANAVGVIAYRLAGNDTPRLSLFGSSLFGPLIGDGALMFAHAHWPHGVRTWMFLFG
                     YGFLAALGQLLMMMATARAPANRVALPQYSQMLWAVAFSYFLFHQPLDSWTCVGIVVV
                     TLSGMLNWIRQHIHYERLALKARHEARLRLRGLHRNETIR"
     CDS             254833..257379
                     /codon_start=1
                     /locus_tag="GLX_02180"
                     /product="TonB-dependent receptor"
                     /protein_id="BAK82630.1"
                     /transl_table=11
                     /translation="MIRYFFHNEMNRSVVGKSSVKLAFLCSSLWVSSAFAQGTTMSLS
                     AGGKAQNVPASTGTADTADVNLDNRPTMIGQTAPTDEKMLVLGHHYSDGVTRRAIGGG
                     LMVKEDAPKSKSTITRDYIEKQTPGLNPMQLIALLPGVNATDSDPMGLTGGHTSVRGM
                     NENSMGYTLEGFPLNDIGSYAVYPQEIVDSENLSSIQVAQGSADLDSPTVSASGGVVN
                     MYLIDPTEKMGGRADFSYGSYNAVRGFARFDTGLMGNSGTRAYFSFSDTHEEMWRGPG
                     DESKLHGEMKVVKEWGKGNRMSLVVVGNQLNNYSQPSVSMASWNKYGIGVPGAIDGSP
                     SGTPANTVYNSVMTGNPKIDQYYYKNRINPFTNIYISAPSHFNLGSHLSLTETPYFWY
                     GYGNGGGAYSENMTRMSYGSQTMSGTINGQSAGNTNVVLYNPSITRTYRPGAVTKLTW
                     TAGINRLMVGYWFEYSYQRQTSPYSALNADGTPVNEYGDGANLILANGQVAQYRDTLT
                     RTIINTPFIGDSISLFHNRLTIDAGLKYSIITRDGRNYLPDTSTGTVINQTYREALPT
                     MAFRYKVDSKNQLFFSVATNYRVPMNSSLYDSGAYYAGSGYSNHAATGLKPEVSISEE
                     FGWRYQGKLINTSLTYFHYNFTNRLFTQTIVDPHNMGDYYTTSINGGGETTNGVDFEI
                     GTRPIYNIRPYFSAEYIDARNDSNLAAQTRGVSALLPTKGKFAPQTPRYQFGLGLDYD
                     NGGIFGNFSLKYVAKQYSTFMNDEAVPSYVRMNIGVGYRFKSWGLFKSPTIKLNLSNI
                     TNNHYLNYASGIETNAQTAIAMNGKSVKGYVPTYGIASPFSAIFSMSSGF"
     CDS             257717..258979
                     /codon_start=1
                     /locus_tag="GLX_02190"
                     /product="phospholipase D family protein"
                     /protein_id="BAK82631.1"
                     /transl_table=11
                     /translation="MISQKISRPLGYIATVILACSATGTACASEKEKNFQIVESIPEQ
                     TQYGQVGIPRTKDVWLDMIHNAQHSIDAAVFYITDKPGHGISDVLDSLVERARAGIQI
                     RIVVEQSFLKETAPVLEKLKDVPNITTAILPGHKLTGGILHAKYMVVDNRTVFVGSQN
                     WDWRALEHIHEIGARIDNEPIARDFETDFNMLWMLAQGAALPAVQTKFAGTPDFVPVT
                     QDNPVILSDGEEPLIAFPAFSPAVMMPAALTTEQRALVDMIHAARKNFRLQVLTMSAI
                     NHYGAPGYWPVLDTALRDAAARGVETQIIVSDWALSEPMQSYLKSLSVLPHVTVKFST
                     VPAIKGNPVPYARVEHCKYAVADDNAVYIGTGNWEPSYFTTSVNAAIFVHGASPARDL
                     NAIFMRDWTGPYVTQLESGKTYAMPHRD"
     CDS             complement(259123..259917)
                     /codon_start=1
                     /locus_tag="GLX_02200"
                     /product="linocin M18 bacteriocin protein"
                     /protein_id="BAK82632.1"
                     /transl_table=11
                     /translation="MNNLHRHLAPISSAAWTEIEEEAARTIRRHLAGRRTVDTSEPKG
                     AAYAGIGSGRGTLIDAPQQGIRAMRREVLPLVELRVPFSLSREEIDAVERGSVDSDWQ
                     PVKDAARTIAFTEDRAIFDGYAAAGIVGLRQGTSNSRLTLPTAAKDYPHVIAQALNTL
                     RLEGVGGPYSIVLGAQAYLALNGGDDDGYPVRKHIESMIDGNIIWAPAIEGAFVVSMR
                     GGDFALDIGQDFSIGYLGHTAETVELYLQESFVFRVLTREAIVAIG"
     CDS             complement(259919..260956)
                     /codon_start=1
                     /locus_tag="GLX_02210"
                     /product="iron-dependent peroxidase"
                     /protein_id="BAK82633.1"
                     /transl_table=11
                     /translation="MATPQPVDTKITQAAIFLVLTLNHDEGTAGTVRDLLGDLSSLQR
                     AVGFRIPDGQLSCITGIGSDAWDRLFGAPRPRELHPFAEINGVHYAPSTPGDLLFHIR
                     ATRMDLCFELAANIVSRLEGVARVEDEVHGFKYFDERDLLGFVDGTENPSGQAARDAT
                     LIGEEDAAFSGGSYVIVQKYLHDLKKWDAIPTEVQEHIIGRKKVSDIELSEAAKPSYA
                     HNVLTNIEENGQQLQILRDNMPFGKVGSGEFGTYFIGYACSPARIEQMLQNMFVGKPP
                     GNYDRILDVSTAVGGTLFFIPTADFLDNAPGAGPVATPATRTDRPSSPPHDVADRHNG
                     SLGIGSLKKEA"
     CDS             complement(261550..261747)
                     /codon_start=1
                     /locus_tag="GLX_02220"
                     /product="transposase"
                     /protein_id="BAK82634.1"
                     /transl_table=11
                     /translation="MEKIARYFPLAHGMPRVDDHRVLSEMVYMIRNRIQWKDAPEVYG
                     PRKTLYNRFIRWSRSKTCSQG"
     CDS             262404..263483
                     /codon_start=1
                     /locus_tag="GLX_02230"
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="BAK82635.1"
                     /transl_table=11
                     /translation="MILPKPGNMIGMSDWTCQPHHGLARRKFTGWDKLKTGGCIPYDT
                     VMFLIMGMNCSKGELRVMSIAQMKENMSSHAGFIAALDQSGGSTPGALRHYGIPDTAY
                     SNDAEMFALMHQMRVRVITSPAFTGKKIIAAILFEQTMNGLVKDVPTPTYLWKERGIV
                     PFLKVDKGLEAEAGGVQMMKPIPGLDVLLEHAVKLGIYGTKARSVIRLPEPAGVAAIV
                     KQQFALAEQIAAHGLVPILEPEVLIKSPDKAGAETLLHEELKRGLDGLPGNYQVMIKV
                     SIPEKSDLYLDLVKHPRVQRVVALSGGYPRDEACKRLSANHGMIASFSRALLEELRYQ
                     MTDEQFNQTLAASIDEIYQASSQKI"
     CDS             complement(263601..264176)
                     /codon_start=1
                     /locus_tag="GLX_02240"
                     /product="hypothetical protein"
                     /protein_id="BAK82636.1"
                     /transl_table=11
                     /translation="MKKILLCGIVLTVAGCASNPSDIGAQYVDPAPYLQQSCAQLAHQ
                     DQADTQDLASAEKHQRRMHQSDEWGVALIGVPVGSIGGDRHKDIGRLKGELDALHAAE
                     RGKNCVGSYSPTDYNGTPSAYPATPAAGALPADTGMTDPAIPVTAGQQGNVARTGGVP
                     PVTTPSNYNPPAYHMPAAGYASPSYSDNPFR"
     CDS             complement(264293..265171)
                     /codon_start=1
                     /locus_tag="GLX_02250"
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="BAK82637.1"
                     /transl_table=11
                     /translation="MNSPAPSSATFILTLSCPNRPGIVAAISQHLYEHGANITEAQQF
                     DDTGSKQFFMRIVFELTRHDDLLHTLRKQFVNIAHTFSMTWTLTDIRHRPRVLLLVSR
                     FDHCLVDLLYRWRIGELRIEPVGIISNHPRETFADVDFYGIPFHHLPVTKDTKAEQEE
                     KIWAIFNQSDAELAVLARYMQVLSNEMAARLSGRCINIHHSFLPGFKGARPYHQAFSR
                     GVKLIGATAHYVTSDLDEGPIIEQDVERISHADSPEDLIRKGRDIERRVLARAVRFHI
                     ERRAILNASKTIVFTP"
     CDS             265599..266399
                     /codon_start=1
                     /locus_tag="GLX_02260"
                     /product="amino acid/polyamine transporter"
                     /protein_id="BAK82638.1"
                     /transl_table=11
                     /translation="MTQPPHSVLRQRHIIMIAFGGAIGAGLFVGSSAVIAAAGPCALL
                     AFTVVGLLVMLIMRMLGEMVAARPGQGSFIAYIRMAHGPGAAFTAGWLYWFFWLVALG
                     SEAIAGAIILHEWIDLPVWLLATVLIVVLKLINLAAVHIFGECEFWLSLIKVISIVFF
                     IVAGSLYIFHIFGTGVPVMHNLVGSGGMFPHGIAAMVSIVPTVLFAMIGSEIATVAAG
                     ESAEPARNVGRVTRTLGLRLMLFNTLSVALIVMIVPWSDVVPGYSPFV"
     CDS             266403..266939
                     /codon_start=1
                     /locus_tag="GLX_02270"
                     /product="amino acid/polyamine transporter"
                     /protein_id="BAK82639.1"
                     /transl_table=11
                     /translation="MQVMGIPGAAPAMRIVVLTAILSCMNSSLYITSRVMAELASYGD
                     APAMLRRRGGQKAPVNAIIANSLAGVLVAFSSILAPGTVFAFLLSCSGGVMLLVYSLI
                     VTAYVVMRKRTPPGERARLFSIPFFPALNFLTLAGVVIIFVVMLMDPAQRMVALASLG
                     TSLFFVLVYVARRRVTAW"
     CDS             complement(267290..268369)
                     /codon_start=1
                     /locus_tag="GLX_02280"
                     /product="transposase"
                     /protein_id="BAK82640.1"
                     /transl_table=11
                     /translation="MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEVFRPDLDRALA
                     YADGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLALSDRVPD
                     AKTVWLFRERLTEAGAIQKLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEK
                     VDLREGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPSTDLAIPFFGYKSH
                     ISIDRKFRLIRKWKATDAAASDGARLREGLLDKTNTASSVWADTAYRSKANEDFMDKE
                     GFVSKVHRKKPHLKPMPRHIQRSNAGKSVIRSRVEHVFADQKSQTGLFVRTVGITRAT
                     MRIGLANIVYNMRRFLFLERLNAAA"
     CDS             268368..269039
                     /codon_start=1
                     /locus_tag="GLX_02290"
                     /product="esterase/lipase"
                     /protein_id="BAK82641.1"
                     /transl_table=11
                     /translation="MSHSLNHHRREGITHRGPEPGVFRTLHVHETLVAHAALPAMVIG
                     HSMGGKTAMMLALNHPNAVHSLIVADIAPGEGGFAQSRQLAHDLAALPLPDYLDRAGA
                     EAWLGQVITDPPVRDLMLMNLELGEKSRWRIGLQQIAASMSAIIGWPPIVPGVHYNGP
                     TLFIAGGNSRYIQPASYPAMRRLFPHYRLETIREAGHWVHAQAPAAFLALVQGFMDSG
                     HGGEA"
     CDS             complement(269077..269715)
                     /codon_start=1
                     /locus_tag="GLX_02300"
                     /product="thiopurine S-methyltransferase"
                     /protein_id="BAK82642.1"
                     /transl_table=11
                     /translation="MNSTFWQAKWQRNEIGFHEHRPNVLLVRNFPALCLQHGARVFVP
                     LCGKSLDIHWLLAQGHQVVGCELSPLAVGQLFAELGLAPHVSICGTMQRYDAEGLCIY
                     VGDIFDLTADALGQIDAVYDRAALIALPPAQQADYAAHLCAITHQAPQLLICLEYDQS
                     RLAGPPFSVDAAQVSQYYGATFTLTCVERVMVPGGLKGACPATEALWHLVPA"
     CDS             269904..271397
                     /codon_start=1
                     /locus_tag="GLX_02310"
                     /product="capsule polysaccharide biosynthesis protein"
                     /protein_id="BAK82643.1"
                     /transl_table=11
                     /translation="MQQGSTGNARQGFLLMHMMFFLSVACILIVMPFIELAGIRTGGS
                     GKAIPPRRVYIDILCALFTVGLLLALTGNPVVSLLVAVLFEVIFVSVSNIKYKILGEP
                     LLFSDLFVARSFLQHPKFYLFSIPWYARVFVVVFLLFLVVGAFFFVVPDIRPHLVGIA
                     MTVLGLLGIHALPAARWVPTPALEQDLQRFGLPGITFLYWRQWKASPIPPAVPPLPGS
                     AAYDAVVVIQCESFADPACLPLPASVGPVAMPGLTQARRWAVQQGELQVSGFGAYTMR
                     SEYGVLYGRTEAELGFRAFDPFLTAMQESSYALPNRLKGAGYESVFVHPHDIRFYNRN
                     LLMPACGFGRMIGPEAYGHTASADMPYVSDMALGKSIETLVRSASGPIMVHAVTMENH
                     GPWAASSQPAQGLANYLRHLGNSDRMLLDLMHALSGMDRNILLVFYGDHRPSIPGIFT
                     PGAARDVPYVAVSLPAGRPDDQAASPPVALSPAGLHALIVQLAVKPA"
     CDS             271468..271707
                     /codon_start=1
                     /locus_tag="GLX_02320"
                     /product="hypothetical protein"
                     /protein_id="BAK82644.1"
                     /transl_table=11
                     /translation="MDHASWRQVGYTDRQKCQIAHIEENYENRGVDEHEATRYAWTIV
                     NRQDRGGRTRRTDGGHENGPQAYAKGHGGNQKMEK"
     CDS             complement(271947..272318)
                     /codon_start=1
                     /locus_tag="GLX_02330"
                     /product="transposase"
                     /protein_id="BAK82645.1"
                     /transl_table=11
                     /translation="MAPHKILHSLGLLDKTNTASSVWADTAYRSKANEDFMDKEGFVS
                     KVHRKKPHLKPMPRHIQRSNAGKSVIRSRVEHVFADQKSQTGLFVRTVGITRATMRIG
                     LANIVYNMRRFLFLERLNAAA"
     CDS             complement(272323..273546)
                     /codon_start=1
                     /locus_tag="GLX_02340"
                     /product="transposase"
                     /protein_id="BAK82646.1"
                     /transl_table=11
                     /translation="MSIDKDLLDRLMEGRSPGDLFGKSGILSELTKALAERALNTEMT
                     LHLDEERADGASAEDNQPPNRRNGNSQKTVTTQSGKVVLDIPRDRNGTFDPMLIAKYQ
                     RRFPEFDRKIISMYARGLTTREIQGHIEEIYGVEASPSLISAITDAVMEEVAAWQNRP
                     LEPCYPIVFMDAIRVNIRSDGTVSNKAVFVALAILPDGTRDVLGLWFQANEGAKFWAK
                     VLSDLRNRGVQDILIAVVDGLKGFPQAIEAVFPRTRIQTCIVHLLRHSMSFASYKDRK
                     AIATALKAIYTAVDATEAEAALGGFEESDLGRQYPAIAPSWRRAWNEVIPFLDYPPEV
                     RRLIYTTNAIEALNSKIRRAVRTRGHFPSEEAAAKLIYLALNATSAQWKRSVREWYAV
                     RCQLAIMFDDRFPMA"
     CDS             complement(273592..274350)
                     /codon_start=1
                     /locus_tag="GLX_02350"
                     /product="transposase"
                     /protein_id="BAK82647.1"
                     /transl_table=11
                     /translation="MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEVFRPDLDRALA
                     YADGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLALSDRVPD
                     AKTVWLFRERLTEAGAIQKLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEK
                     VDLREGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPSTDLAIPFFGYKSH
                     ISIDRKFRLIRKWKATDAAASDGARLREGLLGLS"
     CDS             complement(274567..275469)
                     /codon_start=1
                     /locus_tag="GLX_02360"
                     /product="monooxygenase"
                     /protein_id="BAK82648.1"
                     /transl_table=11
                     /translation="MKEIRLNAFDMNCVSHQASGLWRHPRDRSDQYHTLQYWTDLARL
                     LERGLFDSLFLADVLGVYDVYGGSPDAALRNAAQVPVNDPAMLVSAMAGVTRHLGFGL
                     TATLSYEHPYPFARRMSTLDHLTQGRIGWNIVTGYLNSAAKGTGRKQQPGHDTRYDIA
                     DEYMQVVYALWEGSWEHGAVRRDRASGIFTDPARVRSIRHEGDYFTLDAIHLSEPSPQ
                     RTPVLFQAGASPRGQEFAARHAECVFIAGPSRASVAKTVTSIRTQARAEGRTSGTPLI
                     FSLLTIVTAPTSAQAWAKYEDYRQ"
     CDS             complement(275501..277792)
                     /codon_start=1
                     /locus_tag="GLX_02370"
                     /product="TonB-dependent outer membrane siderophore
                     receptor"
                     /protein_id="BAK82649.1"
                     /transl_table=11
                     /translation="MQMHLPMELCPMARISLHRLSDRSIFRSRLLSHRTTLVVGSYLM
                     GFAPAAFAADVAPAHPVRNTTPAAQHDRPAGHGAVPAAAAPQPEIISVSRHRLSPAAR
                     AEARLASIPGATSVIDAQKVLKGRNFTSADTLSFQPGVFAQSSGGGDGIRLSVRGSGI
                     ATGTNYFRSGMLMMFDGLPVTTPAGTPYELFEPLGLRYTEVLRGANAFDYGGMQLGGA
                     INYVSQTGYDAQRYQARVEAGSFGYVKEQLSSGGVFGKFDYYISATNSYRSGYQDNTK
                     ATSFGLNANFGYKFNDRVSTRAFFRYRQTVNGYPGYLTRDQILSDPKQAQSPYYAWGA
                     HRIQPGTKYYGSMTSIRIDDKSKIEIGGNYQDAPIDIQNTASSQIWGYKTIAGVLNYD
                     RHDVLAGHSSDTQAGIMSYSDIEAWQRNRIRVSSVFGGAPDGMLLRNVKYGGTENYFH
                     LRNNTEVAHNLWLTAAGALAFIKRTSDVTYPNRSDLHTSSVNFIPRGGFRYKPDSHVE
                     IYGNVSRSIQPPNDWNYNYAGSYYNAASYPLQAAAGENATSGRLRNQTATTFEIGTTG
                     HYFHNKWSLTYYHSSVHNELLTVTTPESLAAGTSIYGNGSPTMHQGVEFSLETELLKW
                     SGNTLSLRQAYTYQDFRYKHDAVFGHNRLPGIPEHFYQGEVHLDMRNGFYAGFSAQVS
                     SKVGASYDMAYFAPSYHIYNANIGYSWPRRHREVFVSFNNLANTHYAAIVVPGYQAAG
                     KQLSVMQPGDGFGVFVGASIGFN"
     CDS             complement(277878..278417)
                     /codon_start=1
                     /locus_tag="GLX_02380"
                     /product="flavin mononucleotide (FMN) reductase"
                     /protein_id="BAK82650.1"
                     /transl_table=11
                     /translation="MNNMIAPFGYNQSDVTAVPVEAFRNGMAALASAVTVVTTDGPHG
                     PHGFTASAVCSVSDTPPTVLVCINRGTGAHPYILKHGVLAINVLHAGQHELSNIFSSR
                     SRSMQERFAAGRWHAGPTGAPVLDDALASFDCRIREIRDVGTHTIVIAHVVDVSLAVD
                     GVQPGLVWFNRQYSRVIPK"
     CDS             complement(278424..279917)
                     /codon_start=1
                     /locus_tag="GLX_02390"
                     /product="major facilitator superfamily sugar transporter"
                     /protein_id="BAK82651.1"
                     /transl_table=11
                     /translation="MTLQISTARPVVRDADDISAIVNAGPAAQSHARMVVALALGGVF
                     LDAYDLTTLSWGITDVQAHFGLSAFQTGLVAAALNAGTIVGSLAGGWLTDRIGRYAVF
                     MADMVCFVIAALVAGFAPTAGILIAARFAMGFGVGMDLPVAMAFLSEFSRLEGRGSKA
                     AHAAAWCPTWYAASSACFVIVFVLSHVLPATHPDWLWRASLAFGAVPALIIILVRGRY
                     ISESPVWIARRGDLEQAAAILRRSYGVDPIVCPVRGRPPVVMQADPWRLARRPLLGRG
                     LQVGAMTLISSMSYNIIIFGLPTLLVSIMHASAVQVVVISIILNLVVAFPGGLLGVRL
                     ARSVRSRPILLAGYIMQVVGVGLLAMTGVPHGSVGVIAALAGFAAFLFAQGFGPGCQL
                     MVYPTLSFPTELRGMGIGVARLVSGVGGTLVLLSFPWLNAHLGPALFWLVLLAPLAGV
                     VITCLSRWDVFGYDPDMDPALRQSARPDPHAALPTTPELLFSSDIGN"
     CDS             complement(279914..281365)
                     /codon_start=1
                     /locus_tag="GLX_02400"
                     /product="hypothetical protein"
                     /protein_id="BAK82652.1"
                     /transl_table=11
                     /translation="MVRAMRVSSHSPHIAIIGGGFSGAALAWHLARRRGGPKRITVFE
                     PRPFLGAGLAYGAQDPQHRVNVPATRMSIDTSQPDDFINWIHQTDALADDPAAIRPDG
                     SVFPARAVFGRYVADRLAALLQAGTITHLRRRVTGVHRTPDGGWIVTDATGVSLHADI
                     VVIATSHPAPEAPAVLRDLELHPGQHPVLVTNPWQAGALNAIRDTDRVLVVGTGLSMA
                     DAVVSLSARGHAGRITAISRRGQRSRAHAADVVDPVGNFISPPVRTASLLLRRIRHEL
                     ARHAGQPWQAVFDRIRTQAPDIWAALPVPERRRLVRHLRPLWDTHRFRIAPQADAVLR
                     AREQAGTLDIRAGRLIGVQVRHGHFVVSLRHGNAPTWRADFDAIITTTGPAHGTIMQA
                     QPYLGELAAAGLVERDATGLGLHVDALGRACVGGRHEDSLFVAGPLARGRFGELMGLP
                     EVTHYAEKLAVIISALTAGGTGAFHHHQERATT"
     CDS             complement(281368..282531)
                     /codon_start=1
                     /locus_tag="GLX_02410"
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="BAK82653.1"
                     /transl_table=11
                     /translation="MSYAIPDKINVLWFLPTHGDSRYLGTQKGGRPVDLPYLQQVAKA
                     ADALGYYGVLIPTGRSCEDSWVVASALAPVTERLRYLIAVRPGLLSPTLAARMTATLD
                     RFSAGRLLINIVTGGDPAENAGDGLFADHATRYEITDEFLDIYRTLLRGETVNFEGKH
                     FTIKDGRLLFPSFQENGPPLYFGGSSEAAAHVAAKSIDKYLTWGEPPAQVAEKIAHVR
                     RLAHAQGRDVSFGIRLHVIVRETAEEAWHETDRLISHLDDATIAKAQKVFARMDSVGQ
                     SRMSALHGGQRGKLEISPNLWAGVGLVRGGAGTALVGDPDTVAERIDEYRRLGIDTFI
                     FSGYPHLEEAYQFGELVLPNLPTAHPVRGRSTLNNMGPFGETIAGDHRPTRAA"
     CDS             complement(282534..283964)
                     /codon_start=1
                     /locus_tag="GLX_02420"
                     /product="monooxygenase"
                     /protein_id="BAK82654.1"
                     /transl_table=11
                     /translation="MSRPKKQLHVNLFEMACVSHIVHGMWRAPGNNRHRFGEMGYWLE
                     VAKLAEEGLFDAVFLADVIGTYDRFGDGNAAALREGLQIPNLDPLMVVPAMAAVTQNL
                     GFGVTFSTTYEPPFAFARRMATLDLLTGGRVGWNIVTSYLRSAARNFGLDDEIPHTQR
                     YAIADEYLDVLYKLWEGSWDDDAVVNDAQAGIYTNPDAVRPINHDGRYFRVAGPHLVS
                     PGRQRTPVLFQATGSPDGLEFAARHAEVVFIGGQTTEAVRANIARTRERARAHGRNGD
                     DIRFIVMAGIIADTTQSLAEKKLETYRQYYSVEGALVHAQAEIDLRRFSPDERIGDVL
                     KREGLAFGNMGRRFRPEQTVGSALRQIASFDEGRFFVVGTPDRIADEIEHWLDVDGID
                     GINLRQYHTFGTARDFIDLVVPELQQRGRYRTAYTPGETLRERLFGAGRARLPAQHFG
                     SRYRDPAGLNLTAAPLFPHETFSKAS"
     CDS             complement(283961..285238)
                     /codon_start=1
                     /locus_tag="GLX_02430"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAK82655.1"
                     /transl_table=11
                     /translation="MTDRVHPARGFSPRIEMVAQTLRPVFARIAQGAVEREHHRILAY
                     DAVQWLLEAGFGALRVPVQHGGSGASLTETFALLAELAEADSNLPQIFRAHFAFVEGQ
                     LHEGASPQAARWLERVAQGALFGAAMAELTDSTGTTTALTPRLDGDGWRLEGTKYYST
                     GTLYASWIVVVATDGTDRIQLIVPATAPGVTRVDDWDGFGQRLTGSGTTVFENVSVPD
                     ENILGRTPLSQFPTNEYFTTYYQLFHLATLAGIGRAIVRDAVAFVRPRTRTFGIPGQV
                     AQRHDPLVQGVVGRLSALSFSADALVEKVAEGLEDTFPLWVAGHESGPAFDRAQVQAY
                     QAQQIVAPQVLEAANLLFEVGGASATSAARRLDRHWRNARTLASHNPLVQRQRELGDL
                     VLNGTAFGSRWRTHATDAAPQAAGTRTRSEQVA"
     CDS             285656..286807
                     /codon_start=1
                     /locus_tag="GLX_02440"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAK82656.1"
                     /transl_table=11
                     /translation="MSFPLHDAPQAMEAARHLQSVFTTRAARHDRTGQFAHENIEDLR
                     QAGLLSLPIDTPQRPTAFKLGVVAAIVGTIAQADASTALVLVNHYMVRAAMARHECGS
                     AALARWVEEEQHDQLLNILLAEPDLGSASRGGLPGTVATRTSAGWCLNGRKAYVTGIP
                     GLSWLLVRARTTEETPRVGLFMVPATAPGITVIENWDHIGMRASNSHEVILHDVPLRA
                     DAALDLHLPDTPPAPRNTLLLWNTGLLGALYNGIATAALDWFVTFLKTRVPSSLGAPL
                     ATLPGMRDAVGGFSLTLHMNTMLLDRYMTGVETDAPPERLNADAAVIKAKVVDAAGDF
                     TSAIMGLAGNAGLSAHNPLERAHRDALCGRIHAPHGELLRSRAGQAALA"
     CDS             286941..287288
                     /codon_start=1
                     /locus_tag="GLX_02450"
                     /product="transposase"
                     /protein_id="BAK82657.1"
                     /transl_table=11
                     /translation="MSDLFWLTDEQMERLRPFFPKSHGKPRVDDRRVLSGIIFVNRNG
                     MRWRDAPREYGPHKTLYNRWKRWGDMGIFMRMMDGLSAAKAEPQTIMIDATYLKAHRT
                     ASSLRLKKGIQAA"
     CDS             287309..287698
                     /codon_start=1
                     /locus_tag="GLX_02460"
                     /product="transposase"
                     /protein_id="BAK82658.1"
                     /transl_table=11
                     /translation="MNTKLHAVTDQNGRPLSFFMTAGQISDYTGASALLDNLPMAQWL
                     LADRGYDADWFRDALEEKGIRPCIPGRISRGKPVKYDKRKYKRRNRIEIMFGRLKDWR
                     RVATRYDRCPNVFFSAICLAATVIFWL"
     CDS             287695..288138
                     /codon_start=1
                     /locus_tag="GLX_02470"
                     /product="monooxygenase"
                     /protein_id="BAK82659.1"
                     /transl_table=11
                     /translation="MSPEPNEPVRHVRNDAINSAIDSLTVQSPDKVWTVGELARHAAI
                     GGMGVTIVGSPTEIADQMEEWMAQTGVDGFNLAYAVAPETFEDIVNLVIPELQRRGRY
                     KTAYRPGTLRHKLFGGDDLLDGTHVADSLRIHPVGVRRQHTETGV"
     CDS             complement(288264..288974)
                     /codon_start=1
                     /locus_tag="GLX_02480"
                     /product="hypothetical protein"
                     /protein_id="BAK82660.1"
                     /transl_table=11
                     /translation="MMMPFLSVAMALRPRTTGIPPQAPFPLADELDCTQATRRLVRAL
                     AGFDVVIVPGLDGSLSHHWQSRWEHVLRLHGIGVHRVRQRNWARPTYRMWADTLRLTL
                     GRTGPRPAIVVAHSLGAALSVRMAAEEGLGNVAGIFLVALADVASYRGAEQARVAEFA
                     ALPTGALPLPAMLVASRNDEWLAMSRARSLSATWHATLRDAGRAGHIGNYAPIGAWPD
                     GMDMLADFAASLPHTTRS"
     CDS             complement(289017..289532)
                     /codon_start=1
                     /locus_tag="GLX_02490"
                     /product="peroxidase"
                     /protein_id="BAK82661.1"
                     /transl_table=11
                     /translation="MALFPGWQAPDFTIETTTGPIRFHAWGQDCWRIVMTHPGDYSPH
                     SLRLALRQIRSGIASIHLLGLSPFPDADQDMMVRSGATALADLTDLATVTDDTARVMA
                     LWQGIAVDAGQDSPLVDMHAAFIVDPENRIHSTVTYPPTTGRDFAEVLRVLPEPAPHC
                     CPTLESARRAA"
     CDS             290233..290442
                     /codon_start=1
                     /locus_tag="GLX_02500"
                     /product="hypothetical protein"
                     /protein_id="BAK82662.1"
                     /transl_table=11
                     /translation="MLESRIVEVDGTFVGTLIIEADRVTQRFYATHDSVRAFHNRTLQ
                     GGDDLPRQVARLYRRNHAMGLQSSS"
     CDS             complement(290674..291090)
                     /codon_start=1
                     /locus_tag="GLX_02510"
                     /product="hypothetical protein"
                     /protein_id="BAK82663.1"
                     /transl_table=11
                     /translation="MRTAMSLPYAHISGQPPLSPPAPPVPQDYPPWVQESSFPSTHPP
                     SRRHCTTMLPACRAQGTGHRAQGTGHRAQGTGHHSHWRGKLTMQQKPDPDMEKQPGPT
                     QQHEDEGRDEALDESFPASDPPAQGRTTEPNKKPEK"
     CDS             complement(291126..291488)
                     /codon_start=1
                     /locus_tag="GLX_02520"
                     /product="hypothetical protein"
                     /protein_id="BAK82664.1"
                     /transl_table=11
                     /translation="MAKTFRSALLATLIASAPVMALAQSNMQTNPAPTADSAASEVGK
                     NPPSAISNSGKRVEPSDKLWNNPRTVDEQPGTQPPTSGSGGTSTTSSGWHHHGGAEAG
                     RSSHGGNKTPAPADSSGQ"
     CDS             complement(291655..292116)
                     /codon_start=1
                     /locus_tag="GLX_02530"
                     /product="hypothetical protein"
                     /protein_id="BAK82665.1"
                     /transl_table=11
                     /translation="MQETGAGYLFSRLPGQYRTILHVHRYPYRWRDREEKPPCALIRA
                     TKGLQASPACPCFPFAQREPTMTYTMHERTLPHGVVLSPPRHDTPPRVGTPGQGGPRA
                     GEDEPESTRDNDEKIEKTSHRDTGRNSPHGGGTKPHAHKPAPAGQPDQTPC"
     CDS             complement(292179..300725)
                     /codon_start=1
                     /locus_tag="GLX_02540"
                     /product="cyclic beta 1-2 glucan synthetase"
                     /protein_id="BAK82666.1"
                     /transl_table=11
                     /translation="MDGTPLPPSQPGPAFMPPRRSWLARLMGQPHRMAWENDTTPLKS
                     EIFGPERLEAHAKSLAAVQNISPRTRGYGHPLSRRLAENGAFLRTADIRIAEAIRAGK
                     QLTPAAQWLADNYALVDMQIRETDLDLPPGYYARLPKLADGPFAGLPRVFGVAWALVA
                     HTDSSFTPDTLYAYLLAYQSVTPLTIGELWAVPITLRIVLIENLRRVVAAIMDNNTNR
                     READALADRLEAYRKGTPAALSRFLAMIDPCVLTRAFTAQLAHRSRGLDPEKDPALVW
                     LEQRLADRGTTVEDAVRDDLHEQGAFNATIRNVITSLRLIAGLDWTEAFDCVCLINGL
                     FAQYDSFTQADFASRDLYRKAVEELARGSTLSEMDIARRAIAMAQAAHGPDPRHADPG
                     YYLLMSGRPALEAAIGFRLPLCRMLVRHFCSHGITAYSSLVIVLTMMFLALPLWLAQY
                     GGIGWAWLLPVMAFIPVSEAAVACVNRLALGMVHVTSLPGLEFRGGIPAHLRTMVVVP
                     ALLVTEDTVTELLARIEVHYLATRDPSVCFALLSDWTDHDGPHAPADEPLVALAQRGI
                     DQLNAKYDAPPGAVHFHLFHRRRVWSKSERVWMGWERKRGKLHELNRLLRGATDTTFL
                     PPACALPVDVKYIITLDADTRLPLETVRRLIGKIAHPLNVARFDPVSGRVREGYAILQ
                     PRVTPSLPVGHESTLFQRIFASASGIDAYSAAVSDLYQDMFGEGSYAGKGIYDIDAFE
                     AALADRVPESTLLSHDLFEGIFARAGLVSDVEVVEEFPTDYLVAAQRLHRWTRGDWQL
                     LPWIIPSLSYRRLPPHRRLSGLALWKMLDNLRRTLCTPLVLLSLAACWFLPFHAALVW
                     TAFILAAVALPAFLPMLPALVPRREWITLRSYLSVLGHASAEAAVMTFLNIAFLAHLS
                     FLMTDAIMRTLARVFLTRRHMLQWVPAAQIAGLLRSGLAGYYGRMVPAPMLAGVIALA
                     VSLWAPWNLFLALPFAVLWCLSPAIAMWASRTPVIAARTRPSRTDIRTLRMTARRTWR
                     FFETFTTPDDNMLPPDNFQEDPTAVVARRTSPTNIGLYLLCTASARDYGWCGLADTVA
                     RLEATLATLERMPRYRGHFYNWYATADLQPLEPVYISSVDSGNLAGHLIALASTCQHW
                     QENEPQTDPWREGTIDGLNIAIADMTFRDGTRLSHGVAERKMLRQLAAFKNSVQSAPA
                     RALTDFSALCEQAETLVRQADHLPAMADATATADRTFWIAAARRTLESHLRDMDTDLY
                     ATLGARLGVIAHTARRLAQEMDFRFLCNPTRKMLSIGYLVAQDTQDTNCYDLLASEAR
                     LAVFFAIAKGDMPAQDWFRLGRPITPVGNGAALVSWSGSMFEYLMPSLVMRAPMGSLL
                     AQTNTLIVQRQIAYGQARGIPWGISESAYNVRDLDYTYQYSNFGIPGLGLKRGLGLDT
                     VVAPYATMLGAMVDSKKAVANLYALEKAGALGRFGLYESLDYTPGRIPDGSTVAIIRA
                     YMAHHQGMSILAVADAIMNGIMRARFHDDPVIASAELLLQERAPRTGAVARPLPTEDA
                     APAPVHAINAPSGRYMEQADTLSPVTHLLSNGRYVVMLTAAGSGYSRWQGQAITRWRE
                     DATCDDYGQYIYIKNRRSGQVWSAGLQPGGVRPDEYGVGFHEDRAEFARRDGTITTTL
                     EIRISAETDAEIRQLSIFNAGSETLDIDITSYAELALLPQAADLAHPAFTKLFVQTEY
                     LPATRALIATRRRRTPDEAGIWVAHLAMCDTPVEIETDRARFIGRGHSVHDPVALRAA
                     EPLGGHTGTVLDPALCIRTHATIRPGTMARVTFWTMVAPTRAALLDLIETHHDAAAVE
                     RVRTLAWTQAQVQLRHLDMTPATADLFQQLAGHIIFAGPALRAGSTAITKGAGPQPLL
                     WEQGISGDLPIMVLRIKENANMDIVRLLLLAHEYFQLKQLAVDLVILNEHPASYLQDL
                     QVSLDQLVHARPRAGNDMGSVRVLRTDLVTPAMRNLIISVARVVLDAERGLAEQLGQA
                     ERTPPRPFPPVAARPQPDTPDFGMPPVPVLEFFNGHGGFALDGHEYVIVLEPGQTTPA
                     PWVNVISNDRFGFQVSAEGSGYTWSGNSREHQITPWSNDATSDHAGEIFYFRDENTGT
                     LWCPTATTRRDPQATYVTRHGYGHTRLERIAHGIASSLLQYVPTDDPVKITRIQLHNQ
                     SGQARTLSVTAYVEWVLGAARSTTAPFISTTMDPDTGALFARNHWKPEYANRVAFADI
                     GGYLSASSGDRGAFIGRNATMDNPIAFIHPNGVQGRTGAGLDPCGVVQTVVTLPPGGR
                     AEIVFLLGEGTDEEQARALVSHYRSADLDRVLATVKAHWKKVTGGIEVHTPDRTMDIM
                     LNGWLLYQTLASRVQARAGFYQASGAYGFRDQLQDGMALALTCPQRVRAHLLRAASRQ
                     FVEGDVQHWWLPDTGAGVRTHISDDCTWLAHTVLHYVTTTGDMGVLEEQVPFLEGPAL
                     PLNEHDRFMIPVRSALTGTLFEHCARALDHSMAVGTHGLPLMGTGDWNDGMNRVGEKG
                     QGESVWLGWFLHATLGAFIPLARARGEHTRAQAWQDHAQALVTALEATWDGDWYLRAY
                     FDDGTPLGTHKAAECEIDAISQSWAVLSGVAPPERGEHAMRSVMTHLVRRQDGLVLVL
                     TPPFNTAEPDPGYIRGYPPGIRENGGQYTHAALWTVMAMAALGDGDQAHALLHMLNPI
                     NHARTPADVARYRLEPYVVAADIYSTPPHVGRGGWSWYTGSAGWMQRVGVETILGIRI
                     VGTQLVVQPCIPHQWPQFRALVRWRTATYHITVLNPHQVCRGIGHATLDGMPLPATGV
                     IDMVDDGATHNVDMTLGMTA"
     CDS             301333..302919
                     /codon_start=1
                     /locus_tag="GLX_02550"
                     /product="Na+/H+ antiporter"
                     /protein_id="BAK82667.1"
                     /transl_table=11
                     /translation="MSNVGRFEFILLLIVLIVGLELAARKLRLPPAAALVLGGIAIAL
                     VPGVPVIGIDPDLVLIVFLPPLLLAGAYFSVWHAFRAHLGGILQLAVGGVAFTTFVVG
                     VVAHWLIGDLPWAGCLVLGAIVAPPDAVAAKAVLKHVHLPERITTLLEGESLLDDAAS
                     LVIYRFASLAVLTGEFSPVQAGMTFGLLALGGLVVGGGLGWLWIRLLERVRDRILSIT
                     MTLLLPWVAYIGGEMVGASGVITTVVAGLVLGWRQHDVFSADERLRWAAVWEVLVFVL
                     ESLVFVLIGLSLHAIVLRHMGTAWVAQDVFRPVAGIVTAVLVSRFVWMFLTEGLRVAW
                     LPPQARPGLRGFFTFGVIMGWCGMRGVVSLAIVLALPAAMPERDVMQITTFVVILVTV
                     LGQGTTIGWLIRAVGGESGRGQQYHHLSVSQARALVAHAQEQAMRQQAYDAQGQLVHG
                     RLLEQYAYRAELAERFSHQQQALQGRQDAHYHALLLTIQAGRAELLRLHRGGEIHDAV
                     LHQLEHELDLQQMTAEGGLI"
     CDS             complement(302961..303872)
                     /codon_start=1
                     /locus_tag="GLX_02560"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82668.1"
                     /transl_table=11
                     /translation="MESTMDRIDLFRIFARVVESASFTRAADTLGMPRSSVSAAIQEL
                     ENRLGTRLLARTTRSVAPTPDGTVFYTHCLRLIADVEEAEALFRPDRAGPRGLLRVNM
                     PGRIARLLVAPALPAFIQRHPEINIELGATDRAVNLVEDGIDCVLRVGPLEDSGLVAR
                     TMGELALINVASPAYLARRGTPCHPADLAGHEAVGYASPTTGRVEEWEWMEDGRRHTR
                     DLSWRVSVNSAETLVACCLAGLGLIQVPAYDVRHHIRAGELVEVMPCWRAEPLPMALL
                     YPHRRHLSRRLQVFADWLAQLMAAAVM"
     CDS             304004..304777
                     /codon_start=1
                     /locus_tag="GLX_02570"
                     /product="oxidoreductase"
                     /protein_id="BAK82669.1"
                     /transl_table=11
                     /translation="MADHGIKGKTVLIAGGAKNLGGLIARDLAAHGAKAIAIHYNSEA
                     TRPDADKTLADLKAAGVNAVALQADLTRDGAMAQLFADVVARIGRPDIAINTVGKVLK
                     KPIAETSEAEYDSMFAINTRVAYFFIKEAGKHLNDNGKLVTIVTSLLGAYTPFYSTYA
                     GSKAAVEHFTRAASKEFGARGISVNAIGPGPMDTPFFYGQEQPDAVAYHKSAAALSAF
                     SKTGLTDIADIAPYVRFVVSEGWWMTGQTILVNGGYTTK"
     CDS             complement(304804..306678)
                     /codon_start=1
                     /locus_tag="GLX_02580"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAK82670.1"
                     /transl_table=11
                     /translation="MTQASPPPARPPWRTRLARRFGVYAHVPRMFRQIWRCSPTLTVG
                     SMALRLVQAVQPSLALYVGKLIVDEVIHLSSLHMPPTTLLAWGLHGPAMRLEGWVALE
                     FALIILSDLTARATVLVDGLLNERYVNDVSLSLMEHAATLDLQQFESSELQDLLERAR
                     RQASGRNNLLVQLFNIAKVALTAITLAAGVMAFAPWMVVVLLLALLPATAGEAHFNAE
                     GYRLQRAKTAERREMDYLRHIGSSAEHAKELKLFGLGDFLVGRFRAAATTLMAQNRRL
                     ALRRFVWSGLFGMIGSVAYYTIYIVIVWDTVQGRFSVGDLTFLSGSFVRLHTILSSLL
                     LGVTQTASQAQYLDDFFAFLDLRPVIVPASAATRPFPSPIRHSIRFENVGFRYPGTDR
                     WAIRNLDLNIGAGETVALVGENGAGKTTIVKLLTRLYEPDEGRITVDGVSLRDMDLAD
                     LRAHIGVIFQDFVRYSLTAAENIAIGRIDALSDTARIRAAAREGLADEVVGRLPHGYD
                     QPLGKQLARGRELSGGEWQKIAISRAYMRDADLLILDEPTSALDARAEADVFERLRAL
                     RHGKAALVISHRFSTVRTAERIVVLEHGRVLEQGTHAQLLAHGGRYAELFALQAAGYR
                     "
     CDS             complement(306718..307074)
                     /codon_start=1
                     /locus_tag="GLX_02590"
                     /product="transcriptional regulator LuxR family"
                     /protein_id="BAK82671.1"
                     /transl_table=11
                     /translation="MPLQVTTGTVMLVSIASTEQQIDTRQQMAIQLAASQFHYRYCQL
                     GLDRSQVAGTVLSPRERECLSWAAQGRDTTEIGDILAISDNTIKFHPKNVLHKLGCHN
                     RVQAAVKATCMGLIHP"
     CDS             complement(307245..307439)
                     /codon_start=1
                     /locus_tag="GLX_02600"
                     /product="hypothetical protein"
                     /protein_id="BAK82672.1"
                     /transl_table=11
                     /translation="MIARLYTDIFDLAADIRTAPDQHGLVGAFGALIARLGPHAYSIG
                     TIHRTDLVQRHLIGTTYPDA"
     CDS             complement(307543..308562)
                     /codon_start=1
                     /locus_tag="GLX_02610"
                     /product="hypothetical protein"
                     /protein_id="BAK82673.1"
                     /transl_table=11
                     /translation="MVAIVTDLPSPPPGGALPIRVAALYHFTPFADCAALRAQLLEAC
                     HKLGIRGILLVAHEGINGTIAGTDEAIGQILDIIRALPGCADLEVKFSRAPALPFHRM
                     KVRIKREIVTMGVPGLDPRRDVGHYVPPAQWNTLISDPDTIVIDTRNDYEVAIGTFRG
                     AIDPGTRSFREFPQWFRDQRAALEARGRRPKIAMFCTGGIRCEKATAFVRAEGVEDVF
                     HLQGGILKYLETVPEPESLWDGECFVFDQRVSVGHGLKPGTLDICHACRTPLSAADRA
                     TPEYEEGISCPHCKGARTEAQRRRYAERERQIQLADRRGTHHLGLPLPTAARQAHPCG
                     EDTDQ"
     CDS             308782..309153
                     /codon_start=1
                     /locus_tag="GLX_02620"
                     /product="arsenate reductase"
                     /protein_id="BAK82674.1"
                     /transl_table=11
                     /translation="MTVTLYHNPACGTSRNVLAMILAAGIEPVVVNYLKTPPTRAELD
                     VLAARLVVPVRDLLRVRGTPYAELGLDDPTLTDGQLLDAIAVHPILLNRPVVMTDQAA
                     RPCRPKETLYEILPQVRIVTP"
     CDS             309156..310097
                     /codon_start=1
                     /locus_tag="GLX_02630"
                     /product="sphingosine kinase"
                     /protein_id="BAK82675.1"
                     /transl_table=11
                     /translation="MPVQDRTVIIIANPTAGGGGGGSGENGCVARFARCLRHEGMRPV
                     VLHTAHRGHARVLAREAVQAGACTHIVAAGGDGTVAEVADGMAGSDIVLGILPVGTAN
                     VLASELGIPPDPARNARAIAAGEDTVIWPGRLRSSTGEWLFVQMVGVGFDAHVVHAVS
                     VRMKKALGRMAYVLHTLRALWAYPFHSMTVVVDGVARPAVSVIISKGRFYGGRYVLTP
                     RSMHEHAGFSVVLFGTAGAWASLRYSMALLCGMLDRQPDVTILNARTIEVITPTGLPV
                     QGDGDACGLTPLHVDLPGRPLRVAGFVAVTPGKASPS"
     CDS             310125..311027
                     /codon_start=1
                     /locus_tag="GLX_02640"
                     /product="hypothetical protein"
                     /protein_id="BAK82676.1"
                     /transl_table=11
                     /translation="MTTQMMIELIAVLTAVRDEVPQVMTIGHGRLLPSGPLENTHRSL
                     QAGVRAWVERQTGHPIGHVEQLYTFADHDRILSSAQERMIAISYLALTRSHAGETGWR
                     DWYDYFPWEDGKTEEGRASLAQIERRLCSWVAAMADAATRVRQWQRCVTLFAIGDMGV
                     WNDELVLQRYELLYEAGLVTEAGCPPEHAVPGQAMDHDHRRILATAMARLRAKIRYRP
                     VVFELMPASFTLLQLQRVMESLSGMHIHKQNFRRLIMQQQLVEETGEIDEQTGGRPAR
                     LYRFSGEVRQARQLAGTNIPLVQP"
     CDS             311171..312151
                     /codon_start=1
                     /locus_tag="GLX_02650"
                     /product="quinolinate synthetase complex A subunit"
                     /protein_id="BAK82677.1"
                     /transl_table=11
                     /translation="MNQITPHGETDALYERVRHLVPEMEWETFLTDIRAIETLKRERN
                     AVILAHNYQTPEIFHCVADIRGDSLALAREAQETDADVIVMAGVHFMAETAKMLNPHS
                     TVLIPDMKAGCSLADSITGADVRALRARHPGVPVVTYVNTSAEVKAESDICCTSGNAK
                     RVVESLGTDSVIMIPDEYLARNIEAETGIRMITWPGHCEVHERFTPEEIGRMRADNPG
                     LVVLAHPECPPEVVAASDFSGSTAMMGDFVRGHTDERILLVTECSMSDNLAVQYPQTE
                     FVRPCNMCPHMKRITLSNIRHALETMTYEVMLDPELASRGRRAVERMLAI"
     CDS             312148..313716
                     /codon_start=1
                     /locus_tag="GLX_02660"
                     /product="succinate dehydrogenase flavoprotein subunit"
                     /protein_id="BAK82678.1"
                     /transl_table=11
                     /translation="MIMHPALPAGQPVIVGAGLAGVMAALSTTRPCVLACAGTLEAMR
                     SPTAASMLAQGGMAAAMGADDTPALHAADTLAAGAGLCDPQVVAAITANGPAVIARLT
                     GLGVAWDRHADGSLQLGLEAAHGRRRIVHAGEDATGATIMRALAARVRRTARITVVEH
                     VCARDLVLRDGAVAGMVLDVAGQAVTLPTTAVVLATGGVGGLFADTTNPWAATGSGLA
                     MAVRAGAVLGNMEFVQFHPTALSAGQRGQRLCLVSEAVRGEGAVLVDETGARFTEELA
                     TRDSVSRAVWRHMLAGHRVYLDARASVGADFPCHFPAISALCAAHGIDPVTQPIPVRP
                     AAHYHMGGIMVDRDGQTGVPGLWAVGEVACTGLHGANRLASNSLLEAVVCGTGIGHEL
                     DGLTMERHGTVHESAVQQPDPLPPLSLRQVMSHHAGVIRTDEGLRAGLRQLAGSLHTD
                     AGLVCAAIVQAALLRCESRGGHFRSDFPATGIVGTPSRLGLADLHAGVASVMEGSALS
                     ALSVSSPMNESMPT"
     CDS             313713..314567
                     /codon_start=1
                     /locus_tag="GLX_02670"
                     /product="nicotinate-nucleotide pyrophosphorylase"
                     /protein_id="BAK82679.1"
                     /transl_table=11
                     /translation="MIHPLPDIMLEPLVRAGLLEDLGRAGDLTTDAVIVDRDTPVRAV
                     FAARQDGVIAGLDMVRLSFALMDARIEFQPHVRDGDVITKGTRLATVRGPARGILSGE
                     RVGLNFVSHLSGIATATAQLVELVRPYKAAITCTRKTMPGLRAIQKYAVRAGGGSNHR
                     FGLDDAILIKDNHIAFAGGITPAVERARAAAGHLVRIELEVDTLAQLREGLETGGVDV
                     FLLDNMPPDTLREAVRLVDGRAVTEASGGITPQTVTAVAQTGVDLISLGWLTHTVRVM
                     DIGLDYVP"
     CDS             314607..315071
                     /codon_start=1
                     /locus_tag="GLX_02680"
                     /product="hypothetical protein"
                     /protein_id="BAK82680.1"
                     /transl_table=11
                     /translation="MVHVITRHAGCLAAILSCTLAVAGGARAQPDMQQAAQRAQQMQQ
                     QFQQQQMQFRQQQEQMYMQRDQQMQQMHQQFDQQQMQLDQQARQMVNQPGGREQIKRQ
                     REQMRQQQAQQMQQMRQQFSQQDEQMRQQRMQMNQQEQMQQFGQGMSYQQNW"
     CDS             complement(315141..318647)
                     /codon_start=1
                     /locus_tag="GLX_02690"
                     /product="hypothetical protein"
                     /protein_id="BAK82681.1"
                     /transl_table=11
                     /translation="MRISELRIARYGAIASLNLDFGDGRGLHVIHGPNEAGKSTCLAA
                     IEDFLFGIPARSEAGGVFGKDKMRLGARVLLEDGEEFDLVRRKGNKNTLATPDGSPVP
                     DSVLARALGGMTRARFAALFGLNDETLRTGGAELLSANGDIGRLIVEAGGGLRALTIR
                     LEQIDAKRDSLYSQRRAAGRAFYPALDALTTAQTSLNAASLEHDAYTRHCRDRDAARR
                     RKADISTEQTELRRQHSHYEQLEKALPQLHEIARLAQALAAQADLAPLPPGMGATITT
                     ALATEATASTRHAEAVAHATELARQTVVPLIETTLDSLREPMSQTRALGEVVRQHRAH
                     RVEYAQKQRSIDESLASLRQRLGRGADADLNQSRPGRETLDAIRTLADAQADWQGRHA
                     TLAQQTGQTDMDIARRQQRLASLRTLGHDTALHVDPAPFASLVGERKRLELRAAALAH
                     RQTALTARLHALGVDTLAQLHALPCPPMEGVRQEAERQSSLRAEQDRLGAALAAEHER
                     HTKLAAQLARLEQTGSPLAPGMLHAARARRDTLWHEIRATYLNPETPPADPSAATRHA
                     QVSALEAAMEQVDALSAQLLDQAERMARMEGLRHDMTHCADTIDLHERTLAAMQTRMA
                     RHWQDFTAPFRIPAPHASTPEALHAFVLARSQLLSDAGQIATEQALLAEERIKPDTLH
                     ESLRRLAERLGVASDLELGPCVEAVTAAMRQHTSAHEEYTRLHRELDDLLPVQAQLHQ
                     QAHTMQAQAQEWKQQWATAMHEIGLEANALPPVACALATEWAAAPAQLERLSELHEAC
                     VQADQAECKLTQVIDEIRPHLPMSLSADGVEAAQELDQLWQDTRKGRHQREALLPTLA
                     KAQQDMEAHEASLSRARSSVGQLLERTHAAGPEALGQLATRLALRDRLAQEHAQALHA
                     LSCLTGGQSPADLERAIDGRTLPELQAETARIHDRLKDLDLQRDNAVRAEQDEETALR
                     AFEHNTDAPEAAARREAAIASLHQIVEEYAELTLARNLIANAIDRVRATEQDPLVTRA
                     GQFFSLATLGGFGAIRTELDQKGAPVVLGLRHDGSHVPVSAMSAGTRDQLFLAFRLAS
                     VETYCRATEPLPFVADDLLVQFDDVRSARTLRVLADFSRTTQVLLFTHHDSIREMART
                     LQAEGTAVNLVELPRIPAAVGA"
     CDS             complement(318634..319905)
                     /codon_start=1
                     /locus_tag="GLX_02700"
                     /product="metallophosphoesterase"
                     /protein_id="BAK82682.1"
                     /transl_table=11
                     /translation="MAGMDEFRFLHAADLHLDSPLLGLTEKSGDYARLVADASRRAFN
                     DMVSLAIESKCRFVVLAGDVFDGDLRDTQCGLFFINGMARLQAAGIRVFMILGNHDAE
                     NRFARHLHITDNVHLFATTGAETCLMEDLGVAVHGHSFARRDVRDNIARQYPPPVPGL
                     FNIGILHTACQGREGHETYAPCTLEQLINHGYQYWALGHIHTHEILHRDPYVVYAGNL
                     QGRHAREAGPKGASLVTVRDGKVADVEPKVLDAVRWACERVDLTNTITHEEMGTRIRS
                     TMRDVVAQAQGRPVALRLELVGATALHADLLRDRRELKLEIEAILASVSDQIWLERLK
                     VETSAPVRPAMLDPSTGGRIAADIRAAATPDALLAELDTIITTILERLPPLPDRKEEI
                     RASILHDVPARARDLALSLVENPEGADNADQ"
     CDS             complement(319943..321412)
                     /codon_start=1
                     /locus_tag="GLX_02710"
                     /product="aldehyde/betaine dehydrogenase"
                     /protein_id="BAK82683.1"
                     /transl_table=11
                     /translation="MALKLANSSLFRQNALIDGTWRPAADGARRGVHNPATGALVAQV
                     AECGAQDVTHAIAAAVTAQAEWRNRTGAQRQVILTRWHDLVMDSLDDLTTLIVTEQGK
                     PRAEAAGEIRYAASFLQWFAAEAMRAYGDIIPPTNPATRLSVIRQPVGVCAAITPWNF
                     PAAMITRKAGPALAAGCAMIVKPSEQTPLTALALAELAQQAGVPAGLLQVLPGDGVIL
                     GKALCASPEIRKLSFTGSTQVGRILMAQSAPTLKRLSLELGGNAPLIVFDDAHIKQAI
                     KSAIAAKYRNAGQTCVCANRILVQDGIYDDFATRFARVVAKLRVGPGSDPDSVIGPLI
                     STGALEKVEEHVHDAVAHGATVMCGGARATAGDLFYQPTVLRDATPAMRIAREETFGP
                     VAPLFRFHTEAEAIAMANDTQYGLAAYFFTRDHARAHRVAEALEYGMVGHNTGLISNE
                     VAPFGGIKQSGMGREGSRYGMDEYMEMKYICTDITDPAA"
     CDS             321713..322615
                     /codon_start=1
                     /locus_tag="GLX_02720"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82684.1"
                     /transl_table=11
                     /translation="MFLRQLTYLIALDHYRHFSRAAESCGVSQPALSAAIRQLESELG
                     ITIIRRTRRFNGLTDEGRRVLDWARQTLAALDGLRQEAAFAQQVAGGTLSIGVMPPSL
                     QAMPLLMESFRTAIPGLHLQVRLGSSTDTIHGLRQQQLDLGLVYLDQIPPDGPFETRS
                     LYTEQHVLVAAEPLELPAGRQDWSCLADLPLCLLSPEMRTRQIVDAAFGQAGVTPTIM
                     LETNSLEILYGEVLGGRLASILPVAALPTHTGRNRLQIRPLGACAVPEVGLVRLAPTQ
                     PTTLATRVWEIAATLEMRDVFAIG"
     CDS             complement(322724..322969)
                     /codon_start=1
                     /locus_tag="GLX_02730"
                     /product="transcriptional regulator cold shock protein"
                     /protein_id="BAK82685.1"
                     /transl_table=11
                     /translation="MFAWVPVTQGGQHMAAGTVKWFNAQKGFGFIQPDDGSADAFVHI
                     SAVEQAGQQTLNEGQAVTYDLERGRNGKSSAVNLKIG"
     CDS             complement(323224..323913)
                     /codon_start=1
                     /locus_tag="GLX_02740"
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="BAK82686.1"
                     /transl_table=11
                     /translation="MLLHIPALLNVDELAYCRETLKNAQWTDGRETAGVQSAKAKNNL
                     QLGRDTPACRELGEIVLRALGRNTLFNSAVLPYRVSPPLFNRYENGMQFGAHVDNAIR
                     GILAGGIHTRIRTDVSSTLFFSDPDEYEGGELTMHANGNEQAIRLPAGDMVLYPTTVL
                     HSVTPVTRGSRLAAFFWSQSMIAEESRRQIMFDLDMQVTSLRERLGDGDPAVLSLTNI
                     YHNMMRQWCIL"
     CDS             complement(323939..326365)
                     /codon_start=1
                     /locus_tag="GLX_02750"
                     /product="TonB-dependent outer membrane siderophore
                     receptor"
                     /protein_id="BAK82687.1"
                     /transl_table=11
                     /translation="MTDKTPHPVIRPRLRPFSLLTASMALACATGGAQAATDPAANTP
                     KTSDTAKTASAPDKAPTMQDLYNHTSDTSHDLTHVTASPMNVLHEPIGLSRMPQDAMH
                     TPQNVNVVPQILMQQQNVKSLDEALKNVPGITASVGEGEGGMAGDQFLIRGFAAQNDI
                     YENGLRDFGVYTRDSFYYDHVSVIKGPSSEVFGNGTTGGAINIVTKTPHLGNSYQASF
                     SGGSGSYYRGTMDVNYQLNSSTAFRLTAMGNENNVVGRDALYSHRWGIAPSIAFGLGK
                     KVSFVLEYFHQNDNRIPDYGVPVVYSSANAIGRPVTEYGVKRTNWYGTSYDQDDSSTD
                     MITGRLTAKVSPILTLYNDMRGGIFHRYFSASQEACSNFSSGAVLKNNTFGGVSPSST
                     CQSDFFSSNPAAAQVARNGGVGGPEPYRQSDWSIQDVFSGVAHLKTGHIRHEIIGGFD
                     MEYVTDHRQNYAYGSNRPGTSLLDPSPAVPGLLLGDCAQYPNRLVNIGNGVGRKCYKD
                     SDALDVGFFLSDQVWLTDYLSVKAGFRWDNWNSHYSATGGSTATPDVHYGQNETTINP
                     SVSIMYTPRSNLMVYFNWSESTTPLSLYVTNSSEPMTAKSATASPERSRLYEVGAKYS
                     AFHDRIGFTAALFRLEKNNAVQTDPSTGDVSATSDQERNQGLELSVSGTLLRNWMFYG
                     TYALYDPTITKTGSPTSKLGGQIQYVPHNQATAWTSYEIAPRKPWNMAIGGGITWRQG
                     VWLDQANTARVPATVEFDAMVSHHFDNHWKVAMNAYNLDNRLNYGSLFSNRVTPSIGR
                     SFLFNISAQY"
     CDS             complement(326577..328298)
                     /codon_start=1
                     /locus_tag="GLX_02760"
                     /product="porin B carbohydrate-selective"
                     /protein_id="BAK82688.1"
                     /transl_table=11
                     /translation="MTKQIRHARNGRARHPFFRTRTWLLAMGTATTALPAAHAQVAPA
                     GGVPSLVSVNAVPAVPATSAPQASQIRLNMIDAERLGPTPQAIRRPPNTPIPPSGVPL
                     YPSAGLATISVAPVSSPGDSKAFHKIELDALTHHEGPSGFLPAWVDAQHDSDLEDPYY
                     VPTAGSGHLVPQLSPLRNRLRDHGVSFAFTYKGEAMGVINGGVKRGMSYVHELTAQVN
                     FDLEKMAGIKGWSVHTLVMERAGRAVSHDRVGEYYVNLQEVYGLSGNVVAHLVDFYAE
                     KKLLDNRLDVTFGRMALTHVFATSPLLCSFMVTCSAPVALKLDPGFSVYPKATWGSRI
                     RMRPTRDTAIQLGAYSVNALSDNPSGWAWGSEKATGLMLPVEFTWQPFLTRNRLPGHY
                     VLGYAHDTTRYPDQVGIGLPAALRTAAGHQRSAPMDMFWFEGDQMVYRRGGRNQMAGG
                     YLMAGYIHNTPHVTSISDQAYGGLSFAGVIPSRVTDRLGIMYSWYHVSHRKEEGQILR
                     YEAGYSLGTSVRAPQTNSHIIEAYYAIDAVPGILVQPEFEYMIRPGETKHIPNAALVG
                     LKVIANL"
     CDS             328604..329848
                     /codon_start=1
                     /locus_tag="GLX_02770"
                     /product="two component sensor histidine kinase"
                     /protein_id="BAK82689.1"
                     /transl_table=11
                     /translation="MVSPMSAHGAGREWGNGVAALVLLVVGLIVGALGVWFVLNRHAV
                     AERLPYYPAMRVAVDPVHGVDEDTIAVDDLPVALLVLGRNGRLLHAGARAQGEFAEGL
                     GAMIRHPALQRAVSELQPGSVTEVRIEADVPVRRVVQGFVKAALWHGHPACVVVLLDA
                     TARDALDRARSDFVAHASHELRTPLAALIGFIETLQGPAANDGAARQKFLGIMARQAS
                     RMQRLIDRLLYLSRVQMLEHQRPQGQVLLTDLMGRLRDELQGKPAEERAALVVHAAPP
                     GSLRGDADQILQVLVNLCENALRYGRPQSPAVPRIEIGTQWLETGGLLLSVRDNGPGI
                     EAQHLPRLTERFYRITQPAGRNTGDQGTGLGLAIVRHIVDRHGGRLDITSVPGEGTCC
                     TVWLPGQPLAAGEGDGSGIHTD"
     CDS             330130..331152
                     /codon_start=1
                     /locus_tag="GLX_02780"
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="BAK82690.1"
                     /transl_table=11
                     /translation="MNILPGEYGMSAHSEYKLAELERETRIGGAGICVAREIPRIDIS
                     DYAHRKEAIADALWEAATQVGFFQVFNHGIPEEDIDAAFATAGEFFDLSMAEKERHAR
                     RPDSNAGWEYRAQVRPSTGTPDNKESYQITLPDMAGLWPTATELPGFKERMCRFERQN
                     WELGMKILSCFAIRLGFDADFFTHNHDPASPYYQSTLRLIHYMSMEAATDADFDLWRA
                     GAHSDFDCLTLLHQRPGQGGLQVCPGMEADAPAWTDVPPLRGAVTCNIGDMLMRWSDD
                     RLRSTLHRVRMPRRDEYLGPRLSLPFFCQANRDAVIQGPLKKYAPITASDYLNERIRA
                     NYTPRA"
     CDS             331614..332084
                     /codon_start=1
                     /locus_tag="GLX_02790"
                     /product="hypothetical protein"
                     /protein_id="BAK82691.1"
                     /transl_table=11
                     /translation="MPLSASPQWWIGTSVDRIGSVVRHAAQAGDHTAAGGIRLMLFSI
                     GLNILLLRQLKRQRRDAASSVITALLRALAHYRPASLRGIAVVRADPGNGCLLEVLAC
                     HDGIGRTATVCITVMEAGVEYPACRSGHGVRYSHLSVACSHAVPGMMVGSGVAS"
     CDS             332103..333143
                     /codon_start=1
                     /locus_tag="GLX_02800"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82692.1"
                     /transl_table=11
                     /translation="MIGQKVARCFVYVCRTRPAPVDRGLKTQGMRKGYDLDLLRSLQA
                     LIEEEGVSHAARRLHISEAAMSRSLAKLRVVFGDPILVASGRRMVATSFALGLRERVQ
                     ALVNGADALLEEQEAPDLAGLAPHFTLRANDLIVGAFGAAILTALRLECPGCAITFAP
                     ETDEEPSDDLREGRVDLYLGATDDMRPEIRRQSLFPTSFRALVRADHPILSEGITPAS
                     IARYEHISVSRRGRLHGPIDTVLKERFGLKRRVVMVVPTYYAMVETLRMTDMILPLPG
                     IAIDYLPIRSMYLAAFEFPFDLPSVHPFQAWHPRRDSDPVHRWLRNTVYRVVRQRGEG
                     PPEGFSPTPAGP"
     CDS             complement(333343..334599)
                     /codon_start=1
                     /locus_tag="GLX_02810"
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="BAK82693.1"
                     /transl_table=11
                     /translation="MKIIVLGSGVVGVTSAWYLAQAGHEVTVVDRQPEAGLETSFANA
                     GQVSPGYSSPWAGPGVPFKAVKWLMMKYRPFVFWPMPDPHLWKWLVQMLENCNTSAYD
                     RNKGRMVRIAEYSRDVMRDLRASTGITYDDRQQGTLQLFRTQKQMDGIAGDIRVLEQY
                     GVPYELLDRGECVKAEPGLGASAHKIVGGLRLPGDETGDAFLFTQRLAAKAAEAGVTF
                     HYDTSIRTMTAEGGRITGIETSRGQMVADSYVVSLGSYSPAMVRKLGLDLPIYPVKGY
                     SLTADIINEKQAPVSTIMDETFKIGITRLGNRIRIGGTAELAGFSTTLRAPRRETLEH
                     SVTDLFPGGGDIAGAKFWTGLRPMTPDGTPIIGRTRYDNLFLNTGHGTLGWTMACGSG
                     KVLADIMSGRMPDIAHEDLGVVRYGQ"
     CDS             complement(334634..335779)
                     /codon_start=1
                     /locus_tag="GLX_02820"
                     /product="alanine racemase"
                     /protein_id="BAK82694.1"
                     /transl_table=11
                     /translation="MTNLPFPTPATGWAAPGAGAMLEISLGAIAANYRLLNARAGQAT
                     CAAVVKADAYGLGAHKVAPVLEQAGAKVFFVAHLEEGIRLRAHVSPAAEIFVLHGPMP
                     GTEQEFTRHALLPVLNSMEQIAGWHAHATQTQQALPAAIQVDTGMSRFGLSEADVAIL
                     AATPALLEGIDTRLVMSHLACADTPDNPANAMQRDRLRAMAALLPAAPLALSASSGIF
                     LGPDYHFDLVRPGAALYGLAPNADAPNPLHPTVRLQARIVQRRTIGAGNGVGYGLTWR
                     ASGPKRIATLGIGYADGFLRQGANNGGCAWLDSYRLPILGRISMDSTTIDVSDVPESV
                     LDQITHVDMIGPHRSVDDVAHSAGTIGYEVLTALGSRFHRAYLPQVA"
     CDS             335823..336365
                     /codon_start=1
                     /locus_tag="GLX_02830"
                     /product="transcriptional regulator AsnC family"
                     /protein_id="BAK82695.1"
                     /transl_table=11
                     /translation="MRWLMKCPVVQHNIMQLIAFVTQLYTTMSGKFTMPFDRMTDAIL
                     RNLRHDGRMSNAELAQRVGLSPSACLRRVRMLEQEGVIRGYRALVDERSIHGMTTVIV
                     QITLERQTEECLRRFEARVRECADVRECYLMTGDADYLVRVEARDAADYERIHKEELS
                     RMPGVARIQSNFAIRTVVQR"
     CDS             complement(336474..337457)
                     /codon_start=1
                     /locus_tag="GLX_02840"
                     /product="major facilitator superfamily glycerol uptake
                     transporter"
                     /protein_id="BAK82696.1"
                     /transl_table=11
                     /translation="MKYIEINKKRSLSYPTNRTSLFPHPPCSFKNMVELEKDQKVRSP
                     FPSNDNKRIKWANMLKDRQFLGELIAECIAVLIIVLLGDSVAAMYTLYDPSPYKLAYW
                     GVCIVWGLSVTIAIYITGSVSGTHANPAVSISLALYRGFPWRKVPAYCAAQVLGGVIG
                     AALVYTLYQPVIDHYNQLHAITRADGGAAGVFFTHPGEFITPFHAFVDEIILTGLLVF
                     GIFAITCEYNTMAPQANSSALIIGLLVASIGACSGYLEAWAINPARDFGPRLFCFLAG
                     WGDAALPGPDHFWWVPVAGPVLGGVLGAGCYQFLIRPFIPRHAGQAVPPIS"
     CDS             337731..339293
                     /codon_start=1
                     /locus_tag="GLX_02850"
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="BAK82697.1"
                     /transl_table=11
                     /translation="MVSMDETLSPPPVQDSPFDLLVVGGGVNGTGIARDAAGRGASVL
                     LVEQDDLASYTSSASTKLIHGGLRYLEYYEFRLVREALIERERLLRIAPHIIWPMRFV
                     LPYTPQARPAWMLRLGLFLYDHLAPNMTLPKCKSLDFRTSSAGKPLNGKLARGFAYSD
                     GWVQDSRLVVLNAMDAKARGADIRTRTRLVQARRVDGLWEAVIENTRDGSQQTVRAKI
                     VVNAGGPWVSEVLRERAQVETTKNVRLVKGSHIVVPRLFDGPQAYILQNPDKRIVFAI
                     PYEQKFTLIGTTDVPWTQAPGRVEISPDEISYLCESVSRYFTKPVTPADVVWSYAGVR
                     PLYDDAAKNASAVTRDYVLDVDTQGNQAPMLSIFGGKITTFRRLAEHAIEKLQPFLPV
                     LSAPGWTADKVLPGGDLGEGGFEGAMGRLAAKAPFLDQQLCWRLVRNYGSRADVIVGD
                     ARSMEDMGEQFGGGLTAREVEYLIAHEWAQTTEDILWRRSRLGLHVTDEDAGRLDTYL
                     RGRQPVAAKAAS"
     CDS             339383..340882
                     /codon_start=1
                     /locus_tag="GLX_02860"
                     /product="glycerol kinase"
                     /protein_id="BAK82698.1"
                     /transl_table=11
                     /translation="MNKKNRILAIDQGTTSTRSIVFDRDIAALSVARVEFAQHYPNQG
                     WVEHDPEEIWSNVLSTAREAIEKVGGPATIAGIGITNQRETIVVWDRKTGKPIHRAIV
                     WQDRRTTPVCMRMHEQGHEPLVRERTGLLLDPYFSATKIAWILDNVDGARARAERGEL
                     ACGTIDSFLLWRLTGGRVHATDMTNASRTLLFNIHTCMWDDELLALFNVPRAILPEVR
                     TNSEIFGETEADLFGEPLKVAGMAGDQNAAMVGQACFKPGTAKATYGTGCFALLNTGT
                     TPVKSENRMLTTIAYRIGKETVYALEGSIFVAGAAIRWLRDGLGLITHASQTDDMATR
                     VPHSHGVYMVPGFVGLGAPHWDPDARGLICGMTLGSTAAHIARAALESVAYQTLDLME
                     AMREDGGGRLNALRVDGGMSVNDWFCQFLADMLQTPVERPQQVETTALGAAFLAGLAT
                     GVWGSISELEGTWTRGRLFRPTMDKEQRDSMVAGWRLAVRRTLSSTVAA"
     CDS             340918..341904
                     /codon_start=1
                     /locus_tag="GLX_02870"
                     /product="fructose 1,6-bisphosphatase"
                     /protein_id="BAK82699.1"
                     /transl_table=11
                     /translation="MTSTRHNPYQVTDRNLALELVRVTEAAAVAASAWTGRGLKNEAD
                     GAAVEAMRRAFDTVAIDGTVVIGEGEMDEAPMLFIGEKVGAGGPGMDIAVDPLEGTNL
                     CAKNLPNALTVVALAESGNFLHAPDIYMDKIVVGPYLPEGVVDLDSTIEANLKSLAKA
                     KKRDVSELMVCTLDRERHEELIARARAVGARVTLLSDGDVAAAIAACLDDSEIDLYVG
                     SGGAPEGVLAAAAVRCVHGQMQGRLMFEDDGQVERARKMNPGADPSRKLALEDMARGD
                     VLFSATGVTGGELLRGIRRSGVRTVTHSLVMRSKSGTIRFVEGHHDYQTKNW"
     CDS             341953..343059
                     /codon_start=1
                     /locus_tag="GLX_02880"
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="BAK82700.1"
                     /transl_table=11
                     /translation="MTETATTASARLGLRPGVVTGADYRRLVETCRDEGYALPAVNVV
                     GTDSINAVLEAAARNRADVIIQLSNGGARFYAGEGMKDAAQARVLGAVAAARHVHTVA
                     AAYGVCVILHTDHADRKLLPWISGLIDASEEAVKETGRPLFSSHMIDLSAEPLEDNIA
                     ECARFLRRMAPLGIGLEIELGVTGGEEDGIGHDLDDGADNAHLYTQPEDVLKAYEELS
                     PLGFVTIAASFGNVHGVYAPGNVKLRPEILHNSQAVVAAATGRGERPLALVFHGGSGS
                     EQAKITEAVSYGVFKMNIDTDIQFAFASSVGRYVQEHAEAFSHQIAPSTGKPTKKLYD
                     PRKWLRVGEMGIVERLEQSFADLGATGRTVARMV"
     CDS             343092..343850
                     /codon_start=1
                     /gene="glpR"
                     /locus_tag="GLX_02890"
                     /product="glycerol-3-phosphate regulon repressor"
                     /protein_id="BAK82701.1"
                     /transl_table=11
                     /translation="MSAEERHHEITALVRTQGYVSNEELAQRLNVAVQTIRRDVNHLA
                     RRGLVARHHGGAGLASSVENIAYSERQVLNRRAKEAIGHLAARQIPDNSSLFVSIGTT
                     TEAFAKALRRHKALRIITNNLHVATPLSAQTDFQVIVTGGQVRFYDGGITGSTASSFI
                     EQYRTDFAVIGISGIEEDGTLLDFDADEISVAQAMMRNARRVYLLADQTKFGRRPMGR
                     LGHLSHVHGFFTDRQPSERISAMLREHDVEVHIA"
     CDS             complement(343872..344633)
                     /codon_start=1
                     /locus_tag="GLX_02900"
                     /product="oxidoreductase"
                     /protein_id="BAK82702.1"
                     /transl_table=11
                     /translation="MTATHTGRIQDRIAVITGAASGIGRATAERFAAEGAKLVLTDLN
                     TDALDELVSQLKKNNVAVIAVPADVTSEADVQRVMHEAMKHFGRIDILVANAGVIPEA
                     DLASATAELWDHTMAVDARGMFLSCKYAAAEMVHAGQGAIVCLSSISAFAGQKGQAVY
                     GPAKFVASGLTKHLAIDLADKGVRVNAVAPGTIDTPAVAGMDAEGIRKVVDMHPMGRM
                     GRPAEVASAILFLASDDASFITGAVLPVDGGYLAQ"
     CDS             344953..346308
                     /codon_start=1
                     /locus_tag="GLX_02910"
                     /product="NADH dehydrogenase"
                     /protein_id="BAK82703.1"
                     /transl_table=11
                     /translation="MGHSRFPFLWDWCAGKRVWSIIEMAQKFRIVIVGGGVAGLALAT
                     RLGNSVGRSGQAEITLVDKSFAHVWKPMLHCFAAGTAANENDRISFMSQASRHHFEFW
                     PGEITALDRTAKTISLAPIRDQMSGEVVVDARTLDYDAVVLSIGSRANDFGTPGVAEH
                     CLFIDNLVDANGFNDRFRMELLRAFANGQELDIAIVGGGATGTQLAAELHKALDLASL
                     YSFGRQPPRLRITLLEAGPRILPAFPEAVSAAAVKQLEAIGVSVRVGAMVSGADENGF
                     LLKDGSRVPATLRVWAAGVKAPDVTSKFGNLKLSRSGQLEVRPSLQVMEDDNIFAMGD
                     CAFIAEKPVAPTAQAARQQAHHLARVLPGWIKSGNPLPAFAFHNKGAVVALGDYNGWG
                     TFPGGTVFGGGWLHGLSARLVHLMLYRQHQFELYGPVRGTISCLVDWLDVFVRPSVRL
                     D"
     CDS             complement(346353..346775)
                     /codon_start=1
                     /locus_tag="GLX_02920"
                     /product="transcriptional regulator Rrf2 family"
                     /protein_id="BAK82704.1"
                     /transl_table=11
                     /translation="MHSIRERTAIALVIMLDVAFHGAMERPVSTIEIAGRSSLARRGL
                     EPILQSLARAGLLQGVRGPHGGYRLAIPAREILLADIFRIAMHDSPHAVDRRQGALFN
                     TVIRPFLDQMDGLLVHEYSKLTLQDFVRQAEMRGLDRP"
     CDS             complement(346768..347850)
                     /codon_start=1
                     /locus_tag="GLX_02930"
                     /product="ABC transporter sulfate transporter ATP-binding
                     protein"
                     /protein_id="BAK82705.1"
                     /transl_table=11
                     /translation="MSVQLEQITRLNPSNGRPIVDGASLAVADGSFTALVGPSGAGKT
                     SLLRIIAGLDPHNSGHVLIDGTRMDGVGAAARNIGFVFQHYALFAHMSVAANIGFGLS
                     IRPRGSRPRRDAIARRVEDLLDLMQLSGLGGRYPHELSGGQRQRVALARTLATGPRVL
                     LLDEPFGALDPLVRRQIRSWLRDVHEKLGLTTILVTHDRQEASELADMVVLMHHGRIV
                     QAGTPQALEDTPADPFTMAFTGDVVRLDGRVENSIFTPDLPDILPVAAPVAAGPAELL
                     VRPIDIRLRPGYGQATATLRQARGPLGLYTIHLGTQTLQVETLIPPDAAPVAHCALDV
                     SAGRLARGAAWATVTSLPPSGESVHA"
     CDS             complement(347847..348650)
                     /codon_start=1
                     /locus_tag="GLX_02940"
                     /product="ABC transporter sulfate transporter permease
                     protein"
                     /protein_id="BAK82706.1"
                     /transl_table=11
                     /translation="MPRLLFTTVIYLLVGFMVVLPPVLVFATALSHGLGTALATLTDP
                     DGLSAIRLTLAVTVMSVLINTIFGTMAAWTLAHFRFPGRNLLVVLIELPLSVSPVVGG
                     LVWLLVFGTQGWWGAALERWSHPIVFAQPGIVLATVFVTFPYITRTLMPMLTHNGREA
                     EEAAVMLGANLWQVLWHVTLPGARLALLSGVLLTTARAMGEFGAVSVVSGHIPGLTET
                     MPLHIETLYNGYQTVAAFTMAALLALMAMGVVLARSLTERRHGQTEERA"
     CDS             complement(348664..349530)
                     /codon_start=1
                     /locus_tag="GLX_02950"
                     /product="ABC transporter sulfate transporter permease
                     protein"
                     /protein_id="BAK82707.1"
                     /transl_table=11
                     /translation="MKASRRALFPALHRQPDPLPGFGLGLGMTMFWLGAIVIVPMAAL
                     VARPWGEGLHSGLHAFAHAAHDGRMQAALWVSFTSALFAAVADLVPGVLIAWALVRSD
                     IPGRRIIDMLVELPFALPTAVVGITMATLYGPNGWIGGPLARHGVHVAFTQSGIVLAL
                     MFIGLPFVVRTIAPVLRHLPRDVEEAAAILGASRMQVIARVVVPALYPALVTAAGMVF
                     ARSIGEYGSVIFIAGNQPFHTEIAPLLVVIRLQEYDTQGASLIGFVLVVVSLLSLGAI
                     SLLRRRLSYGMD"
     CDS             complement(349527..350552)
                     /codon_start=1
                     /locus_tag="GLX_02960"
                     /product="thiosulfate-binding protein"
                     /protein_id="BAK82708.1"
                     /transl_table=11
                     /translation="MTKMPFLPRRSLLQATFAVATTLAFRPLQARAATGILNVSYDPT
                     RELYQDIDAGFTRQWAQQHGGVPVQVRTSHGGSGAQTRSVLEGAPADIVTLALAHDID
                     VLAHSGLLATNWQGRLPHNSTPYTSTIVFLVRKGNPKGIHDWPDLIREGVQVITPNPK
                     TSGGARWNYLAAWGWALRQPGGTPETARAYLKALFSHVPVLDTGARGATNSFVQRGLG
                     DVLVAWEAEALLATREIGPDQFDMVVPPVTILAEPPVAVVDRNAKAHGTMELAQAYVE
                     YLFSDAGQKTGAKHYFRPVDPAILAQNRERFAATSTFDIASLGGWNTVQATHFADGGI
                     FDAIYTK"
     CDS             350967..352748
                     /codon_start=1
                     /locus_tag="GLX_02970"
                     /product="hypothetical protein"
                     /protein_id="BAK82709.1"
                     /transl_table=11
                     /translation="MLPSPATTLNHRYSRRFVLCAHVVRTSRKAAEFPVLAMLLSLPS
                     GVAMLGHGAYAADLQAVPPGQADHAGTRTASHPENVVVHIQPRPPIQTYPHANPVGQP
                     LRMSGAENRKNGHQYDWGVFNRGNGEAAGFGPVGVYGVAPWAEDWSRLRTGRKSSDPF
                     DVLKYIPLTRSGNVWISFSGETRLRNWFESRPQLGTQKPNDSGRFGVRNLYGADLHIG
                     SHLRFFGQLVNADAAGWGGYGYGSTYRKRLDAQQAFVETRWNMLGAKSGFIFGRQQFL
                     DAPSYMLYNRETPNVPLSWDGFRAYMVWKRIRIDGWDFVQTYDSENKMFHDTENYATR
                     LYGFNTTWAPPDFTFMGQKGYSFLDAFYIGYKLSGSTGAIAGPGGTSVKGSNTRNNFG
                     MRWHGVAGPIEFSVGGIWQGGVFRQASNNMARNVSAYAINSTLGARLPKNSLNTFVGI
                     QTDVYSGGNASDRNGTIGTYVSPFNPQTNYLDTTTYMTASNLISFAPLVRITPFKSVS
                     IQIKYPLFWRDSVNDPVYKSSGFYKFAGNFRGKFIGMAPQASVAWQINTHVSWTQYVS
                     RFMTSRALNEAGGSSGTYYQSNFVFRF"
     CDS             complement(353003..353650)
                     /codon_start=1
                     /locus_tag="GLX_02980"
                     /product="transcriptional regulator"
                     /protein_id="BAK82710.1"
                     /transl_table=11
                     /translation="MKPTAALDAPIPRPGLRERKQARVRDTLIAEAMRLFSAQGYDQT
                     TVDEIADAAEVSRRTLFRMFATKADIVLAWTRGMTQALTEALADCPADMPPAEAMMHA
                     FTALVPHIAANRHDTYAFVYLIEKTPSLQSVSLQKYGKWEDCLAEGLTKHITERKNRK
                     TAARLMARGGIAIFRTALDEWIRLRGRPALVPLLQKTYALQAILWSQPDQANPDD"
     CDS             complement(353965..354390)
                     /codon_start=1
                     /locus_tag="GLX_02990"
                     /product="transcriptional regulator"
                     /protein_id="BAK82711.1"
                     /transl_table=11
                     /translation="MPQDDIPPSPIADLCRDKGLKLTDQRRVIAHVLSESDDHPDVEE
                     LYRRALAIDPRISIATVYRTVRLFEEKGILLRRDFGGNRARYEKTDHGNHYHLIDAKT
                     GSVIEFEDEVLEVMLRQIAQRMGFDLVTTRLELFGRKLK"
     CDS             complement(354606..355172)
                     /codon_start=1
                     /locus_tag="GLX_03000"
                     /product="bacterioferritin"
                     /protein_id="BAK82712.1"
                     /transl_table=11
                     /translation="MFFCLKNGKVYDIQSKQFSSMKKNSIMPIKDPKVIEFLNTQLTN
                     ELTAINQYYLHARTLRHWGVTLLGKKEYEESIEEMRHADWLIERILYLGGLPNVQRYN
                     QILVGQDVEEILKCDLKLEEKAIGDLREGIAYCESVRDFVSRDLLLKILVNEEEHEDF
                     LDRQFDLIKQVGIQRYIQLNSAPAPDQE"
     CDS             355479..356417
                     /codon_start=1
                     /locus_tag="GLX_03010"
                     /product="permease"
                     /protein_id="BAK82713.1"
                     /transl_table=11
                     /translation="MLSTIIAAMLPLVVIFVLGYAAGWRGDFNGGQVAILNRMVMLYA
                     FPLSLFVGIARMPRTILAGQLPLAASIFGIMCLSFVVCYGLSRFVFRRTPATATLQGL
                     AMAAPSVPFIGSAMLPVLIGQSTTAVVISASVFAMVLVQTPLCMVMLARNEKEGEDGA
                     PLRLGHQVIVSLREPIVWAPIAATLLVACNVHFPASLLNAFALLGNAAAGVALFASGI
                     VLFLQRVSITVPVLVTVAVRNIVVPGLSWLGLSLTGLSHDAMRAAVLALSIPVGTVVV
                     ILAVRFGTDEQEAASTLFLSAVVSVLTMAFFIACTV"
     CDS             356752..357744
                     /codon_start=1
                     /locus_tag="GLX_03020"
                     /product="hypothetical protein"
                     /protein_id="BAK82714.1"
                     /transl_table=11
                     /translation="MMKRTFRTNSDTSLTVPPGNYWRCTPVMTEGIDRTRELWERSRL
                     REEVLDDIDEEIELELDDSRLGSDKDHGTPDSRRTYFRELLRLQGELVKLQDWIKETG
                     HRLVVICEGRDAAGKGGVIKRITQRLNPRICRVAALPAPNDRERTQWYFQRYVSHLPA
                     AGEIVLFDRSWYNRAGVERVMNFCTDAEYEEFFRSVPEFERMLARSGIQIIKYWFSIS
                     DDEQEMRFRARMEDPLKQWKLSPMDLESRRRWESYTLAKEIMLERSNIEEAPWWIVPA
                     DDKKRARLNCISHLLSQVPYQEIQKPEVRLPERVFSPDYLRQPVADDMIVPQTY"
     CDS             complement(358087..359442)
                     /codon_start=1
                     /locus_tag="GLX_03030"
                     /product="phosphate transporter"
                     /protein_id="BAK82715.1"
                     /transl_table=11
                     /translation="MLHFAPYSTFSILALVICFALVCVFEFVNGFHDTANAVATVIYT
                     NSLKPRTAVIWSGLMNFVGVLLGGISVAYGLVELLPADVLSPSNGDPAVPMLISLFGT
                     ALAWNLFTWWFGIPNSSSHCVIGALIGIAIGDALLHTRSLGNSVDWSQIWKILRALAI
                     SPLLGLIGAGGLYFVVRHLIKDPELYQPPQGDRPTRGWVRGLLILTCTGVSFSHGSND
                     GQKSIGLIMLTIIGILPATFALAPDSATQISQISHNATIAAPLITQYDHDGLHDEAIA
                     SVTRLTQTNPDTVVASVLRADIYEVVAGLKAVAANTEASAHDRATAKTLSNQIRPVVE
                     YAPWWVRLLSALCLGIGTMIGYKRIVLTLGEKIGNTHLTPAQGASAELVGAGLIATAG
                     YTGLPVSTTHIITAGIAGTMLGSGSGINRGMLVKIALAWICTLPVTITLGAALFYVLN
                     I"
     CDS             complement(359570..359815)
                     /codon_start=1
                     /locus_tag="GLX_03040"
                     /product="hypothetical protein"
                     /protein_id="BAK82716.1"
                     /transl_table=11
                     /translation="MTGSSLMFESSIIEVDGVFVGVVLQDGPLEPYRFRAMHERVTQM
                     DGDTLPTFEAAVSRVRARFRMGSGKTPRMAEPVRRRA"
     CDS             360059..361036
                     /codon_start=1
                     /locus_tag="GLX_03050"
                     /product="ABC transporter phosphate transporter permease
                     protein"
                     /protein_id="BAK82717.1"
                     /transl_table=11
                     /translation="MMELPSSLTAQDGSVVDGNAHGRLGDVVFGMVARLAGWSILMVM
                     TGIILVLVWGGRQAFFTFGPTFLTSTAWNPISQNFGAATSIFGTLVTTAVALLFAVPF
                     AFGVAFWLVEMAPPALARFIETAVQLLAAVPSIIFGMWGFFIVVPFMAHYVEPTATHY
                     LGHIPGIGLLFRGAPYGTGLLTGGIILAIMVTPFICSVMTDVFVSIPAVLKESAFGLG
                     ATRWEVMHQVVLPWSRQAVMGGIMLGTGRALGETMAVTFVIGNSNRLGWSLFAPGNTI
                     ASLIALEFPESSAGSLKLSALLALGAILMIISFVTLACSRIFLQRGKVN"
     CDS             361049..361945
                     /codon_start=1
                     /locus_tag="GLX_03060"
                     /product="ABC transporter phosphate transporter permease
                     protein"
                     /protein_id="BAK82718.1"
                     /transl_table=11
                     /translation="MSAQKSQPVTGSGWQRGGAQAVQRRLVERLVSLLCNIATVVVLF
                     LLFSILWTLVTRGAAGLSLSTFLHSTGAPGSGGGLANAIVGSCEQTGLAALIGTPIGM
                     MTGIYLSEFGQDGPIVQLVRFVSDMLLSVPSILVGLFIYLIVVEPAGHFSGMAGTLSL
                     AVLFIPIVVRTTEDMLQLVPRAMREAAYALGAPGWRVILSVCLRSARGGIMTGILLAL
                     ARISGETAPLLFTSLGNLNWSTSLNAPMASLPVTIYQYAGSAYDDWVQMAWTGALLIT
                     VAVLATNILARWWLTRNGSAQQ"
     CDS             361942..362739
                     /codon_start=1
                     /locus_tag="GLX_03070"
                     /product="ABC transporter phosphate transporter
                     ATP-binding protein"
                     /protein_id="BAK82719.1"
                     /transl_table=11
                     /translation="MNKIIMDNSTGQNVAVPALAIRGLDFWYGANHALKSISLDFPTR
                     QVTGMIGPSGCGKSTLLRCLNRMYDLYPGQRATGQVLFDGRNILAPGLDVNVLRSRIG
                     MVFQKPTPFPMSIYDNIAFGVRLHERLSRTEMDQRVESVLRRVALWPEVKDRLGASAA
                     ALSGGQQQRLCIARTIATRPEIILLDEPTSALDPISTARIEELLDELKQEFSIAIVTH
                     NLQQAARCADRVAFFYMGELVEVDTADKMFTAPHAKRTQDYITGRFG"
     CDS             362751..363452
                     /codon_start=1
                     /gene="phoU"
                     /locus_tag="GLX_03080"
                     /product="phosphate transport system protein phoU"
                     /protein_id="BAK82720.1"
                     /transl_table=11
                     /translation="MTMPHESVHTVQSYEQELEQLRSFINRMGGVVERQVAQAITAVV
                     EHDEIAARDAPEMDPYVDELERETEALVIRLLALRAPMAGDLREVVVALKISGDLERI
                     GDCAASIARRAMRNELLSCPISLTGLRSMGRLVQENLRRTIDAMDQRDPELARIVWQS
                     DTAVDELYVSMFRELVTYMMEDPRNIGPCTHLLFIAKNLERIGDHATNISERVYYAVT
                     GNTLPIVRPRGGTFD"
     CDS             363644..365098
                     /codon_start=1
                     /locus_tag="GLX_03090"
                     /product="D-Lactate dehydrogenase"
                     /protein_id="BAK82721.1"
                     /transl_table=11
                     /translation="MQANLLCPDTIMNECAPSPATRLSAALASLDAQGLSAQVSTSPS
                     VLETHSHGEAMDAACLPGAVFMAESTEQVAAVLRACHANRVPVVAFGAGTSVEGHVTP
                     TPHAISLDLSAMTAIVEVNAEDLDCRVQAGLTRQALNARIRDTGLFFPVDPGGEATLG
                     GMCATRASGTAAVRYGTMKENVLGLTVVLATGEVIRTGGRVRKSSTGYDLTSLFIGSE
                     GTLGIITEVQLRLHGRPESVSAAICQFADLDDAVQTAMEIIQCGIPVSRVELLDSVQM
                     AASIRYSGLEGYEPLTTLFFEFAGGPAAVQEQVAATEAIALSNNGRGFAWADTAEERT
                     RLWKARHDAFWAAKAIEPGARVISTDCIVPISRLGELIAGVRDDISASGLRVPLLGHV
                     GDGNFHALIITDNTEPGGALALALDRKIVARALALGGSCSGEHGVGMGKLEFLETEHG
                     DGTLAVMRALKNTMDPRNILNPGKLLPPGRLYQG"
     CDS             365134..365820
                     /codon_start=1
                     /locus_tag="GLX_03100"
                     /product="nitroreductase"
                     /protein_id="BAK82722.1"
                     /transl_table=11
                     /translation="MRPWRIVVLRYRVRFCFPAQTGIAMTEAPQRQSDTPVERFILDR
                     WSPRAFTPAPITDAELLAFLDAGRWAPSAYNAQPWRFIYARRGTAEWERFLSWLIPFN
                     HSWAQNASAIVYVASHTVTGSDRAEPVPAPTHAFDAGAAAVLVMLQLSRAGWAAHPVS
                     GFDHDLARAGLELPEDYALNAAIVIGRQGEVDSLPEYLRAREVPSTRRPLAEVAFEGR
                     FLHTPDGNVT"
     CDS             complement(366028..367632)
                     /codon_start=1
                     /locus_tag="GLX_03110"
                     /product="O-linked N-acetylglucosamine transferase"
                     /protein_id="BAK82723.1"
                     /transl_table=11
                     /translation="MSVPTDTITHTLAQALELLRQGRFAHARAMLEGCPPSPRTELLL
                     AHAHAGCNRVQEAARLLCRQAVANPGARHPAQDMLDLLLPHDRADEAEAVLRAVRQRA
                     GQDIRTHDMLGELLLQRGHTAEAQAVLADGLALSPAQLSTGNLMAVCLMEQGEFAAGR
                     DLLRYILQHHPDSAMTHANLAHLLGAWNHNDEALQAHGRALALRPEDARLRLNHALTL
                     LKTGRMERGWAEYEWRRRLPGRQRLPEARMLPVLAPDADLRGKTILITREGGLGDMLM
                     MLRFVPVLAAMGARISVQAPDTLHGLIRRMPGVRRVVGERNMLPAHDWHCPFLSLPHV
                     LHRTKGCDGLPVPYLQADPARVRQWAPFLPVGTGLRVGLVWGGASRPDAPAAFAMDRR
                     RSLPLRRLAPLAGIAGISLVSLQMGTYTKQMHDMPAGMRLYDPMESVHDMDDTAALIA
                     GLDVVVSVDTSVAHLAGAMGCPVLLLDRFDNCWRWLSERTDSPWYPTLRIIRQISAGQ
                     WDNVVHRLCSMLARRDLPPSRLPLRV"
     CDS             complement(367864..368328)
                     /codon_start=1
                     /locus_tag="GLX_03120"
                     /product="hypothetical protein"
                     /protein_id="BAK82724.1"
                     /transl_table=11
                     /translation="MKADAQTPRNGDRLHLPYAIPISRFMNAFAPSAATSAAPSADIR
                     RELARLRSLATLLDAAFRIPGTRARWGLDTLIGLLPVGGTVLMLIPSLYIVWKSWKLG
                     APPAVLSRMLANVLVEGAADLVPVLGDVFDTAFKADLRNVALLEQHFGMVTP"
     CDS             complement(368318..368632)
                     /codon_start=1
                     /locus_tag="GLX_03130"
                     /product="hypothetical protein"
                     /protein_id="BAK82725.1"
                     /transl_table=11
                     /translation="MTDTSHTRPHVSILYCTRCNWLLRAGWMAQELLSTFGEELGSVS
                     LIPASGGRFEITVDSKLIWERKRDGGFPGPKVLKQRVRDVIAPDRDLGHLDRTSPAED
                     EG"
     CDS             complement(368717..370915)
                     /codon_start=1
                     /locus_tag="GLX_03140"
                     /product="catalase"
                     /protein_id="BAK82726.1"
                     /transl_table=11
                     /translation="MHETMPVPTRWTVTSPTIPVILQRSAGTRERFMTKTSHPSHSPA
                     THMGKGGETHQSAGGDIPVLTTQQGVAVSDDQNTLRVGPGGPALLEDFHFREKIFHFD
                     HERIPERVVHARGYGAHGYFELTDSLSDVCKADLFGKVGERTPTFVRFSTVAGNKGSA
                     DVVRDVRGFAVKFYTSQGNWDLVGNNIPVFFIQDAIKFPDFVHAAKQEPDRDFPQAQT
                     AHDNFWDFVSLSPEATHMVCWAMSDRAIPRSFRFMEGFGVHTFRLINAEGRSTYVKFH
                     WKPKLGLQSVVWNEALKINGADPDFHRRDLWQAITGGNFPEWELGVQLFDDEFADSFP
                     FDILDPTKLIPEELVPVRRVGRLVLDRMPDNFFAETEQVAFCTQNIIPGIDFTNDPLL
                     QGRNFSYLDTQTKRLGGPNFTHIPINAPKCPFHNFQQDGHMAMHNPKGRANYEPNSWS
                     QPTGGPRESADGYRSFAQEQSGPKLRQRSESFADHYSQARQFFISQTPVEQTHMRDAF
                     VFELSKVETPAIRARMVSHLLHVDQKLAEGVAMGLGLSPLPRPAVAARPVVTGLQPSA
                     ALSILKNGPDSFEGRKLGIVVTNGVDSALLSGLRKAAEAVGATVELIAPTVAGVHDSA
                     GNELVAQQKINGGPSVLYDAVALLPTVEGANLLRHEATMRDFIADAFAHAKFIAHNDA
                     AELLLAAAGLHPKARDEGVIAMESARDATLFIQTCAALRFWARESQVHAV"
     CDS             370987..371835
                     /codon_start=1
                     /locus_tag="GLX_03150"
                     /product="creatininase"
                     /protein_id="BAK82727.1"
                     /transl_table=11
                     /translation="MRRMPAFMPSFSGFLAAALLACATVLVPSARAATPDTVDFAALT
                     WTEIREAIRRGDTSIIIPIGGTEQSGPYIAVGKHDVRAMILARRIARQAGHALVAPVV
                     AYVPEGGTSPRTSHMRFPGTISITPATFRALVEDAAESFRVQGFSRVVLIGDHGGYQK
                     DLRAVAGQLNRRWSGQGAHVLYIPAYYDVVPGAYATWLRNHGHAAEVGMHADLSDTSL
                     MLALDPALVRAQALAAAPLPTATQGVYGGDPRHADAALGQVGANMQVSAAVAAMQHDS
                     TGQETP"
     CDS             371840..373042
                     /codon_start=1
                     /locus_tag="GLX_03160"
                     /product="hypothetical protein"
                     /protein_id="BAK82728.1"
                     /transl_table=11
                     /translation="MALLACYRGGKKQDHAMTQNKKLSLLGLGALLALGGNALAQGVD
                     TIPGMPPVVDPHNIYSETGANHLNPEVAKDPARIYVPNLRSNNVYVIDPQTYTVIARF
                     KVGKSPQHVVPSWDLRTLWVTNNAEGTTDGSLTPINPRTTQPMASVAVDDPYNMYFTP
                     DGRSAITVAEARQRLDFRDPHTMDMQGSVSVPQCKGVNHADFSIDGRYAIFTCEFGGY
                     LAKVDTVNRKVMGYLKLSGGGMPQDILTAPDGHKFYVADMHADGVFVIDGDTFRETGF
                     IPTGIGTHGLYPSRDGTKMYVANRGSHKIHGTPHSKAGGVSVIDFATDKVVANWPIPG
                     GGSPDMGNVSNDGRTLWLSGRFDDVVYAIDTKTGATRIIPVGLEPHGLTVWPQPGRYS
                     VGHTGILR"
     CDS             373171..373728
                     /codon_start=1
                     /locus_tag="GLX_03170"
                     /product="O6-methylguanine-DNA methyltransferase"
                     /protein_id="BAK82729.1"
                     /transl_table=11
                     /translation="MKALPPRKAAAHAPMRVAVGQSSLGAMLVAMTDRGLAAVMLDDD
                     APSLRQGASRLVPDARLVQGDVEMNRCLDAVRTCIDAPWQPFGLPLDPHGTAFQQQVW
                     QALQAIPYGTTMSYAGLAAHIGRPAAARAVAGACGANPLAVVIPCHRVIGRDGSLSGY
                     RWGVQRKQRLLEMEQVARLERDSAT"
     CDS             complement(373783..374412)
                     /codon_start=1
                     /locus_tag="GLX_03180"
                     /product="acetate transporter"
                     /protein_id="BAK82730.1"
                     /transl_table=11
                     /translation="MKRNNRMGHTLAAANPAPLGLMGFGMTTVLLNLHNAQLVPMGAA
                     ILAMGLVFGGMTQFVAGLLEYANGNTFGMTAFMAYGAFWISLVVLLFLPHWGLAPASS
                     PALLGSYLWMWGLFTAIMAAGTLAASRAHQTVFFSLMLLFALLGGAEMFAIPTLNVIA
                     GYEGLFCGLSAIYLAAAEIFAEQFGRAILPIGLHRPAPLHRDDLMVHMS"
     CDS             374725..375177
                     /codon_start=1
                     /locus_tag="GLX_03190"
                     /note="fragment"
                     /product="amine oxidase flavin-containing"
                     /protein_id="BAK82731.1"
                     /transl_table=11
                     /translation="MLISWGLLMQNAHPRTVHTRRQILTRIGMLAGSDVLYQAMTAMG
                     HARGTDFMAPSVLSGVRPGIRVLVLDARLAGMLAAYELRKAGYQVQVLEFQNRSSGRN
                     ISQRGGDTVTELGGATQKVGFTPDNYINPGLWRIPYHHQGLWDVVQMH"
     CDS             complement(375395..375853)
                     /codon_start=1
                     /locus_tag="GLX_03200"
                     /product="cytochrome c class I"
                     /protein_id="BAK82732.1"
                     /transl_table=11
                     /translation="MKKMLAAVLYGLPLFATPALAADGPALFQANCSVCHQGNAQGLP
                     GQFPPLAGRIGKIAATPEGRNYVIAVALNGLMGSITAQGNSYAGFMPPFKTLPDDQIA
                     AILNHVAGLPAGPDATLFTAVDIAAGRTESLTPTTVAEKRKALDAQHPLP"
     CDS             complement(376256..376588)
                     /codon_start=1
                     /locus_tag="GLX_03210"
                     /product="hypothetical protein"
                     /protein_id="BAK82733.1"
                     /transl_table=11
                     /translation="MSLPSAGCEYAIPFTSGSHARALFFLIRSSAVMTLLCAMAWWLA
                     GPLFHQPAIGISLAIEAVIFRVCDLLYTEDYPHHMATFAGMTIVLGLLSIMVMLPFVQ
                     RQILLHGA"
     CDS             complement(376669..377025)
                     /codon_start=1
                     /locus_tag="GLX_03220"
                     /product="hypothetical protein"
                     /protein_id="BAK82734.1"
                     /transl_table=11
                     /translation="MRKIALLAAVASITCATAASAEPGGCLKYGAVGAVGGHVAGQHT
                     MLGAAAGCITGMYKRHEYRKEAKAKAALYDQEHPGSKGTYIQKATAYDVEHSTTPGKM
                     TADTTTPAQAAPAAAQ"
     CDS             complement(377091..379091)
                     /codon_start=1
                     /locus_tag="GLX_03230"
                     /product="fusaric acid resistance protein"
                     /protein_id="BAK82735.1"
                     /transl_table=11
                     /translation="MGGQGAAFPLLGQPATGLRHLVRRFSWVYSPSLPDLAFALRTSL
                     AAIISLLIAMWMELDSPQWAPLTVWVVAQSSRGESLSKARWRIVGTLVGGVAAITLMA
                     AFPQAPGLFFCVLALWIGLCCALATLLDQYRAYGLVLTGFTSAIIATGAITQPDDVFA
                     VSVARSSYIILGVLCEAVLAVVFMPRIVEHARTALLARLDETFQATCNTITHQLCTAA
                     GAEQQALTSALLRRIVAFSGQIEFSALELGPRNHVGDHARRALAGMLVMLAHARALQI
                     LRPPMQLPSGHEEQVPGHVLAAWLEHDAMPDPAGGKEWQPITTALLGEMRLVMREMTA
                     CATAPHGDRFRFSLTSRRHVREALNNGIRSAAAIMGAWWLWEVTAWHHGSAFISFVAL
                     IYGLMATRENPLVATTPFLKGGLWCAATAAVLALWVIPAITAPEILLLALIIPMTVGG
                     LAARRPELAGYAFSFNMFLPVLIGPMNMGRFDEVGFLNNTLAFLGSIVFVLLTYRVVI
                     PFRLDVHIRRTMAWIGQRLRNLARPQALTDAPAWLSGCAASLVRILFHAAALPAPVLS
                     ACLTQQISDMTVGIYIIRLRDLLRSGSLPPRTRRVVALFLARWHKGQATPAVTHVLAW
                     ARYEQTRHPSGADHALLSEVVACLRIIAVSQHEKTDTAIAGR"
     CDS             379876..380148
                     /codon_start=1
                     /locus_tag="GLX_03240"
                     /product="hypothetical protein"
                     /protein_id="BAK82736.1"
                     /transl_table=11
                     /translation="MYDSMVAACHHYVLSAAAATANTLVLDFDIPGPIVNDRDLFWAP
                     IHYWLMTADCIIHDIIAALSDSIHVLPDYRVISHRFMRQVASEEGK"
     CDS             complement(380366..382051)
                     /codon_start=1
                     /locus_tag="GLX_03250"
                     /product="porin B carbohydrate-selective"
                     /protein_id="BAK82737.1"
                     /transl_table=11
                     /translation="MPDLIFTKRMLTGSSFFVQPCPSPHTALHRRCLRAAYCVLGMGL
                     VFPATGLAQTQIEEDRARLGNSTPLIQQIDPATVRDSERAQADAQKAHEAAADDGDRL
                     DTSGNLLGNMWGARPWLYRHGISFDIQEVDELWGNGTGGSASGNDGAAGSGTGPSYDG
                     VTMPTLTVDTEKLFGLKGGLFNVSALQIHGRSISQDHLANFNPISGFEADHSTRLFEL
                     WYQQSFLGGKLDVKVGQQDLDTEFLISDYASLYLNANFGWPMAPSVNLYGGGPSWPLS
                     SPAIRIRYRPSEKFTFMFAAADDNPPGNRYNSTPIQQATGSLSGYNSDPTSQTYDGTN
                     GTNFNMNTGALLMTELQYALNPQPADMSNVTKNPGLPGVYKLGGFYDTAKFADYRYNR
                     NGGSLGAASVNPASTESDLTPRWDRGNWMVYGIIDQMIWRPSLTSARSVGVFVRATGN
                     GGDRNQISFAIDAGLNLKAPFRGRNNDTIGLGWGIGRASSGLRQFDRDRQTLVQGNEN
                     HLELTYQAQVTPWMVMQPDFQYVWHPSGGTPDWTGLRRVGDEAIFGLHSNITF"
     CDS             complement(382308..382826)
                     /codon_start=1
                     /locus_tag="GLX_03260"
                     /product="hypothetical protein"
                     /protein_id="BAK82738.1"
                     /transl_table=11
                     /translation="MISHPFAFMRLPYALLTAMDSRMLHFWLQPVHYLIRIVHIISMA
                     LFFGMDMLFDFGILSRRMAGKLAPAAQLMVQPLHINLAIAMVTGVILFFYDPVHIGSR
                     AYLTPKLLLITLAMLNAWWCHRSVYLSVLRGCNTPSLHGRIGACLSLCLWTGVMVMSC
                     LNSEGVPKVFLR"
     CDS             382966..383538
                     /codon_start=1
                     /locus_tag="GLX_03270"
                     /product="Fe2+ high-affinity transporter"
                     /protein_id="BAK82739.1"
                     /transl_table=11
                     /translation="MDALAPAHRNMETFNMNKKHIVLAFLTAALPAGVTAAQAREYPI
                     GGPVQAHDMEIASSYLTDIMVMPMPAGMIDNTKPDTIHLETDVHATADNVWGYPDGAW
                     VPYLDIGYVLTKDGTPWKAEGKMHFMTAKDGPHYADNVKMDGAGRYTVVLTYSSPEQN
                     GFLHHVDKETGTPGFWQPFSEKFNFAYPQK"
     CDS             385780..386139
                     /codon_start=1
                     /locus_tag="GLX_03280"
                     /product="transposase"
                     /protein_id="BAK82740.1"
                     /transl_table=11
                     /translation="MTQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLT
                     RQHLYQWRTSFRQRLSSPDQSVAFVPVASVTTPAVASGGDPDELAIVLRNGRSIRVTG
                     HPAEDLLARVIRIAETA"
     CDS             386136..386483
                     /codon_start=1
                     /locus_tag="GLX_03290"
                     /product="transposase"
                     /protein_id="BAK82741.1"
                     /transl_table=11
                     /translation="MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALF
                     AFRGRRGDRIKLLMWDGQGFCLYYKVLEKGRFPWPSPAEGVARLTTAQMAMLWEGMEW
                     RRPSWSAPPSRVA"
     CDS             386547..388157
                     /codon_start=1
                     /locus_tag="GLX_03300"
                     /product="transposase"
                     /protein_id="BAK82742.1"
                     /transl_table=11
                     /translation="MTSAPAVLPDDPDTLREMIVSLQTEVARLSASARAYEALVQSLK
                     IRIARLQKQKFGASSEKIDREIEQLELLLEDVKIAIAAADPSPDIREHDVSDDALSPP
                     RQRGKPKVSDTTPRERIVLDPGEACPACGGPLRLVGEDVTEILDFIAAKLKVVETARL
                     KKSCRHCETLVQPEAPSRPVPRGMAGTGLLAHILVSKFDDHIPLYRQNEIFARQGVDI
                     PRSTLIDWCGQAVAVLRPLTDLIRQDVVKADLLHADDTPIQVLDPRLRQAGKPRGVKE
                     GRIWSYLRDPRPWGGSDPPAVAYWFSPDRKGINPQTHLAQFRGILQADAYAGFRDLYK
                     PDATGTVHVREAACWAHLRRAFHDVWKGSDSTIAREALEQIGELYDIERQITGHPAPY
                     RLAVRQEQSRPRVTAFHAWCETQLARIPGKGELAKAIRYALNRWKAFTLFLEDGRVAI
                     DNNPAERAIRPVCVGRKNYLFAGSDTGGDNIADAMTLIESAKLSRLNPHDYLADVLAR
                     INEHKINRLHELLPWNWKPVNTLHRQAA"
     CDS             388198..388701
                     /codon_start=1
                     /locus_tag="GLX_03310"
                     /product="transcriptional regulator Ros/MucR family"
                     /protein_id="BAK82743.1"
                     /transl_table=11
                     /translation="MDNKDIPHSELVSMTTEIVAAHTNHNTVAIDQIPLLVETVYASL
                     KGLGAEKTVDPAPLQPAVPIKKSVFPDYVVCLEDGKKLKMLKRHLQTAYGMTPEQYRE
                     KWGLPANYPMTAPNYAAHRSSLAQKIGLGRKVVAAPEPEAVVEEPAKPARKTRARRKK
                     DTVELDV"
     CDS             complement(388893..390890)
                     /codon_start=1
                     /locus_tag="GLX_03320"
                     /product="peptidase"
                     /protein_id="BAK82744.1"
                     /transl_table=11
                     /translation="MMYRRLAAIVCLAGCNTAHAAPAQNMQAGSAIMRRVFDTLQLPD
                     APNRYVSGSGLPGPDYWQNRADYAIHARINPVTHVLTGEEVLTYTNNSPDSLDELWLQ
                     LDQNIYRARSRASFANPERHAHTTDGAVIELVTLIHDGHETPLEPHINDTRMQLALPG
                     SPLPHGHKVQIRIRWHHTIPGTWGGRTAVSSVRDGDIFEVAQWYPRMSVYDARRGWDT
                     LPYLGQEFYLDYGDFDYTVTVPWNFTVVGSGALLNPAEVLTPTERARLALAARSDTTV
                     KIRTAQDVTDPASHAARSGEKTWHFRMENTRDISFAASPAFIWDAAGMNLPPIKPAPG
                     MAPVPRLAMSVYPREGQGAQAWDRSTQYVKHAIEYFSSQWYAYPWPNAVNVGGHGAGM
                     EYPGIVFDGWQDRDAMLFWITTHELGHDWFPMIVGSNERRHAFMDEGFNTFIDAYASQ
                     HFNNGEYAPKKDPEFAPQTGRPADDIIPLLTDPQAPPLMLTSELVSEKYRHSVSYFKS
                     AYGLMLLREQILGPDRFDAAFRRYIKVWAYRHPAPSDFFRFMNSEAGEDLGWFWRGWY
                     FENWWPDYALTDVSPINNDPHQGMQVGVRSKGQLMLPVVLRLDYTDGTHVDQVIPTES
                     WHLTDHITVTFPGGPTVLRATLDPDHALPEPDRTDNTRTMP"
     CDS             complement(390984..391784)
                     /codon_start=1
                     /locus_tag="GLX_03330"
                     /product="hypothetical protein"
                     /protein_id="BAK82745.1"
                     /transl_table=11
                     /translation="MKPATMSLPESINLLYVLSGLGVGFLVGMTGVGGGSLMTPLLIL
                     LFKVHPQAAVGTDLLYAALTKTVGTLVHGRRQSVEWRVVGRLALGSIPATLLTIAILH
                     WAGSPSAQVTHVISVALGIALLITAPSVLFRQRLQALSGRRAGQLSPAMTGYLTTLLG
                     GMLGVMVTLSSVGAGAIGMAALIFLYPAIELRRLVGSDIAHAVPLTAIAGMGHWWIGD
                     IDMNLLASLLCGSIPGIILGSLCVGIVPDRVQRVILAVILVTVGVKVM"
     CDS             392273..393484
                     /codon_start=1
                     /gene="mauG"
                     /locus_tag="GLX_03340"
                     /product="methylamine utilization protein MauG precursor,
                     Di-haem cytochrome c peroxidase"
                     /protein_id="BAK82746.1"
                     /transl_table=11
                     /translation="MVIAMMLPRALPGHAHAIDGVVLSRPQARARAMALSALGRDLFH
                     DRHLSASGQMACSSCHADGQAYAQANALSVQPGGHRAVPSLKYLQDVPQFTEHFFDSD
                     DEADESIDNGPTGGLTWDGRVDTAQAQARVPLLAPYEMANASPADVVSHALAAGYGQR
                     IDALLFSAPNMETRFTLIAEALATYQQEERLFYPYTSKYDAVLAGRAKLTARESLGLR
                     LFEQPDKGNCASCHVSAPGDDGTPPQFTDYGLIALGVPRNMQITLNHDPNYFDMGLCG
                     PDRTDLTNHPEYCGLFRTPSLRNVATRRVFFHNGMMHSLRQAVAFYVLRDIRPQMWYP
                     KAPDGTVRKYDDLPARYHANINMDPPFGPQPGNRPVLSDDEIDAIVAFLKTLTDGYAT
                     PGTYRSHGSAP"
     CDS             393781..394008
                     /codon_start=1
                     /locus_tag="GLX_03350"
                     /product="hypothetical protein"
                     /protein_id="BAK82747.1"
                     /transl_table=11
                     /translation="MLQIIRQINEGRTLLMNAGVFLCVVAMLGLANLFCRFVLHADLS
                     YLMPWLLGGAVLYVFGPPLVLWLFTGRSSDR"
     CDS             complement(394024..394575)
                     /codon_start=1
                     /locus_tag="GLX_03360"
                     /product="protein disulfide isomerase"
                     /protein_id="BAK82748.1"
                     /transl_table=11
                     /translation="MPMTYSSLFHKTVLAAAACALMAPAAYAAQPAPAFGPGPIVPVS
                     HPYGPAQDAQQSIDAAFQQARQTGRKVLLDFGANWCPDCRILAGVLAQPAIAAWVSQT
                     FIVVTINVDRAAGPTVEGERFNTNADLAQHYGVTISAIPALLVLTPDGQLVNRDGAIA
                     LGNARTLSGQAMVDLLNEWAQHS"
     CDS             394784..396070
                     /codon_start=1
                     /gene="hsp70"
                     /locus_tag="GLX_03370"
                     /product="heat shock protein Hsp70"
                     /protein_id="BAK82749.1"
                     /transl_table=11
                     /translation="MSPIPSPRTVRLGMDFGTTNTVVVLLDEQGRPHSARFSFPHHAV
                     SETCRTLLCLWQEEERVGRPVIHEAIGAAAIDAYLEDPAESRLVMSMKSYLAQASFRQ
                     TRLLGQVMTLEMLIARFLSCLMRTIGIDPAHVEVTVGRPVHFAGELADDALGEQRLRE
                     GFRLAGFGEINVALEPEAAGWHFAQRLRAPATVLVGDFGGGTSDFSILRFDPAKPRQA
                     EPLGYAGVGIAGDQFDYRIIDRVIAPALGRNSTYRVMGGQPLPVPAQWYASLGRWHRL
                     ALMRTPQTLRDIADVARTASEPEKLHALMDIIDNQQGQALYRAVGEAKRELSSADRTM
                     LDYTYRDVKIRREITRAEFEGWIAPDLQRFDDAVGTALERASLPASAIDRVFLTGGTS
                     FVPAVRDLFDRRFGHERVDTGNEFVSVAEGLALMNR"
     CDS             complement(396287..398749)
                     /codon_start=1
                     /locus_tag="GLX_03380"
                     /product="TonB-dependent receptor"
                     /protein_id="BAK82750.1"
                     /transl_table=11
                     /translation="MPNTMRRQRRRLARRPLLAGSTFVWLLSVGPAAIAAGQTSDTAA
                     APRAHRGSTTATHARTATRAPAHHDTTPVAASSTPESLKVSVGRVRTHNAVQAVTREQ
                     MDHFVEGTSPNQILALTTPGANFASDDAFGLDTVANTLYVRGFNQSQLGATLDGIPMG
                     GQGFHNWNGLSVDQMEIQENVSGMTMSQGAGALDTPSAQTLGGALTYTSSDPKNKAGG
                     RISQTFGSYNAFRTFARVDSGVLNSTGTKFYASFARTAQDLWKGYGDQQELQANFKLV
                     QPVGDRGKITAIFDYSDFDQYNYMGLTKNMWQKMGRDTTYLKPNYALAKEYAYYAQNG
                     GVPSNLQGILSNDEIGDYAYDSTQSQRNYLSAITGEFELFHNVTSKTVGYAHVSNGDY
                     NGTNPFLVSPTSGVDMALESGHPDVRRIGFTQSFNIKVHDNDIQTGIWYENDSFNYPM
                     RMYEDGVDTAHPSLGGFKSSEAATWYSDSFNTNTFQFYLQDTYHIIPGMTVSAGFRSL
                     LQSTHGGTKVDNTALYSNWNTYYSHPASGNMTAANAFLPHFNFDYHFRDHHEVYFDIA
                     ENMRAYDYGQQSSSGTVWGGLGSSSMSAQSVFDANKNSLKPERTWNYVVGYRYNSHLF
                     TGSVDFYHTDYYNRIATVTEGSTGNIFGAVANVGRETMNGADVMGAIRPVKGLEISNS
                     FSWNNAVYEGGISNGGTNISLKGKHQVYYPKFMYKANLTYNWHRAMFNFNVTYTSRRA
                     MTYTNDQYIPAYWTSNLNGSYNFGKVGFAQNIKATFGITNLFNKNYIGGVFGAASVSG
                     DDNANLYVAAPREFFGSVSAQF"
     CDS             399797..401728
                     /codon_start=1
                     /locus_tag="GLX_03390"
                     /product="alpha-amino acid ester hydrolase"
                     /protein_id="BAK82751.1"
                     /transl_table=11
                     /translation="MMAACVSSGPLAAQAPADRADTSSLSVQTGSDIPAQVIFPTTAR
                     NYIKRDVMIPMRDGVKLHTVIVIPKDASGAPMLLTRTPYHASERANRIPDAPDIRSIL
                     PQGDDAFVEAGYIRIFQDIRGKYGSEGDYVMTRPPRGPLNPSKTDETTDAWDTIEWLV
                     HNVPQSNGRVGMLGSSYEGFTVVMALLDPHPALKVTAPESPMVDGWMGDDWYHYGAFR
                     QGGLDYFTAQMTVRGEGHTIPRIDHDDYTNFLTAGSAAQFAHDAGLDQFPWWQRMLAH
                     PAYDAFWQQQALDHLLARRKATVPMLWEQGLWDQEDMWGAIHSWQALQAEKPAVPNVL
                     VMGPWRHSQVNYNGSTLGPLQWNGDTASQFRHEVLRPFFDQYLRPGSAPVHLPQAIIY
                     NTGENHWDHIDHWPSACEAHCTHPLQAFYVQADHGLSTSRPTQSMQGGQGMDQYISDP
                     AHPVPFLPRPFAFPTDSDRWKTWLVQDQRFAESRPDVLTYESPVLSAPVKVSGVPVAD
                     LYAATTGSDADWVVKVIDVNPPTTADRPEMGGYELAVSMDIFRGRYRQGFDRPMAVTP
                     GAVTQYRFTLPAVNHVFEPGHRIMVQIQSSQFPLYDRNPQKFVPNILKASREDYIPAT
                     QSIYRDPTHASAVWLPVVP"
     CDS             401737..403257
                     /codon_start=1
                     /locus_tag="GLX_03400"
                     /product="amino acid transporter"
                     /protein_id="BAK82752.1"
                     /transl_table=11
                     /translation="MDDHISQKGTGELPVPDLCPESRGPAFHVVLAIEIWERFGFYGM
                     QAILLLYMIQKLGLQDMQANMLWGSFAAMTYAAPVAGGWLGDRVLGSRRTMVVGGIVL
                     ASGYLLLGMLVGTTQALFVNMAVIAVGNGLFKPNSCNMVNIIYRGQDQKLDVAFTIYY
                     MSVNIGSTFSLFLVPLVQQSYGWGAAFIFCGLGLLLGVGGYFIRRSRLAAIGTVSDFR
                     PVPWRHGLLVAGGAVAVTALMALVFASASIQGVLVVASGITIILAWAVVYARAAVHER
                     TGLRIMYLLTFQVALYFVFYQQMVTSLTLFALRNVNKDFTLWGLHLFSMSAGQFQVFN
                     PVWIMLGTPMLIAAYNWLGRRDADISIAGKFVIGFFCVTLSFLAWWLSTVLSSSDHVS
                     PWVMLFGYGPLSIGELMINSLGLAAIARYVPVRISAFMAGCYYVLVGFAMYVGSIVAN
                     MAAVDNAAGLDAARTLVIYGSLFRTLAFMAGGATVMFALLLPMVRRWEGANAMAER"
     CDS             403574..404374
                     /codon_start=1
                     /locus_tag="GLX_03410"
                     /product="oxidoreductase"
                     /protein_id="BAK82753.1"
                     /transl_table=11
                     /translation="MSAEHLPFSGKVALVTGAAGNIGLATAEHLAAMGADLALLDLDH
                     EKLEQARTGLGGHDVRINIYTCDVMDGGQVSQTVDTVVRELGQIDFLFNNAGYQGAFA
                     PVQDYPDDDFARVMNINVCGAFHVLRYVAQHMITRKFGRIVNTASMAGVQGPPNMAGY
                     AASKFAIVGLTEVAAKDLAPHNIRVNAISPAFMGPGFMWDRQVELQARAGSQYYSTDP
                     KEVAQQMISSVPMRRYGNIDEIPGVVAFLLGEDSSYMTGVNLPISGGI"
     CDS             complement(404639..405130)
                     /codon_start=1
                     /locus_tag="GLX_03420"
                     /product="hypothetical protein"
                     /protein_id="BAK82754.1"
                     /transl_table=11
                     /translation="MTTAGTSSSRPIRAWRGRFLTLLALLGGLATQPGLAWATDTALP
                     TPPAQCMGLQAEPQLEITLMFGMRRPNDGRRINRHEWNAFMREVVTPRFPAGLTVLRG
                     DGQWQNRTSGQIGREPSRIVWIVTPPAPDLQTRLETIRQTYRTRFAQQSVGLVVTASC
                     AAF"
     CDS             complement(405445..405864)
                     /codon_start=1
                     /locus_tag="GLX_03430"
                     /product="glyoxalase/bleomycin resistance dioxygenase"
                     /protein_id="BAK82755.1"
                     /transl_table=11
                     /translation="MIGFLYIIQEASMFSHITLGSNDIAASKKFYDTTLGALGIAPSG
                     INAKGRLVYTTDHGRLIVTRPVNGQPATAANGGTIGFVAGSEQAVDAWHAAGVANGGV
                     PCEDPPGIRHMSTGDLYLAYLRDPTGNKLCALYRVTA"
     CDS             405955..406701
                     /codon_start=1
                     /locus_tag="GLX_03440"
                     /product="hypothetical protein"
                     /protein_id="BAK82756.1"
                     /transl_table=11
                     /translation="MTAVMAGPELLPHRLKREIMRFIASLAVVTGLAMAAPLGAQAAS
                     LHTDWEKYKATRAFNHLSADGQRAMVDILNAKQVLDSGQTEQAIPALYDATKRLTAAG
                     KANAKFMAAETTLHPAPQHPAASTHVPGTTPVTWIPVGGEIVGSETLAPEKKAAIATA
                     NTQLKTGNTQQAAQSLQVVGEDADFIMALAPLEQTQGAINRASVFTEARNPKAASAAL
                     QQALDGLVFVSEDFAETVMPHGGKSASHGK"
     CDS             complement(406762..407040)
                     /codon_start=1
                     /locus_tag="GLX_03450"
                     /product="hypothetical protein"
                     /protein_id="BAK82757.1"
                     /transl_table=11
                     /translation="MISVAVFKVAKYFIEKKMSQTSSKKSLGEARVSLTKFITIIIAV
                     FIERLMGVFETKVSDPTAILYPAGLAGGGHTDRALAGGVPAHGRGCRA"
     CDS             407475..407741
                     /codon_start=1
                     /locus_tag="GLX_03460"
                     /product="hypothetical protein"
                     /protein_id="BAK82758.1"
                     /transl_table=11
                     /translation="MVYRLNQHERTSIVSLTPVDSRSGGGTEHNPGNFANDRRKASEA
                     GHKGGQHNSGNFAEGPQRATGAGRKGSQHSHDHDHDHDHDHEKS"
     CDS             407861..408394
                     /codon_start=1
                     /locus_tag="GLX_03470"
                     /product="hypothetical protein"
                     /protein_id="BAK82759.1"
                     /transl_table=11
                     /translation="MNKRKMAILGLALCISVPAIAQSVPEKTGINSLMGVAPRTADFV
                     KIATINDMFEIQSSELALQNHDPALTAFATQMIEDHKKTSAALKDQLRSGTVQLAPPT
                     ALDESHQDMLDKLKTLHGRDFALQYRSDQIEVHQDAVSLFRRYGEGGENAGLKTWASN
                     TVPTLESHLQAARALPQ"
     CDS             complement(409695..410156)
                     /codon_start=1
                     /locus_tag="GLX_03480"
                     /product="D-isomer-specific 2-hydroxyacid dehydrogenase"
                     /protein_id="BAK82760.1"
                     /transl_table=11
                     /translation="MPMPSSTTLTDCRFVPDLVTLARDSDILVVAASDGTGSLHLVNA
                     AVLAALGPDGFLVNVARGSVVDEDALVTTLQQGTLEGVGLDVFTHEPDVLQALRESPR
                     MVMQPHRASPWERYGWPWVIWWWTTLSPILRAGPCSPPLPDTLAQHRRRST"
     CDS             complement(410230..411231)
                     /codon_start=1
                     /locus_tag="GLX_03490"
                     /product="ABC transporter oligopeptide transporter
                     ATP-binding protein"
                     /protein_id="BAK82761.1"
                     /transl_table=11
                     /translation="MTGTSLTPVLELRDLRKTYHLPHGRMLRAVDGLSLRVRPGEMLG
                     LVGESGCGKSTLGRCMLRLADPTSGRILFEGRDITTLPERRLRALRPRMQMVFQDSSA
                     ALNPRRRIDDLLAEPLRVHPGADGRKRSTATIAARLHELMDLVGLPAQALTRYPHEFS
                     GGQRQRINIARALALSPRLVVADEPVSALDVSVQAQIVNLFADLQRELGLTYVFIAHD
                     LAVVRQISNRVAVMYLGAIVELGETDAVLHHPAHPYTAALTAAVPQAVVGNTYALALR
                     GDAPSPTAPRIGCRFHARCPHAQARCAHEDPVLRPLHPDHAVACHFPLPPGPQPTQG"
     CDS             complement(411228..412253)
                     /codon_start=1
                     /locus_tag="GLX_03500"
                     /product="ABC transporter oligopeptide transporter
                     ATP-binding protein"
                     /protein_id="BAK82762.1"
                     /transl_table=11
                     /translation="MPADTPLLSVRDLCVSFPVHGRMVPIVEHVSFDMQPGEILGLVG
                     ESGSGKSVTAMALMGLIDSPGVRITGSALFRGRELVGMPPRQLRRLRGRDIAMIFQDP
                     MTAFTPVYTIGWQIDEQIRAHEKVSRSTARARTVQLLDDMGVPDPAQAAERYPHQLSG
                     GLRQRAMIAMALSCSPALLVADEPTTALDVTVQAQILDLLRRLRGTHGTSVLLITHDM
                     GVVAQTCARTLVLYSGRVAEYGPTEAVFEWPSHPYTAALLDAIPPLYGARPARLPAIE
                     GAPPLPASRPAGCAFAPRCPHAHTTCATTPPPLVPTGPDQQAACVLPAEGIPLPPRVQ
                     GMAGRTA"
     CDS             complement(412243..413217)
                     /codon_start=1
                     /locus_tag="GLX_03510"
                     /product="ABC transporter oligopeptide transporter
                     permease protein"
                     /protein_id="BAK82763.1"
                     /transl_table=11
                     /translation="MMVALLRRAAQTALVLFGVSVLVFGVFFATPGADPTARIAGRNA
                     SPQVMEKVRHEYGFDRPLPVQYAIMMKKLFITRDLASYANRGQAVVPGIMQAAPVTAC
                     LVGGAAVIWVTISIAMGTLAAAMKDTWVDRSLMVLGLVGISIPVFWLGQVTNLVTQSR
                     YHDTWLFSWVPGLGYVPFTQDPLGWFRALVIPWVVLAVMFIGIYSRVLRYDLVALAGE
                     DFMRTARAKGLSPARVLLRHGLRTSMVTFISLFGLDFAQLAGGGALLTEVVFGLPGVG
                     RLTYRALTMLDLPVIMATVMYSAIFVVLANAVVDVVYLFLDPRVRDAR"
     CDS             complement(413214..414215)
                     /codon_start=1
                     /locus_tag="GLX_03520"
                     /product="ABC transporter oligopeptide transporter
                     permease protein"
                     /protein_id="BAK82764.1"
                     /transl_table=11
                     /translation="MPASPHPASGPWRQAATGLARNIPAMAALGVLVLVVLASLLAPF
                     YAQHVAHTDPFASNVAGTIMLDGQEVDIMQPNDNPLHLGLSPIGPTGRAAYLLGADSQ
                     GRDVAARLLYGGRNSLLISAGAAVLCLLLAGMAGVAAGFLGGVADAVISRLMDIMWAV
                     PVYLFAISLSIIMVSQSMRLGPFVVHADSLLVPIFIIALVYVPYAARPIRGRVMALRQ
                     AEFVTAARGLGVPVWRIMLRDILPNLATTLVMLGPLVMALALLAESALSFLSLGVQAP
                     QASWGTIIQDGQGLIYTRPMVAVAPGLAIVIVVLALNILGDGLRDALDVRDSGRRTS"
     CDS             complement(414216..416075)
                     /codon_start=1
                     /locus_tag="GLX_03530"
                     /product="levanase precursor"
                     /protein_id="BAK82765.1"
                     /transl_table=11
                     /translation="MKEIILYNYLYLMKPFLMELSLYPPPRGLRMAQNHLVASAHRYS
                     LGSMTDASPPRLSCRAALSSFAVLGTGGLAQGAGANTPPSSGPATPLPPQAPDNTRGD
                     EPNASHPSPADQPGGMPHPVMKTEIDMPYRPTIHFTPTTGFMNDPNGLVFDGTQYHLY
                     YQYNPFAPYAGHVHWGHATSPDLLHWTDQPIALDETGAGEAFTGCAVMDSHNASGLFR
                     TPQGGMVALYTRASPHAQAQYLATSYDNGQTFEEYARNPVLDISSNSFRDPQVCFHKP
                     TGRWVMVVAKSRLHQIAFYASIDLVHWVHLSDFGPSGLFGVDYECPNLIEVAVEGGGT
                     RWMLFVSVNPGAPTGGSITQYFVGQFDGTRFIPDNTVIGLTDFAKDAYALQVYSNMPG
                     AEAVSIAWLGNWQYAQELPTQSWRGAMTLPRTMVLRRDFTGGLRLAQTPRGLNTLRDT
                     PLACPAGRLAAGESRQVSLPQGRAVELCMSVTVDERPHGLNPGDKGRTGRFIITFGNE
                     GGEKLTIGFDAFSGQLWLDRSNLAGFAQPFFTGQFSTALAPDDRHFEIRIVLDACTLE
                     IFADGGLAVGTALVFPASPLEFLRLEANGAGATIGSLNLYPLRKTMPRMTAAT"
     CDS             416329..419553
                     /codon_start=1
                     /locus_tag="GLX_03540"
                     /product="RND superfamily multidrug efflux pump
                     acriflavin resistance protein"
                     /protein_id="BAK82766.1"
                     /transl_table=11
                     /translation="MVFIIQGISRPMNAIVVTALRRPYTFVVLSILIVVFGIMSVLRT
                     PTDVFPNIKIPVVSVVWTYGGMLPEEFAGRIIYNYELMVTSTVEGIEHMESSSYYGRG
                     IVNIYFQPGTDIGKAEAEVTAISQTVIKQLPENIPSPMVMSLDASSVPVLTLQVTSDK
                     QTPSDLFKLAMIRVRPLLVTVPGAVVPQAYGGMDSFVMVALNQQQLQAHHLSAMDVQN
                     ALRGQNIVLPAGDQKISATDWMVQTNATPRSMKELGDIPVKRVGNAVIYVHDVAEVYR
                     GGHPQTNLVLVKGKQGVEIVVMKSGDASTLDVVAGAKALLPRIQKLLPPDVKVSILGD
                     ASIFVKDSIFDVVREMLTAAALTGMVVLLFLGSWRPTVIIATSIPLAILCAIIGLHWA
                     GQTINVMTLGGLALAVGILVDDATVMIENIDAHLEMGKSLEPAIIDAANQIVIPTFVA
                     TTCICIVWLPLFGLSGVAGWLFMPMAEAIIFAMIASFILSRTLVPTMAKYLLAGHSVT
                     GHGDSHHCEPQVHNLQYPKRLPERFQQAFERGFNTFRESYAGVLERAIAGRRRFVGVF
                     LGVSVCSLGLYLVAGRDFFPETKSGTIQMHMRAPLGTRIEVAGREASLVEDRINQLFP
                     GKVESMIENCGLPEGAHNQAFIPTPTIGTQDCDITIALKDEETPVWDDRTILRHDLSE
                     RFPGTVFTFQPADLTARILNFGSPAPIDIQISGPDLRDNYDYARLLVNRLRGVPGAAD
                     VVIQQTMKTPTLFVQGNRTFSQATGMTEADLANNELMTLSGSQTVDPQYWLDPATGIT
                     FPLNVYVSQDQLTHFNNLMTIPVDKGDGDPQGRHMQLLGGISNVSATGTPGQVSHFNS
                     MPEVDIYVSAEGADLGQVTTGVQHVLDQTQNKVPSTAAVVMRGQTETMRHAYVELVFG
                     LVVSVLLIYLLIVVNFQSWLDPFIIISALPGALAGIAWALFLTHTRLSVPALTGAIMC
                     MGTATANSILVVSFARERIEEHGDALRAALEAGYGRIRPVLMTALAMVIGMVPMAMSN
                     SQNAPLGRAVIGGLLVATVSTLLFVPCVYAILHNRPSRSRGEVN"
     CDS             419553..420740
                     /codon_start=1
                     /locus_tag="GLX_03550"
                     /product="multidrug efflux pump acriflavin resistance
                     protein"
                     /protein_id="BAK82767.1"
                     /transl_table=11
                     /translation="MSTQKNRKIIMLAGAAVIVGWCGYLLVERVQHAAALRREAAIAS
                     VPDVMVISPRHEARHVSLDLPGTVEAWYQAPIYPQASGYVRMWYKDYGARVAAGDVLA
                     EINTPGLDAQFAQAQADLQSSQAKYDLAVVTAQRWRLMGKSQAVSGQSVSVQDANEKS
                     AAADLEAARHNLDRYAALERFKVIVAPFDGVVTERDINVGDYVHEGGGNLNATGAASE
                     LFSVADTHQMRLFVSIPENMSYILQPGLQASVQVPQFPDRRFEAKFLTVSGGYDPDTR
                     TSVSEFVIDNADHALWPGTFAAVTLTAPEQAAHQTIPTGALVFQEHGMQVAVVDAQNH
                     AHFHTITVGRMGDGATQVLSGITPGDRIIDNPPADLLEGESVHVVQPVAGYSNDTDEK
                     DDE"
     CDS             420737..422323
                     /codon_start=1
                     /locus_tag="GLX_03560"
                     /product="secretion system type I outer membrane efflux
                     pump lipoprotein NodT"
                     /protein_id="BAK82768.1"
                     /transl_table=11
                     /translation="MMTRRMRRSVCRGGASVLALVSLAGCDLAPVYHAPHYVVPATWQ
                     GQAPFAVAQPMDDHIPANWWTGFADPRLDELEALATDHNGDLQAASERFLQARAIVSE
                     ARADLLPHFGLAFGGSNNKSSAERLFRYKGPITDSDEFYGGMASWEPDFWSSIRNRVR
                     LQKDYAQEAAAQYASARLSLQAELASDYFTLRGLDAQAAIYTQSIGYYQESLRVTRTR
                     LVDQAASQLDVARAENQLYTTQARLLDIQAQREVMEHAIAVLVNVAPSSFHIAADSHL
                     NATRSALSTPMPSDLLQRRPDVAVAERQMAQANRAIGIARAAFYPHVSFQMNGGFDDN
                     GFNLANLANSMWSYGATVTMPVFEGGLRRAQLQQSWSAYRETRDHYRMTVLAAFRDVE
                     DGLSRTRRLDGENERLHAAVGAASQTQDITMNLYKGGLATYLDVLIAQVSTLDARIQQ
                     VEVQTRYLQARIGLIRACGGGWDAAQLPAPNRLFSVDPLQYSGLHNAHPAGDVPAPHS
                     HGPDGDDDLTGPVLTPGLRQ"
     CDS             complement(422410..423261)
                     /codon_start=1
                     /locus_tag="GLX_03570"
                     /product="hypothetical protein"
                     /protein_id="BAK82769.1"
                     /transl_table=11
                     /translation="MMLQKVAESPPFVVPIQEHNVNIQPFGTYPPTKTQQWIRYIFFN
                     TSFGYMKLRRPFVERFKQECKGGPVDSYLFGLKVRFYPQDNQTDAKSAVCGNCYNAKE
                     WRWLDKCLPTGGTFLDIGANMGFFSLFAVTKQARIIAIEPNTILFERLCNNMFLNGSA
                     ACLVKVAVGERDETGTLIQTNMDYGGGTIGQGKGETVRIRPLLDILTELNVNKVNVLK
                     IDIEGYEDKALLPFLSTAPASLLPDHIIMEYSERDRWQSDLMSKLTQVGYHQKARSRG
                     NILMSRK"
     CDS             complement(423624..424892)
                     /codon_start=1
                     /locus_tag="GLX_03580"
                     /product="isomerase, N-acylglucosamine 2-epimerase"
                     /protein_id="BAK82770.1"
                     /transl_table=11
                     /translation="MAEALPALMLPVTSWLRLGPHRRWLDMQGQRLLDFSKPSRVPHG
                     FSALGDDGRLQPDAVADSTLTARMTHVYAVAMGRGLPGCAPLAAHGVACLRGALEDHD
                     HGGWYLTPTVAGAPPENSRKQAYLHAFIALAASSARVAGIAGAHELLDSALTIWERHF
                     WSEAEGVFRESFAADWSDEEDYRGANANMHSVEACMAVADVTGNAVWRHRALRVAERF
                     IHTHARDGGYCLPEHYNRNWEVLRAYHQNKPTDALRPYGMTPGHFVEWAHLLLKLEAA
                     LLRTEGHAPPWLVEDAVELFHSGMNNGWQRDGAPGLLYTIDWARRPVVHNRPHWCQAE
                     ALTAAAALLKRTGHARYEHWYRTIWDYIDTYMIDRRQGGWIQELDEHNYPSSAVYAGK
                     ADLYHAWQATISPLLPLAPSFATAVTLLDN"
     CDS             complement(424885..425745)
                     /codon_start=1
                     /locus_tag="GLX_03590"
                     /product="oxidoreductase"
                     /protein_id="BAK82771.1"
                     /transl_table=11
                     /translation="MTKTIPPQSQPHQPGIERLMDPPAEHIRPDYKGSGKLAGRRALI
                     TGGDSGIGRAAALHFAREGADVGILYLEEDEDARETIRLVEAEGVRGLAIRGDVSDSA
                     VCTDAVTRTVETFGGLDIVVNNAGVQYVSNDLTDITDAQWQRHMDVNINGYFYITRAA
                     LPHLGQDSVIINTSSINAFAGNTSLVAYTTTKAAEMGFTRALALQLAPKGIRVNAVAP
                     GPVWTPLQPASWGPVDPQAVADLGKNTPMQRVGQPSELGPAYVYLAARDSSYVTGQTI
                     HVNGGMIING"
     CDS             complement(425978..427051)
                     /codon_start=1
                     /locus_tag="GLX_03600"
                     /product="hypothetical protein"
                     /protein_id="BAK82772.1"
                     /transl_table=11
                     /translation="MRGQPVSHPIPAAGSHMSQHTPFGLDNDTVTVTAVTHSGNFHLD
                     ETLGYVILHYALAPQGDLAGRVMANTPGDRLHFTRTRTPERIAAANIVFDVGGRHDPA
                     AGRYDHHMKDKPLREDGTPYSAAGLLWKDYGIAAIRNMLATPVDEAELPAIWQAIDKS
                     LVLPIDQDDNGVAKMGKLSLADIVSACRPAWDTAELYGPEQARARESAGFSQAATTIA
                     GYLVNMVDRVRASLKAASRVLAAYEAAQDKRILIMDTGMPTEKVIFEHDLPVVYVVSP
                     AGRDRWNVKAVPPTRGDFGQRVSLPDAWRGLEGEALAKVSGVSDAVFAHPARFICGAA
                     SKAGAVRMATLALEIDAAAAPSA"
     CDS             complement(427174..427506)
                     /codon_start=1
                     /locus_tag="GLX_03610"
                     /product="hypothetical protein"
                     /protein_id="BAK82773.1"
                     /transl_table=11
                     /translation="MDPKAVAEAYFSLGTQIEESQARVSDAAEALIPLAQKGNEDART
                     ALNRLREAAVSMQAERTRAQYLWDLAAGRTPPAPPVEATTPDQPGKAGRPHTFLDSLL
                     EDLTGTPL"
     CDS             complement(427905..428606)
                     /codon_start=1
                     /locus_tag="GLX_03620"
                     /product="pirin domain protein"
                     /protein_id="BAK82774.1"
                     /transl_table=11
                     /translation="MIEIRPFDRLGHADHGWLDARHHFSFASYHDPARMHWGALRVWN
                     DDMIAPNTGFGTHPHRDMEIITYVREGAITHQDSLGNTGRTEAGDVQVMSAGTGIRHS
                     EYNRDNVPTRLFQIWIMPDRTGHAPSWGTRAFPRGERAGRFVVLASGHKEDTDALPIN
                     TDARVLGATLRNGEVVEYPLGNERLGYLVPARGAVEIEGLRVGERDGAAISDTAVLRV
                     RALGDAEIVLVDTAP"
     CDS             428772..429716
                     /codon_start=1
                     /locus_tag="GLX_03630"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82775.1"
                     /transl_table=11
                     /translation="MMRLPDLEAWAIFAKVAERGSFARAAEEIQLSKPTVSKAVSRLE
                     QALGVALFNRNSRQMSLTETGRALLGHASRILAEAEAAETEARGGTLVPSGLIRIAAP
                     MTFGVRHLAPLLPGFLRQYPQVDITMDYSDALVDLVAGGYDIALRIAALADSALRARR
                     LCGVRLVLVASPAYVAQIGHPDDPRALEGHRSFVYTNTSAPGMIRLHERVSGREYVLS
                     QTARLRSDNAEAFLPALEAGLGFGLFPEFMVWKGLQAGRIIRLLPQWEADPVALYLVT
                     PASTLRPMRVTTFIDYLAGAFARPPWEHQDAPAHSGAA"
     CDS             complement(429775..430371)
                     /codon_start=1
                     /locus_tag="GLX_03640"
                     /product="flavodoxin/nitric oxide synthase"
                     /protein_id="BAK82776.1"
                     /transl_table=11
                     /translation="MPKVLVLYYSTYGHIETMAHAVAEGVRAGGLEADVKRVPELVPE
                     DVAKAHHFKTEQAAPLATTAELAEYDAIIVGAPTRFGRIPSQMANFWDQTGGLWLKGA
                     LVGKVGAAFTSTASQHGGQETTLFSILTNLIHHGMVITGLPYSFQGQLKLDEVTGGAP
                     YGATTIAAGDGSRQPSANELDGAKFLGQHVADLARRLA"
     CDS             complement(430479..430913)
                     /codon_start=1
                     /locus_tag="GLX_03650"
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="BAK82777.1"
                     /transl_table=11
                     /translation="MLQILGRNPLLNCDDTGIRSLPGTGSASAPICPFTLFLSELDEY
                     EGGELIIQNTYGTQRIRVPAGAMVLNPATILHSVHKGTRGSRWAAFFWSHSMIRNDVQ
                     HTLPYQFDCSVIEIRKALPDKRPGKLGLTATCHNLPRQWTEL"
     CDS             complement(431133..432608)
                     /codon_start=1
                     /locus_tag="GLX_03660"
                     /product="phosphoglucosamine mutase"
                     /protein_id="BAK82778.1"
                     /transl_table=11
                     /translation="MKIAQWMQHSGVAFGTSGARGLVTAMTDRVCFAYTVGYLRHLAT
                     LGEFAPGTDVAVAGDLRPSTPHILRACVAAITHMGGRPVFCGFVPTPALCLYAFGRGI
                     PSLMVTGSHIPADRNGIKFNRAHGEFLKSDEAAMREEDVDLPDSLFDGSAALISPPIL
                     PPVTDVVPGFIARYRDFFGSDALSGLTLGIYQHSAVGRDVLVHIVEALGGRAVPLGRM
                     EDFIPVDTEAVRPEDATLARQWASDGELDAILTTDGDSDRPLLADRAGDWLRGDVLGI
                     LAARFLGACAVTTPVSSNSALELSGFASDVRRTRIGSPFVVAAMTEAAAAGSLPSVGY
                     EANGGFLLGSDVTRNGRTLRALPTRDSVLPMLCALVAARDAGMDLAELVRTLPPRFTL
                     SDRLVEMPTAQSRDRIARLSEDPVQGAEALGLCKICGPLASVDETDGLRMTFADGRVV
                     HLRPSGNAPELRVYVEADSPEQAQTLLRAGIDAVSLWREQA"
     CDS             complement(433053..433430)
                     /codon_start=1
                     /locus_tag="GLX_03670"
                     /product="oxidoreductase"
                     /protein_id="BAK82779.1"
                     /transl_table=11
                     /translation="MKIGFVGLGAMGHSMAQRLLAAGHGLCVYNRIAARVDDLLAQGA
                     TLAPTPPAAAQGANIVFSMLFDDAAAQVLTFGPGGIATTLGADAIHACCSTLSPKQAR
                     RLRDGRAARDGGGEWQAGLCYSA"
     CDS             complement(433524..434579)
                     /codon_start=1
                     /locus_tag="GLX_03680"
                     /product="alcohol dehydrogenase zinc-dependent"
                     /protein_id="BAK82780.1"
                     /transl_table=11
                     /translation="MLSCVGYAATAADAPLKPFTFERRETGPDDVRIDILYCGVCHSD
                     LHQARNEWHNTIYPCIPGHEIVGRVAETGTSVTRFKKGDMVGVGCLVDSCRECASCRE
                     GLEQYCEVGFVATYNGEDRHGRGITFGGYSRAVVVDQSFVLRVPDTLDPAAASPLLCA
                     GITTWSPLRKWKVGPGQRVGIVGLGGLGHMGVKFARALGAEVVLFTTSPGKIADGLRL
                     GAHEVVLSKDADAMAKERGQFDFILDAVAADHDINAYLDLLKRDGTMVQVGAPEKPLP
                     VSVFSLLMKRRSFAGSLIGGIPETQEMLDFCGKHNITADIEMIRMDEIETAYTRMLRS
                     DVKYRFVIDMATMPQSA"
     CDS             complement(434603..435658)
                     /codon_start=1
                     /locus_tag="GLX_03690"
                     /product="aldo/keto reductase"
                     /protein_id="BAK82781.1"
                     /transl_table=11
                     /translation="MKYNPLGQTGLLVSELCLGTMTFGGNDGIWKEMGGLDQKHADGL
                     VRTALDAGVNFIDTANVYAAGQSEQITGQALRNLGVARDDVVIATKVLGPMGAGPNAR
                     GASRAHILAQARASLKRLQLEHIDLYQIHGVDPLTPIEETMEALDTLVRSGDVRYVGV
                     SNWAAWQIAKALGIAERKNLAPLRSLQAYYTLAGRDLERELAPMLLSEQVGLMVWSPL
                     AGGLLSGKYNRDGTSMTGDGRRANFDFPPVNRERAFDVIDAMRPMAAAHGCSVAQIAL
                     AWLLHQKVVTTVIMGARRPEQLTDNLAATAITLSEVELAALDHVSALPPEYPGWMIER
                     QGGYRTGAMAGEKPKSA"
     CDS             435840..436754
                     /codon_start=1
                     /locus_tag="GLX_03700"
                     /product="transcriptional regulator"
                     /protein_id="BAK82782.1"
                     /transl_table=11
                     /translation="MMSQPLMTLRQTMARHATGLQTETPVPGLVLFHSVGQTLPMESV
                     YRPRLCMIVQGSKQVRLGTRVFTYDTRKYLIATVDLPVTSCVTQASADMPYLSLSLDL
                     DPAEVAALLLGAPPVATDARMSPGLAVSALTDDLLCPMARLVNLLDRTGDIPVLAPLI
                     KREILYRLLQGEQGGQLRQIALAGSHLSQVSGAIAWIRQHYAQAFDVDTLARQTGMST
                     PSFYRHFRAVTMMSPLQYRTRIRLHEARRRMVSVGEDAARAGFAVGYESPSQFSRDYR
                     RLFGVPPARDVAALRATLRAMPQRQQAG"
     CDS             436969..437682
                     /codon_start=1
                     /locus_tag="GLX_03710"
                     /product="aspartyl/Asparaginyl beta-hydroxylase"
                     /protein_id="BAK82783.1"
                     /transl_table=11
                     /translation="MARKKTIYHLTKGLRDRVDAFIMRQSLLPDQAVFDPSIMPWVSM
                     LERNWENIRDEALRVGVGNIPSLGDISPDHGRIAADRRWHSFFLEGYGYKRQENRARV
                     PLTATLIDHIPDLCTASFSVLEAGCHIPRHRGMTKGMLTYHLALRVPADRENCWIQIE
                     EGEKLHVCPWTDGHSLLFDDTYNHEVWNNTDQDRYVLLIQVRRPCRWPARLLMSLFFV
                     GVRYSRFVQDIRKNLDRRG"
     CDS             438169..439578
                     /codon_start=1
                     /locus_tag="GLX_03720"
                     /product="hypothetical protein"
                     /protein_id="BAK82784.1"
                     /transl_table=11
                     /translation="MKPARSPLSRPQPDACDLSRRARYEYGAALRKGTARARHGLWHA
                     PHGRPDPVGVLIAQGTSRIQDLLPVRYARMLVSPFAFLRGAATIMAGDLAHTPAAGPM
                     VQGCGDCHLANFGSYASAEGTPVFDINDFDETLPAPFEWDIKRLGTSLVLAGRQGGLS
                     DGASRRLAVTMAQAYATEMKRLSLFSPLEVWANPINLSAAIAGFASKQARTQAQALLA
                     QRMESARGHYGLVDTRQPMPALRERRPLVMRLPAHDDVIRKAFARYVATQPAELGVLL
                     ARYRLHDVIFKVVGIGSVGMFCAIGLFATVDGDMLLLQIKEAQQSVLAPFAGLSSFSN
                     QGQRVVTGQRIMQAQSDLFLGWTHSAGQDRGATDEAGFLGAGRQFYVRRLKDARLAAV
                     GSDVTPEGLPDYAHLYGRTLARAHARSGDTAVISGYLGRGRSFSDAVGSFSILYADQT
                     RADWDVFCKAVRTGRIVVA"
     CDS             439719..440414
                     /codon_start=1
                     /locus_tag="GLX_03730"
                     /product="hypothetical protein"
                     /protein_id="BAK82785.1"
                     /transl_table=11
                     /translation="MKIGIIGAGQIGGTLACKLVALGHSVSIANSRGPQTLAALAAQS
                     GAHAATVADAVKGADLIVVTIPEKNIPALGHAPFAHVSPEVVVVDTCNYYPRQRDGRI
                     AAIEDGTPESVWMAQHIGRPVIKAFNNIYARHLLENGRPAGTPGRIALPVAGDDARAK
                     KVVMEMVDALGFDPVDAGPLAGSWRQQPGTPVYCADLDADGVRHALAQARPERLPQWS
                     ATDKSPGSFEQPA"
     CDS             complement(440420..440746)
                     /codon_start=1
                     /locus_tag="GLX_03740"
                     /product="hypothetical protein"
                     /protein_id="BAK82786.1"
                     /transl_table=11
                     /translation="MFVFAQFAELGHSSMAQRYAIRLMAEAGAFMAHLLSGPQLVACM
                     AMVNALTGRSAHAIFGMPDDRKFHSSKTLFHRAALREAAFCTALACFFNDAEDTPTLR
                     RAHLVP"
     CDS             complement(440840..441139)
                     /codon_start=1
                     /locus_tag="GLX_03750"
                     /product="hypothetical protein"
                     /protein_id="BAK82787.1"
                     /transl_table=11
                     /translation="MAVQYWGKTMFRMQVKETPDISVPFDPPASGTPVQLPPPYDPDR
                     HDPDDEKPLDPPDWPVPDDDEDGDHDDGRDEPPARDEENGGPLFSLCVDPHARSL"
     CDS             441264..443396
                     /codon_start=1
                     /locus_tag="GLX_03760"
                     /product="glycogen debranching enzyme"
                     /protein_id="BAK82788.1"
                     /transl_table=11
                     /translation="MLKDRLREGHPYPRGATWDGEGVNFALFSAHAHKVEVCLFDHDG
                     MTEIERITLPEYTDQIFHGWLPDIGPGQFYGYRVHGPYEPDVGHRFNPNKLLLDPYAR
                     AHMGDLKWDPALFGYTLGHKDADLSFDTRDSARFMPKCVVINPGFDWHGQSGRNPLPW
                     DQTVLYEAHVKGLTRLHPRVPEGLRGTYAGLATRDVLDYIRALGVTSLELLPVHSFVN
                     DQHLLEKGLSNYWGYNTIGFFAPDPHYAADRAESLREFKEMVSAIHAAGLEVILDVVY
                     NHTAEGNECGPTLSFRGIDNVSYYRLVKDQPRYYVNDTGTGNTVNLSHRRVIQMVTDS
                     LRYWADEMHVDGFRFDLGTILAREPNGFDNQSGFLMACSQDPTLETVKLIAEPWDCGP
                     GGYQVGGFPPGWAEWNDRFRDVVRNFWRGGEGAGALAPRLLASPEQFDHQGRKPWACV
                     NFLTAHDGFTLNDCVTYDTKHNEANGEDGHDGADQNNSSNYGVEGPSDDPAIQELRGR
                     QIRNMLATLLVAQGTPMLLAGDEFGRTQGGNNNAYCQDNPISWINWDFGTRGKTLIRF
                     VTWLTDLRRRLPILRRGRFLTEAYNAELDIKELTWLRPDGVEMTPQDWDGAHCVGLML
                     DGRAQPTGIRRRGADATLLMVFNARSEPVELTLPSVSDQHWRLLVDTRIDDGGAGQTD
                     RHFSPGNLYPIADRAFALFELLPDAAPA"
     CDS             complement(443696..443860)
                     /codon_start=1
                     /locus_tag="GLX_03770"
                     /product="hypothetical protein"
                     /protein_id="BAK82789.1"
                     /transl_table=11
                     /translation="MGGVRISPPDTQVYAYTRRAGRKAAVVALDFSDTDASFTLLVGH
                     AADVKGNAET"
     CDS             complement(444282..444917)
                     /codon_start=1
                     /locus_tag="GLX_03780"
                     /product="hypothetical protein"
                     /protein_id="BAK82790.1"
                     /transl_table=11
                     /translation="MRNNRNNPIMNTQSPSPRAPRIYLAGDTVFRPGAADLFRAMKDI
                     CTKAGLEGVCPFDGQAEVDDLAPGAQTSLLIARLDRDLMDGCDAGVFCLDPFRRAADM
                     DPGTAVEIGYMAAQGKKLAGYTVDGRAYPQKVAQYRKQAWGDSLRERTGNGGSGTTED
                     ADGLIVHSEGMVQNAMTEGFIRLSGGEVCVDTDLLTAFGMAIDNLRQRLLG"
     CDS             445041..445970
                     /codon_start=1
                     /locus_tag="GLX_03790"
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="BAK82791.1"
                     /transl_table=11
                     /translation="MKIIIDTDPGQDDALTILLALASPEIELLGVTTVAGNVSVEQTT
                     ENALKTLDLAGRTDIPVHAGADRPLLRPAVNATHVHGRTGFEGVDLPPPSRAANPGHA
                     VDFIIRTVMENPPGSITLCTIGPLTNIALALAREPALRERIGQIVMMGCAFSEVGNIT
                     PTGEFNVYVDPHAAEMVFASGIRLVVFPLDVTHQLHTSAARLARIEQIPNRIGPVVAA
                     WLRFEKRFEATKYGTDGGPLHDPNTVIWLLRPDLYHGREVNVEIETGSPLTMGMSVVD
                     WWGISRKPKNALFMRDVDVEGVYDLIVDRLSRL"
     CDS             complement(446010..447407)
                     /codon_start=1
                     /locus_tag="GLX_03800"
                     /product="dihydropyrimidinase"
                     /protein_id="BAK82792.1"
                     /transl_table=11
                     /translation="MLHVKGGTIVTADRTFKADILCDDKGRIASIAPDIATPTGCEVV
                     DAGGLLVMPGGIDPHTHLEMPFMGSVASDDFFTGTAAGLAGGTTSIIDFVIPEVGGSL
                     LGAWKEWRGKAEKAAADYAFHVAVTHWDEQVPKDMETLVNECGVNSFKHFMAYKNALM
                     VDDDVLLHSIRRAGELGALCTVHAENGDAVAYLQAKLLAEGQTGPDAHPRSRPPTVEG
                     EAAQRVIALAGLLDAPVYIVHVSTQEAAHAIANARMRGQRVYGEVLPQHLVFDESVYT
                     NPDWLTAARFVMSPPFRPRHHQQALWAGLTSGQLQTTATDHCCFCAGQKENGRSNFTH
                     IPNGTPGIEDRMSIMWHHGVVSGRLTPQEFVAITSTNTARIFNMHPRKGCIAEGADAD
                     LVLWDSTGTRTISAATHHQNVDYNIYEGMTVTGVARRTISAGRVVWDDGDLRVTRGAG
                     QYIARAPLPRGHKAV"
     CDS             447542..449044
                     /codon_start=1
                     /locus_tag="GLX_03810"
                     /product="APC transporter"
                     /protein_id="BAK82793.1"
                     /transl_table=11
                     /translation="MQGRADHMDSHLVNEDLAPVRTRSWKWFDYVSLWMSNVHSIGGY
                     ITAGSLFAMGLPAGDVFIALVAGIVIIQVICNLVAQPSFASGAPYPVMARMAFGVRGA
                     IIPGLVRGIIAVGWYGIQTWLASNAVLVLLLRQWPGLAPWADVRLHGLLGLSALGWGC
                     FMFLWGLQGAVFWRGMETIRRFIDWAGPVIYVVMIGLDGWLLWRAGGHVSLDVLGTVP
                     QGMGARMLGILNATALIVAYFSPIALNFGDFSRYGISMGDIRRGNFWGLPVNFIGFSI
                     LTLLTIVLTRPVFGRLMVDPVEVVSQIDNPTAVALGVLTFVTATAGVNIVANFVSAAF
                     DFSNLAPHAINWRKGGAIAAVGAIVVTPWNLYARPDVIHLTLDILGTFIGPLTGVLLA
                     DYYITRRGKMDTSALYTANPQAPYWYHAGINPVAMAALLFSVLCGLVLVFGPVFSPVR
                     NLSWFVGFSCAIASHVVLSRLWGRTGQTPALASQGRPVIVPTPFSPRGDD"
     CDS             complement(449073..450335)
                     /codon_start=1
                     /locus_tag="GLX_03820"
                     /product="major facilitator superfamily sugar transporter"
                     /protein_id="BAK82794.1"
                     /transl_table=11
                     /translation="MHTDSVRIDSHDSTHHMTFPTPGTPPHTATGIARPLIMVFAAAC
                     GLIVANIYYAQPLTGPIAASLGLAPRWAGIIVTVTQMGYCLGLLLIVPLGDLLENRGL
                     VVWMTRAVAVALLVVAFATRPALFLVGMWLVGLLSVAVQVLVTFVTHLTPLAIRGRVV
                     GSVMSGLMLGIMLARPLASLVAQLASWRAIFVLSATVMLGLSFLLRWSLPRHQSASTQ
                     GYGPLLVSMARLFATTRPLQRRAFYHACLFATFSLFWTVTPLLLSSPRFGVSQGGIAL
                     FALVGVAGAIAAPIAGRVADRGWIWSATLAAMALTALAFTLTWFVAPRFFIAALGLEG
                     ILIDFGVTTNLVLGQRVIFSLSAAYRARLNALYMAIFFLGGATGSALGGWAYASGGWE
                     RACMVGMALPALAFLACLTEAGGRRQTP"
     CDS             complement(450384..451325)
                     /codon_start=1
                     /locus_tag="GLX_03830"
                     /product="nucleoside hydrolase"
                     /protein_id="BAK82795.1"
                     /transl_table=11
                     /translation="MKRKIIIDTDPGQDDAVALFLALASPEIAVQAVIAVAGNVPRTR
                     TVENARRVLEMAGRTDIPVFAGAARPLRPTQTTAEHVHGPTGLDGIDLSVPPTMPVQP
                     ESGVTYLVDAIRAAQEQELTLVMLGPLTDLAMALTIAPDIAGRLREVVLMGGAWSELG
                     NITPAAEFNIYADPQAADIVFSAGIPLVVLPLDVTHKCLGLPDRLAALRANANRCSIA
                     AADMLSYSERFDLVKYGWKGAPLHDPCTIAWLVAPDLFGGRHVNVGIETEGKLSVGMT
                     VVDWWRVTDREPNALFLRDVDSDAFYSLLVSRLATLP"
     CDS             451957..454314
                     /codon_start=1
                     /locus_tag="GLX_03840"
                     /product="TonB-dependent receptor"
                     /protein_id="BAK82796.1"
                     /transl_table=11
                     /translation="MTQIYLRSLVSAIAISTVFSSYAASAQSAHTTTAARKTPVRHAG
                     TAPAAHTHTAPLHQMASSQPETLAVHVSRHARDGGGGMMRVETEPHAVQSVGKQYIEM
                     RSPASTGLDLIQNLPSVSIAMPDPDGFKGGSIFIRGLTDADMGLMLDGAPASLASYLQ
                     QNVDSENIESVNVMPGSSQVDMPTANAAAGTLDERTITPSEKRGGSVDFSYGTNNFSR
                     EFIRLQSGYIGHSGVRTYVSFSNAHARQWMGGGINERKHVDFGLQKDFDNGSFIKLFT
                     SWHNSMFTIDNYATASEFYDYKHNGVGYNRSNSQAAGGNYWKGNLDSWNQFFVSAPVH
                     VVVNKKLDFDMTPYLSTGFGWDGSSAGTVGATSACSGGCYYNNGTQAASNQLLSTYYA
                     QGWSPDVGVVAKVNYRIDRHNRFTFGYWYENNSVSEFSPTMATMASGRNPKTDNSAAM
                     LYNMDGQKLVSTVHSGYELNSFFLQDSAKYLNDKLTVNAGFKFVMSNYWDRASGLLAG
                     SGSRLGENTTAPLPHLAIAYRFNAHHQIYMNAEGDFRQPSPSALPVGVTTLPKNQYSI
                     TEQLGYRFNNKWLIADISLFNSSITNRLLSVYMPSTQYETVNAGNETIRGFDAMIAGR
                     SFHHFSPYASVEYLYGRMDSNIAYGDSYLPTKGKQSINTPRVMANFGLTYANQGFFSN
                     FSLHYTGPQSVTMVGDERMPGYVTDTLAVGYHFKPLSFAKTPTIRLNFANLTGSIVRV
                     GTTGVATNMNQVMLLNGHDTAAAGAGASFYVLPRFSMTGTISTDF"
     CDS             complement(454752..455999)
                     /codon_start=1
                     /locus_tag="GLX_03850"
                     /product="nucleoside transporter"
                     /protein_id="BAK82797.1"
                     /transl_table=11
                     /translation="MTFHLRPLAGILVLLLVALACSTDRRAIRPRVIVSALACQIAAG
                     LVMLGLPAGRRVLGAVAHGISWVIDFGHAGIAFVFGGLANPALATSIPGWGFIFAINV
                     LPQIIYLSALIAVLYHYNIMQFLARGLGMALAWLTGVSAIEAFSAATAMFLGQTEVPI
                     AIHPYLARLSRSELLSVMSSGTASISMSMLAAYAGLGVPMEYLLAASFMAMPGGLLFA
                     KILFPATDGAVHAIAQPASTAETRSANLFDALAVGATNGMRVAVSVCTMLIAFISTIA
                     LFNALLGLAGSGLGYPGLSISGILGFLLRPFIWLLGVPWRECHVVAGIIGTKIAVNEF
                     VAYGNLTPYLAHATLPRQTLAVASFALCGFANLSSIGVLIGAFGSQCPERRRDVASLG
                     GRAVLAGSLSNLTSAAIAGMFIS"
     CDS             complement(456033..456971)
                     /codon_start=1
                     /locus_tag="GLX_03860"
                     /product="indigoidine synthase A family protein"
                     /protein_id="BAK82798.1"
                     /transl_table=11
                     /translation="MNTNALPRSLPPLVLSAEVRDALAQGRAVVALESTIITHGMPWP
                     QNVETARQVENLVRAEGGVPATIAIIAGKIHVGLDDSTLEWLGTARDVMKVSRADLAY
                     ALSAGRHGSTTVAATMICAQLAGIRVFATGGIGGVHRGVEETMDISADLTEFARTPVA
                     VVCAGAKALLDLPRTLEFLETQGVPVVGYETNDFPAFWSRSSGLPVPLRADSAKDIAS
                     MIAMRTTLALEGGVVVANPVPQVSEIPRAEMETFITQAVEEARRDGITGKAVTPYLLS
                     RMLELTAGRSLETNIALVLNNARLATHIALALSGKA"
     CDS             complement(456968..458122)
                     /codon_start=1
                     /locus_tag="GLX_03870"
                     /product="carbohydrate kinase PfkB"
                     /protein_id="BAK82799.1"
                     /transl_table=11
                     /translation="MEHTMPPRHSLTEQERIVLDIIMDNPFASQKDLAERCGMTRPTL
                     ATHIGQLTRKGYLLGRAYVAATRAPIVCIGGAAIDRKFCLFSPLVPGTSNPATGYTGF
                     GGVARNVCENLARLGQATALVSIVGDDLPGHALADHMKSCGVDTSRIQFAGNASTAEY
                     IAILDDRHDLGVAVFDAVVFERLDIDYIRRCWPLIAAAGWLFVDCNVSVEVLAWLTRK
                     AREGSFSLAVDTVSVPKAQRLRGQLDGVQVLFTNRDEALTLLDGTTTADTSAAIAAAL
                     VMQGVGTVIMTEGARGLTVADSSGVHALPAYRTDVVDVTGAGDALVAATLSALSENMD
                     TVTACRHGLAAAALTVGSRESVCPGISHDALDTFMTTHACTQDQAKETVQ"
     CDS             complement(458224..458922)
                     /codon_start=1
                     /locus_tag="GLX_03880"
                     /product="transcriptional regulator"
                     /protein_id="BAK82800.1"
                     /transl_table=11
                     /translation="MNPKGIPVPLMPPVPPTIPTRRKRTGAPRQNNTRQILNAAEKVF
                     AAHGLSGTRMNDIAEASNLPKANIHYYFRTKEDLYRATLKQLLDDWLGDASKWLSADR
                     SPQEGLRGFIEAKMEFSRKRPEASRLFAHELLSGGRYVHDFLVDTLRKHVEQRTRVFK
                     AWHEAGLMAKTDPVHFLFCLWAMTQAYADVQVQMAAVLGKPHLTGRDYATGTQTIMQM
                     VSSLLPPSPPETAE"
     CDS             complement(458968..460374)
                     /codon_start=1
                     /locus_tag="GLX_03890"
                     /product="transcriptional regulator"
                     /protein_id="BAK82801.1"
                     /transl_table=11
                     /translation="MTAHAPPRPDRDSATPLVGQIGEDLAHRIRSGMLRRGARLPSIR
                     RMARECGVSTLTIANTYLRLAAAGLVESRGTRGYFVCTPPRAAPLIQRSIDSTWLLQY
                     AYEDEAPVIKAGCGWLPSDLLFTSATRRALAGMTPGRLASVLEYGNPYGHAGLRHDIS
                     QMLARRDVCCEDGNIIMTHGASQALELAVRCLSTRGDTVLVEDPGYCNLYPALQSLGL
                     RTASIPRLPDGPCPDALARMVRQHQPRLFITTSILHNPTGSCATTRNMHAVLDIATRH
                     DLTVIEDDIFLDLAPEGQQTLSQLGGLERVVHIGSFSKTIAPGLRVGYVACASDTAQR
                     ILRQKMASNLTTAPLNEEIVHAIVSSGLYRPHLAHLREHLTRVQARVCTRLGQAGMAV
                     HFQPPGGMFAWARFGQDMDVRALAERACQHDIMLAPGHLFRPGGQPSQWFRFNVAHCE
                     DERLFTFIKSVACGKGID"
     CDS             460520..461869
                     /codon_start=1
                     /locus_tag="GLX_03900"
                     /product="beta alanine--pyruvate transaminase"
                     /protein_id="BAK82802.1"
                     /transl_table=11
                     /translation="MVQDSEKTALLRNKQDGVYWQPYTANRLLRANMEPRTMVSAKGA
                     YYTNSEGTKLFDTLSGLWCTPLGHAHPRIVEAVRKQAETLDFAPSFQLTHPGAISLAE
                     RIADLAPDNLNHVFFANSGSEAADTAIKVALGYHRLKGEASRFRMIGRERGYHGVGLG
                     GMSVGGIVPNRKMFAPIMMNGVDHLRHTYEPSHMAFTRGQPTWGTHRAEDLVRLVTLH
                     DASTIAAVIVEPVQGSTGVVVPPVGYLQRLREICTANGILLIFDEVITGFGRMGENFG
                     AQRFGVTPDIITFAKAVTNGIVPMGGVIVTDEIYNTFMTGPESAIEFCHGYTYSGHPM
                     AAAVGHVVLDVMREEGLVERVRVLEPVLEEAMHGLKDLDVIADIRNIGLTAAFDMKPA
                     EGKPGARGLALFEAGLRNGLLLRCTGDTVSFGPPFISTEQELRDMAATLRRLITEVC"
     CDS             461915..462328
                     /codon_start=1
                     /locus_tag="GLX_03910"
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="BAK82803.1"
                     /transl_table=11
                     /translation="MPLMHFHMVKGARTPDELRGFLDAAHDAMVAAFKVPGRDRYQLV
                     SEHEPTHMIVEDTGLDIPRTPKVVLLQVFSRPRGKEQIAAFYKLLAETLEARTGLAPS
                     DLMVSVVENNDEHWSFGHGRAQFLTGELPLPGAKA"
     CDS             462546..463898
                     /codon_start=1
                     /locus_tag="GLX_03920"
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="BAK82804.1"
                     /transl_table=11
                     /translation="MPQGPDIAPGRLSDTELALNFSDAHPPLTHAQAVVEADRCFYCY
                     DAPCIEACPTGIDIPRFIRAIATDNMAGSARVILESNILGGSCARVCPTEILCEQKCV
                     HNTREEGQPIRIGMLQRHATDWQMDHGGQPFTRAPSTGRRIAIVGAGPAGLACAHRLA
                     MHGHDVMIFDRHARAGGLNEYGVAAYKLADDFAQREVDFLLAIGGISFAGGEALGRDM
                     TVASLRREYDAVFLAVGLAGVRSLGIEGEDLDGVMDAVDFIEGLRSVNKQTVPVGRRV
                     VVIGGGNTAVDAAVQARRLGADEVTLVYRRGYENMSATPVEREWAQTNGVTVKLWASP
                     VRLVARDGALAGIEFARGARGADGRATYDAQNTFVQDADMVLKAVGQTFLPDPLNGES
                     IALAGGRIVVDENGQTTMPGVYAGGDCTPGEDLTVAAVRDGRNAAEAIHAAFTAAAAK
                     "
     CDS             463910..465184
                     /codon_start=1
                     /locus_tag="GLX_03930"
                     /product="dihydropyrimidine dehydrogenase"
                     /protein_id="BAK82805.1"
                     /transl_table=11
                     /translation="MADLRTNFVGIRSPNPFWLASAPPTDKEYNVRRAFEAGWGGVVW
                     KTLGEDPPVVNVSSRYGSLNYNGTRMIGLNNIELISDRPLATNIAEIKSVKRDYPDRA
                     VVVSLMVPCVEESWKAILPIVEETGADGIELNFGCPHGMSERNMGAAVGQVPEYVEMV
                     TRWCKQNTRMPVIVKLTPNITNVLMPARAARRGGADAVSLINTIQSVIGVDLDTMAPM
                     PTVDGKGTHGGYCGPAVKPIALRMIGDIARDPEMAGLPISGIGGIGSWRDAAEFLAMG
                     ATTLQVCTAAMHYGFRIVEDMTDGLSAWMDQKGYATINDVTGRAVERFVPWNQLNMKF
                     NTIARIDQDACIKCGLCHIACEDTSHQAIAKTKVEGERHYEVIDEECVGCNLCAHVCP
                     VDDCITMQPQPVDGVLTWPEHPNNPHRVAVES"
     CDS             465198..466496
                     /codon_start=1
                     /locus_tag="GLX_03940"
                     /product="allantoate amidohydrolase"
                     /protein_id="BAK82806.1"
                     /transl_table=11
                     /translation="MVAQHGRKPMTQQNTAPHGSNIGIDGQALWADLMETAKFGGTPK
                     GGVRRLTLTAEDKQVRDWFVRTCESLGCTVTFDSMGNQFARRAGLDDSLPPITIGSHL
                     DTQPTGGKYDGILGVLGGLSVLRALQRSGYVTRHPIEVINWTNEEGSRFTPPMMCSGV
                     FTGVFTEQEVLDKRDRAGKRFGDELEAIGYRGSEPCGKHPVTAYFELHIEQGPILEAE
                     HKTIGIVTGVQGARWYEVTVKGKDAHAGSTPMPMRHDALLASARMIEAVSQVACAHAP
                     TAVGTVGLIENRPNSNNVVPGEVFFTIDMRDPDDAVVSQMEDELYSQLPEIARRSNVE
                     MEIVRIWDAPAVHFNPECIGMVEAAAAESGYAARRIVSGPGHDAAYMAHVAPTTMIFV
                     PCEDGLSHNEAESITEQDAAAGAGVLLKAIMKADAAFNAG"
     CDS             complement(467076..468311)
                     /codon_start=1
                     /locus_tag="GLX_03950"
                     /product="nucleoside permease"
                     /protein_id="BAK82807.1"
                     /transl_table=11
                     /translation="MHIRGYFGIMLLICIGILFSTDRRRINARIILSCLLLQGAIGVL
                     VLRVPAGQALLRAMAGAVTGVLSYGSEGGRFLFGALVGPRMHEIFPDGSYIFAFQVLP
                     SLVYVSALIAILYHFGIMQAFARVLGLGLQRLLGTSPVESFGAIITIFVGQSELPVAL
                     GPYLATMNTTELFSTLCSGTASISGATLIGYFGLGVPAEYLVAASFMAVPGGLLFAKM
                     LEPRLPDSPVSPVSAAGGAYHRAFFEAVMEGALKGAHTAMAVAAMLVACIGLIALANG
                     MLQAAGGAVGMQGLSLEYLMGFIFAPLAWLLGVPASECSAVGSVLGLKVVLNEFVAYL
                     HLGPDIQAGRLSHRAGAIASLALCGFANLSSIGLLVAAFGSQCPERREEVARKSARAV
                     LGGMLSNLMSAAIAGIILP"
     CDS             468443..469063
                     /codon_start=1
                     /locus_tag="GLX_03960"
                     /product="hypothetical protein"
                     /protein_id="BAK82808.1"
                     /transl_table=11
                     /translation="MADPIPPHWPDPRQIMTFAPGDPDENPWVMGQPPPESITLQPWC
                     PDWQVRFAQLEREIRKVLGGGALAVEHVGSTAVTGLAAKPVIDIDCIVPDPGCEETYR
                     PRLEALGYVMTVRERSWYGHRMFRHTHPRANLHIFGPACPEHARHILFRDWLRTHPDE
                     RERYARVKTQASIGVANVQEYNRNKQALILAIYQRIFAYMGWTDPA"
     CDS             469159..469695
                     /codon_start=1
                     /locus_tag="GLX_03970"
                     /product="transcriptional regulator"
                     /protein_id="BAK82809.1"
                     /transl_table=11
                     /translation="MARPRTIDRDSVLDSAERLVQRRGASALTLDAVAREAGITKGGL
                     QYCFGSKDDLITALIDRWIAQFDAQIARHLGPDPTPRARVAAYVAACGQTDAPTHARL
                     VGMLVTLLHSPRHLQRVRDWYAGWFHKHMPGSDAGERARTAFFAAEGAFFLRSLGFVE
                     MDEAQWQNIFASFQRLAM"
     CDS             469744..471873
                     /codon_start=1
                     /locus_tag="GLX_03980"
                     /product="squalene--hopene cyclase"
                     /protein_id="BAK82810.1"
                     /transl_table=11
                     /translation="MTFLTGTEKMNKESRPFPPTASGTAGPAASTTQQAPTGSPRALD
                     NSLSHTISAACDWLIGQQKPDGHWVGPVASNASMEAEWCLALWFLGLEDHPLRPRLGH
                     ALLEMQREDGSWGIYYGAGNGDINATVESYAALRSLGYGADEPTLARAAEWIASKGGL
                     RNIRVFTRYWLALIGEWPWEKTPNLPPEVIWFPNSFVFSIYNFAQWARATLVPLAILS
                     ARRPARPLRPQDRLDALFPGGRANFDYELPRKEGRDLWASFFRTTDRGLHWLQSRVLK
                     KNSVREAAIRHMLEWIIRHQDADGGWGGIQPPWVYGLMALHGEDYQFHHPVMAKALSA
                     LNDPGWRHDRGDASWIQATNSPVWDTMLALMALHDADGETRFTPQMDKAMGWLLDRQV
                     RVKGDWSIKLPDVEPGGWAFEYANDRYPDTDDTAVALIALSSCRNRPEWQARGVEAAI
                     KRGVNWLVAMQSESGGWGAFDKDNNRSLLAKIPFCDFGEALDPPSVDVTAHVLEAFGL
                     LGLPRDMPAIRRGLAYIRAEQAAEGPWFGRWGVNYLYGTGAVLPALAAIGEDMTQPYI
                     AKACDWLVGCQQENGGWGESCASYMEISSIGRGPTTPSQTAWALMGLVAANRRQDHDA
                     IVRGCRYLIDLQQPDGRWDEKEFTGTGFPGYGVGQTIRLDDPALSKRLQQGAELSRAF
                     MLRYDLYRQLFPIMALSRAARVLKAAG"
     CDS             472070..473701
                     /codon_start=1
                     /locus_tag="GLX_03990"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAK82811.1"
                     /transl_table=11
                     /translation="MNTSAPTADGPVIHAAPPRPSYIPPFGVRTVIGCLGMLLAVHVA
                     GFNEHVTEIGLSDIRGAMHIGHDEGTWVIAIYEAFNIAAMAFTPWFYMTFSIYRFSIF
                     MTAMLALLSIPAPFMPDVTSLCILRAFQGLAGGCLPPVLMTVMLKYLPPPIRVFGIGG
                     YAMSATFGPNLGLPLEAFWFEHVGWHWLYWEIIPTAALAIAMMAYGLPRDPMHFERFE
                     KFNWLGVLVGLPAICSLVIVLYQGDRLDWFRSPVITNLAFWGGAAFIVFVINEAYHPS
                     PYFRIQYWRSRNIQASLLSLVGILAICAMMGNIPAVYLEGVRGYRPIQAAPVSLVVAL
                     PQLIMLPLIAAICNSRRVDCRFVLAGGMLCLAASAWLGTWLTVDWVRDNFYLLQVLQV
                     FGQPMTVIPTLMLATMAMGPADGPFISGMVNILKGLANAVAFAIFGALTRRREQYHST
                     MLLDHHGTHRLALQGMGDPISQQLAPTSPDSAHVARNALQVFHTYVHEQALVLALNDI
                     YYILIWVCLFYAVMNLVLPHRVYPPRAPSPSAPAR"
     CDS             473718..474794
                     /codon_start=1
                     /locus_tag="GLX_04000"
                     /product="major facilitator superfamily multidrug
                     resistance transporter HlyD/EmrA/FusE"
                     /protein_id="BAK82812.1"
                     /transl_table=11
                     /translation="MIYRKPLLYAGCTAVVLALVAWGGARLVNGDGINQYTNDAYVTA
                     DFPTVAPKVSGRIDRVIAQDNEQVHAGEELAHIEDDDYRAALDVARGNRQAAQGDVSN
                     LEAELTRQDAVIAGARAAVQSDEADLAFARLNAARYRNLSSGGAGTIEQKQHSEAQEK
                     EAQAAIARESAGVDAAIRQVDVLKGQLERARGMLLRAQGDERQAELNLSYCTIPAPMD
                     GVVGARGVRVGNYVHAGTGILAVVPTHEAYVLANFQETQLTKVQTGQAATIWVDTFPG
                     HPLKAHVDSLAPATGVAFAPIQPDNATGNFTKVVQRIPVKLTFDPGQPLAARVRVGMS
                     VEVNIDTSSKPEGPHASDAHYVWQ"
     CDS             474799..476319
                     /codon_start=1
                     /locus_tag="GLX_04010"
                     /product="secretion system type I outer membrane efflux
                     pump lipoprotein NodT"
                     /protein_id="BAK82813.1"
                     /transl_table=11
                     /translation="MKRFALVGLSALALAACTVGPTYHKPHVKAPATWRETQPPAEST
                     VSTASTDPQWWTLFNDPLLTRLEGEVAASNLDLKAASLRLMQSQAERRIASAAQFPHA
                     EANASYGRERASTNGVLGLLGTMEREGTGSIASGTQGFGPTALPGSVGNPSFNLPQYG
                     MNASWEVDLWGHVRRQVEAATAAMHATEEMRRDILVSLMAETAQDYIDLRATQTQIGI
                     LEHNIAIATNSVRLTTMRLQQGAATRLDVAEATGQLHTFTARLAPLKAQATHLLNALS
                     FLVAREPGALDAELGASAPIPVVPATIPVGLPSELAERRPDIRMAADRLHAATASIGV
                     AIADFFPRITLSGSLDVQALQFSGLGSWASRQYGFGPTATLPIFEGGRLTGQLHLRRA
                     QQKEAATMFQRTVLKAWQEIDDAMADFTAAQKRRDELTQAVHENEIAVETAKLQYVQG
                     SSDFLNVLTLQNALLAAQSAQADARAHVADSVTRLYRAVGGGWQDLYPEKKAKKHG"
     CDS             476329..477072
                     /codon_start=1
                     /locus_tag="GLX_04020"
                     /product="pirin domain protein"
                     /protein_id="BAK82814.1"
                     /transl_table=11
                     /translation="MMDIRRAATLGTAHSDGLELRCHFAFADYTDPAHVHEGRLRAVN
                     LGILGAGETYRLGQEASVDIVTWVQAGSLSAQMDGCEPEQLGAGGVHLASTGNGCAAV
                     QWCAGPQGASIIQFWLLADIEGTTPAQETRAGLPGGDGGFVLLASGFPEDDPEESGAV
                     ADGAPVALSARARLAQAAIPAGEGAAYSTCNGRDLYLVVVSGSIGIGAAVLEHGDAAA
                     LAEVTDLTIIARADAVVLLVDVGADTSVF"
     CDS             477251..478303
                     /codon_start=1
                     /locus_tag="GLX_04030"
                     /product="glycosyltransferase"
                     /protein_id="BAK82815.1"
                     /transl_table=11
                     /translation="MFLMSSHFGTVVSVSGDNNFYHAYPEEVYPDLCFDIDGHIIRAP
                     EGFSKLHDIETRREGDSWVIVSNGQFMCADIGGAISWRTDCLAMEKFTLMPIENYVSI
                     QEGRIRIPRKRQTNHISRTVHQIFLNGQLPSAFETASEQLRKMNPDWEYVRYDAKDIL
                     DFIYDFYGWEILKLYLQINPRYGAARADLFRYLCIYQKGGVYLDIKATTRNPLDSFIR
                     PDDQYLLSRWKNGHGEPHEGCGLGPEMKSFDGGEYQQWHIIAAKGHPFLESVINDTIT
                     RIHKYREDYVGCGKLGVLRLTGPYVYTTSINKNITKYRHRFFDYHESGLIYNFINGYD
                     KLFKTHYSKENTPIVL"
     CDS             complement(478645..478878)
                     /codon_start=1
                     /locus_tag="GLX_04040"
                     /product="major facilitator superfamily sugar transporter"
                     /protein_id="BAK82816.1"
                     /transl_table=11
                     /translation="MSGAIRARATRPDVAGAAINSASNVGILLGSAIGGQVLTVYGFG
                     VLTPLAIAIVVCALAVALCNPAAFPHSLPAHEE"
     CDS             complement(478933..480543)
                     /codon_start=1
                     /locus_tag="GLX_04050"
                     /product="transposase"
                     /protein_id="BAK82817.1"
                     /transl_table=11
                     /translation="MTSAPAVLPDDPDTLREMIVSLQTEVARLSASARAYEALVQSLK
                     IRIARLQKQKFGASSEKIDREIEQLELLLEDVKIAIAAADPSPDIREHDVSDDALSPP
                     RQRGKPKVSDTTPRERIVLDPGEACPACGGPLRLVGEDVTEILDFIAAKLKVVETARL
                     KKSCRHCETLVQPEAPSRPVPRGMAGTGLLAHILVSKFDDHIPLYRQNEIFARQGVDI
                     PRSTLIDWCGQAVAVLRPLTDLIRQDVVKADLLHADDTPIQVLDPRLRQAGKPRGVKE
                     GRIWSYLRDPRPWGGSDPPAVAYWFSPDRKGINPQTHLAQFRGILQADAYAGFRDLYK
                     PDATGTVHVREAACWAHLRRAFHDVWKGSDSTIAREALEQIGELYDIERQITGHPAPY
                     RLAVRQEQSRPRVTAFHAWCETQLARIPGKGELAKAIRYALNRWKAFTLFLEDGRVAI
                     DNNPAERAIRPVCVGRKNYLFAGSDTGGDNIADAMTLIESAKLSRLNPHDYLADVLAR
                     INEHKINRLHELLPWNWKPVNTLHRQAA"
     CDS             complement(480607..480954)
                     /codon_start=1
                     /locus_tag="GLX_04060"
                     /product="transposase"
                     /protein_id="BAK82818.1"
                     /transl_table=11
                     /translation="MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALF
                     AFRGRRGDRIKLLMWDGQGFCLYYKVLEKGRFPWPSPAEGVARLTTAQMAMLWEGMEW
                     RRPSWSAPPSRVA"
     CDS             complement(480951..481310)
                     /codon_start=1
                     /locus_tag="GLX_04070"
                     /product="transposase"
                     /protein_id="BAK82819.1"
                     /transl_table=11
                     /translation="MTQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLT
                     RQHLYQWRTSFRQRLSSPDQSVAFVPVASVTTPAVASGGDPDELAIVLRNGRSIRVTG
                     HPAEDLLARVIRIAETA"
     CDS             complement(481416..482357)
                     /codon_start=1
                     /locus_tag="GLX_04080"
                     /product="major facilitator superfamily sugar transporter"
                     /protein_id="BAK82820.1"
                     /transl_table=11
                     /translation="MLFKSLPAPAVIGLWALFACTFTALTSEVAPVGILIDMARAFHI
                     AEGKAGLAVSAFALMVAVGAVPLTILTAHIDRKRLMVVSLAGYVLSNLVMAMAPTFVL
                     VCAGRMIGGVAHALLMSIVSAYAARLVPQAMTGRAISFVYGGTSLGAVLGVPGMAAAG
                     QLVGWRAAMFTLAGLSMVLTLCIAFFLPPVSSPVQVRETLPAMRSHRTMRIFMVVVVV
                     NGVFFIAHNLLYTYVTPLLLDHGLPGGALSAALLLIGGTSILGLWGAGQLVDRNPAAG
                     VLAGGLAMLAGMGLMYGHIISGWVAVGAVGLWCIGYS"
     CDS             482877..484499
                     /codon_start=1
                     /locus_tag="GLX_04090"
                     /product="methyltransferase"
                     /protein_id="BAK82821.1"
                     /transl_table=11
                     /translation="MALRGPRIMTDGCRVLMVFPLFNAGSFWNYTEACDLSGARYPAA
                     PLGLVTVAALLPQHWEIRLVNRNTEPLDDAAFAWADLVMTGGMLPQRNDALDLIERCI
                     KAGKPVMVGGPDVTSSPALYAAANFQVLGEAEEIMADFIAAWRRGERHGVFEAPMGKT
                     DVTKSPLPRFDLLKLDQYLHVGVQFSRGCPFSCEFCDIIELYGRVPRTKTTTQVLAEL
                     DALYALGYRGHVDFVDDNLIGNKKALRQFLPALQHWQEGKKYPFAFSTEASINLADDA
                     DLLRSLSASNFFAVFIGIESPDTDTLVMTQKKQNTRRSLQQSIATIHGAGIFVNAGFI
                     VGFDSEKGSIARGMIDCIEDTAIPVCMVGLLYALPTTQLTRRLRAEGRLFADDGQTHS
                     GDQCTAGLNFETTRPRRDVLDDYRTVLAAIYDPVAYFGRVRRLGRMLRRVRPHRMERG
                     DLRSFMRLLLRIHRAGPGTAGPFWRMLLDCVWHNPRAVPYVVMTSALYLHLGPFSRQV
                     RGEIDREIADVDAGRGPVYERVRPADAVLEPA"
     CDS             complement(484779..485552)
                     /codon_start=1
                     /locus_tag="GLX_04100"
                     /product="hypothetical protein"
                     /protein_id="BAK82822.1"
                     /transl_table=11
                     /translation="MLVHEGAERNAIIDRRLGCSLAAIAGAVNAAGFLAVGYYSANMT
                     GNVSSLATGLHAGHIGAVLSCCGLVLAFVAGGVLSALMVNAGRRRRLPSIYARSILLE
                     ASLLGVLGLTDMLLSAQPRGPMLAYGLSFLMGLQNATVTRISGARVRTTHMTGMLTDV
                     GLELADWMDSFFHPVEPAQLARTRERLGLHAAIVVSFTTGGITGVFLYGWWSALFLLL
                     LAAGLACLSLPGAVAPTGAAPPAVTAMERTGNQQAGRCS"
     tRNA            complement(485840..485914)
                     /locus_tag="GLX_t0040"
                     /product="tRNA-Val"
     CDS             486032..487000
                     /codon_start=1
                     /locus_tag="GLX_04110"
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="BAK82823.1"
                     /transl_table=11
                     /translation="MSLFYRGPAAPFRALTPTMPRECPTARTRQPGPGHMAEPDIPPY
                     HIIDAIGPQVPLVVASAHSGRNYTDAFLRMSRLGAHALRRSEDCYVEQLFEGAPGQGA
                     ALLHATFPRAYCDANREAWELDPTMFRDPLPPWCNTTSRKVRAGFGTIARIVSRDGPI
                     YPRPLPFSEAEARIRTCWQPYHDALARLVQDRLDHHGCCMVLDAHSMPVVAGQRDQPD
                     FVLGNAWGTACTPQLTAVVDQALRRHGYSVARNVPFSGGYVTRHYGQPRRGVQVIQLE
                     ISRALYMDQATLQRHTGFARVQAAVMDVVASMAHHGGILVTGQAAE"
     CDS             complement(487054..487455)
                     /codon_start=1
                     /locus_tag="GLX_04120"
                     /product="hypothetical protein"
                     /protein_id="BAK82824.1"
                     /transl_table=11
                     /translation="MVFPIGTRDGNTNTMSGIFNDVMGKLSDLAGSTGLSQQVHSYLS
                     QLLTPTAISSLMAQADQAGLGDKVRSWIGDGHNLPISTDELRSLLSNQQVQAMVDKTG
                     LPAATILPVLAHLLPEAVNTQTPTGEAPKTA"
     CDS             complement(487633..488316)
                     /codon_start=1
                     /locus_tag="GLX_04130"
                     /product="nucleoside diphosphate hydrolase"
                     /protein_id="BAK82825.1"
                     /transl_table=11
                     /translation="MDNPGDISFAPGIDPALHERVLQAPHFRRWYDGMRRRFTLRHVL
                     VRDAVAFGPRRMGFIMVEADAQHQGKAIPGLAMLRGDSVSVLLVLKCPGYPDRTVLTR
                     EARVPIAQPDMLALPAGMLDGGAFESTALRELSEEVGTDLRVQAHDLVELTTVWLSPG
                     GCDEAIGLYYAEVVVDEGLARRLSNRQTGLAAENEHIRLHVIDMDQLPHIGMTDAKTL
                     LSWHMYHAR"
     CDS             complement(488342..491302)
                     /codon_start=1
                     /locus_tag="GLX_04140"
                     /product="glycosyltransferase"
                     /protein_id="BAK82826.1"
                     /transl_table=11
                     /translation="MMAVSSTHAETAAGWATFDPAWYRARHAALLDMLGVGADETEGF
                     YTTHGAALGHSPNAFFDETWYRQTYPEVTRGIEHGTWASGFAHYLHAGLHTHSPHWLF
                     DEHAYRAAAPDVTLAMMDSAGYRNGYDHYLRVGDGEMRAGSCFFDPAMALAHVPGTGR
                     EAAAHPFVDYLLRGMEAGPDAAVSVYFDAGWYVQTYPEVRAAIDRGEWLCALHHYLCN
                     PTPCAFDPGPFFSESFYASVNPDVADAVEAGLLRNGYAHYLNDGVFEQRKPCSMLDLA
                     TYMRDPSVQADLAAGRARDGLGHYLTARPDLRPPPAPPVMEEQTRALFRHMCTVRLPL
                     LLGGRIDFTSDTPPELSVIIIAHNQFAMTMSTLASLRANYHGSMQVLVVDSGSRDGVA
                     SIERHVKGIEVLRFAGNIGFLRGCNAALARVRAPATLYLNNDVDLQFGAIANALARLG
                     AQDTTGAVGARVVRTHGMLQEAGSIIWRDGSVQGYMRDAHPSVPEAGFVRAVDFCSGV
                     FLMVRTDVLQVLEGFDEGYAPAYFEETDLCMRIRALGYTIMYDPTVCLVHYECGTSDS
                     TSASRLIARNSTLFTRSHARPLRRKLLRHPALLARARHADGGGRHILFIEDRLPLRHL
                     GSGFTRSNDIIATLAGLGYHVTVYPVYRPTEDAATLATAFPPGVEVIHDRELADLPAF
                     LEGRAGSLDAIWVARTHNAARLASILNNAAAAIPAGRIIVDTEAIAACRDEEHARLHG
                     QPPAQPFAARLEAELAPLFLADRVVAVNAAEADLLRGAGFDNVSVLGHMQVSRPTGPG
                     WAGRRDILFLGAVHDMAAPNLDSLAWFSGAVLPLLVERLGPDIRFGVCGHVNPRVDLG
                     PLRRHPNVTLLGQVDDTAPVYDHHRVFVAPTRFAAGIAYKLHEAAANGLPVVGSPLLC
                     RQAGWCDGDDMLCADVTDPAAFAAQVVRLYQDQALWDRVRQNALRRVESEHTPQDYRA
                     QVSAIMAGVFTQQI"
     CDS             complement(491349..492302)
                     /codon_start=1
                     /locus_tag="GLX_04150"
                     /product="hypothetical protein"
                     /protein_id="BAK82827.1"
                     /transl_table=11
                     /translation="MGQPVSPGPVSCYGGGMNTPLSTRLLALAVAVAILSWASAYPVV
                     RIALRDMPPVPLAAVRYALAALVALAWLVARRTPPPALRDVPLLVACAGIGISLYNIL
                     FNMGEVTVPAGAASLLIASAPLMTALIAMPVLGERLTGWGWLGSLFSFAGVGLIVGGQ
                     AGGMAFGAGAMLVLGAALCSAIYIILLRQLLRRYDGLTCMAYILIIGAVLLLPWLRQA
                     CAVLRHAPWSCVGAVAELGVFPAAIGYGAWTFVIREMGAARGSALLYTLPPVTMVLAF
                     MLTGEVPGLRTLVGGLIVMAGVLVINTWGHPARRVGAPIKN"
     CDS             complement(492330..492926)
                     /codon_start=1
                     /locus_tag="GLX_04160"
                     /product="hypothetical protein"
                     /protein_id="BAK82828.1"
                     /transl_table=11
                     /translation="MGAVAWHEVLFYPWWHIFPRAGPQPVIRTPVVTGQTSATRFLAR
                     HGVPFSVHEYDYAPGGGLIGMQAAAAIGADPACVLKTLVVMVDRTTPVCLVVPADHKV
                     DFKKVAGLFGGRNARMMAPERAAELTGFHSGGTSPFGQATQLPVVLSDVAMAQPHVYI
                     NAGRQGLVVGIAPTDAQAVVGAKIADISAPPLPAPVAP"
     CDS             493688..495037
                     /codon_start=1
                     /locus_tag="GLX_04170"
                     /product="hydroxydechloroatrazine ethylaminohydrolase"
                     /protein_id="BAK82829.1"
                     /transl_table=11
                     /translation="MFDILICDAHLYLDRDWEIAGGWIAIEKNRIHSAGGPGQPRPEA
                     RRVINAQGRLVTPGLVNAHHHMFQNLTRAYAPIARSGLFQWLQQLYPLWSGLDEEATY
                     VSSYISMVELLLGGCTTSTDHMYVHPRPGLMDAGFAAAYDVGLRFMSTRGCMTRAQEN
                     GGLPPAAVVQDEDTIMADCERVVAQFHDRAPGAMTRVALGPVSLFSASEQIMRDCLTM
                     AERHDLRLHTHLAEDEEEDDYSLSVYGCTPTEHFERMGWATPRAWVAHYIYPSSSEAA
                     RLIRAGVSMVQCPSSNMMIGNGSADVMDLRERGMNVGLGTNGSATTDMASMWMEARNA
                     MLLGRMRNGPASMVARDALDMATRGGAACLGWGDEIGHLRPGACADLVIWQDSPIAMA
                     GALTDPVEAWLRCGPMMAGTTIVNGKVLVEDTHPLQPDLADALRRHAIQARRIQKLD"
     CDS             complement(495233..495811)
                     /codon_start=1
                     /locus_tag="GLX_04180"
                     /product="hypothetical protein"
                     /protein_id="BAK82830.1"
                     /transl_table=11
                     /translation="MHPRMTILPMACTMAVLSALPAQAAGPPAFPAPAHLPDTTQPPP
                     PQRLYRHLWTDDRGISHIATCPVHDFFLKSMSPPAGPQWQDPMVPQVATVMMTVQPAH
                     WDGTWHPDPKPQWIIPLQGRWYVRAMDGTRVEMGPGDILFGEDQNVRPMANGPYRGKK
                     GHDAGNIGDGPVTLMVIQSANAPVINQPCRYH"
     CDS             complement(495950..497077)
                     /codon_start=1
                     /locus_tag="GLX_04190"
                     /product="L-sorbosone dehydrogenase"
                     /protein_id="BAK82831.1"
                     /transl_table=11
                     /translation="MIPATFRTICALLGLCAPLAAHADPRMDLLRVPQGFSISLVSGH
                     VPNARAMARGARGTIFVGSRAAGTVYALTGVDDGGPVKVHVLARGLDMPVGVAYHNGD
                     LYVSDTKRIVVLHAIEDHLDTPPRPQVVADGLPYRDGDHSWKFIAFGPDNRLYVPIGA
                     PCNICDVGHEYGRLISMAPDGTDRRDVAYGIRNTVGFTWQPGTDTLWFTDNGRDMMGD
                     DVPSDELDRLDTPGQSFGYPYCHQGNIPDPQFGSQHACSAFTPPALLLGAHVAALGLR
                     FYEGSAFPAAYHGNLMIAEHGSWNRSQLSGYQVVSVHFGPDSTPQPPTVLVSGFRQGQ
                     TAWGRPADVLPLPDGSMLISDDMAGAVYRLSYGRQGYGATR"
     CDS             complement(497151..499646)
                     /codon_start=1
                     /locus_tag="GLX_04200"
                     /product="response regulator receiver:GAF"
                     /protein_id="BAK82832.1"
                     /transl_table=11
                     /translation="MPNSAIQPHGWLLVCDAHLSHVMRWSANAPAHLGQGALEAGMYL
                     SDLVGQEATHNIRNALATHGEAHRRPALVFGQTVPGGDCFDVAIHTAGGEIMLEWEPA
                     IDTDRDGTYLTHLRTMIDRIREITDSERLFRTVVRLVAGVLRYDRVMLYRFSEDGTGR
                     VEAEYHTPTLESFLGQHFSLSDMPDPLRRLYSTNLIRVIGDVEAVPIPLVSPPGMGQA
                     DLSHTHLRTGTPGHCAYLRGMGVAACMSVSIMVDGQLWGMIAAHHHTARVLNMSERII
                     ARMFGEFLSLQITNLLRTRRLGMTRQTHALIETFLKGAAPVADMPAYLMAHLPDMLTF
                     VQCDGAALWVDGQWTYHGAHPPTDAMPAMLELARAHAGSQIWHTARLCTFRPEAAAFA
                     DRAAGVMVVPISSQPGDYLMVFRKEVVRTLKWGADTTIPDRNGNPENVYFGPRSGFAL
                     WTHRVTREGLPWSGDDLEAATLVRSALIEVMGAYHQLQLRERATADLRQRMLNEELNH
                     RVKNILSIVQSLVSQPVEPDCTPAEHVARLRGRISALGLAHDQAVRSEGGGLLNALLD
                     AELAPYRARCFVTCTGPRIWLTGQALSVLALVVHEMATNAVKYGALSHARGRLDIVWS
                     FDATQDVWRIHWRETGGPAVVSRLRRGFGSVLIERGFPHELGGTTEVDYGPHGVSVTL
                     SLPARHVKSAPPPTPAANVHNPATMAARKETTVLDADILLVEDQFLIAMEAEGAIEEM
                     HIGQVRTVASVYEALSAIRTRLPDVAILDVNLGGESSVEVAHALRARGVPFIFATGYA
                     DRTMIPPELHDVPIERKPYSATALAERIREIVS"
     CDS             500084..502639
                     /codon_start=1
                     /locus_tag="GLX_04210"
                     /product="hypothetical protein"
                     /protein_id="BAK82833.1"
                     /transl_table=11
                     /translation="MPRDMIDDMQVTVLPALEQTILGVVLIDENNTVTFFNKAAEGLW
                     HCVRQDVIGRNVNILVPRNIRSTHDDLIRHNRETGINKIVGTSREVLVERFDGTTFWA
                     NLSLSRIAVDGKIGYMALIRDISQEVDDREKIRLLSLVVRETDRGVAILDPEFRIIYV
                     NRAFSDMFGFGPERVTGHGLSVILAGDTTDIGILNQLHEGARNARGFTLDIRARHASG
                     RDIWVSAAMNPVFNNEGDIENIVVVLTDITEQHFLDSLQRDTLEAISSDLGLHEVMDF
                     ICRRIEHYIPDVMPAIYLVEKDERLKCKGRASLPLSLVKLYDTLPIGPEAACSGVAAS
                     TGTVAESPDIAHDPRWHHLREQTLHNGIRAARATPIILRDNRVAGVFTCYSRTDHLPD
                     AACQKAVATSLHLCTLAIERHEAKEHINRLSDFDLLTSLPNRRWLRQNMARILRRAVR
                     GNIMLLTVGVDNFKHINDVFGHTAGDELITQIGGKLREAISIDDTLVRSGGDQFTIVT
                     NGEQQHASTLSASILRALAVPTHIGDVPVSLSASLGVAVHPENGEDGDTLLKNAETAM
                     FQAKANGGGHCCFFSPRMNQQASDRLILAAALRDAIAHDRLRLFYQPQVHACSGRLYG
                     VEALSRWIDPSLGFVSPARFIAVAEETGQIEAIGKWSLRAACRQMAQWIRDGVEVPVV
                     SVNLSPLHFRDETLPRFVSELLEETGIPPHSLTIEITESTMIDNYDRTIRVAQRLREM
                     GVGMSMDDFGTGFSSLSNLAGLPVNEVKIDRSFMTGLESIEKVRAVVMAVVRIGQSLG
                     MTVVAEGVEHEEQRRLLAEMECDVLQGYMFSKPLPAEELAAWFAAYQPSGLNA"
     CDS             502840..503943
                     /codon_start=1
                     /locus_tag="GLX_04220"
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="BAK82834.1"
                     /transl_table=11
                     /translation="MNIDGHLVLPDRVMPGRIMFDTAIADVRPHAHVPDRYILPGFID
                     GHVHGGGGADTMDGVDAIRHMALFHMAHGTTTLLPTTITAPWSDIMDALYCVADVMRT
                     GIHGGPSIPGAHLEGPFINPQKLGAQPPFAQVPGLARMAAVLRTNAVRVVTMAPEIEQ
                     AESAMQAFVNAGVRVNIGHTLADIDQAERAICLVCGPGGTVGGTHLFNAMPPITARAP
                     GPATALMCSDVAYAEMVFDTHHVHPALFRLAHRLMGSRLVFVTDSMRATGAGDGPSTL
                     GRQAVFVADGVARLADGTLAGSVLTLDQALRNALQAGVSLPQAAALVSTNAANWLGLH
                     DRGALLPGRRADMVVLGPDLTVQEVWVEGRRRA"
     CDS             complement(503946..505220)
                     /codon_start=1
                     /locus_tag="GLX_04230"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAK82835.1"
                     /transl_table=11
                     /translation="MPPPRRHRHARAGVNRLALPTAWGKRVVRSLRHRNYAIWASGAV
                     VSNIGTWMQRTAQDWLVLTQLTAHDATAMGLTMACQMAPQVLLLPWTGHVADRFDRRA
                     LLMLTQGLMGVLALGLGALVISSTARLWEVCVFAFTFGSVAAFDGPARHSFVSELVPA
                     ADLPNAVALNSVSFNAGRMLGPVAAGVCIAAIGTGWAFVLNGVSFIAVLLSLTALRGR
                     AVPVRASGGGREILAGFRYVWAQPDLRTMLLVLLLVGMFGLNFPIFISTMAVGVFHVG
                     AGGYGLLTTAMAVGTMAGAVLAAGRERVTLGTVGGSALFFGTGGLLAALAPGYALFAA
                     ALALVGVASLTLATGSNSFMQLASVPEMRGRVMAIRLAVIMGGTPVGAPVMGWVANHF
                     GPRWALGLGAASGFAATIVVIVRRYQTRAAAG"
     CDS             505529..506860
                     /codon_start=1
                     /locus_tag="GLX_04240"
                     /product="DNA helicase TraA"
                     /protein_id="BAK82836.1"
                     /transl_table=11
                     /translation="MSRTVLTACQERALAEILAARGTSATHLLTGYAGTGKTTLMRHV
                     ARALRKQGADVVFTAATHKATAVLRTRVGTLAPCRTIHNVLSLQPSAQDGREVLQRAD
                     RPEPITADVIIIDECSMVGAGLMRWVRELVPDRFVLFVGDPAQLPPVGEAISPSFAIR
                     SASHLETVVRQAAGNPLVAAATTIRESQGGPMDWSWCRASHHEGAGLFVPRTPDAWMQ
                     RAFTSDEFRASSDAFRYLCWTNARVEAVNRTVRRWIHGGETPTPFMPGERVITRAPVL
                     DVEGRRVVVATNEEAEIADIRPAILRHAFPATSKVAGWTTELPVYDVILRTLSGDETP
                     VPILRPGADMAAIERRLKTEAATERARWQHRFVFRRGIGHLQAVYAMTVHTAQGSTFG
                     RVFVDVGDIARRAATNVLEAQQLLYVAATRPATAMILTGLSPHGAGSTGQG"
     CDS             507720..508346
                     /codon_start=1
                     /locus_tag="GLX_04250"
                     /product="transcriptional regulator cAMP-binding"
                     /protein_id="BAK82837.1"
                     /transl_table=11
                     /translation="MSFSQLPIPTDGLKRSFSERQEFITEDAPANMHFHVVSGGARLF
                     KSLPDGRRQIIGFAHRGDVLPAYPCIRYPYSAEAMRGMQVSCVPAPVLHHLHETSPGA
                     CAASLHSARQLLVGMHARLLMLGRQTARERLAAFLLGQGTRMGSTELWPVDPALSRAD
                     IADFLGLTTETVSRLLSTFHREKLISRERRAIHILDPDRLRAIMAMPE"
     CDS             508370..510736
                     /codon_start=1
                     /locus_tag="GLX_04260"
                     /product="diguanylate cyclase (GGDEF)/phosphodiesterase
                     (EAL) with PAS and GAF domains"
                     /protein_id="BAK82838.1"
                     /transl_table=11
                     /translation="MPEITALTTEILLPALEQAIDATVIIGQDNEIIFYNQAAASLWG
                     IPREEVIGHNVDCLVPTRLRHEHDRYIDRNRETGHNRIVGTSREVEFTRADGEYICGE
                     LSLSKVQIGEGDSRQIYYMGVMKNVTDESQRRKILILQNDVLQALASDMLIQDIGELI
                     CRKVEAFVPNAVAAMLVLDDNQPWRVICTPALPRRIRNALETTVPSPSDVEKLQANPS
                     YTGRLVWDSYQSMSRSLGLQSCYAAPVLAADGRVTGIFALYLRETNQLGAWPQRLVGA
                     CLPFCALALEQHATKTHMTQLARYDSLTGLLNRGALHRVMEEMIAQPGNRTMAIFMLD
                     IDRFRDINDALGHVHADQFLVEIAARIRSIAHDDYVLSRSGGDEFVLVVPDCDGARIE
                     EIARILIETIGRPLQIGQNTLSISCSIGISTFPANGPDSESLLSHADTAMRQAKEDGR
                     GIYRFANLEKNQVAQDRLVLGSALRDSLAQGMLQLHYQPQVRTHTLELSGVEALSRWH
                     HPTLGNIYPSRFIAVAEETGQIEAIGRWSLLEACRQIVKWDADGVFVPTVAVNLSAVH
                     FRNRALPEHIAALLRDHNLKPARLTVEITESVMMDSSSDTEEVLQSIRNLGCGLSMDD
                     FGTGYSSLSRLTRLPLTEIKIDRSFINDFEYDTNAQAVTMAVIGIGSRLGMTVVTEGV
                     ETEQQRALLEKLNCDVMQGYLFAKPLAPRDLEEWVRRGGAPAVIRELKAARATKAASK
                     TTTKKGANPPAAQAAAASTTEPATPPAEEDKDKPKAPAATKTTATNRS"
     CDS             510769..512511
                     /codon_start=1
                     /locus_tag="GLX_04270"
                     /product="diguanylate cyclase"
                     /protein_id="BAK82839.1"
                     /transl_table=11
                     /translation="MSLKHDDRLRALTHKDSDFWADVVDNVLIVAITDVRGVITYVND
                     RFCEISRYPREELLGSTHRIVNSGYHDASFFRQMYRTIRMGEIWRGNICNRAKDGTLY
                     WVATTIMPKHNSLGAIEGYVATRFEITELMNTRDRLKSLAATDPLTGLFNRGGFNNVL
                     QTAVEQKAQNIMREIMLVMFDLDGFKQINDIHGHHAGDVVLKTISTRLMALVSPDDAV
                     CRLGGDEFALILNQTLTKKPLQDILDQLLAALEAPIEVGNTMVNVSGSIGVSPVASQE
                     SAESLQKNADIALYAAKRAGGHQARMFDITLHQHALERAQILTDARTGVEKDQFELYY
                     QPILNLALDRCDQIEALLRWHHPQRGLLAAESFHDVFLDAALAQAMSPRLVKAFQNDM
                     RLWNTTLDAYPNLTINLSRLDLLNIGFQNDLEAEIRRQGSQASDYVLEVSESVLAGRR
                     SDRVLLRLQELAAIGFQLTLDDFGLATLSISALREIPFTQAKISRRLVRDIEHSQQAR
                     DVIAHLSGLAHAFGLSVTVSGVETAAQMEILRAIGVDRIQGFYISPPISAANLVLAEH
                     IFAPDHTEIALQAS"
     CDS             512518..512934
                     /codon_start=1
                     /locus_tag="GLX_04280"
                     /product="transcriptional regulator Rrf2 family"
                     /protein_id="BAK82840.1"
                     /transl_table=11
                     /translation="MRLTLHTDYSIRALLYLAHNPGKRIAIQEIADTHRISQHHLVKV
                     IHRLSTSQIVLARRGRNGGIELAREPRQIIIGDIVRLMEADLAAIVACIPDTGQQCIL
                     ADACRLRGLFSRSMNAFMGVLDRLTLHDILHDDKKN"
     CDS             513231..513644
                     /codon_start=1
                     /locus_tag="GLX_04290"
                     /product="transcriptional regulator Rrf2 family"
                     /protein_id="BAK82841.1"
                     /transl_table=11
                     /translation="MRLTLHTDYAIRVLVYLARNPERRVSVHEISNSHGISHNHLVKV
                     VNRLSHNGIVVARRGRSGGLQLPCLPHEIVIGDIVRLMETDINSVVSCQPENGQHCLL
                     VDICRLRLLLGQSMRAFFKVLDETTLHDILPDHRA"
     CDS             514064..514450
                     /codon_start=1
                     /locus_tag="GLX_04300"
                     /product="glucose dehydrogenase"
                     /protein_id="BAK82842.1"
                     /transl_table=11
                     /translation="MSAFVTPQTPAGWATLGLAVIIILLGLPLAYMGAELAFIGGSWY
                     YVVVGLAVTVAGVLMAMGRVAGGLLYLAAVAFTWLWAVWEVGFDGWGLLPRVFGPTLL
                     AVGVVLCLPVLKRAEAARSTLVREVA"
     CDS             514450..516651
                     /codon_start=1
                     /locus_tag="GLX_04310"
                     /product="glucose dehydrogenase"
                     /protein_id="BAK82843.1"
                     /transl_table=11
                     /translation="MPRTPILRSLLLGATIITSLSCAAAYAQVPPADQPPGTGNATVP
                     PGEPAQPVDKFAAPSPNAPQAPGVNAANIPDGPPAEPSEATPMVEQVVANPAHDDWPG
                     YARDDKATRYSPLDQITPANVSHLKRAFIYHTGSKPGPGQTNKWAAETTPIKVGDGMY
                     MCSALNDMMRIDPATGKEIWHFHANEKYESIPYTAACKAVVYYTSSTVPEGEHCHHRI
                     LEATLDERLIEVDSEDGKVCEGFGWHGMVNLMKGMGESVPGFVAETAPPPIVNGAIIT
                     NQEVLDGQRRWAPSGVIRGYDAETGRFLWAWDVNRPHEHGEPKEGEHYSRGTPNSWAA
                     MIGDNALGLVYVPTGNSAADYYSAMRSPEENKVSSAVVAIDVKTGEPRWVFQTVHKDV
                     WDYDIGSQPTLMDFTKPDGSSVPALIMPTKRGQTFVLDRRTGEPVLPVEERAAPSPGM
                     VPGDPRSPTQPWSVGMPRLGFAPLKESDMWGMSPIDQLYCRLKYRRAHYVGEFTPPSI
                     DKPWLEYPGYNGGSDWGSVAYDEKTGILIANWNNTPMYDQLVSRKKADQLGLMPVDDP
                     NYKPGGGGAEGAGAMADTPYGIVVSPFWDEYTGMMCNRPPYGMITAIDMHTQKVLWQH
                     PLGSARANGPFGLPTHLPLTIGTPNNGGPVITAGGLIFVAATTDNMIHAFDIHTGKEV
                     WNDVLPGGGQATPMTYEYKGKQYVAIMAGGHHFMMTPVTDDLVVYALDNVN"
     CDS             516710..517381
                     /codon_start=1
                     /locus_tag="GLX_04320"
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="BAK82844.1"
                     /transl_table=11
                     /translation="MRVKNVKKFLGAAFFQKASPKTFILFTMDYFMAILTTPDPTRPR
                     CAWAQADAMMMAYHDNEWGQPVHDSRMLWEMLVLESFQAGLSWRTVLRRREGLRAAFA
                     GFDPDRVAHFDAVDEERLMADPRIIRARAKIRATIGNARAYVTMRDAGEDFATFAWGM
                     VPAAPVRNLSGRVLASSDLSSAMAAALRARGFRFVGPVIAYAWMQAAGMVHDHEPGCF
                     RHSPA"
     CDS             complement(517633..518274)
                     /codon_start=1
                     /locus_tag="GLX_04330"
                     /product="hypothetical protein"
                     /protein_id="BAK82845.1"
                     /transl_table=11
                     /translation="MPAHSWPVRCPRHPPCHGWHKGRDDGTGVHPHCPAGRSVHKTGH
                     KPARAGPAMPPACRDTMQARNREQRVPLLSNPLLQQEAPMAITRNVADITTRIGDFLT
                     GAHGDRSGALSVLNDILGPLPAPEHPSMLENRAEAVGLLPVIHAWQIHDKSPPTDEET
                     IHTLFHPAELARFSTQTGLSELAAMNILREMLPTAVRHRAVTAQASRAAPPVQ"
     CDS             complement(518341..518691)
                     /codon_start=1
                     /locus_tag="GLX_04340"
                     /product="hypothetical protein"
                     /protein_id="BAK82846.1"
                     /transl_table=11
                     /translation="MPGPTVVGAPQWSDQDVPRFRPAARSHTTLPLPGRLGLLGLCAA
                     LALPLAGCTGRIGEDACISCAKEKKQASAKATTSPSTPPTVNAMGHGVGGSTGSPQQV
                     VQNQRPGVANASGM"
     CDS             complement(519022..519381)
                     /codon_start=1
                     /locus_tag="GLX_04350"
                     /product="hypothetical protein"
                     /protein_id="BAK82847.1"
                     /transl_table=11
                     /translation="MISSFHTLPRQRAARRVAARATLRAAALALSGMLGGCGPAHSLP
                     ASPAPRPDLAPTQVQEQPAPQSRIGMANPASVYCQKRGGTLEMRHTAQGTTGWCHLPD
                     GTVVEEWALWRSHHSAP"
     CDS             519783..521816
                     /codon_start=1
                     /locus_tag="GLX_04360"
                     /product="hypothetical protein"
                     /protein_id="BAK82848.1"
                     /transl_table=11
                     /translation="MSPYMHAGGTCLSTPSSLRGAQVLNLATMKRTKTGMRPPHGARA
                     GTRLRLACLLALSGLAGCAGPVSVRQVSLVHSYRESIRSTLLGGAPSDNTLIVLRRHA
                     LLATWRAHPDRAIAALRAQAAGHEDVGDVLFALAELSYRQGLRHHHAPDFLAAALYAY
                     AYLQPGQAGETAGYDPRFRQACDFYNFGLAAALGTPVTVASGTLALPFGTIDLVADPA
                     QLRWHGRVLDNIRPTATMAVSGINNVYRTPGLGEALTAQARPDPAVTPGSPPVPDTDA
                     SFSVSDRLRVPASVLVEMDNPRAQVLGTQLHGRLVLRVMAPDTATTAIDGARVPVAYD
                     QTAGRALALVDTALGTKEYRGFFDGTTFDGTRPRLVAMTPHHRGNMPVIFVHGTASSP
                     YRWASMANDLLEDPRIRDHFDFWFFSYATASPIPYSAWQLRQAIEQAVAELGGVAADP
                     ALGHITLVGHSQGGLLARMLVIDPGSRLWDGTAGRPLSSFHLDAKTRALVKNTMFPTA
                     MPGIDRVVFISTPQHGSYLAGMSVARLIGSMASLPLSLSETAREIVTSAARDSPNLRN
                     TIPRLGSVYAMSPRSAFMRTLPTIPIVADVHTHSIIPVCGNPRDLAHADDGVVSYESA
                     HIPGVESELVVRNSAHSTQSNPVTINEVQRILLEQLAAHPNLSPPTTPWLAGQ"
     CDS             521813..522832
                     /codon_start=1
                     /locus_tag="GLX_04370"
                     /product="hypothetical protein"
                     /protein_id="BAK82849.1"
                     /transl_table=11
                     /translation="MRAHWPHAAGLWAGRLAWAMATVWGAAALYYSTIVPDGLRVALA
                     VAFPACMVAFGWLPRAGLRHGMRAALVALLGVWYGTDPPRNDRRWAEEYAVPADAWRT
                     GDVVHVHNVRNFRYRTTSDYRPAWYDASYDLNRLESVDLVTSYWAGRNIAHVFLSFGF
                     SDGQHLAISIETRRQARFAYSTIAGFFHHYELFYVTADERDLIGVRTDVRRERVYLYR
                     LDLKPETRQRLFLSYMAAIHNITHHPLWYNTLTDNCTTGILARAGARLRYRFDWRVIL
                     SGHTADMAYDMNLLGPYDPKHYPDYDALHAASRIWRAPDAVIGPDYSTAIRATLPPPE
                     GPGMP"
     CDS             523083..524147
                     /codon_start=1
                     /locus_tag="GLX_04380"
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="BAK82850.1"
                     /transl_table=11
                     /translation="MPTLFTPLKVGALTLPNRVVMAPLTRLRSGSTHIPNDLMAEYYA
                     QRALAGLILSEATPVTPQGIGYEGVPGIWAPEQAEGWKKVTSAVHEVGGRIFLQLWHV
                     GRISDPYFLNGEAPVAPSAIAAKGHVSLLRPKRDYVTPRALETGEIAGIVAAFRRGAE
                     LAKVAGFDGVEIHGANGYLLDQFLQDSTNHRTDRYGGPIENRARLMLEVTDAAIDVWG
                     ADRVGMHLAPRCDLHDMGDSNPAATFGYVATELGRRGIAFICAREAEGPDSLGPQLKK
                     QFGGVYIANERFTPEAAEKAVEEGRADAIAFGQSFIANPDLPERLRAGAPLTPPDPST
                     FYTHGPEGYIDYPTLGESGD"
     CDS             524404..524754
                     /codon_start=1
                     /locus_tag="GLX_04390"
                     /product="hypothetical protein"
                     /protein_id="BAK82851.1"
                     /transl_table=11
                     /translation="MIRDISGNGHNGKVGSMAEQLHEYEGRPDDTPVSYTMHGGGVCR
                     TDQLVHMNMDEAGAGNAACGKIAARALNGEGAAGSHDHECRHIPGAGDDGAVTVQTAC
                     MPVRVLAGCTQPNR"
     CDS             524947..525942
                     /codon_start=1
                     /locus_tag="GLX_04400"
                     /product="arylesterase"
                     /protein_id="BAK82852.1"
                     /transl_table=11
                     /translation="MAPYDRVGSREKWSVLPMTTLGLVDGAQRDMVSSFPSFDPERES
                     LEDFRRNLVTGITALLQSGPVGYGERTVPGPDGAPDVRVIMFRPTGITAAAPAILYVH
                     GGGMIAGTPDMQAGMLERLAAATGTLIVSVDYRLAPETPFPGGLEDVYAALVWLHGHA
                     GELGVDPARIMVMGDSGGGCLAAATALLARDRGQVGLRAQILVYPMLDLRTGGADAPS
                     DDPTTGEFVWTRAQNRHAWSVVRGALADDDPQLGYLSPAFMRDLSGLPATFIVTGALD
                     LFRDEDVTFAQRLWKAAVPTELVVYASAVHGFDLLPSPLATRVRHDVVAAVRRFL"
     CDS             complement(526161..527057)
                     /codon_start=1
                     /locus_tag="GLX_04410"
                     /product="hypothetical protein"
                     /protein_id="BAK82853.1"
                     /transl_table=11
                     /translation="MPHTARGWKGDVTMDCPSVTAWRVARHRARHQVLEKGAVFADPL
                     AIAMVGGDEAALAAPDGTPAERHFRLFLAIRSRIVQDMLARAVQRGMRQAVVLGAGLD
                     TLGLRNPHAACGVRVFEVDRPAMQDWKRGHIARAGLAVPDSLAFVPVDFERDSLLACL
                     AHAGFDVGMPAFFSWLGVVPYLTRVGIENTLRFVARVPQAEIVFDYGEPVENYTGAHA
                     LRMAERARFVALAGEPWLSRFNPTDLHAMLRDTGFATFTDYDRAGIAAYFGWPVPAAT
                     GAGPHVVVAHARQGCAVAGPER"
     CDS             complement(527059..528126)
                     /codon_start=1
                     /locus_tag="GLX_04420"
                     /product="hypothetical protein"
                     /protein_id="BAK82854.1"
                     /transl_table=11
                     /translation="MTRPALRLAPVPLLACARAVQVIFRLLPGMGLCAVLAALAYGLQ
                     AVEIRLYGRAWLEALNIALLLGVGVRACIGPRAGLAAGVKCCARTLLNVGIMCMGATF
                     SVGAVLRAGPGLLGGVACIVVFSLAFTCCVGRVAGLSPARTLLVACGNSICGNSAIMA
                     AAPVIHAREADVGATIAFTAAGGLVVVLGLPLLALPGLDNAGHGVLAGLTVYAVPQVM
                     AAASPFGAGAVQAGTLVKLMRVLMLGPVCLVLSVLYARAAGHAGGRCGSVLRLVPWYI
                     IGFGAMMGLRAAGVVPPCAVTGLNGLATGLTVLAMAALGLGVELRAVLCAGRPLVVTV
                     VVSLLGLVGASVLLVQLAGGG"
     CDS             528226..529128
                     /codon_start=1
                     /locus_tag="GLX_04430"
                     /product="transcriptional regulator LysR family"
                     /protein_id="BAK82855.1"
                     /transl_table=11
                     /translation="MMRGMTLEQLRLFIAVAEREHVTAAARALHITQSAVSAAIAALE
                     ARHGVRLFHRVGRGIRLTEAGQLFLPEARAVLARVEAAENMLDAFAGLECGTLRVAAS
                     QTIAAYWLPPVLVRFRQRYPLIAVELSITNTIEAARRVREGGVDLGIVEGVVDDPTLV
                     QWPLAHDRMLLVGPTPCLPGVVDAHWLRTATWVMREAGSGTRATLEGYLRQWSIEPAS
                     LAVSLVLPSNESVRTAVEAGAGISALSALVVAPALASGRLHAVPQALGERAFYGLRHR
                     ERYRSPAADALLELITTAYGKKTA"
     CDS             complement(529732..530184)
                     /codon_start=1
                     /locus_tag="GLX_04440"
                     /product="hypothetical protein"
                     /protein_id="BAK82856.1"
                     /transl_table=11
                     /translation="MEDTLHKTIAVGFAHATGGNPTVPAPYIMRLDMEDVDAQLAVTP
                     NFWSVTYEVHVDLTGRVDVTDSTGNEITKAEISGSGSSSVNGNCIVIQKGIQQAIKEA
                     SKKAIRKMGSDFACKIINTNVVKSVRCGHEPSVKPLSGAAFLLRRRFL"
     CDS             complement(530322..530750)
                     /codon_start=1
                     /locus_tag="GLX_04450"
                     /product="aromatic ring-cleaving dioxygenase"
                     /protein_id="BAK82857.1"
                     /transl_table=11
                     /translation="MTDRTPAPRPLSEIASYHAHVYFDGAEPRERAAHLREQIAARFP
                     VRLGQWHERAVGPHVAPMYQVAFDHDVFARLVPWLMLNHAGLSILIHPGTTSPRRDHL
                     HDGMWIGRPRALLADRLPEHTDTPDQRGEVNTQPEATAVI"
     CDS             complement(530773..531354)
                     /codon_start=1
                     /locus_tag="GLX_04460"
                     /product="hypothetical protein"
                     /protein_id="BAK82858.1"
                     /transl_table=11
                     /translation="MNILKSHSLRLVGLVLPVALLATTARAETRHLDLTPENTAVLLH
                     TDSVVGSMDGQFGKVSGTLDYDLANQTCHVDLTMDATTVHMGTVLERKAAKSGGMLDS
                     EHYPTAHYVGDCSPRVVKGQVRSRMVGRMTLRGQTHPLTLSTQMVFNANTLSVLDSTG
                     TFDGRQWGLSTMLHTVKPQMRTETRITLPAPHC"
     CDS             complement(531708..532790)
                     /codon_start=1
                     /locus_tag="GLX_04470"
                     /product="phage transcriptional regulator and peptidase"
                     /protein_id="BAK82859.1"
                     /transl_table=11
                     /translation="MGRVWSMAGFYGIYPNTSRNNGIYPLYPVGHICGTVPIMDTRSP
                     AAAEIERRMAQLNLNKKRLAELAGLNETYVHDILRGKSRNPGGDRLEKVAAVLGCTAS
                     DLLRAPASGSGPGTAAGRLKALRERAGYTVRGIARDLGMGDRFSSYAFYENKLKKDFI
                     PVDLVRRLVSLLTDRGDPPIAASEVWALSGIVPGATDLNESISRAERATMPPIDDGAI
                     TVHEYDISPQAGAGAIVDHTACGDGEAHPTLESWRIPRNFIRNYLPDTGGLAIIRVTG
                     NSMEPEFSAGDRVLVDTGHRIPSPDGVYVLWNGMGVVIKQLMLVPNSRPPRIRIISVN
                     PTYPVDEVDASDLVINGRVVGKWVWK"
     CDS             532863..533603
                     /codon_start=1
                     /locus_tag="GLX_04480"
                     /product="DNA recombinase"
                     /protein_id="BAK82860.1"
                     /transl_table=11
                     /translation="MLSGAAAQATCDLDTIAQWCARWPDCGWRVVCGPSGLFALDVDR
                     PGTHAADGVAALAALVRRHGALPPRPMTRTGGSGGAVLFFAHCGEALRGHAGHPAPGL
                     DPHRGRQAVTIPPGTHPATGGAYTWRVPPWVVPPPPIPRWLAALLAPPPPPVQPVRHM
                     DGERMQGTLMRALHAVCDAPAGMANTTLNARAYTLGRWCGAGLLDRATAHDTLLHAAR
                     LRHIPLAEARATIRSGLDAGLRRPRHGA"
     CDS             533600..535405
                     /codon_start=1
                     /locus_tag="GLX_04490"
                     /product="DNA primase domain protein"
                     /protein_id="BAK82861.1"
                     /transl_table=11
                     /translation="MSTPLAQSRPTPLHTAARAAAKNTTPPGHTGARTTRLCRHGAWG
                     MAIIPACPAISPAWATAQNARPCRPIRHPDMRHDPASSAPDPIPRTGYPDYLSHTGPS
                     AIHHAHPGTARGMTHNARAWQRGRSCKTGQAGRLPPAVRPMRHAGTPCQRVPLSRTSI
                     PRSAPRVRRTRTFQHGYPAMPVLDPPMPQQPAPAATAWMTLLARGPRGGVLASLSNCL
                     VLLGHDPVLSGLLAWDAFACLPVLTRAPPPAFATASAAAGPYPRSVEDTDVTLVQAYM
                     QRAYDLPVSAAVAMQACRVAASLRRTHPVCDWLDTLRWDGTPRLDTWLHHALGTANDA
                     YHAAVGARLLCGAVRRVRQPGCKFDYVPVLEGAQGIGKSRLLAELFTPAWFKDDLPRD
                     LGDKDAAQGLLGVWCVELGELQALGRSTSRDAKAFFSRQNDRYRPSYAMADVMRPRQC
                     VFVGTTNEHDYLTDPTGNRRYWPVCCTRADVAWVTASRDQLWAEACRRETTDPMPLWL
                     DDAATAAIAAEAQEARLPEDPWHDPITAWLAGRGTGSVRMADVLHLALGLPRERQDRP
                     AQKRAGTVLRAMGWTRHKMRSGSTTYWAWRPEGLR"
     CDS             complement(535781..536245)
                     /codon_start=1
                     /locus_tag="GLX_04500"
                     /product="hypothetical protein"
                     /protein_id="BAK82862.1"
                     /transl_table=11
                     /translation="MNKSFLALVPALVLAGRAHATDVKLPDNTPASVTIQTPCTSESY
                     GEYATCISAILSLPSNRGGDIDIRAVESLLPKDSQKAAIISGITATPGAPMTVSLKHY
                     DDKNITWPATDTPLDHVIIPNNGTYQVVLTTADGGKTWGMRVVIEQPGSAGQ"
     CDS             complement(536438..536569)
                     /codon_start=1
                     /locus_tag="GLX_04510"
                     /product="hypothetical protein"
                     /protein_id="BAK82863.1"
                     /transl_table=11
                     /translation="MDCNCTDFCAAMLSRLSYVIFYMFFNMLHGWVRCGGVAGGGYY"
     CDS             536695..537759
                     /codon_start=1
                     /locus_tag="GLX_04520"
                     /product="hypothetical protein"
                     /protein_id="BAK82864.1"
                     /transl_table=11
                     /translation="MKKLIVMPLILLLGGCYGVGSQRLDRDQLDYSQALIGSSKQQTL
                     LNVVRLRYADTPGFLDTTQLISGYQLQRNIAIGVGSDSNPIRPAGTIGAQIQESPTFT
                     FQPVTGDAYAQSFLRPLPPGSLLPLAMGGLPIDILFRLSVQSVNLINNVGAIGGDVGR
                     GSPEFFELIYDLRRLQIAGLLGIQLEHSEEVPGKTPAFDRVFLTVSPTTDPILSDVVK
                     ATRRFFEMSPKDERIEVIYGAGKPQHGQIRLLTRTMLGVLGQIAYQIDVPQEDIDSGR
                     TLPKIILVGRSTRPTVFVHVSNERPHSSFVTIKYNNKFYYIADTDFPSKLGFTMLQIL
                     MELSKTTKNPGAVLTIPVNG"
     CDS             538556..539110
                     /codon_start=1
                     /locus_tag="GLX_04530"
                     /product="hypothetical protein"
                     /protein_id="BAK82865.1"
                     /transl_table=11
                     /translation="MPQTAHTLPAERARVATILRADRRARLLARDVAAGLKPDMGTDG
                     PAATARVVQATRMELAPHTAPQPVRRVLDTCMPDRLFHRANAALTPDQHAAGLRFRAT
                     WRRAVRSGRLVQRYSPLTGAGGGVALEDSEASVHARRQLDRAHALLTPARWRVVCAVC
                     ALDEAPGTRLRTLHRALDVLHEKW"
     CDS             539222..540328
                     /codon_start=1
                     /locus_tag="GLX_04540"
                     /product="hypothetical protein"
                     /protein_id="BAK82866.1"
                     /transl_table=11
                     /translation="MNRSGLALALLSAVLFGASTPFAKLLLGGMPAQMAAGLLYLGSG
                     LGLAVVLGARAALRLPTHDEAPLGGRDLPWLLGVIATGGVGGPLLLMLGLARTDAASA
                     SLLLNMESIATLLIAWVVFRENVDRRLLIGAACIVAGAAVLSWQGRAMFSTGALYIVG
                     ACVCWGIDNNLSGRLSAVDPVRIAMLKGLVAGCVNMGLALTFLHAGLPGAALVAGAMA
                     VGFAGYGVSLVAFMLGLRHLGAARTGAYFALAPFVGAVVSLAVFGVHDAGRLAMAGVL
                     MGIGLWLHLSERHDHEHIHEEMAHTHRHVHDEHHQHTHTHDDPPGEPHTHYHVHTRLV
                     HTHPHYPDLHHRHSHDGHGPHDHGPDGQDHTHAA"
     CDS             540558..541655
                     /codon_start=1
                     /locus_tag="GLX_04550"
                     /product="hypothetical protein"
                     /protein_id="BAK82867.1"
                     /transl_table=11
                     /translation="MDPYEGCNTAALPYWLSTPQQDFAALGATIVPHVERLLARDGVF
                     APFGATVALEPYIANVTLLDPPARAASDVQLEQARAALGRVLAATPHRAAAVVANCTV
                     ILPGQSDPSQAVVMMCAHRDGTAEQVVHPYTIAHERITFGPATTTEGTRDIFPPIRLR
                     FYIRESCPPRPVGYTVAMFMVHGMDRAAVLRHFGLEETGQAVDETRPAPGGVTSLPGG
                     WTALWCNAAGLRHRVEAHLATTPAGSTIVACMVNEPAYASAATGWRDGARIWDISHNG
                     QAGPHDLKVDGTPPPELKAVIAAMDMEETQSGYPPGMIDFYFDIPVELVFALTGLRYC
                     QRDYTHGPVTFSAIREMARAGQGGVNAVYGA"
     CDS             541784..542290
                     /codon_start=1
                     /locus_tag="GLX_04560"
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="BAK82868.1"
                     /transl_table=11
                     /translation="MRTISLSKVCRKDADDLVKANIESRSYHAPWVQPFITREGFDTW
                     FDEQVSGANIGFIARELDTGGIVGITHLSQIFMRGFQNAYLGYYGMKGFAGRGLMTEA
                     VRLTVQTAFNDIGLHRLEANIQPGNMKSIALIHRLGFRHEGFSPRYLRINGAWRDHER
                     WALLRDES"
     CDS             542585..543556
                     /codon_start=1
                     /locus_tag="GLX_04570"
                     /product="hypothetical protein"
                     /protein_id="BAK82869.1"
                     /transl_table=11
                     /translation="MPDTNQHPALTFVMGEHQLVSIVRRYLPGHESISRAEGLATMGI
                     GAAEMAGAAGLLAAPEPLLSKVGGIALAAHGADMMAAGQQAWKNGTEPHTLTERAVHA
                     VALKAHAPPAVADLAGQAADAVIPAGILHAAAHFAATRAIRVAMADANRLAFRQDDIT
                     TEHFHRPVVQHTGQPARTPANQNLLSPHRQNRLDLNHHEAPPHNRKAGGHVLLKHVDP
                     TEAYIERRFRKENRPIVSFFTSKEDAERAIHALLRDNSSKVDTWLRDAGNGDRIILDG
                     YFSGRGAVIIESANREHKAARRIEVTIIKKEHNGMIYYVQTVKLYRS"
     CDS             543567..543899
                     /codon_start=1
                     /locus_tag="GLX_04580"
                     /product="hypothetical protein"
                     /protein_id="BAK82870.1"
                     /transl_table=11
                     /translation="MFPRLTNLGSSSFGEDPDLFGDTLFEVIDDAPRGHRLPFKQQTV
                     NELRTLLAYDDMDLDRVSWAVLSIDPTVDPEEPPNWGSFPTLRAFWSAVLHAFENDPE
                     VQAGKEID"
     CDS             544405..544788
                     /codon_start=1
                     /locus_tag="GLX_04590"
                     /product="hypothetical protein"
                     /protein_id="BAK82871.1"
                     /transl_table=11
                     /translation="MSKLLNCTNDDILDMFPRIKNLGGGPFGEDADIFGDTLREVVQD
                     APQTHDLPFKQQTVNELRNFLTYNDEDIERVSWVVLGIDPTVDPEEPPNWGSFPTLRA
                     FWSAVLHAFENDPEVQAGKEIDRNP"
     CDS             545283..545654
                     /codon_start=1
                     /locus_tag="GLX_04600"
                     /product="hypothetical protein"
                     /protein_id="BAK82872.1"
                     /transl_table=11
                     /translation="MSRLLYFTDYEIRQKFDCLAGLGASSLGEDADMFGDTLEEAIQC
                     GPRTHDLPFKLQTIAELRTLLSCNDAEIDHVTWLLIRIDPTVEPEEPPNWGSFPSLRA
                     FWSAVLHAFEHDPEVRETKGS"
     CDS             complement(545774..546259)
                     /codon_start=1
                     /locus_tag="GLX_04610"
                     /product="hypothetical protein"
                     /protein_id="BAK82873.1"
                     /transl_table=11
                     /translation="MRHRSTAMSRSPFPPFGVGTATLKVRLAEDAWNTRNPEQVALAY
                     TSGSRWRNRTRFITGRAEIVSFLQDKWRTEHDYRLIKELWGFRLNRMAVRFAYEWHDG
                     TGAWWRSYGNEVWEFDADGLMHTRFAAINDQPITADARLFHWPAGRRPDGHPGLSELG
                     L"
     CDS             546327..547268
                     /codon_start=1
                     /locus_tag="GLX_04620"
                     /product="transcriptional regulator AraC family"
                     /protein_id="BAK82874.1"
                     /transl_table=11
                     /translation="MIRAIGFVLYPDFQLLDAAGPTAAFEIAGRIAGQPYTLAMLSRA
                     GGLVMSSSGVAVQTVAVEGAGGFDTLIIVGGEGHRAAMECGVLRAFMQARMAHTRRIC
                     SVCSGAFVLAGAGLLAGRRATTHWRHAQEFRRQFSDIRLEPDALYIHDGPVWTAAGIS
                     AGIDLALALVGHDLGDDIARQAARQMVVYHRRPGGQSQFSALLEMEGGERFSTLLGWV
                     RAHLAQPLGVDVLAARAGMSARNFSRAFRAAVGVSPARAVERLRLEAAYERVVYSTDP
                     VEAIARTTGFHDPERMRRAFIRAFGLPPQAVRRNAAR"
     CDS             547463..548020
                     /codon_start=1
                     /locus_tag="GLX_04630"
                     /product="phage associated protein"
                     /protein_id="BAK82875.1"
                     /transl_table=11
                     /translation="MPARFMCLMLPQWDSAAHGTALQAGHTMPGTMQLLPARFLHTYL
                     PYWPNPHRRVVMPEPAGPRRGAAYSRRLADEICARLSDGQSLRAICTDPAMPHRATVL
                     RWLHANPEFRGLYTLAREAAADALAEEIVAIADRATGRDDVPAIKLRMEARMWVATRL
                     RPAAERRTDTAPAITIAITPDDTDL"
     CDS             548004..549317
                     /codon_start=1
                     /locus_tag="GLX_04640"
                     /product="phage DNA packaging protein"
                     /protein_id="BAK82876.1"
                     /transl_table=11
                     /translation="MTQTFSLTPDQRRANHLLGRAATHILLRGGARSGKTFVLVRAVI
                     IRALRAGGTRHGIFRHRLNALRATVVADTFPAVMRACFPAVPWALSRTDWTVELPNGS
                     SIVFGGLDDEDRTEKILGLEFATVYLNEASQITYGARNMLLTRLAQKSPLALKEYIDA
                     NPPTTSHWLYRVFEEGVEPTSGTPLDRARYATMQLNPAGNRANLSAQYLTQLEALPER
                     ERRRFMLGEYQHAVDGALWRMEDLARAAPVTPATRASVAAGMRRIVVAVAPSGCAGPE
                     DTRSDEIGIVVCGVDGSGNGHVLADLSRRDSPAGWARAALQAQVDWGAERIVAEQNFG
                     GALVEATLRGLNPNAALTMVSASRGKAARAEPVAALYEQGRVTHHGVFAQLEAQLCQF
                     SASGYHGAHSPDRADALVWALSELMLSAPPPAPARWVPTRFSMGR"
     CDS             complement(549385..550164)
                     /codon_start=1
                     /locus_tag="GLX_04650"
                     /product="topoisomerase-associated Zn-finger domain
                     protein"
                     /protein_id="BAK82877.1"
                     /transl_table=11
                     /translation="MACCFCRCKNGRTGLDRLPPVNWRVNFHASPPPMLMGVAEVLVG
                     LLLLGWGACGLLRAPAPVARRAARAAGRVEPITRIRPPAPVPDPMPEPAPGWAAGGVS
                     GEMPQAADAGFTVPVSMADYSWAVPLYQPRPLLSAWECRVLRTLMAQVPPGYLVCPQV
                     RLAELMVPRGPDADANRRAFYKIASKSVDFVVVRADDGHVVLGVELDDSTHDQPERQY
                     RDGLVNAAFAQVGITLVHITPGQRVDVTGYFEDALAEPTVW"
     CDS             550210..551622
                     /codon_start=1
                     /locus_tag="GLX_04660"
                     /product="phage portal protein"
                     /protein_id="BAK82878.1"
                     /transl_table=11
                     /translation="MDWQELSQTYPRDPDLPARAHRLAALGRVLEGTQYDAIPNPFGR
                     EYNGAGEYIPLSARRPSVRTNMCRAVVDDAVSLLFGASHWPGLVATDPHLPTILAQLA
                     AETALPALMMQAATRGAIGSSAMLLEAVQHGLRIQVHDTRYLTPAWDGAGEIATMTEC
                     YKVTGAMLAAQGWPIGVDDATSVFWWLRAWDRTDCHVYVPQRVDAGLPTRIDPARSTH
                     HGLGFVPWVWMANLAAPGVMDGPCTFAPAIDTVIECDYLLSQSGRGLKYSADPRLVIR
                     AGPDPYADGTPASSGGASTALTLPLDGDAKLLEINGDAAGAMRDHYRELRASVMEQIH
                     GNRAQADSLSAPTSGRAMEMLYQPLLWLTDRMRLSYGEYGLLALYRMACRFSHVLAGG
                     LRIGGQDYVGLDAAGLALQWPPYFPGTEGEIAQLAQGLGVAVQGGFLSRQSACALFAA
                     RAGVPGPHGEWARINASSPT"
     CDS             551647..552144
                     /codon_start=1
                     /locus_tag="GLX_04670"
                     /product="phage-related protein"
                     /protein_id="BAK82879.1"
                     /transl_table=11
                     /translation="MTASVPQSPNPETLRHEMDALRAERDAAVAARATLEADLARATE
                     QATTARTRASRAVIRAEARAMAARMGAVEPADVVRLVDLSTVTLAEDGTPQGLDSLME
                     AARESRAYLFTPAQPASGAATGTTAAGPAPRAGDPTPFDARTAGARDVKAAASAAGLR
                     WPVAN"
     CDS             552618..554153
                     /codon_start=1
                     /locus_tag="GLX_04680"
                     /product="hypothetical protein"
                     /protein_id="BAK82880.1"
                     /transl_table=11
                     /translation="MSPTFSPFRACAARGTGKGLLTGHVPYPPPGPFMAQPAMTAPAA
                     ARRFARRLFCVLSKEMNFMAIANFPAALQPVIQQGFLSRAFQDALQSRLGFRSIADQM
                     EFPARIGQTITDTRAGLLPPATTPLNPTANTSFDNGMTPAQWSVEQYTLTINQYGNTM
                     DLNQVTEGVGIANQFLANAARLGINARQTLDRLARNALFGGAQNGVGGYLGGNTRVTT
                     TLGAAGSVVAVDDIRGFQNILSDEGQVISVGASNGMTVTIGAGSYTLMGVTADAANTS
                     TAPDGISGTLALSDNVSVSNATAGNAVVAATAPLVLRPASRATTAALVSGDLLTVQTI
                     LSALATLRDNNVPTPDGGVYHCYLDNAQLLGLFRDADFKLLYRGQYGSDTYQTGQIFD
                     LLGVRFIPTTEAPQQASLGVGAIHRAIICGQGALIEGDYANIGTHYAPLLDGGELTDV
                     EGVCMITRPALDRLAQIIAQSWSWIGGFALPTDLTANTAVIPTATNSYLKRGVVIESL
                     GAA"
     CDS             554236..554868
                     /codon_start=1
                     /locus_tag="GLX_04690"
                     /product="hypothetical protein"
                     /protein_id="BAK82881.1"
                     /transl_table=11
                     /translation="MTDITPATTGTTTGTVTAATAGMGTTATDPDTTDTGMTGTNATG
                     APTGGTTAMTDTNSADMATGNDVAPVPCASVAQPPTAATMTDTPLVDAELAQARRYMG
                     YPALGGQDSGMQSWRFFRVYGFNEWRLRNLAPTECAQARAFVAQCQMLEGAIMAATGN
                     LDTDRAAVWTRNRTEVTDRFTLYTRWRVQLCNFLGVPPGPGLRGAGEIII"
     CDS             554868..555518
                     /codon_start=1
                     /locus_tag="GLX_04700"
                     /product="hypothetical protein"
                     /protein_id="BAK82882.1"
                     /transl_table=11
                     /translation="MDQPTLCHLAARGFARAATRIGAPATQYRPTAPASPCATPHARV
                     MAAFNNDRAFGFVGPALWDVPFVFALLDTTDVRAGDIVVCGTETYFIARAEPFRPPLC
                     VLCNAVVNISTTLPVAADVAAPGGYATSGDVSAQATIATGWPAMIRPGSGAGVPGPVQ
                     PGSIHTGGYEMFLPAIPTVTVQPAMWADDGAGSRYTIGAARASPWGVRCQLGRQQI"
     CDS             555655..556515
                     /codon_start=1
                     /locus_tag="GLX_04710"
                     /product="hypothetical protein"
                     /protein_id="BAK82883.1"
                     /transl_table=11
                     /translation="MADISTISTTIATALAAALCPDGTASGAVTGRPLIIRRGGLTQA
                     DLGDAAHTLQQGCDFIGIVDLPESWTRLDEPLGRPWRANNQTPATVSISVTGTTATIS
                     VTGSAMPTGTVGLRIGGLPGVNGTACSLHVAMPGDTAADIAAMLAASLPGAVATGASL
                     TLPAGCTAQAINAGTQAARCVARRQSQMFVITAWSALPAARDVLGQAISDALALTDWL
                     TDENGSTFRIEARAATNDDTAMNRGLFSRPARYLVTFDTDLTRTTPVMLAGGVGVGPT
                     VVTGDVLLDQ"
     CDS             556690..558171
                     /codon_start=1
                     /locus_tag="GLX_04720"
                     /product="phage tail sheath protein"
                     /protein_id="BAK82884.1"
                     /transl_table=11
                     /translation="MTIYQSGQINTNSLNVPDLYVQVLKPQNIALNDVSTGRIGLVGT
                     ATWGPVGTPVIVGSMGDCLSAFGPKQALASDIGTAVNIAIMQGASDFRCVRVSDGTDA
                     AATGTLDGVSLTAMHTGSAGNALSATLVADPIITTHYTLSISHATLGSRSYRGTTWAV
                     LATAVAADSMALVRIGLPSTVPALAAGSVTLAGGADGAAPTTAAFLGTDGATRTGLYA
                     LRGQGCALGILAGVSDSTSWTTQAAFGLGEGVYMIACGPAGDGIASAVAAKAAAGLDS
                     YAVKLMFGDWLWWNDDTNGTMLVPPQAFVAGLLGGLSPERSSLNKELYGAIGSQKAGL
                     VSGGTSQTYSTAELSALFAAGIDVICNPAPGGSYWAVRGGISTSSDGVSDDDSYTRLT
                     NYLAETLNAGMGAFVGEVISATLFGDIRAVLLGTLSNMAASGILASASWAVVCDATNN
                     PQAETALGYVRADVQVRYQGINRFFVVNLQGGASVTLAAATAG"
     CDS             558239..558670
                     /codon_start=1
                     /locus_tag="GLX_04730"
                     /product="hypothetical protein"
                     /protein_id="BAK82885.1"
                     /transl_table=11
                     /translation="MSTKPFNIGRDCRVVLVYDGSRIDLPTVTGFNAQQRTHQLTSNP
                     LNDMPLFYDVPGGWGGQFTFQRDSAGADDLFAAIESGFWSAGTVVLGSIYQYVSECDG
                     TLSTYEFIGASLQLSDAGRYQSEMLVTQTITFSARARNRVS"
     CDS             558683..558994
                     /codon_start=1
                     /locus_tag="GLX_04740"
                     /product="hypothetical protein"
                     /protein_id="BAK82886.1"
                     /transl_table=11
                     /translation="MTEHTVKTSDGRTLTWRERGPGDVLTLLEFGPASPTEAWMEYAL
                     MVSSVEAVDGVPVIRPASRIQLEQLANKIGNAGMMALSDAMFGTDGTEAAQAGEVAAK
                     N"
     CDS             complement(559420..560481)
                     /codon_start=1
                     /locus_tag="GLX_04750"
                     /product="outer membrane adhesin like protein"
                     /protein_id="BAK82887.1"
                     /transl_table=11
                     /translation="MTCMTGPPACGATAAACPPPGGRGLMNGGLSACCRPVCPAPRCG
                     TNGCMGVRSARARPAVGIPGVQGRVRGGVMAPGRVVSGNGARCAGRVESCAEGALPPA
                     CGIHAMTARAPVARGRMPGGMAAIPTGVARGPDGPDREGTSLPGLTSGHTGATGGPAG
                     GMKAAGPSCVHPPGGSGVAAGGAVTGRALRLATLPVAPPANRLPRVTGGTVRAVVRAA
                     ASGYGRVGCGMARTAMAAVTTGTMGVDGAMAGAGVMDGGRTGGGRTGGRRGGARMAGR
                     TTAGPPGMDRPPVAARSCPPAPMRPDGRERGLPPLCATGRRGVPCQGASGPALPLLAA
                     VLRPRGGTTGGGMDGMPPG"
     CDS             560760..561680
                     /codon_start=1
                     /locus_tag="GLX_04760"
                     /product="hypothetical protein"
                     /protein_id="BAK82888.1"
                     /transl_table=11
                     /translation="MSLTLMNAQTAIGAIGRLWASAPVTIGALTLTGMEVPRLIRDGG
                     TQQVAIHRLPGGGRIIDAVGNDPDRLELEGTFVGPTALARARALKQMRVAGAPVAFSG
                     AGLSLMVRIVQYSYDYQQKGIVIPYRLVLEQPNQTATSGAGTSTLSALVGADGASALS
                     GVSGALANVATIAGNIGGQLATVAGQVTPIADMAGAGGVFAGVQDNLAVVGGLSGAGV
                     NLASLPQGATGLLSGLEASGTGLGTAISQTGANLEGIDLTNTASLSTLTQNAQLHSTS
                     VTSGALVNRAYANTLTATSATQNGPLVTAQ"
     CDS             561692..561901
                     /codon_start=1
                     /locus_tag="GLX_04770"
                     /product="hypothetical protein"
                     /protein_id="BAK82889.1"
                     /transl_table=11
                     /translation="MTTTIRVTAADGTLYHVAATWLGDATQWWRIALLNNLDDPDLSG
                     LCAPVPLVLPAPDGTQGSGVPGVDA"
     CDS             561898..563058
                     /codon_start=1
                     /locus_tag="GLX_04780"
                     /product="hypothetical protein"
                     /protein_id="BAK82890.1"
                     /transl_table=11
                     /translation="MSTDMTVTATQPPTWRAPRARLLVNGVEQAQTGLESFTLERTRY
                     RRADTLEMTLALDRTQQATSLWFDVADPAGGGVPPDIDIQLQMLDAAQDGAQWTTMFQ
                     GIVDHVEWSPAETSVHVQCRDYLARLLDMRVLDGWMNMTGGDVVRAMITAAGLIPDVH
                     MGDGMVGQFWQVEHKRMAAASHGRFQTAFDLASTLATQGGCDLYATGRTVTCAPPATA
                     STANTHGLGYADTSPTAPLAIGANALRLSRDYQIARGIVVHVMSWDSRQRTKVDYYYS
                     ATGGSVRPPGGGGSVHSFSLPGARLDDLQRYARQKYSQIVAHERTITAQIPGRITLAP
                     RQFMQVSGTGTTWDGTLAVDSVASRFSWQGGFSQQVTLRHRNTLQEGEDTND"
     CDS             563051..563731
                     /codon_start=1
                     /locus_tag="GLX_04790"
                     /product="phage-related baseplate assembly protein"
                     /protein_id="BAK82891.1"
                     /transl_table=11
                     /translation="MTDPRMLAANMANAQAQPGFGLVSAVDPVNHAVKVMAQPAGVET
                     GWLPCAAMQVGSLRIACPPDIGAHVLLVRLEGDGEHAVCACPVYDAVVMPPASPATRQ
                     PAQPGEMLIVAGCATPPATGGTTPGSATDNAPWWHITRDTIYSGAGNATETLTNGSRA
                     WKVGGVSMVLDANGLAVTGGPIMTDRDMTAQGTVTGRTDVLAGGTSGHSHTHSGVQPG
                     SGMTGAPQ"
     CDS             563955..564317
                     /codon_start=1
                     /locus_tag="GLX_04800"
                     /product="hypothetical protein"
                     /protein_id="BAK82892.1"
                     /transl_table=11
                     /translation="MSALSHTMGGDLDLSGTGGIAVVTGAQQTRQTLLRRLCTNAGAY
                     IWQPDYGAGLPARVGAVMDEAGIRALVLAQVQAEAGVDQTQPVTVTVTSPRTGAYLLA
                     ISYTDATTGAVQELALTA"
     CDS             565005..566129
                     /codon_start=1
                     /locus_tag="GLX_04810"
                     /product="hypothetical protein"
                     /protein_id="BAK82893.1"
                     /transl_table=11
                     /translation="MAITFQSFKTTLGNMVASAQGACPSLLDLDVGSPGRAMLEAVAG
                     LGLWFQFIALQILSRTRLATSIGADVDSFVQDFGLTRLAGTPATGTVTFTSFTPASQS
                     ATIAVGATVKTASNLIYDVVEDSTNAAWSAADNAYIRPAGTASITVPVQCETTGTTGN
                     VAAGAICLLGTAVSGIDTVTNTAALTNGSDGETDAALRTRFIAYINSRSKATIAAIEN
                     AVTDVSADLAYQVVENVDTSGAFLPGNVVVYVDDGSGDVSDATINAVYAAVDDVRPAA
                     VSIMVVRPHVVRPAVAMTVSVDSTGDLATVQATISTNIAAYLNGLAIGAAASYSRLIQ
                     IAYAASTSVTNVTGVTLAGGVVDLPATIGTAYRAGAVDFG"
     CDS             566122..566748
                     /codon_start=1
                     /locus_tag="GLX_04820"
                     /product="hypothetical protein"
                     /protein_id="BAK82894.1"
                     /transl_table=11
                     /translation="MADTTQNGFALRIRRLLPTGWFPPAPATGQAEQAPVLNALLQGY
                     GSVFAWVWSTLAGTDAQTRLDTMTGAFLDMFAADFFGTMLTRNPGESDDAFRTRIKES
                     LFPSLGTRPDVVNTITDEVGQAGRVIEPRNATDCKGLGSLASPAVGGGYGYGVAALRY
                     GSRGAPFQLFAQLPTGDTNPPATQTLTRIAAVMPAGTIAWVQDVETLD"
     CDS             566748..568079
                     /codon_start=1
                     /locus_tag="GLX_04830"
                     /product="hypothetical protein"
                     /protein_id="BAK82895.1"
                     /transl_table=11
                     /translation="MDRQIVYPAQIPLDSDQLNAQRNAYVGLGQLAAMAYGWSTVAAS
                     GFACTAGTGLAVTIAPGSLLAPGVVDATAYGTLAAVGSALVRQYVSRDPLTLAVPGGG
                     GTYTVYATPTTIDGDDTVLPFYNAADPAVTYAGADNSGNTAPTVRQDVAQIGIGASVP
                     AGAYPLWAITVPAGATSITADMIAQSDVAPFYDTIPQLQAAKQDALGFVPVSGQWAMG
                     TTAYQVLGLTYLISAGRPQYFYEDGSGTQYAGGTLALESDVTSEASARESADAGLQGN
                     INAEAAARASADAKLVSGVWAIDSTAYQITGLTHLIADGRPQYFYEDSSGGQRTGGEL
                     MLRSDVTMTKFSNGSTRYTNSSAGTYVEHWFNVAAQDQQEIGFPTALSRVDSLQLTID
                     MGYSNTSPKSVAANYVEGTLTGTGFKASLKIPAESDQAAGGMLNIYVAGWL"
     CDS             568110..568589
                     /codon_start=1
                     /locus_tag="GLX_04840"
                     /product="hypothetical protein"
                     /protein_id="BAK82896.1"
                     /transl_table=11
                     /translation="MTTDSNTPQNYILYRTRALGWQAVGYVIVAMQLTAEQATGAPAG
                     FAYTLDTAGAYPDGSLYRVPSTAYALSGPATAGTALTLDLTPDNYGPKTETLVTLSDG
                     GAGGTFSSGTVTFGAGIKTPQAVTYTPKAAGTVTISATNNGGLTDPASLSVTVAAAS"
     CDS             568652..569080
                     /codon_start=1
                     /locus_tag="GLX_04850"
                     /product="hypothetical protein"
                     /protein_id="BAK82897.1"
                     /transl_table=11
                     /translation="MSDITTLTQGGPVMPQRCATVEDLARVRERLAKVEGGHDNLRDG
                     LNTLSQQFSDLRRDLTQSVTDNAARTRREIMQRVDDMTDTATARDNEISGRLARIEGG
                     LRLTSWMTMTFIVLATGLLGWGQIGDAAWSFCKRAFGYGP"
     CDS             569077..569535
                     /codon_start=1
                     /locus_tag="GLX_04860"
                     /product="bacteriophage protein"
                     /protein_id="BAK82898.1"
                     /transl_table=11
                     /translation="MTSNRNPDTMNALIPRDIRNNNPGNLDYVGQAGAHLETGVPHPR
                     FAAFPTMADGIRALRDQLLRYAERGLTTVASIISVYAPASENATGAYISGLCRTMSVQ
                     PDTVLDLCDPATMQALIAGIATMENGPGHITSTQIEQALANRPGLNGEYT"
     CDS             569532..569873
                     /codon_start=1
                     /locus_tag="GLX_04870"
                     /product="hypothetical protein"
                     /protein_id="BAK82899.1"
                     /transl_table=11
                     /translation="MNTTAKLGGLGAVIGLLLTEVPEQYALYVALFIIACGAVTALVP
                     PPHAGSRWAVVWQLITTIGLNIGWAENHFKPGQSGVRVPVADKPAAKQAVASAGIPVL
                     DKKGKPEAPAQ"
     CDS             570012..570596
                     /codon_start=1
                     /locus_tag="GLX_04880"
                     /product="hypothetical protein"
                     /protein_id="BAK82900.1"
                     /transl_table=11
                     /translation="MEAPMHNPTRRAFLRGTSALATASLAACTVTRNGTTITLALNVA
                     EVVDYGSAILSFASTAIGISFVSAAMGTTNVTLADAVIAGLKSGLTAFQTAAGSSASV
                     SYSTASVKAAFDSILSDVEKVNTLIIATITGTAANLSSIVVTQAKTAAGAAATLIDLL
                     KAIMDMSGPRLDSVSPLNEKTAIGQIAVFAAQSA"
     CDS             570593..570715
                     /codon_start=1
                     /locus_tag="GLX_04890"
                     /product="hypothetical protein"
                     /protein_id="BAK82901.1"
                     /transl_table=11
                     /translation="MSAFAQGLMTGAGGMVVLIGLLVAIPLWLRAMRLRARGLD"
     CDS             complement(570787..571878)
                     /codon_start=1
                     /locus_tag="GLX_04900"
                     /product="enoyl-[acyl-carrier-protein] reductase"
                     /protein_id="BAK82902.1"
                     /transl_table=11
                     /translation="MDWFARIGLEMPLLQAPMAGVSTSALAAAVSQAGALGAIGVGAA
                     GPVRAREMICQIRQQTAAPFNVNLFVHAAPQIDPAREQAWLAWLRPLFASFGATPPAG
                     LEPIYRSFNDDPDMLAMLVHMRPPVVSFHFGLPSRPAIAALKAVGIILLATATSVDEA
                     RAAEAVGMDAIVAQGIEAGGHRGIFDPADADDALGTCALTRLVVRACRIPVIAAGGIM
                     DGAGIAAALALGAVAAQMGTAFIPCPESGADAAYRHALAGPAAFHTRMTRLVSGRPAR
                     CLANRFTALDHGAGMPPPPDYPIAYDAGKALDKAARKHDESGFGAFWAGQGAPLARAM
                     PARQLVRLLNEELQVARQAPAYFHQKPVR"
     CDS             571957..572865
                     /codon_start=1
                     /locus_tag="GLX_04910"
                     /product="cation transporter MgtC/SapB"
                     /protein_id="BAK82903.1"
                     /transl_table=11
                     /translation="MSSRMWPLPRCHIPLWHAGTSTPRNRGGGWAVIMVMTALPHFIH
                     PAPGEGWLQLGELALAFGLSALVGLEREFRQKSAGLRTYTLVGVASALFMLVSKYGFD
                     NVLDEGRVVLDPSRIAAQVVSGIGFIGGGVIFMRRDVVRGLTTAASVWLTAALGMACG
                     AGLIALAVATTIGHFIIMLGFRRISHLLPRDHGARAVGLYITYRDGRGLLRTILNRCT
                     RLRFTIHRVRVEQAAPPIDPDTLNDLRDRHHDTTAIPPDASTPGMVTLFIKARGRRPV
                     SHLVTVLSAIEGVTGVETDEADSDPE"
     CDS             complement(572888..573277)
                     /codon_start=1
                     /locus_tag="GLX_04920"
                     /product="hypothetical protein"
                     /protein_id="BAK82904.1"
                     /transl_table=11
                     /translation="MGHRLAYKIMTLDEYMDFEDRKLFTGSRADVADGFIHLSTAEQV
                     SSTLAKHFSGQDGLWIVTVDLNRLEPAALRWEAARGGQLFPHLYAPLPHAAMVGSAPA
                     FVTESGEVLLPEPAAPAAGSEPGLTIH"
     CDS             573673..574071
                     /codon_start=1
                     /locus_tag="GLX_04930"
                     /product="hypothetical protein"
                     /protein_id="BAK82905.1"
                     /transl_table=11
                     /translation="MRPDNDNTGPAILHFPRRAILSPSEASAYLGIRPPLLHVMRYLR
                     CGPKAITINRRAVYTEEELRSFRNALTSAVGVTENGGAYRELLQGKPRTEAADPLMTL
                     LARNLVWRRAILVTLWGMMALGIGIDLILF"
     CDS             complement(574670..574924)
                     /codon_start=1
                     /locus_tag="GLX_04940"
                     /product="hypothetical protein"
                     /protein_id="BAK82906.1"
                     /transl_table=11
                     /translation="MASCNHHTCRQGHLVCTYACACAGFPGGLRIMNASSDSTPRPRK
                     EPHEEWREALIHAWKNRRGYLRQHDAASMAAEEAFRHDEA"
     CDS             576548..577375
                     /codon_start=1
                     /locus_tag="GLX_04950"
                     /product="oxidoreductase"
                     /protein_id="BAK82907.1"
                     /transl_table=11
                     /translation="MPSSVEPLRKRETMQIDLTGRTAIVTGSTGGIGLAIAKGLAASG
                     AQVVVNGRHEAAVHKAVSALSGLGGGGAMGFTGDLGTAEGCAALVAAHPQCDILINNL
                     GIFEPKDFFDTPDADWSRFFEVNVMSGVRLSRAYLPGMEKTGWGRVVFISSESAFNIP
                     VEMIHYGFSKTAQVTVARGLAERMAGTGVTVNSVLPGPTLSEGLADMLRPEQEKTGRP
                     MKELAAAFVMEHRPSSIIRRAATVDEVANMVVYLSSPQASATTGASVRVDGGVLGTI"
     CDS             complement(578077..578433)
                     /codon_start=1
                     /locus_tag="GLX_04960"
                     /product="hypothetical protein"
                     /protein_id="BAK82908.1"
                     /transl_table=11
                     /translation="MMSCKDMTMDNPLETTPQTQARIAAKAKEMWEADGRPGCGPQAY
                     TEAASELIGMESNPDAGQVPVDSPVPLDANGQPVEQAWLEENLGNPGGSEDELDDRRE
                     VPFATRQEEEDALKNQ"
     CDS             578868..579059
                     /codon_start=1
                     /locus_tag="GLX_04970"
                     /product="oxidoreductase"
                     /protein_id="BAK82909.1"
                     /transl_table=11
                     /translation="MSSCAGLTVDPFTVSYSASKHAVEVITKAISKEPQESGVAAITI
                     NSAPFLTGFNDRIFDSWKN"
     CDS             complement(579525..580754)
                     /codon_start=1
                     /locus_tag="GLX_04980"
                     /product="hypothetical protein"
                     /protein_id="BAK82910.1"
                     /transl_table=11
                     /translation="MRLPRSIRITSRLLAGACLMAMSSHAHAAPAPLAPAASASASAA
                     TAAAHAGMLTASVPLPAPLSLPDAGQALRITYLSTNGVTGTGLVPVTAEVILPPGPPP
                     AGGWPIVAWAHGTVGVSDHCAPSSNPWTERNRHYLGAWMKRGFAIVGTDYQGLGTPGG
                     HAYLNTRVEAYSVLDGVRAALASVPGLQNRIMIVGQSQGGGAAFASAAFAPAYAPELD
                     IRGTVATGAPYITAGLIRQMLAAPTAPGASYNPLVVYLLYLAQGQASYQAGFRPEDVF
                     TPKAIPAYDAAASLCVSELTDRVKRDRLNLGNALQPGFATALAPALAAMEYPTLKLAQ
                     PLFMGTGELDRDVPPPLQLGLVKAACAAGTVVQAHVYKGLDHSQTVNASLPDSAVFTQ
                     AVMAGRPVAPQCTPMPE"
     CDS             complement(581305..582567)
                     /codon_start=1
                     /locus_tag="GLX_04990"
                     /product="major facilitator superfamily sugar transporter"
                     /protein_id="BAK82911.1"
                     /transl_table=11
                     /translation="MNGNVNVLAEGAATGLGRPALITARHVVTASFLAWMLDACDFFI
                     VLFTLDDVARSFNVALQAVLLAPTLTLLTRPIGAFVCGRAADRYGRKPVMITTIMVYS
                     AIEVLSAFAPTLSIFLLLRALFGVALGGEWGVGTSLIMESVPPSWRGMASGILQAGYP
                     AGYLLASLVFLLLPVMGWRGLFVLGGCALFSALYIWLRVPESPEWLAQHAGRGPAAAR
                     PCAPGLGQLVRSNAALCVFAVTLMAAFNFMSHGSQDLYPKIFLGLERGLSHPSITLVV
                     VLYNIAAIAGGLFFGMLSQRIGRQYSIALAALLTLPLLPLWTLPHSTVWLTVGAVCIQ
                     FCIQGAWGVVPAYLSELSPPWARATFPGLAYQCGNLLAASNALIQTSLATMLGTGLAI
                     PLMLSVGLAAMVVLGLTLANARLHPAIR"
     CDS             complement(582701..584377)
                     /codon_start=1
                     /locus_tag="GLX_05000"
                     /product="porin B carbohydrate-selective"
                     /protein_id="BAK82912.1"
                     /transl_table=11
                     /translation="MIVPRSGRHDMGHILFQFKNAPATMPPFHRVSARPYPSISCPAP
                     LRGVFPSASRLRRLWGAAALACAVASPAAHAAQDRPQSWPGTPSAIPAPSSAPMVAST
                     TPVRRKRPIVETRLDALFNTESISALLNHNDDALRQSDLSAGYFVAEQAFGNLVPQIR
                     PWRDWLSNRGFSFELTYKGEGMANVGGGVSKGMDYVHDLRVSMLFDLGRLMGLDGWYL
                     HGIIMNREGRQVGWDHVGERNVLLTEVWSIHGPAAARLADLYVEKSFLHNRININMGR
                     IALTHTYATSVLLCTFMTQCSAPMAIREPAGWSVYPKTSWGGTVRFRPTRDLTLRTGI
                     YKIGPKVQDNTGWAWGSESTTGVQTPVELTWEPFFGVRKLPGHYKLGYGHDTSPYPDL
                     IGPVPAAYAAAIRAHREKPRDTFYVEADQMVYRRHGDYQMAGGYVLAGYIHNTPSISN
                     FADEFYFGASLLGLIPHRPFDRFGVMYSYYQMSPRLTYGQSLRQAAGLPLGPYITGPQ
                     THSAILEAYYGIPVTPGLVLTPEFEYVMRPGETSVIPNAMLVGLKVIANL"
     CDS             complement(584946..587189)
                     /codon_start=1
                     /locus_tag="GLX_05010"
                     /product="c-di-GMP phosphodiesterase A"
                     /protein_id="BAK82913.1"
                     /transl_table=11
                     /translation="MHLFKEKNTAMSKEIFPVTTENVNSDICMDMLEQARDGVIIIDE
                     RNCIVFFNRAAQELWGYTQAEVMGRNVKCLVPMAYRAEHDSFIAHNRNTGINRIVGTS
                     REITFESKSGDYVSAEMSISTALIGPDRKRYYMAFMKGVTEESHRKKLLDLQNTVFRS
                     LSGDMLIQDVADLVCQGVEEFVPNSVAVLMLLTADRTLQILSGAGLPRRFATALENMT
                     LTDADITALANDLDEASSVVWESYRSLGISLGLNECWASAIRAPNGRIAGILALYSRN
                     KHEVAEWPRKIVAGAVPFCGVVIEQYEARQHISQLANYDPLTGFLNRSSLHRMLRSMI
                     SQPGDNYFAVLLLDLDRFRDINDALGHIQGDTFLKVIAERLKTLCRSNYIVSRSGGDD
                     FVIVIPNATQDMAVDFTKTLIAAMQRPLDVAGNQLSASFSIGIATFPENGPDGESLIS
                     HAEMAMRLAKKEARGSYRLVSAIDSTEAQDRLVLSSALRESLSKGLLNLHYQPQIEAR
                     TGEIYGVEALARWNHPTLGTIFPSRFIAVAEETGQIEAIGRWSLEEACRQITRWEREG
                     VHIPVVSVNLSAGHFHNRSLVPMIAGLLEKYGLAPERLTVEITESVMMEESDETMNAL
                     SHIRKLGVGLSMDDFGTGFSSLSRLTRLPLTEIKIDRSFIMNLDHDPNAQAVTTAVIG
                     IGNRLGMTVVTEGVETEAQYDLLERLHCDVLQGYLFARPMSATDLAAWARQPRMLMPA
                     MQRTDRA"
     CDS             complement(587368..588066)
                     /codon_start=1
                     /locus_tag="GLX_05020"
                     /product="hypothetical protein"
                     /protein_id="BAK82914.1"
                     /transl_table=11
                     /translation="MKQNGLSLSPSLQALSGKVALQVLHGAGEGIVVIDEHNRIVFFN
                     AMAEKLWAYTQADVIGKNVSMLLPASLRDGHDAFVERNRSTGVNTIIGTSRPITLENR
                     AGEPVAAELSLSVIEISPDGRKYYQATIRGLTEESHRNTLAGLQNTVFRALLSDMSVV
                     SIAGFMCRELETYLPDMTATLLVVDDRRQVHILSGVGLPGRYATALEGITLSAHDDAT
                     LARDSAQATDVVWA"
     CDS             complement(588102..588518)
                     /codon_start=1
                     /locus_tag="GLX_05030"
                     /product="hypothetical protein"
                     /protein_id="BAK82915.1"
                     /transl_table=11
                     /translation="MEFESSGALHVLWVRIAVSSGESRLVLGPKKADSGLLLVDIIMK
                     EDQEKANLSIMFRDVASLSATYDSCMDITLVGLLSGDATEMDCNAWAVIRLRGNVCNL
                     SAENSQLIKGNDGSSVLYIHSYTAEELGKIHIDISK"
     CDS             complement(588711..589790)
                     /codon_start=1
                     /locus_tag="GLX_05040"
                     /product="transposase"
                     /protein_id="BAK82916.1"
                     /transl_table=11
                     /translation="MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEVFRPDLDRALA
                     YADGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLALSDRVPD
                     AKTVWLFRERLTEAGAIQKLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEK
                     VDLREGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPSTDLAIPFFGYKSH
                     ISIDRKFRLIRKWKATDAAASDGARLREGLLDKTNTASSVWADTAYRSKANEDFMDKE
                     GFVSKVHRKKPHLKPMPRHIQRSNAGKSVIRSRVEHVFADQKSQTGLFVRTVGITRAT
                     MRIGLANIVYNMRRFLFLERLNAAA"
     CDS             590310..590885
                     /codon_start=1
                     /locus_tag="GLX_05050"
                     /product="DNA resolvase"
                     /protein_id="BAK82917.1"
                     /transl_table=11
                     /translation="MLIGYARASNDDCTLDLQVWHLNDAGCDVVFEDDLVEKERERPA
                     LTRLLHEVRQGDVVAVYRLDRLARSTRHLLEIAETLRTKEAGLRSITEPWADTTSPEG
                     RTVMTVFAGIADFERALIRERTAAGRVQARNRGTHMGRPAKFIPSDAERIYTMVMQDG
                     VSVAEVAARFNVHKATVYRTISRFRAIKDQA"
     CDS             590987..591646
                     /codon_start=1
                     /locus_tag="GLX_05060"
                     /product="transcriptional regulator"
                     /protein_id="BAK82918.1"
                     /transl_table=11
                     /translation="MPDAASRPQHTGGRPTPEMSAQLDRQILEVATAFFVEQGYAATS
                     LEKIARMIGCSKATLYRRYSSKEDLFKAVVAARGRMLLEEAEAVEASSTDPLVATREI
                     ALFFLDFMLRPETREAYRIVIGDGHRIPFIADEMITTIGEPFVATISRLISAAAAAGR
                     LQSTDHEETTRVLMSLVTGWPLQNTMLGQNCMDDAGARRQFFDRAWGIFLSGVCPRNS
                     T"
     CDS             592160..593602
                     /codon_start=1
                     /locus_tag="GLX_05070"
                     /product="hydroxydechloroatrazine ethylaminohydrolase"
                     /protein_id="BAK82919.1"
                     /transl_table=11
                     /translation="MKLIAGTTIMAATMLCLTPRAHADAANRQESLLVKNAYIFSMAD
                     KYRKPFTGYMLIDASGTITAIAPGAPGRRIHATTTLDAHGHWVMPGFISAHSHLWQAA
                     YRGLAQDSTLLGWLDALYDKTASHARPEDFYWFTLDGALDHLQHGITTAYNFNYGNHW
                     GQPATEADNVDHQQFRAEMDSGLRFVHGINPTADTVDHSLAGARQHLRGFIDWTQAQP
                     ASTAFLSIMLNGTAAFQGTPARALDEAMLEGSLMKEFGLGNQTHYLEPPDHVAAQQAI
                     FPYFAQSGMMGPKLIFGHFIHTTPEILAQTGRAGAAMSWNPLSNGRLASGTADIPTYL
                     KNGIRVGMGEDGEASADLADPFENMRTGLYAIRDRYQSASIMSPYDVLRLHTVGSAAV
                     LQASDRLGSLERGKYADFLIIDPTHLAHVFDPYATLVLAASMRDLEQVYVGGHLVVDH
                     GRVLTRDINTVEAQADQRVAASLPGHDRHH"
     CDS             593982..595064
                     /codon_start=1
                     /locus_tag="GLX_05080"
                     /product="purine nucleoside transporter"
                     /protein_id="BAK82920.1"
                     /transl_table=11
                     /translation="MADQRRSRFPAGIVTSVLLAGAACLPMAAQAAPPVQEVRFVVVT
                     NWENGADSGDAPGEYQNWVEREHLDEKVPVRGAPDVVRRSKAGLYGMVLRHGVTDLAA
                     FVLDPRFDFHHTYWLFTGISGVDPNVASVGSVAWARWVVDGDALREIDDRTIPKDWPY
                     GLYAIGASRPNTLPDAPDHYGSVTDVAELTRAYPLNQGLARWAFALSQKANLADDPAI
                     AIRRQAWTGFDQARKPPFILMGETLGAERYWHGAPRNRWAQDWVRLWTHGQGQFVMTN
                     EESQTYQREMRTLATLGFVDPDRIMVLRSGSNFSLPPPGVAVTQSMGDEAPGQSLAFD
                     NNERAGAPVIEAILANWQKYRNHIPS"
     CDS             complement(595408..596223)
                     /codon_start=1
                     /locus_tag="GLX_05090"
                     /product="ribonuclease I"
                     /protein_id="BAK82921.1"
                     /transl_table=11
                     /translation="MLQRALTALRGLRPALAVLVPTLSLMAGCAHTPPAARSDALSIP
                     VAQHGDFDHYTLALTWQPGFCTDRHGPSCQPDQPHTPVIGLHGLWASLPSDLVHDGLP
                     VTMWWNKGCDIYNHDDTPPRLSPVLAKRLSMTVAHTRSSLVTHEYTKHVQCFGMNAER
                     FFTVASTLRDRFAAGPVGRDLEHDAGQEISKADVLASFEKAYGPLPQRGLQFRCNTDA
                     QGQTVLAQLWFTLDPRGLGRFPAASGFLPSPDVQDNCPARFHVPAWPATTQAG"
     CDS             complement(596230..597873)
                     /codon_start=1
                     /locus_tag="GLX_05100"
                     /product="acid phosphatase"
                     /protein_id="BAK82922.1"
                     /transl_table=11
                     /translation="MVHDLTPSSISAGQPLMPRRPPSGHSRFIARGRGRVWRAGVLAG
                     AIAAVLPAGPLQAASARQMEQVRTVVVIFAENRSFDNLYNGFPGADTFAGQPPALFAQ
                     RDRDGTILSELPPVWGGLTGRGVRNGVTQAMSAHLPNQPFRVDDPQGFNVALSTLTHD
                     LWHRFYENQMQINGGRNDMFVAWADSGAMPMSYWNGSAMQMWQVARRYAMADRFFMGA
                     FGGSFLNHQWLACACAPYYPQADTSPAHPVISVVDASGKALVVAPNSPRSALEGVPKF
                     VRDGNLTPDFHAVNTMQPAYQPSGNPPAAGQDTRFADPTQPTTLPPQTGATIGDRLSE
                     RNITWAWYSGAWQDVLEHGNHYPAPDFQYHHQPYNYYLNYAPGTPARAAHLLDGGLAG
                     TRFIDAIDHGTLPQVAFYKPQGNLNEHSGYADIRSGDQHIADLIAHLEKSPQWPHMLV
                     IVTYDENGGLWDHVAPPRGDRWGPGSRIPAIIVSPYARRGYVDHTVQDTTSILKFLTE
                     RYHLRPLDGVVVRDRAIQAATGQPLGDLTNALNLNSAGK"
     CDS             598032..598823
                     /codon_start=1
                     /locus_tag="GLX_05110"
                     /product="transcriptional regulator GntR family"
                     /protein_id="BAK82923.1"
                     /transl_table=11
                     /translation="MHTLSDPRSSRALHHQIAEDLTGRIGREAEYCDRLPSEAALCRI
                     YNVSRVTIRHALRHLENAGLVCRRQGRGTFVVPSQQRPPPAPAHPVVGLSDILHAHGM
                     AVETELLAFSLAPAPGDVMAALGLEGPQALLLRRRYLIDHVPVAVTEVYYPPAFRGFI
                     SAHDARLHPSATLMTEHVGLQLGRTHITVDVTGAHPGLAGELDMEPGSPIMVMRRITC
                     DDAGSACEHSTLLARPGITRFSITAHGGSLPDTDFIPQNPWPPAQ"
     CDS             598911..600254
                     /codon_start=1
                     /locus_tag="GLX_05120"
                     /product="xanthine/uracil transporter"
                     /protein_id="BAK82924.1"
                     /transl_table=11
                     /translation="MKPNLLERLFHLRAAGTTPGREVVAGLGTFAAMVYCVAVNPAIM
                     ANAGMDRASELTATCLIAIIASATMGLLANLPLGLAPAIGSNVVFAVVMVQQMGVPWP
                     AALAIVCLTGIVFMVLTVTKVRERMADGMPDCLRVGIQIAVGLTIMFIGLRNAGFVVG
                     NHTTLVTMGSLSSPAVMLTFAGLVLTPALVAAGVPGALIISIMVLTVIGLFVPDGHGG
                     MITHWPTRLFAMPVWPSATAFHLDPGYIFRNFFYVLPVIIFFLCTELFGTLANLLGIA
                     SAGGMLRRDGSIPNATRAFAADAAGTIVGPVLGTAVVAVYLESVIGVQMGGRTGLTAV
                     VIALGFVAALFLWPLFMIIPPQATTPALVMVGILMFGAISRLDLTDMTQSVPAIMTFM
                     FAVLTGNLLNGMAFGTFAYIVMNIAARRWRSVTPTAWGLGAVMAVFFIVSMSMRH"
     CDS             600263..602071
                     /codon_start=1
                     /locus_tag="GLX_05130"
                     /product="adenine deaminase"
                     /protein_id="BAK82925.1"
                     /transl_table=11
                     /translation="MRGTILIQHERTGPMSSPYPDLNDPALRDRAVRAAQGQEAFDTL
                     LVNGRVADVATGEVREADVGLVGALIASVHPRGTFHEAGEVIDLGGRIVAPGLIDSHL
                     HIESSMVTPRTYAGVVVPQGTTTICWDPHEVGNVGGLEAVRWAIAASRGLPLRIIVLA
                     PSCVPSAPGLERSGAVFDGNAMEEMLSWPEVGGVAEIMDMRGVLARSPLMRSITQAGL
                     ESGKLVCGHARDLAGRGLQGFLAAGIESDHEITSEADLLEKIRAGMTIELRVSHEDIL
                     PQAVALFGRLGHVPQTVTLCTDDIFPDDLVSRGGMAYMLRRLVQIGLDPVQALRAATL
                     NTAMRLQRRDLGLVAPGRRADLVVFDDLTEFRAHHVFASGRHVAENGELCEALRPDPV
                     TAPTETMKLALTTEQSFHIPATGTHARVRTVAIPRTTRWGERDVAVRDGHVVIPHDAA
                     LMAVFNRYGASSVPGLGILEGWGEWSGAVATTVLHDSHNLAVIGRGEADMMLAANTLI
                     RSGGGMVAVRDGKVLAHLELPVCGLLSAAPPTEVARQFNAVREACASVTTWNGQTAVI
                     KLMIGASLACNPGPHVTDMGITSGMTGEVVTDCVLA"
     CDS             complement(602252..602995)
                     /codon_start=1
                     /locus_tag="GLX_05140"
                     /product="transcriptional regulator IclR family"
                     /protein_id="BAK82926.1"
                     /transl_table=11
                     /translation="MTEADSEISLTFVKGLAVLRAFGKGKEGMTVAELAREVGQTRAT
                     TRRLVRTLEMLGYVTADGTRYMPTPLTLKLGLGFLHSRSIGQLVSPVLHEESLVVGEP
                     VSLALLSGNELVYVVHVPTAAKIEMAGYTTGSSLPLVKTAMGLATLAFRSRAGAIALL
                     PPDLPAPDQQALEQALDTIKAQGFAHVPDVNGKAFHAIAVPAFGLKTQDAVGALGIVY
                     PNGQYDIDHLHDVIVPNLHKCARYIATAL"
     CDS             603181..603582
                     /codon_start=1
                     /locus_tag="GLX_05150"
                     /product="hypothetical protein"
                     /protein_id="BAK82927.1"
                     /transl_table=11
                     /translation="MSSMSFPLRTTGTWHSMNRQVQPDDLSLHTTAAPRTCFMVRNQT
                     MPNDWPHGNGGTTMALSFNLDLATTRFMHSAPQRAVILAHRGLQPACAPLSVGIDASI
                     RLHMAPRPENCRNAGLHANWHDVPAVATTDA"
     CDS             603575..604483
                     /codon_start=1
                     /locus_tag="GLX_05160"
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="BAK82928.1"
                     /transl_table=11
                     /translation="MPDVQARAAVSRTARRLVHESTLEMTPAYVSAARQRPDALPQGT
                     TIFITWLTGFAFGQTLTACRKVREWGCQPVPHLPARAMADLPMLRMIGQAVTQELHTD
                     TVLLIAGDKAKPAGCLADTLALLQTGTLQESGIRNIYVAGHPEGSPVMQQPGQALSVL
                     RQKQEIGQRDGLDIRIVSQLCLDPAPLLQWERHLRANGITLPVHVGLPGPVPPRMMMR
                     YGMRCGVGPVLPFLKAQRALMHRWSCTSTPEQVIRPVAQVMTTTPGTLFRGLHFFPCG
                     AVARTLGWREAGGMPRQAYAKGLMNA"
     CDS             604551..605846
                     /codon_start=1
                     /locus_tag="GLX_05170"
                     /product="hypothetical protein"
                     /protein_id="BAK82929.1"
                     /transl_table=11
                     /translation="MLDTRLFFPSFLACCILMVAIQTKAASLPQADSPYGDGGTSAFY
                     TPDGALPTPGTMIRTEAFSTPHLPDGTARAIRTLYSATDGVEDNGTAIAVSGQILLPP
                     GKPPRHGWPIVAWEHGTTGIADICAPSWRGYSPRDRVYLAHWLAAGFAIVATDYQGLG
                     TPGPHPYLLYRPEGYSVLDGLSAALKQFPTLLRNQIVLVGQSQGSGAALGAAWLAPTH
                     APALHILGVVATGVVADFHITAPARHTAIPAVYTDPAQMDAAFAILRVEGTDQSLNPT
                     RNADTVLTPAGRDYARQARTSCLHDLFTYADRTHVSASTLFNAGLADYEKRHDAAFQI
                     PDGHIGVPVFVGTGLADGEAGTAGQYNAVAAMCDAGTRVEWHEYPGLTHNGAVNASVQ
                     DSLPFVKRLIRNRPVASTCATLIQPGPIQQATPGIRWNN"
     CDS             606387..607556
                     /codon_start=1
                     /locus_tag="GLX_05180"
                     /product="nucleoside hydrolase"
                     /protein_id="BAK82930.1"
                     /transl_table=11
                     /translation="MAYHQPTTTPWKSGYSMSFLSSRNARHRLCGVLVALACSVPAYS
                     GFAAENRKVIIDDDDSLSLAEATLLKAPGVDVLGITVASGNRWRDDEINRMLRGLEIL
                     HRTDVPVVPGAIYPLINSEKLTEKWESLYGRLIWKGAWMKQWVEPTNQPEPNYHAPDV
                     VPTPADGNATTKPAKEIAANFLIRMVHAYPGQVTIVAAGAMTNLALAQRLDPEFASLA
                     RELVYMGGSLNPHQQLSTVAAGQYAREFINSPRREFNLRFDPEAASIVMHAPWHKMTM
                     VPSDPATATELSADFLHRIASRNADISKLVAHWQPGSPMWDEIAATVWLNPQIVTRSA
                     TLYVDINTQFGAGYGDTLSWSPGYQPDLDEQKETVIEAINPQALLATMEQVLARP"
     CDS             607936..610449
                     /codon_start=1
                     /locus_tag="GLX_05190"
                     /product="TonB-dependent receptor"
                     /protein_id="BAK82931.1"
                     /transl_table=11
                     /translation="MKCTRAIVGCVNIRSSGKPGIGSVSRGGEEIDMRSYIHGNRTLF
                     AMSCLVTTFLTTLGPASRSMAATGTTIQQGSGHAGHTGSHTTAAKATAPAKPQSVVAT
                     ATPEVIRVGHSRSARDGGGGMMRLETAPHSVQSVGKQYIDMKSPTNTALDLIKNLPSI
                     SVSTSDTSGIQGGSIISRSLTDADMGLLVDGAPAASATYLSEDVDSEDLEAVNVTPGS
                     SAIDIPTTSAAAGVIDERTHTASHKFGGMMDFSYGTNNMSREFIRLESGDIGKTGIRS
                     YFSFSNTHARSWMGAGINSRKHIDFGLQKDWQNGSFAKFFISWSYEDFTIDNYSNAAE
                     FYRYKHTGQGFGRSADPSSNNYWGNNIDHWNQIFLTAPVHIVLPARFKFDITPYFNFG
                     QGWDGSPGRQATVGTNTADTTYNNYTYGNGTAVAAGTNLTNYFLEDYAMEVGVTAKLG
                     YDIDRHNHAYVGYWYQNQDYLTHFPVSAQMSNGFNPSPNNSAYQMYQNGQRMFPGNDA
                     GFEVHSIFIGDSAKYLHDRLTIDAGFKYVMTNYWYKSFGTTGTLSGRYGENNTTPLPH
                     LSIGYTFNNHHQIYVNAEGDFRQPAPSAIANSGIAGGMPKNQYSIKEELGYRYHDKYI
                     MFDLSFFNYNITNRLLSTYIGGGQSGVVNGGNQTARGFDAMISSRPFHGFSPYASVEY
                     LNARMDSNIAALAADGTTKSYFATAGRQAPQAPHVMANFGLTYQKYGFFGNATLHYTG
                     SQSVTLAGDERIPGYVTDTLSLGYHFKPFMYAKSPTFRLNFTNLTGAIVRTGVRGIGT
                     SGEQVRLMNGMMSSAKAANGASFYVEPRFSMTGTISTSF"
     CDS             610477..611637
                     /codon_start=1
                     /locus_tag="GLX_05200"
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="BAK82932.1"
                     /transl_table=11
                     /translation="MNAALPHGRAVVSCKLHSAYRGRLACSHMPIIEQEHIMTDLLSR
                     RHFLAATGGLVAGGLVRPVRAATTPRKVIVDADIGVDDTMALLMVHFAPEVEIVGITT
                     VNGNGTLANTTRNALFLAEKFGINAPVAKGAGISLDNRSETAPTFIHGDNAMGNIVLP
                     THINRTVDARPAWRMIVDMVRAHPHEITILGLGRLTNLALALRHDPAIADLTKEVIVM
                     GGGFGLHGDLGNVTPAAEANFKGDPLAADIACGASWPMTIVGVDVTFQTTMNDAYLRT
                     IRDQGGAGSGLIWDVTRFYMAFHKQRLGLDSMYVNDASASAYLLRPDLFKTRRGAVRV
                     VCGGVADGESILKPAGKHFPASAWDNRPEQAICGDVDADGVRTLFAQVMRGH"
     CDS             complement(611782..612030)
                     /codon_start=1
                     /locus_tag="GLX_05210"
                     /product="transposase"
                     /protein_id="BAK82933.1"
                     /transl_table=11
                     /translation="MLTDNGTHFTDPTGDGWTPQDVKAMRAEGMLFRCHSFEAACADL
                     DIEHRLTKPRHSWTNGQVERMNRTIKEAMARRFYYENA"
     tRNA            complement(612088..612180)
                     /locus_tag="GLX_t0050"
                     /product="tRNA-Ser"
     CDS             complement(612281..613729)
                     /codon_start=1
                     /locus_tag="GLX_05220"
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit B"
                     /protein_id="BAK82934.1"
                     /transl_table=11
                     /translation="MSYTLEGKTGTWEIVVGLEVHAQVISHSKLFSGASASYGGEPNT
                     HVSLVDAGFPGMLPVLNQECVAQAIRTGLGLRARINLESRFDRKNYFYADLPTGYQIS
                     QFTHPIVGEGTVEIELADGTVRHIGITRLHMEQDAGKSMHDQDPARSFIDLNRAGVAL
                     MEIVSEPDIRSPEEAGAYLRKLRQILRYLGTCDGNMEEGSMRADVNVSVRKAGQPFRT
                     RCEIKNVNSIRYVMHAIEVEATRQIEVWENGGEVDQETRLFDPSRNETRSLRSKEDAH
                     DYRYFPDPDLLPLVVEQAWVDELERGLPELPDDKRDRFVKEYGIPRYDASVLVAEQAI
                     ADYYEDVAKGRDARLAANWVTGDLFGALNRTGRTIADSPISAQALGGMLDLVSDKTIN
                     GKIAKEVFEDMLETGDSAADIVERKGLKQVTDTGAIDAVVADVLARNADKVAEYHSGK
                     DRLFGFFVGQVMKAMAGKANPAMVNEALKKVL"
     CDS             complement(613726..615210)
                     /codon_start=1
                     /locus_tag="GLX_05230"
                     /product="amidase"
                     /protein_id="BAK82935.1"
                     /transl_table=11
                     /translation="MSLTELTIADAAAGLRARKFSAAELVRAHTDAIDALNPRLNAYI
                     TTTTEAAMQAAVVADEALGKGEAKSLTGIPLGIKDLFCTRGVRTTAASNILKNFVPPY
                     ESTVTANLLRDGAVFVGKTNLDEFAMGSANITSAFGTVENPWKRKGDDAALVPGGSSG
                     GSAAAVAAGLAMGATGTDTGGSIRQPAAYCGIVGLKPTYGRCSRFGTIAYASSLDQAG
                     PMARSVRDCAILLQSMAGFDARDSTSVNRDVPDYSAAIGRSLKGLKVGIPAEYRAEGL
                     SAEIEAAWQQGINWLKAAGCEIVDVSLPHTKYGLATYYIVAPAECSSNLARYDGLRFG
                     ERVPGDTLDGMYEATRRAGFGPEVRRRIMMGTYVLSAGYYDAYYLKAQKVRSLIRRDF
                     TESFQQVDVLLTPTAPTPAFAQGEQSDDPVQMYLNDIFTVPASMAGMPAMSVPVGLGT
                     TGLPLGLQLIGRPFDEETILAAGSALESAAGFTHRPAIRAEGAK"
     CDS             complement(615212..615499)
                     /codon_start=1
                     /locus_tag="GLX_05240"
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit C"
                     /protein_id="BAK82936.1"
                     /transl_table=11
                     /translation="MSLDPATVRRIARLARIGIDESDVPALQGELNGILGWVEQLNEV
                     DVEGVTPMVGTGHAALRTRPDVVTDGNCREAVLSNAPDAVGPFYTVPKVVE"
     CDS             615578..616069
                     /codon_start=1
                     /locus_tag="GLX_05250"
                     /product="Holliday junction resolvase"
                     /protein_id="BAK82937.1"
                     /transl_table=11
                     /translation="MPLFNISDLRTHLRRNQRLLGLDPGKKTIGVALSDVGLMLASPH
                     TGLKRGKLSVNAAEIGKIARMQDVGGLVVGLPLSLDGSFGPAAQAARDWTLNLSDLTG
                     LPAAMWDERLSSSAVNRFLISEADMTRQRRGEVVDQMAAAYILQAALDASIPSGEGGI
                     ADS"
     CDS             616210..617139
                     /codon_start=1
                     /locus_tag="GLX_05260"
                     /product="major facilitator superfamily glycerol uptake
                     transporter"
                     /protein_id="BAK82938.1"
                     /transl_table=11
                     /translation="MRLPHLHLPYLHIHVHDRPLAGDPHPHNPFHWKLYFCEAIATAI
                     LMILGLSGVIVLTAPGSPLSHPLLPHPYVQTALCGLVFGLSGTAAAMTPFGKVSGAHI
                     NPSVTLAFSLAKRIGGVDALNYMIAQVVGAFVGTGLVYEAGRLFTWWGSMAVAVRYGA
                     TVPYGHISIWWAMWSEMFVTAALIAMLYWLAAHPRWKFITPWSGGLFFLIMNPLTAWL
                     SGNSVNFARTLAPALFSGQWTGLWVYVVGPFAGASLAVMAIRMNLLGKLHLLEARLVN
                     FGHHGRVPGLDDPHRKLNHPDDPDHIPPGAGPA"
     CDS             617274..618914
                     /codon_start=1
                     /locus_tag="GLX_05270"
                     /product="dihydroxyacetone kinase"
                     /protein_id="BAK82939.1"
                     /transl_table=11
                     /translation="MIMKRFFNTRETIVTEALDGFLRSAAGQHLCRLDGYPDTCVIMQ
                     REPDRGQVSVISGGGSGHEPAHAGFVGRGMLTAAVCGALFASPCVDAVVAAILATTGE
                     AGCLLVVKNYTGDRLNFGLAAERARALGKQVEMVIVGDDIALPDSATPRGVAGTVLAH
                     KLAGYGATQGWPLARVAEFVRDGAGRMRTLGMALEDCNPYEAGRISRLAADEAELGLG
                     IHGEPGAQRIALATASDLMRRVADALEANLPATVRNTRFAVVLNNLGCVPEVEMALLL
                     EAFSHTPLARRASYVIGPAPLMTALDMNGFSLTLIELDEAITQALQAPVQPRAWPGMA
                     PRHSPAVAPMPTMPSAFPYPASANPAVKTLLEQGAKILIANEAPLNELDGRIGDGDAG
                     STFAGAAREITAALDRLPMADPHQLMTTLSNILTQHAGGSSGVLFAIMFAAAGRSTAP
                     WRDALCEGLEHMMACGGAKPGDRTMIDALHPALEALARTGSLHDAARAARTGADATTT
                     METARAGRAAYVPSEHVRNVPDPGAEAVARLLEGLAGK"
     CDS             complement(618959..619369)
                     /codon_start=1
                     /locus_tag="GLX_05280"
                     /product="alkylphosphonate uptake protein"
                     /protein_id="BAK82940.1"
                     /transl_table=11
                     /translation="MSFAWAGVCFKSSAQPARTKMSTDPQCPVCGCTHTYPDGSLWIC
                     PECGHEWNPATAGAEETDGPVEIRDANGNVLADGDSVTVTRDLKIKGASSVIKGGTKV
                     RGIRLVDGTDGHNIACKIAGVGAINLKSEFVRKA"
     CDS             complement(620047..621165)
                     /codon_start=1
                     /locus_tag="GLX_05290"
                     /product="cyclic-AMP phosphodiesterase"
                     /protein_id="BAK82941.1"
                     /transl_table=11
                     /translation="MPPSYADTQSAGKFVVWVYFLSQRYCQPPCRRKDHPVPLCSVIR
                     SCLKIFVALVVGACPLRAMAAGFDITVLGARGGLEDGNLSAYMVHPIGDSRAVLCDAG
                     TVLHGLQVADQHGALDDIRMPANAVETRPGFVLHHAIQAYLVSHAHIDHVAGLVLVSP
                     DDSPTPIYALPSVNRVLSRDLFNGAVWPNMGDRGAPPLLGLYQYQDLVPGHAVALAHT
                     GLRVTAYPLSHGNVESTAFLLQSGSDAMLYMGDTGADAVEHGTRLHALWQAVAPLVRR
                     HRLRGIIIECSYDDSRPDSQLWGHLSPHLLLNELAALQGIAGTPLRGLPVLVAHIKPS
                     LRKGADPVALIPEALRRGNAMGVNFIVPEQGMRLQWHK"
     CDS             621253..621747
                     /codon_start=1
                     /locus_tag="GLX_05300"
                     /product="hypothetical protein"
                     /protein_id="BAK82942.1"
                     /transl_table=11
                     /translation="MTRIFIDADACPVRDETYRVALRYRLHTFVVSNSMMAIPDTPLI
                     ERVVVTQGMDVADDWIADNVAAHDIVISADIPLAARCVAQGACVLDPRGRILDENAIG
                     MALAVRNLMTDLRDTGAITQGSRGFTRADRSTFLSALDTAVVRARRQAAGLGRKLPFI
                     PPTP"
     CDS             complement(621819..623489)
                     /codon_start=1
                     /locus_tag="GLX_05310"
                     /product="phosphoglucomutase"
                     /protein_id="BAK82943.1"
                     /transl_table=11
                     /translation="MPSISPFAGKPVDPDRLVNIDALLDAYYTRKPDPTIATQRVAFG
                     TSGHRGSSLSTSFNEEHILAISQAIVDYRKNAGITGPLFIGIDTHALSRPALKSALEV
                     FAAAGLEVRIDAKDGYTPTPVISHAILTYNRDRSTDLADGVVITPSHNPPEDGGFKYN
                     PPHGGPADTDITKVVEAAANDFISKKMAGVNRISFEDALKAPTTKRHDYITPYVDDLG
                     AVVDMEIIRQSGISIGIDPLGGAAVDYWQPIIDKYGINATIVSKEVDPTFRFMTADWD
                     GQIRMDCSSPYAMARLVSMKDRFDIAFANDTDADRHGIVSGKFGLMNPNHYLATAIEY
                     LFNNRDVWNPVAGVGKTVVSSSMIDRVAKEIGRKLVEVPVGFKWFVDGLYNGTLGFGG
                     EESAGASFLRRNGTVWSTDKDGIILGLLAAEITARTGKTPGAAYEAMTQRLGTPYYAR
                     IDAPANPEQKALLKALSPEQIGMTELAGEPIESTLTNAPGNGAAIGGLKVSAKDGWFA
                     ARPSGTENVYKIYAESFKSAAHLKAIQTEAQDAISALFAKADAAKKVG"
     CDS             623660..624112
                     /codon_start=1
                     /locus_tag="GLX_05320"
                     /product="hypothetical protein"
                     /protein_id="BAK82944.1"
                     /transl_table=11
                     /translation="MALNYIKFGTFFISQPHPHLTPRLRQAGCNTYHTGMDMLPAPST
                     ASDNSAEHMRRRRLERLLRRLPARGEQAMRWLLQPGRAGLRLVLGCLLMIGGVLSFLP
                     ILGLWMLPLGIILLAEDVPLLRRLSERMLEWIERRHPNWLAPETGHTP"
     CDS             complement(624131..624586)
                     /codon_start=1
                     /locus_tag="GLX_05330"
                     /product="transcriptional regulator"
                     /protein_id="BAK82945.1"
                     /transl_table=11
                     /translation="MTMKEPNSPDSPLAELCRQRGLKLTGQRRTIAFVLSDSDDHPDV
                     EELYRRAVEVDPRISIATVYRTVRLFEENGILQRRDFGGGRARYEVADGDHGDHYHLI
                     DADSGKVIEFENTELDSLLAGIVRQMGYDLVTTRLSVVGRPKAKSGQRE"
     CDS             624727..625368
                     /codon_start=1
                     /locus_tag="GLX_05340"
                     /product="hypothetical protein"
                     /protein_id="BAK82946.1"
                     /transl_table=11
                     /translation="MMTDTTVFMNDLSCSERLLVWCVRRLNGGDSTGAGMPGLALPCF
                     RADFAAVVEAFHMALARLRAYQREPVDVGICSATRLTGTENRFLLAATAAQEGREAEV
                     RRTLRPIFTHHHVLSPFAAAITQLGACMAGAGYWLPRRGGTPAAQTRTRSTRLRPSPS
                     IPGREGDRLQRVATAHHQPIGAGCLAAMRWHDADMGNAHIMWPGHTLSHAGGL"
     CDS             625596..626912
                     /codon_start=1
                     /locus_tag="GLX_05350"
                     /product="5-methylthioribose kinase"
                     /protein_id="BAK82947.1"
                     /transl_table=11
                     /translation="MPAFCARTCPRPCPARPRLEERRMEPTPAYRTLDATAIRALIAS
                     LPTIAARLGGASTQWQVREVSDGNLNNVFLVGGPSGEVCFKQSLPHVRVDPSWKMPLD
                     RTFFEAEWLRAIQPLAGGLTTEFLHYDPDLYVLIVESLSGHTVLRTALMQGAHWPGVA
                     PRIGTFVAHATFGTSLLARPFEDVFTARRLFAANLALTRITLDLVLDDPYRDHPRNHW
                     HDPALTPIVLDIRSSAATLLAVENLRRRFLSQPQALLHGDLHTGSIMSTADDTRVIDG
                     EFAVYGPIGFDCGMFVGNLVLHYFATPDRAARQATLHDIAAFWHRFHDEFLALWISHD
                     TPPPGTLHPLAYGPAADVARQRFMDEIMADTIGFAGVEIIRRIIGYAHTADFDTIAAS
                     HQRATCRAGALGFAYYVLEHLDQVRTMADFLRHLAEHDGTGLLGSG"
     CDS             complement(626909..628534)
                     /codon_start=1
                     /locus_tag="GLX_05360"
                     /product="type I DNA methyltransferase M subunit"
                     /protein_id="BAK82948.1"
                     /transl_table=11
                     /translation="MLSAPAIWRIAERLRGVVPPGEYGSVILAFTVLRRLELARGRPV
                     AALAAVARAASPQARLETLIARLPAPVRGMMTRMEMDLIAPRLARAGVLGDVAAHFAA
                     LDLSPALYGTQDMARLFEELVHHFDSSEDTGAHYTPPEVCDLMTDLVFAPDGAGTGHA
                     LYDPAVGTGALLGRAADRLAARGVMVDLFGQEISPRACAICQADMLLRGRNPAHIQPG
                     NTLAADHHSRRRFARMLANPPFGQEWRGIRPAIQAEHAAGAAGRFAAGLPRVADGSML
                     FLQHLLAKMRKPVHGGARVGMVTHGAALGGGGAESGESAIRRHLVDHDLIDTLIALPP
                     DMFVNTGIATYVWILDNCKPAGRQGMVRLVDATGLWQRCPRSSGEKRREMTQAHIAAV
                     VQAGTAGHDMDLIVQPGAEGAAAGWHAVTHDGSVRMDGTCALPLSRSVKGEDFLYHSL
                     SVERAANCDGAPTRLTFTVDGADNPQAWFARMIQPFDPTARLDRTRSTTGCAISFARY
                     FGAPSAPRALHAIEADLHHSMARLAALVEKGGR"
     CDS             complement(628538..629629)
                     /codon_start=1
                     /locus_tag="GLX_05370"
                     /product="transporter"
                     /protein_id="BAK82949.1"
                     /transl_table=11
                     /translation="MVARYPNNQDRSRPMDENRNRTQYIGTFIFVCAVLLFSAWIEQS
                     FLFAFVWGGILSITTYPLYRRLVQRGMGNCMAAGLIAAGIFALLAVPMIAMAVRAGLE
                     LPSLMAWGRGALHDGIPLSPQVAEIPRIGPRLAGLWQHYLSDPAELRHWTSVASRMFA
                     TGDGRELPHRLMEMTETFVIATLSVYFYLAASRTLQTDIRAVGSRFLGTRARDVIRNT
                     VGAVRGTVAGLVLVGLGQGVLVGIGYFIAGTPHPALLTLLTAVVSIIPFCGPILLCAT
                     VLMTFAANGVTQAVIVTVIGSIAYGAGDHFVRPKLISGSTSIPFLAVLTAILGGLHMF
                     GLLGLFIGPTVIAVALSLWRTAAAEEQAR"
     CDS             complement(629771..630949)
                     /codon_start=1
                     /locus_tag="GLX_05380"
                     /product="type I restriction-modification system
                     specificity determinant protein"
                     /protein_id="BAK82950.1"
                     /transl_table=11
                     /translation="MHEHGGRQPTGVAPWPCVPLGALVDCLDARRIPLSRARRAGCPG
                     SVPYHGASGVVGHVDRALFDGPLVLLGEDCAPFLNPVRDVAFFHDGPLWAGNHVHVLR
                     PRAGVDGRFVAHALNTIAYGGYVEGTTRPKLVRARMNSLPVPCPPLDSQRRIARELDG
                     ALERIDCQLHELSVQRVLLREQADAALWHAVQPGHGHTARLLGSLFDIVGGGTPPTDQ
                     DPLWGGDIPWITPADLPAGPPTWLYHGARSLSAAGLAACRATLVPPGALVVSTRAPVG
                     RVGMLRGAVSVSQGCKALVPRGADVALDYAALLLRAHAPILRQRAGGSVFAEVDTATL
                     ASLELSLPPLPAQHAAARTAWASLTRVAKCEAACAAMEVTLREYRPALRRAWVSGMRP
                     "
     CDS             631101..632462
                     /codon_start=1
                     /locus_tag="GLX_05390"
                     /product="Na+ driven multidrug efflux pump"
                     /protein_id="BAK82951.1"
                     /transl_table=11
                     /translation="MTRPDRPFGTEFRAILAIAGPMGLSQFAQMLMGLTDNVLLGGIG
                     AQALAVGGLATGTFFTLNAILAAMIEAGGILLAQARGREDHASLGGIMTSMLVVAGVL
                     CVPELFCLYHVDRLLAWLGEPMAIRAPVTDFVHILMWAAPPALMGQGILSTALPVMGA
                     QGILMRVMPCIMVANGILNAALIHGWLGLPALGLHGSAIATVLTLWCMPIALLWLAGR
                     RPELRHGLCPRAHDWGHTLALLRTGLPMLASAMAEVTLFQTNSLEAATLGSNALAAFQ
                     IMLGIGMQSFTLYIALGQACNIRVGYWTGQDNPAMIRRAAGAGMVLGLVLGGAATLLL
                     ALGRHAIIGFYLDTALPENAQAIQIALGVLLVGAAIQLPDAIQAIATGVLRGQGDTTI
                     PMVVAVAGYWGIGFPAGLYLAFHHGTGAWGLWCGNGIGLACVSVLLCARILWRLRRRQ
                     AAG"
     CDS             complement(632479..632985)
                     /codon_start=1
                     /locus_tag="GLX_05400"
                     /product="hypothetical protein"
                     /protein_id="BAK82952.1"
                     /transl_table=11
                     /translation="MIWGDFQAVIQLSAGLNVAILSFVDISLPAIKERRRVFSKARQE
                     LELHRGGTEHQHPDDAADYAAAVQEMDRKLFMLWQESSTFIREEESLIRSTGVLGVFG
                     AVLSLGLLWYSAEHYGGTISLMGRVLIILSFCSLLGAFMINFMTASQAGVFTKKCNSI
                     REEMHKRL"
     CDS             633136..633462
                     /codon_start=1
                     /locus_tag="GLX_05410"
                     /product="hypothetical protein"
                     /protein_id="BAK82953.1"
                     /transl_table=11
                     /translation="MNIHVPTTYEIYRGWQSVQGSGLEIGTALLLGLSMAFMLGLLAF
                     LLPIFIACQRGVHNAAVVAVVNCTLGMTGIGWVVALVMACVMETDARRHARLRRAEQA
                     TFLTVP"
     CDS             complement(633663..634928)
                     /codon_start=1
                     /locus_tag="GLX_05420"
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="BAK82954.1"
                     /transl_table=11
                     /translation="MTSQPNGHLSLPKDKIRILLLEGIHDSAINLLKDNGYENVTRLK
                     TALEGEALEKALEGVHIVGIRSRTQLTREVIEKADRLIAIGCFCIGTNQVDLGAAREA
                     GIPVFNAPYSNTRSVAELVMGEIVMLMRRIFPKSEECNAGIWKKSATNSWEVRGKTLG
                     IVGYGSIGSQLSVLAEAFGMRVFYYDVIDKLVHGNASPVDTLEHLLAQSDVVSLHVPQ
                     TPETAGMIGEAQIRAMKKGSFLINNARGNVVDLDALAAALKDGHLLGAAIDVFPKEPK
                     QAGEALETPLRGLDNVILTPHIGGSTAEAQERIGVEVARKLVEYSDIGSTLGAVNFPT
                     VQLPENPHGTRFMHVHHNVPGIMLKINEIFSSEACNVTAQYLQTAGELGYVVVEADTG
                     RDVEKDNRILDSLRALKGTLRARLLYKQQ"
     CDS             complement(635028..635837)
                     /codon_start=1
                     /locus_tag="GLX_05430"
                     /product="inositol-1-monophosphatase"
                     /protein_id="BAK82955.1"
                     /transl_table=11
                     /translation="MTALPPDFPRDAVLEAAMAAADVARSVVLPFFRRGVRADDKGDA
                     SPVTMADRTAERTIRAVLSERLPGFGLMGEEFGLEGADSPYRWVIDPIDGTRAFITGR
                     PTFGTLIALLHNDVPLLGLIDQPVTGERWVGLRGAPTRYLSTLPGTPATRTCAHVAAA
                     ELSCTAPEILDAPHRPGFESLARAVKRTSWGGDCYAYGLLALGQIDIIAECTMKIWDW
                     AALVPIVEGAGGRMTDWSGRPLRADGDGTVLAVGDGCLLPSVTALLSMPAI"
     CDS             complement(635837..636340)
                     /codon_start=1
                     /locus_tag="GLX_05440"
                     /product="cytochrome c"
                     /protein_id="BAK82956.1"
                     /transl_table=11
                     /translation="MDSVKLNQIGVACLIAALAVGAGWGIAHTAVPEPLPARPGVAIP
                     HPVAPSGASIDDLVAKASVDKGRAIAERQCAMCHSLAPGGPSIIGPNLFGVTGTHIGD
                     IPGYDFSDALRAHKDETWTSTTLSNWLKGPADYAPGTKMSFPGIASDTDRADVIAYLR
                     SLQPETP"
     CDS             636371..637228
                     /codon_start=1
                     /locus_tag="GLX_05450"
                     /product="3-deoxy-D-manno-octulosonate
                     cytidylyltransferase"
                     /protein_id="BAK82957.1"
                     /transl_table=11
                     /translation="MKTAPYLDCRATCVKHAGRATAAALPPRQIMDGPDPDPMNPIVL
                     IPARMASTRLPGKPLADIAGRPMIVHVLQRAQAAAIGPVAVATAEAEIAEVVERAGGT
                     AILTDASLPSGSDRIWQALCRLDPAGKHDTIINLQGDLPGVEPACLRAVLRPLADGTT
                     DIATLVAPVRDRAEAEAPSVVKVACSLAAEGDNDVTRALYFSRLPIPWGQGPLWHHVG
                     IYAYRRAALARFVSLPESGLEKREKLEQLRALEAGMTIGCARIETAPFGVDTPADLER
                     ARMAMGTMA"
     CDS             637225..638070
                     /codon_start=1
                     /locus_tag="GLX_05460"
                     /product="prephenate dehydratase"
                     /protein_id="BAK82958.1"
                     /transl_table=11
                     /translation="MSAQGIIAFQGRPGAYSDLACRTARPGWTTLPCQTFAQAIGAVH
                     DGLADEAMLACENSLAGRVPDIHALLPQAGLFIVGEHFQRVEHCLMGIPGSTLADARR
                     VHTHPVAMAQIRDVIGELGLEPVVEFDTAGAAEMVRGWGRREDVAVASALAAELNGLE
                     ILRRNVEDASHNTTRFYIASRRPAMLPPAGPGYMTTLLFRLNNHAGALYKALGGFATT
                     GVNMTRLESYMLEGSFSATQFLLDVEGHPEAPPLAQALRELSFFVQQQEILGVYHASP
                     FRRQT"
     CDS             638213..639103
                     /codon_start=1
                     /locus_tag="GLX_05470"
                     /product="dihydrodipicolinate synthase"
                     /protein_id="BAK82959.1"
                     /transl_table=11
                     /translation="METTMFKGSITALLTPMNKDGSLDLPSMGRFIDWQIQQGTAAVV
                     PVGTTGESPTLTHDEHAKVVEFTIKSAAGRVPVIAGAGSNSTAEAVALAQQAERAGAS
                     AVLVVTPYYNKPTQEGVYRHFMAIADAISIPIILYNIPGRSIIDISVETMARLAQHPN
                     IIGVKDSTTNLMRPLQVRRAVKKPFNQISGEDGTAVSFLAAGGDGCISVTANVAPALC
                     AQAQQSWVDGNVMNAMELQDRLLPLHDALFCESNPVPVKFAASVLGLMGETCRLPLAP
                     LSDAGRTQVKAALDAVGLLG"
     CDS             639108..639602
                     /codon_start=1
                     /locus_tag="GLX_05480"
                     /product="trans-translation helper factor"
                     /protein_id="BAK82960.1"
                     /transl_table=11
                     /translation="MAAKSKGSGMISTGIAAQNRKGRFNYTIVETVEAGLVLKGPEVK
                     SLRMGRATINEAYAGERNGEIWLINSYIPEYQGGVLSRFEPRAPRKLLLHKKQVDKLL
                     GETARNGVTLVPLDIHFNSRGLAKLTLGVGEGRKKADKRQAIADRDWARDKARLIRNK
                     GRDD"
     CDS             complement(639975..640667)
                     /codon_start=1
                     /locus_tag="GLX_05490"
                     /product="transcriptional regulator cold shock protein"
                     /protein_id="BAK82961.1"
                     /transl_table=11
                     /translation="MRSNRTDRSSRSPRRGGFDDDFMSSPSFGDRSSAPPPRRSFGGG
                     GGGPQIVASGPEISATVKWFNSEKGFGFVELSDGSGDVFLHANALNPTGHATVAPGTT
                     LVVQIGQGPKGRQVAAVLSVDESTAQPERPRAPAGFGAAGGAPRGGFSRSGRPTPDLS
                     HAQDMRGTVKWYNATKGFGFITPENGGKDIFVHASALERSGLSGLTEGQTANVQVVEG
                     QKGPEAAALSVD"
     CDS             640930..641781
                     /codon_start=1
                     /locus_tag="GLX_05500"
                     /product="transcriptional regulator"
                     /protein_id="BAK82962.1"
                     /transl_table=11
                     /translation="MSSQRCKLNSTIILAFYSHSHIIRRRYCLEPLIPAGKNAPMSNV
                     TPPRRGRGRPPKTARAPEGTRAMLVRAGVELLTEKGFSSTCVDDVLNATGISKGSFYY
                     CFSSKEEFGQALIGYYADYFNAKLDLWLTDAKEPPLQRLLNFMHDAKGGMEQYNFRRG
                     CLIGNLGQEIDIIPDSFNGLLLTIMQGWEQRVADCLLDVFAPRPTPEQKRLCTGLARY
                     FWIGWEGAVLHARMAHDATPLDLFTSFYLAQTAQQLGVSLPVAAKPSLRVSPARPVHA
                     KTIQAAS"
     CDS             complement(641720..643882)
                     /codon_start=1
                     /locus_tag="GLX_05510"
                     /product="DNA helicase"
                     /protein_id="BAK82963.1"
                     /transl_table=11
                     /translation="MPPRRMNRRVSDTAFPPTNSLLAPLLAGVETLKGVKPATAKLLA
                     RVAGGGRVIDLLFHLPESVVDRRYRPNLGQAETGRVCTLHVTVTRVVPPAPGGGRGKR
                     PWRVGVTDGTADADLVFFSPHQARRLEAGQEICVSGTLERFGERLNMAHPDYVVPAAR
                     MSEIPLLDPVWPLTAGLFASQVRAAIRAAFDIFPPLPEWQDTSVLKQRRWPGFEDALR
                     TLHRPCDMPDLLEGDALVAASERARARLACDDLLAQQVAMAQARRLNRLRPGRAVVGD
                     GSLRRVVLSRFGHEPTTAQVRALAEIDADLAAPRQMTRLLQGDVGAGKTLVALQAMLG
                     AVEAGHQAALMAPTEILARQHLATFERLSPVSVAFLSGSVKGKARREALARIADGTAR
                     LVIGTHALFQESVVFHDLALAVIDEQHRFGVEQRAMLGEKGPQTDVLVMTATPIPRSL
                     LLTQWGDMQVSRLDVKPAGRKPVRTSLHALSAMGELLAGMERALARGARIFWVCPLVS
                     ESETTDIAAAEARHEALGAHFGTQAVGLAHGQQDITLREQAIADFAQGRTRILVATTV
                     IEVGVDIPDATVMIIEHAERFGLAQLHQLRGRVGRGLAESYCLLLHDSALGQTARRRL
                     ALLRETEDGFLIADEDFRLRGGGDVAGRRQSGMPDLRLASPLHVDMLLTLAAQDARRL
                     VDTPPGQRPPALQAREPAVSLLLELFSRARAVRAIRAG"
     CDS             643912..644289
                     /codon_start=1
                     /locus_tag="GLX_05520"
                     /product="hypothetical protein"
                     /protein_id="BAK82964.1"
                     /transl_table=11
                     /translation="MRAIGHLRHGTKHNHTLQGWNAMEARTPDLSRLDTRRRKIYYRA
                     THRGTHETDVLIGGFVAPRLEGMTEAQLDALEAVMDLPDADLADWLSGRRPVPESLNT
                     PMMREIMADATDPARLAAIRGGK"
     CDS             644286..647768
                     /codon_start=1
                     /locus_tag="GLX_05530"
                     /product="transcription-repair coupling factor"
                     /protein_id="BAK82965.1"
                     /transl_table=11
                     /translation="MNTTAGFSLAPDAPLPVWGVPDGYDAFLIARRLREGPGPVLHVC
                     RDDAGLARIAEQLAFVAPDAEILRFPGWDCLPYDRVSPNPAIVAERVATLTRLLEKAT
                     APRIVLTTVMGLIQRVAPRAAFAGQSITIRTGESLDAPFLMELLIAHGYNRTDTVMEQ
                     GEFATRGGIFDIFPAGDSEPVRLDLFGDEVENIRRFDPGTQRSTAKIDSLTMRPVADF
                     SLDPASISRFRTSWRDLFGPAAASDPLYQHISDGRRHAGMEHWLPLFHEQMETLVDYL
                     PGVSISLANQAEEVLVTRLEMIADHYDARRQPTREGEVPYRPLPPHLMYLDRKGWDAI
                     IAGRKAVVFMPFAQPDGAPGMDAGGRPGQMFAKTVTEGRENVFPMLHARVEEWSQTGR
                     RAYVTAWSRGSCERIGVLLREYRLPVQTYTTWKEAQKLRPGTVGLLTLGLDRGFVADN
                     VAFVSEQDLLGERISRPPRRRKKADQFISEASEIAEGDLIVHQDYGIGRYDGLETIGV
                     GTAPHDCLRLIYDGNEKLFLPVENIELLSRFGSDQAHVALDKLGGVSWQSRKAKMKQR
                     IRDMAGELIRTAAARALREAPAITPEDGMWDEFCARFPFVETEDQSRAIADVLDDMAS
                     GRPMDRLVCGDVGFGKTEVALRAAFVAAMSGAQVAVVVPTTLLARQHYRTFSARFNGL
                     PVNVAQLSRMVTPKEATAVRKGLTDGTVNIVIGTHALLAKTVKFADLGLLIVDEEQHF
                     GVAHKEKLKALREDVHVLTLSATPLPRTLQLALTGVREMSLIATPPTDRLAVRTFIMP
                     FDSVVIREAIQRERFRGGQVFCVVPRIEDLDRMATRLHEIVPDARLVQAHGRLTPTEL
                     ERVMTEFSDGKYDILLSTNIVESGLDMPAVNTLIIHRADMFGLGQLYQLRGRVGRGKQ
                     RGYAYLTWPQTHVLSAAAQKRLEVMQTLDTLGAGFTLASHDLDLRGAGNLLGDEQSGH
                     IREVGIELYQQMLEDAVADLRTEKGRRRLLDRDWTPNIILGLPVLIPDTYVTDLPVRL
                     GLYRRIAALANDAEVEAMEAELVDRFGTLPDEVRNLLDVVTLKRMCREAGVERLEAGP
                     KGMVIQFRGNTFANPAGLVAWIAKQKEANVRLRPDHKLAIIREMTNAQRIAQARKVLA
                     ALVHMVQADAGVSA"
     CDS             complement(647877..648809)
                     /codon_start=1
                     /locus_tag="GLX_05540"
                     /product="hypothetical protein"
                     /protein_id="BAK82966.1"
                     /transl_table=11
                     /translation="MKTFLLTTAIAALSCIGVARATALPATCAHVVVASSQPHGAGSL
                     AGHGYDLSLAGDAQRTFHAGDITATGTGLDPQALRDMEDVASLVLLATLTGHHSEGCA
                     QDYFAAAATPIMEGLRAGHSYDLIWQDGQLTSGATKLSFRRAHLHLGGARSDDTPSTL
                     TLDTQGVGITGTHNILLASALPQQATANASVPGSALVSLATAITGHPAHNIMVPLHVS
                     SLNAQRGSMQVTGNGDANLTGNTDASSATGHIQVQNLDAVIDTLRNAGQTRASAALVL
                     AKLFGHKAASGGTSWDVSWEGGVMTVNHIPLPIR"
     CDS             648842..649861
                     /codon_start=1
                     /locus_tag="GLX_05550"
                     /product="bile acid/Na+ symporter"
                     /protein_id="BAK82967.1"
                     /transl_table=11
                     /translation="MQCRMIWPAITVSHGRFPIMFRKLDSFLLCLLATVMLASVVPCR
                     GVGVNIFNTLAIIMIANMFFLQGARLSRRAVMEGVTGWRVHLAIGLCTFALFPLLGVA
                     LHTLAPDLLEGPMWTGVLFLCCLPSTVQSSIAFTSIARGNVAAAICSATLSNILGIFL
                     TPLLVGLVLARHAATGGGGGIGPIVLELLVPFIVGQVAQPWIGAWAHRHKKLLSFSDR
                     GSILVVVYTAFSEAVVQGLWHRLPPMQLGRVALVDIVILAIVLGLTRLVGRMGNFERT
                     DRVAILFCGSKKSLASGVPIASVLFSHADVGLIVLPVMIYHQIQLFACATLARRLGAQ
                     AEGAD"
     CDS             649936..651369
                     /codon_start=1
                     /locus_tag="GLX_05560"
                     /product="aromatic-L-amino-acid decarboxylase"
                     /protein_id="BAK82968.1"
                     /transl_table=11
                     /translation="MTGLDPDNWDALRALGHEMVDDMFNRLSTLRERPVWQPMPATLR
                     AQLRTGLPHDPTPPQELYARFRELVEPYSTGNIHPGFMGWVHGGGTAMGMLAELLAGG
                     LNANCGGRDHAPIEVEREVIRWAAEMCGFPTETTGLLVTGSSMANMIAVITASRAVPD
                     GLAMRAGGVGTRKLVGYAAATAHGCIARAFDLTGLGTDALRVIPVGADNRMILPELEQ
                     AIARDRAAGFEPFMVIGTAGTVDTGAIDDLAALADIAARENIWFHVDGAFGALAMLSD
                     TLRPSLRGLERADSVAFDFHKWAQVQYDAGCILVRRPGVQAAAFAQSRAYLAREDRGL
                     ATNAPWYCDLGPDLSRGFRALKVWMTLGTYGADGMGDMIANCCAIARHLANRVEANPR
                     LELLAPVTLNIVCFRIIAPVADLDHFNGEVVKDLHESGIAAPSTTVINGHKAVRAAIV
                     NHRTTTADVDRMLDALLELADRRLIAA"
     CDS             complement(651429..653327)
                     /codon_start=1
                     /locus_tag="GLX_05570"
                     /product="cobaltochelatase subunit"
                     /protein_id="BAK82969.1"
                     /transl_table=11
                     /translation="MRENRKNASSPKSELEAMRAERFKRATVGAVRAMGGKAQAEVSF
                     LNGPVPSGVSVTGMHVRLPHPTQRMTDAEMTRMRGAADAAALRLRHHNAALHDHARPP
                     AGEAREVYDILEQARVESLGARHMAGVAANLDARLAQECADLGMDRLPSHTRLPTPLA
                     LGLLARARMSGQPVVESMRDLMARWFDDMPPAARRALDEMVSRQDSQTDFAQAARRLL
                     MACSLLEQETTPDEAADDGTAEAEAASTEDEEQGEDVTPEPQDDGPEEDDSSQPMQMS
                     QGTGTGDDEPEDGEQGGTASGSEEAGGPGEEDAPPDDTPPAYRAFTTVYDEEIAAEDL
                     CDGEELSRLRQTLDQQLVSMQGVVSKLANRLQRKLMAQQTRAWEFDLEEGMLDAGRLS
                     RIVVNPMLSLSYKRERDTDFRDTVVTLLIDNSGSMRGRPISVAAMCGDILARTLERCA
                     VKVEVLGFTTRAWKGGRSREAWVQAGKPENPGRLNDLRHIVYKAADMPWRRARRNLGL
                     MLREGLLKENIDGEALLWAQRRLAARAEARRILMVISDGAPVDDSTLSANPGSYLENH
                     LREVIAHIETRTTTELLAIGIGHDVTRYYRRAVTITDPEELGGTMMKKLSELFAEEAL
                     RSRPRRGG"
     CDS             complement(653346..654371)
                     /codon_start=1
                     /locus_tag="GLX_05580"
                     /product="cobaltochelatase subunit"
                     /protein_id="BAK82970.1"
                     /transl_table=11
                     /translation="MNEPADLTTAAVDANGTPLPAISAVSAPDLQVTARDVFGIDSDM
                     KVPAFSVRTEHVPEIDPSYKFDHDTTLAILAGFAFNRRVMVQGYHGTGKSSHIEQVAA
                     RLNWPSVRINLDSHISRIDLIGKDAIVLKDGQQITEFREGLLPWGLQHPCALVFDEYD
                     AGRPDVMFVIQRVLEVEGHLTLLDQNRVIRPHPFFRLFATANTVGLGDTTGLYHGTQQ
                     INQGQMDRWNIVTTLNYLPHAQETAIVMAKMGIDPKKDEVGRKRVESMVALADLTRSG
                     FIAGDISTVMSPRTVISWAQNFDIFKDLAFAFRVTFLNKCDEAERPTVAEYYQRCFNA
                     SPLAPRD"
     CDS             complement(654515..655141)
                     /codon_start=1
                     /locus_tag="GLX_05590"
                     /product="heat shock protein"
                     /protein_id="BAK82971.1"
                     /transl_table=11
                     /translation="MMKRRNTRHRAFDPDPDAPERCCDMHDCDQPAGYRAPRSRDALN
                     SYFWFCLEHVREYNARWDYYRGMSPGQIEAHIRADTSWNRPSWKLGQGKAAHTFSEED
                     MLDPLDLLKGAAKARARAARRKHEEDRRADAPQALKYPLGVLDLGWPVSMEELKTRYK
                     DLARRHHPDANGGDRKAEERFKGINIAYTAVRAHLVANAGREGMARSA"
     CDS             655149..655535
                     /codon_start=1
                     /locus_tag="GLX_05600"
                     /product="stress response and cell division protein"
                     /protein_id="BAK82972.1"
                     /transl_table=11
                     /translation="MCACSCFVQERSCAMNDPAIMEPPMEQQATGRAGRIDRILREHL
                     APVELQIKDDSARHAHHAHMRDNGVQAGESHYNVLVISPAFNGVGRVQRSRMVHDLLA
                     GEFAGGMHALSLVLRTPEEQARMNVA"
     CDS             655532..656155
                     /codon_start=1
                     /locus_tag="GLX_05610"
                     /product="outer-membrane lipoprotein carrier protein"
                     /protein_id="BAK82973.1"
                     /transl_table=11
                     /translation="MKPAFPFATRRLMMGGLLTLLAACAGVPEQAPDQRTDIARVETY
                     LNTSHGLQADFVQTWPDGGKGQGVLHYDPGRLRLDYTTPGAMKLVAAGGHLLFVDHRR
                     ESVTRMSLGHQPLGLILDQPVHLSGQILVTAVQHGANSLQVSLARADSPSQGILTLGF
                     SDMGGKLSLLVIEMTDVERQHIRLDLSNAAASGQPWPDTMFTLSASN"
     CDS             complement(656177..656869)
                     /codon_start=1
                     /locus_tag="GLX_05620"
                     /product="lipoate-protein ligase B"
                     /protein_id="BAK82974.1"
                     /transl_table=11
                     /translation="MKGAWAMTENEFLWHRAPDLVPYPAALAEMEAQARGIREGTMPE
                     RVWLLEHPPTYTAGTSARESDLFNPRGYPTYPAGRGGQWTYHGPGQRVAYAMLDLSRP
                     HGMVPARDLRAYVHALEEWLIRTLAHFDVVGERRADRIGVWVVDPATGREEKVAAIGV
                     RVSRWVSWHGVALNVAPDLSDFGGIVPCGISDYGVTSLAKLGRHPTMGDVDAALTATW
                     PECFGPIPGAQG"
     tRNA            656930..657015
                     /locus_tag="GLX_t0060"
                     /product="tRNA-Leu"
     CDS             657379..658311
                     /codon_start=1
                     /locus_tag="GLX_05630"
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="BAK82975.1"
                     /transl_table=11
                     /translation="MKIDQMERFPVSVMHLEVNILVIKPLKKAVLPVAGLGTRFLPAT
                     KCVPKEMLTVVDRPLIQYAIDEAREAGIEEFCLVSSRGKDSLIDYFDISYELEDTLKA
                     RKKASALKALEATRVTPGSMLSVRQQEPLGLGHAIWCAREFIGNDPFAILLPDDVVQS
                     KKSCIGQLVEVYNKTGGNVLAVTEVPREQTGSYGILDVGHDDGKTVEVKGLVEKPDPK
                     DAPSTLSVIGRYVLTADVLKHLAKLEKGAGGEVQLTDAMAKTIGHVPFHGFRYEGKRF
                     DCGSKVGFLEAQIAFALEREELAGDVREFLKKYK"
     CDS             658308..659714
                     /codon_start=1
                     /locus_tag="GLX_05640"
                     /product="phosphomanno mutase"
                     /protein_id="BAK82976.1"
                     /transl_table=11
                     /translation="MTFQHRFDPSTLREYDIRGVVGTTLGPEDAYAIGRTFGSMVARA
                     GGQRLIIGRDGRLSSPSLEQALVEGAVASGMAVQRIGCGPTPMLYFASVAFGADGAIM
                     VTGSHNPPDHNGFKILQANQPFFGPQVRELGRLSAMGDVVPHNPGTTQDVDIRPDYVA
                     RLLRDYDDGPRPLKVVWDNASSAAGDVLSMVVQRLPGTHHILNGTIDGHFPAHHPDPT
                     IPANMRQLADAVRMEKADLGLAFDGDADRLGVVDDTGTMIWADQLLVLVARDVLRARP
                     GATVIADVKASQILFDEIARAGGRPLMWKSGHSPIKTKMAETRAPLAGEMSGHFFFAD
                     RWYGFDDGLYAAIRLLGIVSRLSQPLSAIRAALPATLSTPELRFDCPETRKFGVIAEV
                     ASRLEKTGATVCAIDGVRVSTGEGWWLLRASNTQALLVARVEGATQAALERLKAELCA
                     QLALSGIAAPDFSGARSD"
     CDS             659858..660181
                     /codon_start=1
                     /locus_tag="GLX_05650"
                     /product="hypothetical protein"
                     /protein_id="BAK82977.1"
                     /transl_table=11
                     /translation="MMRGTGQGNRHRAPDAVFLLYACSWGLIRPLPVRYAGHDPVQEP
                     CSIMAQPPFRSFLVPGQAVSHPDHPEWGDGLVQSAIGHRVTVMFPHAGKVVIDATVVH
                     LTELS"
     CDS             660192..661211
                     /codon_start=1
                     /locus_tag="GLX_05660"
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="BAK82978.1"
                     /transl_table=11
                     /translation="MDHTPLPDSYGRLLTYLRVSVTDRCDMRCIYCMAEDMTFLPKAE
                     ILSLTELERLCTSFIRHGVRRLRVTGGEPLVRRDVMSFFREMGGWLGQADGQPGLDEL
                     TLTTNASRLAEFADDLHACGVRRVNVSLDSLEPTRFARITRRGNLARTLDGIRAARAA
                     GLAVRINTVAMAGVNADEFDGLIAWCGEIGADLCLIETMPMGETGEDRTDHYLPLSGV
                     RRRLEQRWTLEPLAYRTGGPARYARIAQTGRRIGFITPMTHNFCESCNRVRLSCTGRL
                     YTCLGHEGSTDLRGPLRAGADDGEMMEHVRAAILRKPRGHDFLIGRSADDPARVTRHM
                     SVTGG"
     CDS             complement(661226..662089)
                     /codon_start=1
                     /locus_tag="GLX_05670"
                     /product="methyltransferase"
                     /protein_id="BAK82979.1"
                     /transl_table=11
                     /translation="MTTEVPQIFDRHAVRVHRDRAATTMATVRPILAEAATRLLDRLD
                     DVTRSFGTALDIGGRGVVAPALRARGIATVAADLSPRLCARDDGPAICMDGEWLPFAA
                     HSFDLVVACLSLHGVNDLPGLLAQVRRILVPDGLFLACMPVLPTLGGLRHALLEAETA
                     RRGGVSPRVSPFPGLRECAGLLQRAGFALPVADADVIHLSYRTPMGLLTDLRHAGETN
                     TLRQRARGLTHPALLADALARLPLEADDSLTQDLHVAMMTGWSPAPTQPQPLRPGQFS
                     ISLEQALRGKP"
     CDS             662145..662912
                     /codon_start=1
                     /locus_tag="GLX_05680"
                     /product="competence protein F"
                     /protein_id="BAK82980.1"
                     /transl_table=11
                     /translation="MPSILSALPWRRATTGLLDLLFPPRCPGCGEDVAQAGHLCGACV
                     SRMHLITDPFCRRCALPFTSRAAAGPDRTCASCTENPPPWHEGRAAMVYDDMPRSLIL
                     PLKYADATENAGLLGRYMAWAAKDLIRPDSLLMPVPLHRLRLFGRRYNQALLLARALG
                     RQARVAVMADGLERTRATRPLEGLGRPARHDLMRGVIGVRAHRRAAIQGRHVIVVDDV
                     MTTGATLGACAHALLGAGAARVDVLAAARACGQYEQQ"
     CDS             662967..663230
                     /codon_start=1
                     /locus_tag="GLX_05690"
                     /product="glutaredoxin"
                     /protein_id="BAK82981.1"
                     /transl_table=11
                     /translation="MPAIDIYTQPGCPYCIRAVRLLAQKGVPFNEINAPHGTPERADS
                     IRRSGGRTTVPQIFIDGTPVGGCDDLMALERTGRLDGLLGAAG"
     CDS             663259..663720
                     /codon_start=1
                     /locus_tag="GLX_05700"
                     /product="hypothetical protein"
                     /protein_id="BAK82982.1"
                     /transl_table=11
                     /translation="MIRYQLRCGAGHEFEGWFPGSSAFERQAANGLLCCPQCGTHTVA
                     RALMAPAVRTRPAAPAQAAETLPPIATPPGHAPEALPDAMIALLQKMRQTVEEHCEDV
                     GDRFAHEALEMHRGTRESRGIYGSMTVQEQAELDEEGVEVHAIPWVRRADS"
     CDS             663786..664307
                     /codon_start=1
                     /locus_tag="GLX_05710"
                     /product="hypothetical protein"
                     /protein_id="BAK82983.1"
                     /transl_table=11
                     /translation="MHDSNKDNHPGQTGTRAARWLACSTGAVLCAMGMMLAPIAIPAT
                     SHAQTAEPDIIGRWMTKDHDGVFEISHCGQEVCGHLVGLRYETKMPRDKHGEAECNLP
                     MLNGFKPDTDTPGHWNGRVTDPDTGHVYHAKLWVSQSGDLKLRGFVAVPLFGETETWS
                     RYTGSIGPACKLP"
     CDS             664354..665583
                     /codon_start=1
                     /locus_tag="GLX_05720"
                     /product="3-carboxymuconate cyclase"
                     /protein_id="BAK82984.1"
                     /transl_table=11
                     /translation="MSSTISRRAFAATLAASGVPVLSRRAVAQGASKPRTICYIGGYT
                     QHGPPGGAGNGQGISVFEMNPDTSSLSPLMTYVDIASPSFMTMSADFKHLYALSEISD
                     FNANGEGCVTAFSVNRSSGELTKLNVVRSGGAVPAHLSVHASGKYVLVANYMGGTVGV
                     LPIHADGGLGDPTDVVHNTGPRMPDRAADNPPGNFAISDHSSAHVHMVASDPSGRYVL
                     ACDAGLDRVYVWTLDLHTGRLVPAKTPFISMTPGSAPRHFSFNEKGTMIYILGEQDSK
                     VVAASFNPQTGEIVPQQTVSTVTPHFRGSTLAAGILLSPNGKYLYVSNRLGDSLASFH
                     VNDDGTLNLVEEIWMHADYGRAMMFDPSGNFLFCANQRSDSVTSFKVNAQTGVLDFTW
                     NFTPVGSPTTFAFMNTI"
     CDS             complement(665608..666375)
                     /codon_start=1
                     /locus_tag="GLX_05730"
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="BAK82985.1"
                     /transl_table=11
                     /translation="MKGGAPMQNHDSPVVSADSVAPEEIAHFSSLAARWWDTAGPMRP
                     LHAMNDLRTGWSMRHLPAPVGADGTRRTLLDIGCGAGLASEAFARAGYDVTGLDASQA
                     AITAGRLHLRQHPLLASAGPLAYRCASAETLVAEGARFDAISALEVIEHVTDPAAFLR
                     MLAELLRPGGVMVVSTMNRTWRSMAMAKIGAEYVLRLLPVGTHDWRKFITPAELGQHA
                     AQAGLRVTDIAGMVPTLGGWRESRDLAVNYIAALVRD"
     CDS             666518..667771
                     /codon_start=1
                     /locus_tag="GLX_05740"
                     /product="aspartate kinase"
                     /protein_id="BAK82986.1"
                     /transl_table=11
                     /translation="MSPTVPRIVMKFGGTSVADLDRIRAVAEKVRKQVEAGCEVAVVV
                     SAMSGVTNRLVGYCRDLSPTHDEREYDTVVATGEQVTSGLLAIALQKLGVNARSWLGW
                     QIPLRTDDAHGKARIVSIDGAGLVASMQAGEVPVVAGFQGIGPDGRITTLGRGGSDTS
                     AVALAAALKADRCDIYTDVDGIYTTDPRIVTKARKLDRITYEEMLELASVGAKVLQTR
                     SVELAMKERVRVQVLSSFADGPAPSEGHLPGSIVVDEDEIVEQEQVAGIAYSRDEAKI
                     SVRQLPDRPGIAAGVFGPLADANVNVDMIVQSTGDDGMTNMTFTVGKSDLARAISVLE
                     AHRDTTQYAELQTDDSVVKISVVGVGMRSHAGVASTMFRTLAERNINVQVISTSEIKV
                     SVLIASEYTELAVRALHTAYGLDAA"
     CDS             667783..668856
                     /codon_start=1
                     /locus_tag="GLX_05750"
                     /product="enoyl-[acyl-carrier-protein] reductase"
                     /protein_id="BAK82987.1"
                     /transl_table=11
                     /translation="MTDTLAATLADPARRAEARARLDHLCGRGTRFLGSEYALLGGAM
                     SWVSERNLVSAISNAGGFGVLACGAMEPARLAEEIAATQALTSRPFGVNLITMHPQLD
                     DLVRVCLDAGVTHIVLAGGIPSSPVIRAIKDGGAKAIGFAPALVLAKRLIRSGIDALV
                     IEGSEAGGHVGPVSLTVLAQEILPHVHDVPVFVAGGLGRGDAILSYLELGAAGAQLGT
                     RFAASSESIAHERFKKAFIRANARDAVTSVQLDERFPVIPVRGLNNAGTSSFLQHQAE
                     TLRRFQSGELTKEAAQLDIEHFWAGSLRRAVIDGDVEHGSVMAGQSVGMITDVQPVRE
                     IIGELVDQAIDALIRQEERARYG"
     CDS             668853..669956
                     /codon_start=1
                     /locus_tag="GLX_05760"
                     /product="hypothetical protein"
                     /protein_id="BAK82988.1"
                     /transl_table=11
                     /translation="MSDGKRVFRPKSAPDGTTPVPGASPIASVGDILRARREELGWKL
                     PDVAAWLRIRLPYLEALEAGRASELPGSAYAIGFLRTYAKALGLDGEPLAARFKVESR
                     GAFTRRAELSFPVPLPDRGLPTGVLLLCGIVILVGAYVGWYKFSSSESTGNDLPARLT
                     LPGTSTIPASPQVASMLPPTDDRPTPQPLPPQEREALTGMPATPASSPPADVPIPAPM
                     PASPTQPLEKMGEDRNVLTQQQATTQPATGAANTVTLNATATTWVQVRKSGGAILYNG
                     VLHPGETWQAPADQTDLIMTVGNAGGLTLSSGGVTTQPLGRNGEVRHNVPLSPASIAD
                     GSVMHAGTAAAPAATPPGGNNLSPPLPQHFDAE"
     CDS             670089..671249
                     /codon_start=1
                     /locus_tag="GLX_05770"
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="BAK82989.1"
                     /transl_table=11
                     /translation="MSSYRPYQHIERRKSRQIHVGKVPVGGDAPVSVQTMTNTLTTDA
                     EATIAQIRRAELAGVDIVRVSCPDEESTKALAEIVREVNVPVVADIHFHYKRAIEAAK
                     AGAACLRINPGNIGSAERVREVVNAAKDHNCSIRIGVNAGSLEKHLLEKYGEPNPDAL
                     VESALEHAKILEDHDFHEFKISVKASDVFMAVAAYQQLADVCDHPLHIGITEAGSKRA
                     GTVKSSIGLGNLLWAGVGDTMRVSLSAEPEEEVLVGWDILKSLGLRHRGVKIISCPSC
                     ARQGFNVIETVQTLEDRLAHIKTPMTLSIIGCVVNGPGEALMTDIGVTGGGSGRHMVY
                     SAGKQDHTMPAGDMIEHIVELVEKKVEQLQVADASNTPAEEMAREASMSTAD"
     CDS             671314..672588
                     /codon_start=1
                     /locus_tag="GLX_05780"
                     /product="histidyl-tRNA synthetase"
                     /protein_id="BAK82990.1"
                     /transl_table=11
                     /translation="MQEYRVVSSLQPVRGTHDLIGEERRRFNHVVETARRIVSLYGFD
                     EWSTPVFEDTRVFSRSLGDTSDVVSKEMYTFEDRGGESLTLRPEGTAAICRALVTNGL
                     TQSLPQKVFYAGPMFRYERPQKGRYRQFHQIGAELLGAAEPLADAEIIAMGRDVLAAL
                     GIGAEVVLELNTLGDTASRDAWRTALIAYFSDRRDELSADSQTRLERNPLRILDSKAQ
                     QDRTLVADAPTIDQFLTPEAQEFWDDLRRTLDVMGVPFRHNPRIVRGLDYYGHTAFEF
                     VTERLGAQGTVLAGGRYDGLVAEMGGPATPAIGWAGGIERLSMLLAESPEDPRPVAVI
                     PMGADAQAAALAVLQAIRAAGIRAETSYRGNMKRRMERANRMKATHAIVIGSDEIARG
                     VVQVKDLDSGQQAEVAMDGVADFLHAGSAIKA"
     CDS             672593..673654
                     /codon_start=1
                     /gene="prfA"
                     /locus_tag="GLX_05790"
                     /note="protein synonym:RF-1"
                     /product="translation peptide chain release factor 1"
                     /protein_id="BAK82991.1"
                     /transl_table=11
                     /translation="MVKFDDRLDRIVARCDELQALLAAGMSGADFSQASREYAELEPI
                     VTRVNALRAAEEAERDASQMLADPEMRELAQAELDELRTQIPTLRHDIRLAMLPRDEA
                     DERSAILEIRPAAGGDEAGLFASELFGAYQRYADLRGWRFEVLEYDQSELGGLREGIA
                     SITGRGVFARLKYESGVHRVQRVPATESQGRIHTSTVTVAVLPEAEEVDVEVNEGDLR
                     IDVYRASGAGGQHVNKTESAVRITHLPTNIVVAMQEEKSQHKNRAKAMKILRARLYER
                     NRAAAHESRAADRRAQVGTGDRSERIRTYNFPQGRVTDHRIGLTLYKIDRVMAGELDE
                     FVDALTQEEQAALLAADEG"
     CDS             complement(673667..674131)
                     /codon_start=1
                     /locus_tag="GLX_05800"
                     /product="hypothetical protein"
                     /protein_id="BAK82992.1"
                     /transl_table=11
                     /translation="MQILLPSPRLVRALLATALCTFLATPALAGSFEVEDGYGEGEVS
                     EVSRLYVDEQLVATFHLDHDHITQTAHIDTPVSRVNHSYALCGEITIRRPAGKIEIHQ
                     VSGEGVLHEPDGHHLVALGARNFTEFYLADPDDPNVVERHPGRSSLCAAPTS"
     CDS             674159..675025
                     /codon_start=1
                     /locus_tag="GLX_05810"
                     /product="modification methylase"
                     /protein_id="BAK82993.1"
                     /transl_table=11
                     /translation="MIKETMVPSPANLRILLSTATDQLRRAGIEAPQREARLLAAHAA
                     GTDLAGLLRIDALTGAAHATFSQILTRRLNHEPMAYITGQAGFWSLDLATSPATLIPR
                     ADSETLIEAVLHHLPDRTQALRVLDIGTGTGCLLLAILAEYPHATGIGTDINPHAARL
                     AADNAARNGLGARCATLCCNWAEAVHGPFDLVLSNPPYIPHTDLAGLMPDVVAHEPAR
                     ALDGGPDGLVAYRALAAALPTLLAPGGTSVLELGIGQDHSVPALMRASGLEVVETRPD
                     LGGIGRALVVKK"
     CDS             675291..675848
                     /codon_start=1
                     /locus_tag="GLX_05820"
                     /product="hypothetical protein"
                     /protein_id="BAK82994.1"
                     /transl_table=11
                     /translation="MNMKRMRGRHNRSGGSSGGSVRHNNGQIPLNRNHVFDSNGPDLR
                     VRGTAQQLFEKYLQLGRDASSTGDRVMAEAYFQHAEHYFRILNAMTQAAQQSQLERQE
                     RMNGRQQRPLHDNRQPVDSGAEDTGEQPALSATAAMPEEVAPQPSVAAVPEPAPAPRA
                     PRTARAPRRAKPPVEKKEELESSSS"
     CDS             complement(675913..676161)
                     /codon_start=1
                     /locus_tag="GLX_05830"
                     /product="hypothetical protein"
                     /protein_id="BAK82995.1"
                     /transl_table=11
                     /translation="MTFFQHRSWRMTNHDSKRQIVLKILSDGRARSVKEIGDLFPELG
                     TYHARLALQALRNQGLVTVEDAPEADDGRKRKVWRLVG"
     CDS             complement(676209..677480)
                     /codon_start=1
                     /locus_tag="GLX_05840"
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="BAK82996.1"
                     /transl_table=11
                     /translation="MRGPQWLERGMHHVWLPYAQMQTAPSPLPVVATQGRTITLADGS
                     ELLDGIASWWTACHGYNHPHIRQAVQAQLACMPHVMFGGLVNEPALTLATRLAALLPG
                     DLERVFFTDSGSVAVEVAMKMAIQYWLNRGERGRTRLLAFRGGYHGDTMATMAVCDPD
                     EGMHSLYAGALPEHFMAELPVDAASTQALDNLLAQSAGQIAAIIVEPLVQGAGGMLFH
                     SPDVLLTLRQLADRHGVLLILDEIFTGFGRTGTLFACEQAGIVPDIITLSKALTGGTM
                     ALAATVARRHVFEAFLSDNPLHALMHGPTFMANAMACACANASLDLFACEPRLTQVAQ
                     IEAQMRSELEACRHLPGVVDVRVMGAIGVVELARIADMNALKAALVAQGVWVRPFRTI
                     IYLTPAFTITPAELSRLTAAIHTVLAHQGQV"
     CDS             677553..678740
                     /codon_start=1
                     /locus_tag="GLX_05850"
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="BAK82997.1"
                     /transl_table=11
                     /translation="MAGFDPIFQTALDRMAARHTRRVLRPVRPVGAATVLRDGRRLIN
                     FSANDYLGLSHHPALRARAAQWLSEDGTGAGASRLVTGTTARHMAVEARLAAFKGAQA
                     ALLLASGWQANASVLAAVLRLAAEQGAPPLVFADRLNHASLHQGCMAAGMRQIRFHHN
                     DLNHLEHLLAHHADRPGMRVIVTESVFSMDGDQTDMARLSAIGRAYGAFTYVDEAHAT
                     GVLGPQGRGLCAGHDIDLVMGTFSKALGGFGAFVTGTQAMCDWLLNACSGFVFTTAPP
                     PAVLGAMDAALELLPTLDAERGQLARNAARIRGVIRNCGLSPEPSTTQIIPIMLGEAA
                     RALAFATALEARGILATAIRPPTVPPGGSRIRLALSAAHTDDMIDQLATAIPAALREI
                     EGT"
     CDS             678741..679400
                     /codon_start=1
                     /locus_tag="GLX_05860"
                     /product="hypothetical protein"
                     /protein_id="BAK82998.1"
                     /transl_table=11
                     /translation="MTAALPIVFVHGWAFDPTVWDQTRTALGTARTQCLDFGFFSSHP
                     AMALPTQPYIGVGHSLGALWLLRHHGPLCQGLLLINGFSRFSAAPDFAHGIPPRVIGR
                     MRTGLQHAPAGMLRTFRMRAGIDAPVPSHIACDRLEQGLGILIDMDCRPDLRHATCPV
                     QVMAGMHDTIAPPDLTRACFPPDGPIATRWLDGRHLLPLTHAVQCAHAIADLTRRITP
                     P"
     CDS             679397..680806
                     /codon_start=1
                     /locus_tag="GLX_05870"
                     /product="biotin synthesis protein"
                     /protein_id="BAK82999.1"
                     /transl_table=11
                     /translation="MTPTARIAARFDAADGYEQAARIQRIAAMELARRISCQHGREAP
                     VRILEIGCGTGLLTRELRRLFPHAHITATDIAPRMLERLAAQMPGDKRLSLHVMDGET
                     PDLPGPFDLICSSLAMQWFHNRRAALLSLATLLLPGGQMALATLAAGSFARWRAAYAH
                     AGVACPMPHYPTPDTLQGEWPTMGAGLWQVAEIIDTPATPLAFVRELRAIGATHTTHP
                     PATAGQMRRVLAAAQAHHPFVVSYHVAYGQFNRAAWPGVFVTGTDTDVGKTVASAALV
                     QAWNAAYWKPLQSGTDDAPADSTSVRQLAELDASRLYPPAASFGASLSPEDAAAHAHT
                     HIDPAAIALPPHTAARGPLVVEGAGGVFVPIAENYLMIDLMVRLGLPVVLVARSALGT
                     INHTLLSLAALRARGLHVAGIILNGQPEPLARSAIERHGQVRILAEFPRLSPMGPQAV
                     AQLASRLPTWAQVMDGSVQ"
     CDS             complement(680800..681471)
                     /codon_start=1
                     /locus_tag="GLX_05880"
                     /product="transcriptional regulator"
                     /protein_id="BAK83000.1"
                     /transl_table=11
                     /translation="MLTKKQHELLLFIDGHLRRTGFSPSFDEMKDALGLRSKSGIHRL
                     ISALEERGFLHRRHHRARALEILRLPDIETMPSPVEQPDPAPGMMPVAAFQVPVVEVP
                     FVGRVAAGNPIEAISTDTTRIAVPADMLGKASHYALEVTGDSMQDAGILDGDMVIIRE
                     GAHASDGQIVVALIDGDEVTLKRIRHEGGEIALIPANIRYETRLLPAARVSVQGTLAG
                     LIRRY"
     CDS             complement(681595..682803)
                     /codon_start=1
                     /locus_tag="GLX_05890"
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="BAK83001.1"
                     /transl_table=11
                     /translation="MLSVSEARRRILAGVLPLPAEVVALSEACGRVSAAPVVALVSNP
                     PADVSSMDGYAVRAADLSAGGVSLTCIGHAPAGHPFAGAVGAGECVRIFTGSLMPAGT
                     DAVLIQENAQADGTHVATTHTLSPGTYVRHRGQDFSAGEVVIPAGRRLAAQDVGVAAA
                     ANHAWLTVTRRPRVAIAATGDELLLPGSPVGTGQIANSNTPMLAALLRAAGAEPVMLP
                     ALRDDMADLAALERMVDGVDMLVTAGGASVGSHDLVRRCLEQVGMTTDFWKIAMRPGK
                     PLMYGHLGRLPFIGLPGNPVAAFVCSIVFVLPALRRMAGMAQPVKPPVRAVLGADVPA
                     NDQRMDHLRATLTHNEQGQLVATPFSMQDSAMLHILAQSQALVLRAPHAPAAQRGDVC
                     EIIRIDPAMA"
     CDS             682963..683130
                     /codon_start=1
                     /locus_tag="GLX_05900"
                     /product="LSU ribosomal protein L33P"
                     /protein_id="BAK83002.1"
                     /transl_table=11
                     /translation="MAKSNTIQIKLVSTADTGYFYVTKKNARAQTGKMELRKYDPVAR
                     KHVAFREAKIK"
     CDS             complement(683209..683538)
                     /codon_start=1
                     /locus_tag="GLX_05910"
                     /product="septum formation inhibitor"
                     /protein_id="BAK83003.1"
                     /transl_table=11
                     /translation="MQLGKIIRRVLHATIPPALFIGLTAYFGWNVMRGEHGLHSYATQ
                     LHLLAEARSAQKDATAEQEVWLRRVRGLKEGALDTDLLDERARSMQNLARQDEIVVPY
                     GDHDHLY"
     CDS             complement(683597..684877)
                     /codon_start=1
                     /locus_tag="GLX_05920"
                     /product="phosphopyruvate hydratase"
                     /protein_id="BAK83004.1"
                     /transl_table=11
                     /translation="MSAIIDIIAREILDSRGNPTIEVDVELASGAKGRAAVPSGASTG
                     AHEAVELRDGDPKRFGGKGVLKAAGHVEHEILEALQGVESTDQVAIDEAMIDLDGTPN
                     KSRLGANAILGVSLAVAKASAEELQVPLYRYVGGVYARTLPVPMMNIINGGQHADNPI
                     DIQEFMIQPVGAPTVTDAIRMGSEIFAQLKKSLSGAGYNTNVGDEGGFAPALKSADEA
                     LGFMMRAIEAAGYRPGEDVTFALDCAATEFYRDGRYVLAGEDKSLDAAGMIAYLADLS
                     ARYPIISIEDGLAEDDWEGWAELTENLGHKLQLVGDDLFVTNPDRLRRGIKDGVANSL
                     LVKVNQIGTLSETLEAVQMAQHAGYTAVMSHRSGETEDSTIADLAVATNCGQIKTGSL
                     SRSDRTAKYNQLIRIENELATAARYAGRTILKNG"
     CDS             684956..685501
                     /codon_start=1
                     /locus_tag="GLX_05930"
                     /product="hypothetical protein"
                     /protein_id="BAK83005.1"
                     /transl_table=11
                     /translation="MQRIMPEQAIHNDQIQENPAMKRLPLLAIVTAIASLLPLIGCTC
                     AILFLTPDHTPRLLTAAVGYGAVMLSFLGAVHWGLALEQPDIVPVGGTQRLTNMRLAL
                     GGVPAIIGWAGLCAATVRELAGLLILIAGFVIVGIGQRMAWQRGAMPRGYLTVQWFVI
                     CLAELCFLAILAACMGMRPAQ"
     CDS             complement(685722..688043)
                     /codon_start=1
                     /locus_tag="GLX_05940"
                     /product="aldehyde dehydrogenase large subunit"
                     /protein_id="BAK83006.1"
                     /transl_table=11
                     /translation="MGRLDRFRLGRDGRREQPSLSRRGFLVTSLGAGVMFGFARQASA
                     NQIFPLDNAGPGDGAFEPTIWCAIAPDGIITVNIIRAEMGQHIGTALARIIADEMEAD
                     WSKVRINYVDTDPKWGLMVTGGSWSVWMTWDVFRQAGAATRTALVEEAARLLGTTPDK
                     CTVANSIVSAGGKQISFGDIVTKGHPSHSFTPEEMAKLPLKPASERRLIGNAELKALD
                     IPAKTNGTAIYGIDAKVEGMVYARPKMPPTRYGSKVRSVDDTDAKKIKGYVRYLLIDD
                     PSEVVQGWVVVLAESYTAAIRATDALKVEWTPGETIHTSERDIQDRGRQLISNKEGGV
                     YIFNDDGVDKAFSGAHLVMDQEYTCASVLHYQLEPTNALAFQKDGVYEIHAGNQWQSL
                     ILPTLAKSLQVPESKVILRSYLLGGGFGRRLNGDYMIPAALASKALGGKPVKLILTRS
                     DDMQFDSFRSPSVQRVRMAFDASDKITSMDYQAAAGWPTGVMAEAFMEKGVDGKPYDQ
                     FAIAGGDHWYEVGAFRVRALRNDLAEKTFRPGWLRSVSPGWTSWGIECFLDEVAHRQK
                     KDPAQFRLELLTAQGRNKGQAPDSVGGALRQAAVVRRLMEKTNWGKTTLPKDSAFGLA
                     TTAGQERGMPTWIGCVAQVHVDRSTGVVTCQKLTIVVDAGTVVDPDGAKAQTEGAALW
                     GLSMVLFENTEIVNGMPVDRNLNTYTPLRLADTPEMDIEFLPSTEKPMGLGEPGTTVV
                     GPAIGNAIFNAVGVRLRHMPVRPADVLRALQNT"
     CDS             complement(688036..688509)
                     /codon_start=1
                     /locus_tag="GLX_05950"
                     /product="aldehyde dehydrogenase small subunit"
                     /protein_id="BAK83007.1"
                     /transl_table=11
                     /translation="MTTFRLNGREVTVDVPGDTPLLWVIRDEVGLTGTKFGCGIGMCG
                     ACTIHIGGRATRSCVTPVSAAEGADITTIEGIDPEGNHPVQQVWREIQVPQCGYCQSG
                     QIMQAISLLKDYPSPTDEEIDAVMAGSLCRCMTYVRIREAIKKAAATARGDASNG"
     CDS             complement(688531..689859)
                     /codon_start=1
                     /locus_tag="GLX_05960"
                     /product="aldehyde dehydrogenase cytochrome c subunit"
                     /protein_id="BAK83008.1"
                     /transl_table=11
                     /translation="MIKRIAAAIVGIGVAGGVGFLAYAWYPAIAPVAPPPPSSFTAAQ
                     IEHGRVLAAGGYCAECHTRTDGVRGVELAGDYKMDTPFGAIFSSNITPDPETGIGRWS
                     EAAFHRAMRKGISRDGTQLFPAFPFDHFTHMTDQDIADVYAFLMTREPVHSVKRDNTV
                     GFPFNIRLEQAGWKLLFLHEGPLKNDPAHDAQWNRGAYLAEGLSHCSACHTPRNLMGA
                     EKSSAPYDGAPVDNWIAPPLNEHNPTPVVWTEDEYFKYLRFGSAPLHGSAAGPMSPVV
                     HGGLSEMPESDVHAIAHYLADIDHASTRVSQDPKALKWAMQASMKDLVGPQVNPNAKL
                     YAGACAACHANSGPQPVEGRPDLALNNALWLDEPTNLFQVILRGIGTTEGISTVSMPS
                     FYHSFSDADLARLATYLRATRTTLPPWTDLEKKAAEVRKTLPVSPVASSH"
     CDS             complement(690241..692625)
                     /codon_start=1
                     /locus_tag="GLX_05970"
                     /product="glucose dehydrogenase"
                     /protein_id="BAK83009.1"
                     /transl_table=11
                     /translation="MNTPLRSAPLLAAAIAVCALTGLYLLGGGLWLCAIGGSFYYVVA
                     GVVLLVTAFLLFRRQAAALTVYAVLLLGTMAWAVGEAGLDFWALAPRGDILVPIGIVL
                     LLPWVTRNLQPAGLGARLPLLGAIGAAVVVIGAALMGDPQDIAGNLPPVAQNAPEPGD
                     AHQMPDEDWQAYGRTQFGDRFSPLKQINTGNVSKLKVAWTFRTGDMRGPNDPGEITDE
                     VTPIKVRDTLYLCTPHQILFALDAKTGKERWKFDPKLQYNRTFQHLTCRGVSYHEDKV
                     DAQADTAAAPVECARRIFLPTNDGQLFALDAESGARCASFGNNGVVDLRDGMPVKTLG
                     FYEPTSPPVVTDTTVIVSGAVTDNYSTHEPSGVTRGFDVHTGALQWAFDPGNPDPNEM
                     PSEHHTFVPNSPNSWITSSYDAKLDLVYIPMGVQTPDIWGGNRGADAERYASSIVALN
                     ATTGKLVWSYQTVHHDLWDMDIPAQPSLVDIRTASGEIVPTLYAPAKTGNIFVIDRRN
                     GQLVVPAPEQPVPQGAAPGDHLSPTQPFSQLTFRPSKKLTDADMWGGTMFDQLVCRIM
                     FHRLRYDGTFTPPSLQGTLVFPGNLGMFEWGGLAVDPVRQIAIANPIAIPFVSTLIPR
                     GPNNPASPDKSLPSGSESGVQPQFGVPYGVDLHPFLSPFGLPCKQPAWGYMSGIDLRT
                     NKIVWKHRNGTIRDSAPLPLPIKMGVPSLGGPLTTAGGVAFLTSTLDYYIRAYDVTTG
                     RVLWQDRLPAGGQSTPMTYAVDGKQYVVTADGGHGSFGTKLGDYIVAYTLADQN"
     CDS             complement(692766..694253)
                     /codon_start=1
                     /locus_tag="GLX_05980"
                     /product="NADPH-dependent L-sorbose reductase"
                     /protein_id="BAK83010.1"
                     /transl_table=11
                     /translation="MVMTKLNAASLSHLPPTIMAPAYDRSRVTPGIAHISVGNFHRAH
                     QAVYIDRVLGRPAQSGWGILGIGLMENPHEAAKAQDMAAQDCLYSLTECAPDAPNVVR
                     VIGSITEYMYAPADRAATIARLADPAIRIVSMTVTEGGYYVDENGTFPIDHPVIAEDL
                     ARDVPHTVFGLLTEALRLRRESGAGPFTILSCDNLPHNGHVARIAFLGWARAKDAGLA
                     QWIEENVTFPCTMVDRITPAVLSEDIRRLDGESGLDDLIPVFCEDFIQWVVEDRFCAG
                     RPELEAVGVQFTDNVQPYEEVKLHMLNASHSLLGLSGVLSGYRVVSEIMEDMNEVALV
                     EQYLGHDAEPLLKAPPGMALSEYGRRLLHRFRNRAISDQLLRIASDSTSKLAMFVRST
                     AMGVLAHHRPVTRIAFVVACYAEYLRGHDDRGQVYAIVEPHLTDDDRTLAASPRLEDA
                     LGMSAFAGWELADSPAFVQAYVALRQSIRAHGTRATLATVIAEGK"
     CDS             694486..695604
                     /codon_start=1
                     /locus_tag="GLX_05990"
                     /product="glycosyltransferase"
                     /protein_id="BAK83011.1"
                     /transl_table=11
                     /translation="MRILYLINSLNGGGAERPLPAVIGLMRACGHSVRVVALARKAGN
                     AIAWLEAAGIDYHIVDDRDPERFASLWQTMAYVRANRPDLLWTSLTRATLFGQLIGRA
                     LGIPVASWQHSAFLKPANRFLLRRTRNMSAFWVADSDFVARVTQRQLAVPPERICTWP
                     LFEANAAAPVATPWQGKKDAVFHIGSLGRLEPEKNMELPIRAMAVIRERMPEARIRLS
                     LCGSGSQMAHLKALAAGQGGADINFEGFQPDPLAFCRRLHVYVQPSHFEGLCIAVHEA
                     MQAGLPVIATPVGAIPDIIRDGQSGFLLAPPTPEALAERILHLYTNPGLCARTGQQAR
                     AEILERYAKDRIETMARTVIHRAERLVQAWHHSPARGG"
     CDS             695654..697171
                     /codon_start=1
                     /locus_tag="GLX_06000"
                     /product="DNA helicase"
                     /protein_id="BAK83012.1"
                     /transl_table=11
                     /translation="MNTIQNPPSAESRQKDSLLGVSQRLPPANVQAEQALLGALLTNN
                     RAYDRVSDFLTGAHFANEVNGRIYDAISRRIEGGQLADPVTLRAEFENTGVLDSVGGT
                     AYLAKLLTSMVGIINAADYGRVIHDAWIRRQLIDIGQDVVNNAFGARPELDGPNQIAA
                     SEEALFRLATEKGQDGGFMSFDRALADALEIAQQAFSRSGDVVGLTTGLRDLDKKTGG
                     LHPSDLLILAGRPAMGKTALATKIAFSAARAIMEEARDAPPDAKPKGSVAVFSLEMSA
                     EQLATRILSEQASVSGEKIRRGDLGQKEFDRFVQVSRELAQLPLHIDDTPAISLSAMR
                     TRCRRLARTKGLSLVVVDYLQLMRPSVGSRAENRVLEISMITQGLKALAKELSVPVIA
                     LSQLSRQVESREDKRPMLSDLRESGSIEQDADAVMFVYRDQYYLQQRQPKETSYDSQD
                     KYQTAMEEWQRKMDLAHNRAELILEKQRHGPTGTVHLFFEGEFTRFADLDMVHDV"
     CDS             697485..698996
                     /codon_start=1
                     /locus_tag="GLX_06010"
                     /product="magnesium chelatase-related protein"
                     /protein_id="BAK83013.1"
                     /transl_table=11
                     /translation="MTDTALASICGFAFSGIEAIPVKVEVQLSVGLPSFLIVGLPDKA
                     INESRERVRAALSAMGLALPAKRIVVNMVPANLMKEGSHFDLPIALALLVVMGLLSGD
                     MAQRYAALGELSLDGGVNPVCGVLPAAMTACALSLGLICPAAQGVEARWASDRMDILA
                     IRSLPELLNHFRGQQVIDPVELPTRLDTDLTALPDLADIRGMETGRRALEIAAAGRHS
                     LLMVGPPGAGKSMLAARLPGILPDLTTAEMLEISRIHSIGGLLKDGQPVSRPPFRDPH
                     HSASPAALSGGGARARPGEVSLAHRGVLFLDELPEFARSALEILRQPMETGSISIARA
                     AAHVTYPARFQLVAAMNPCKCGYLGDAAQECRKAPRCGEDYQARLSGPLLDRLDMAVH
                     VEPMPLARIAEPQGGESSAIVAARVMEAVLRQRARQGEARNAEAPIDDFRITAPARDF
                     AVQAAEKIPLSARGFVRLLRVSRTIADLAASADVERAHIAEALIYRIRRPGRK"
     tRNA            699066..699140
                     /locus_tag="GLX_t0070"
                     /product="tRNA-Val"
     CDS             complement(699318..699785)
                     /codon_start=1
                     /locus_tag="GLX_06020"
                     /product="hypothetical protein"
                     /protein_id="BAK83014.1"
                     /transl_table=11
                     /translation="MGVGHVDHALNAACVQASYGVSGRGPELLMIVQDTNFFCDMPED
                     MKYLRDRNPPQNFLEQNLIFVLPERLRKFRRNLFHVRRTDSDATVYAPLFRVRCISAR
                     DPVPEGYDGPFDVFPFYTNPTRKRRRTLDYYVLFLFQDKLSYVKCRDALGATS"
     CDS             complement(699816..701705)
                     /codon_start=1
                     /locus_tag="GLX_06030"
                     /product="hypothetical protein"
                     /protein_id="BAK83015.1"
                     /transl_table=11
                     /translation="MLGIRTFDPRSGGNTAYKALTHPLAAQKLAGLAHQLASVGPVAL
                     YDPHGMADTLLALLPCPLTVAGIYTHDTLRVGHDCAGHVLQPVADLDQSTVRAVWALD
                     FSQIAMGSRLSTLLPRTATLYTLEPVRLPAHMLSVGHAYLDRLNFATNLAFFRESADF
                     STRLVTANYWARYGAQAVRLWLRLFDANGQVLHTWEQDMPGEGQAIIIDSAEIRQCFD
                     LPHFTGQLFIHAQGVAGHDVVKYALETRGKGDNTSLSVTHDANAWPANRYANLPAPAG
                     GEDVVLWVQNSHALPIPAGSMHLNRMGHDTLVPIERDLAPYQTLAVHVRDMLPGLTWP
                     EQIEFRAGGHVVRPRYEVTRSGRTRIAHLNVQRADLRPDPHIEKLDPRFFGRGYLLPF
                     PVPDPARYRTLLLPSPMAEGLSTLPVRVDSFDTEGRGTGSHFVGCLARDHATVMDVGE
                     LAGQGGHAELLYDFRDGGSADGWLHALIRYEDRKSGHVAETSFGSHIFNTVMTYRGEP
                     QSYAGSPPGLSTRLFLTAACTEPYSFCTLIYPVSNRWHRVSDTSLHLHGANGEVIARE
                     KIAIPMSGSRLIQPERIFGQAALQRAGVGGYVIIRDTTCRLFGYHGRHDEGEGRFSLD
                     HMFGF"
     CDS             complement(701750..702760)
                     /codon_start=1
                     /locus_tag="GLX_06040"
                     /product="hypothetical protein"
                     /protein_id="BAK83016.1"
                     /transl_table=11
                     /translation="MAGQKRQGIDAPVPIPPHGGMTAPPCPASIIAADLAGMRSQTFG
                     LARRVGLEPHLYALVPRGLWRHVPAAWWPSPLRAIQPLGLDSLAHPVISIGGSGGAVG
                     AALRRKGATVIQVQNPRLPPGRFDLVIANRHDRIAGPNVILTRTALHGVTPELLAQAQ
                     VEWGPRLAHLPRPLVAVLVGGGNGRFRLGRPEGAALAVSLATMMRRDQVGIALTPSRR
                     TAPEVCRELHDALAGPDSWIWDQSGPNPYLGLLACADAIVVTMDSVSMVSEAVATAAP
                     VMVAALPGRSRRIGLFLRELEQVGRIRPFAGRLETWPVTPLDDTLMAAEAVRAHLGLV
                     AP"
     CDS             702782..703912
                     /codon_start=1
                     /locus_tag="GLX_06050"
                     /product="RNA helicase"
                     /protein_id="BAK83017.1"
                     /transl_table=11
                     /translation="MSETEPTFSAMGLDGHVVAALARMGLQTPSAIQSAVIPPVMAGR
                     DVEARAGTGSGKTVAFAAPIISTLAAQAADNSRVRCLVLSPTRELAGQIAGVLRGLAR
                     GTGLRVLQATGGTARVAQARTLADGVAIVVGTPGRVSDLVHGGELGVSAIGSFVLDEA
                     DRMLDPGFAEEMLTLAAVLPPKHQTLLFSATIPPAMAELATRLLHRPERISMQVEDAP
                     TPRIAQYAIFVPMRHKAEATLACLRQYGMQRVMVFVRTRQEADSVARAISALTPAIAI
                     HGEHSQAKRERMLRDFRQGRVGVLVATDVMARGIDIDDVALVINHDIPPLPESYVHRI
                     GRTARAGRRGMAVALCAPEERLALKEIERLTGQRIRIASLPE"
     CDS             704081..705118
                     /codon_start=1
                     /locus_tag="GLX_06060"
                     /product="hypothetical protein"
                     /protein_id="BAK83018.1"
                     /transl_table=11
                     /translation="MTEGPDNTPLPVRVARPTTFLDRLPPPPCSLPRWDIGITPPDLS
                     PWLDGNCGIPGVMHYEGRRPGPHVVCVSLIHGNEFSGAIVLDHLLRARIRPRAGRLSF
                     VFANPAALTLFNPDDPVRARCVDEDMNRVWSPDMLESSQHSHELARARELLPVILTAD
                     RLLDLHSMLWPGDPLLLSGLSPAGRRMARRVRGVDICVADRGHRSGCRLIDHPRFTGD
                     TAAACLLEAGQHWQQATVTRTMQAVLSVIGPCCGLPEGNEGPLPCHNMVVTNVVTART
                     GQFRFVRPFHGGEILPLAGTVVAHDGGDEIRTPYARCMLVMPNLRPARGHTAVRFARA
                     DAGTGGLIPAS"
     CDS             complement(705267..706574)
                     /codon_start=1
                     /locus_tag="GLX_06070"
                     /product="serine hydroxymethyl transferase"
                     /protein_id="BAK83019.1"
                     /transl_table=11
                     /translation="MTVPDPISQTDLKQFFRAPLAEVDPDVAAIINAEKVRQCDGIEL
                     IASENMVSAAVMAAQGSVLTNKYAEGYPGRRYYGGCVEVDKVETLAIERVKQMFGAGF
                     ANVQPHSGANANQAAFMAMVKPGDTVMGMSLAAGGHLTHGAAPNYSGKWFNAVQYGVR
                     AQDGLLDYEEMERLARAEKPKLIVAGGSAYPRIIDFKRFRAIADEVGAYLMVDMAHFA
                     GLVAAGLYPSPVPHAHVVTSTTHKTLRGPRGGLILTNDADLAKKINSAVFPGLQGGPL
                     MHVIVAKAVAFGEALRPDFRTYQEAVANNARVLAETLVNSGFDIVTGGTDCHLLLVDL
                     RPKGVTGRAAERALERAGITANKNAIPFDPEKPAVTSGIRLGSPAATARGFGEAEFRE
                     VGLMIDEVLTALAKSEGQEGCTKTEQAVHARVKALCARFPIYA"
     CDS             706745..708238
                     /codon_start=1
                     /locus_tag="GLX_06080"
                     /product="amino acid transporter"
                     /protein_id="BAK83020.1"
                     /transl_table=11
                     /translation="MNVLTRHGLAHALLRRLPANAPADNAGLKRVLGLGSLIALGVGA
                     TIGAGLFSLTGIAAGSNAGPAVIISFALAAVACAFAGLCYGELAGMIPTAGSAYVYAY
                     AALGELAGWVIGWDLVLEYTVGASAVSVSWARYMRSLLDEWGIHLAPRLMASPFEVVG
                     MIDGRPVHGIANLPAVFIIVAISMLLMRGIAGSARMNMLVVIIKLTVIAAVIGFGLPY
                     IKVANYTPFIPPNTGTFGQYGLSGILRAAGTVFFAYLGFDAISTVAQETRNPGRNMPI
                     GLMASLAICTAVYITFSFVLTGLVNYHAMIGDAAPVATAIDQTPFGWLKAAVKLGIIC
                     GFLSVILVMLLGQSRIFFAMARDGLLPPLFCRTHAGWGTPVGCHLFFMVVTGVLAAFL
                     PIEQLAHMTSIGTLLAFVIVCVGVIVLRQREPERPRVFRVPGGAFIPLAGIASCLVMM
                     VSLDGLTWLRLVGWLAIGMVIYAKYGMHHSRLATRQGQDMPAMRPTP"
     CDS             708309..709316
                     /codon_start=1
                     /locus_tag="GLX_06090"
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="BAK83021.1"
                     /transl_table=11
                     /translation="MELDWMSIGQFPHVRLRRNRRDRFTRRLVCENTLSTDNLIWPIF
                     VTEGTGSVTDVASMPGVQRVSLDRLAAHVEPAARLDIPAVALFPITPPGLRDEAGTEA
                     TNPDNLMCRAARLLKKEFPEIGLIGDVALDPYTSHGHDGLIEGDYVVNDPSVAILSTQ
                     AVNQAAAGIDIIAPSDMMDGRIGAIRTALDAGGLVNTRIMSYAAKYASAFYGPFRDAL
                     GSGGLLKGDKKTYQMDPANSDEALREVGQDLLEGADMVMVKPGMPYLDVIQRVRQEFS
                     VPTFAYQVSGEYAMLMAAIQNGWLDRDRVILESLMSFRRAGANGVLTYFALDAARLLQ
                     A"
     CDS             709456..710244
                     /codon_start=1
                     /locus_tag="GLX_06100"
                     /product="arginyl-tRNA--protein arginylyl transferase"
                     /protein_id="BAK83022.1"
                     /transl_table=11
                     /translation="MTYTSPRHPQLFYTTAPLPCPYLPGRMERKVVTEIGGAEAVAFH
                     NRLSRAGFRRSHTIAYAPVCASCTACTPIRVPVERFTPSRTQTRIRRRNAGLHTTTVP
                     PHATPEQYALFSAYQSIRHVGGDMASMTFPDYRAMIEDTTVETFMIEFRNTEGRLACV
                     ALVDKLDDGLSAVYDFYDPEQQHNSLGTFAVLHLIEHARLLGLPYLYLGYWINESRKM
                     AYKARFRPAQIMTRGMWHDLDLTTYNNQQVHESAFLPNGMFRPA"
     CDS             complement(710520..712736)
                     /codon_start=1
                     /locus_tag="GLX_06110"
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="BAK83023.1"
                     /transl_table=11
                     /translation="MPVDTTAGHIEDTKLADALSERYLAYAMSTIMSRSLPDVRDGLK
                     PVHRRMVYAMQQLKLDPSAGFKKCARVVGDVIGKYHPHGDASVYEALVRLAQDFAVRY
                     PLVEGQGNFGSIDGDNAAAMRYTESRLTAVAKALLEGIDEDSVDFRPTYDGEEHEPVV
                     LPAAFPNLLANGAAGIAVGMATSIPPHNVGEICAAALALIRKPATTTAELLAHMPGPD
                     FPTGGSIVEDRDAIIRAYETGRGSFRIRSKWEVEQGRFGTWQIVVTEIPYQVQKSRLI
                     EQVADLMEQKKLPLLADIRDESTTDIRLVLEPKSRGIEPAVLMETLFRATQLESRFGL
                     NMNVLGADQVPGVRSLKDVLQAWLDHRHDVLLRRSANRLQAVDRRLEILDGFLAVYLN
                     LDEVIRIVREEDDAKAALIAAFDLTELQADSVLNMRLRSLRRLEEMEIRNEHAKLSAE
                     KQALHDLLENEGQRWKRIASEIRDIQKTFGSGALGARRSLLADAPVEIDVEAVLPVER
                     DPLTVILSQKGWIRTVRGHGQDLQALKFKEGDGPGRAVECYSNDRLCVFATDGRAFTL
                     RVADLPRGRGDGQPLRLAIDLSNDEDIIAMFPMDDGRRRLLASSTGRGMIVAESAMTA
                     EKRTGKQVLNLKEGESALICTSAEGDHVLVLGQNRRMLVFPLDQLPEMARGLGVILQK
                     YKDGGLKDAVVFAADAGLAWPDAARTRNFADLKEYVGKRAEMGKTAPAWATRKLRG"
     CDS             complement(712797..713588)
                     /codon_start=1
                     /locus_tag="GLX_06120"
                     /product="DNA repair protein"
                     /protein_id="BAK83024.1"
                     /transl_table=11
                     /translation="MEWEAPALVLSATPYGEGSAIVHVLTGEHGLYHGLARGGSASRG
                     RAIWQTGNLVRARWLARLPEQLGNITAETVHASAARILDYPLPLAMLASLCALADGCL
                     PEREPHPAIFQGLTSLLARISLDPQWAEAEAMPEIVRWELLLLSELGFGLDLGGCALG
                     GSRDDLRWVSPRTGRAVSDEKAGAWRDRLLPLPGFVLHPQQIGTPRDWYDALRLSGHF
                     LRRDAFGQRHCPVPEARERLADMIARKADISPAGAQAEATVEPPD"
     CDS             complement(713637..714542)
                     /codon_start=1
                     /gene="tsf"
                     /locus_tag="GLX_06130"
                     /note="protein synonym:EF-Ts"
                     /product="translation elongation factor Ts"
                     /protein_id="BAK83025.1"
                     /transl_table=11
                     /translation="MAEITAALVKELREKTGAGMMDCKKALKEAEGDIEGAIDWLRKK
                     GLSAAAKKSGRVTAEGLVGVAQTDLKAAMVEINAETDFVARNEHFQNFVSEVAHAALS
                     VGDDLEKLKVAVLKSGRTVADELTHLIATIGENMSIRRARVLSVPSGVVATYVHGAVS
                     PGLGKIGVLAAVEAPSASEALEDLGRRIGMHVAATRPAALDVDSVDPQALERERAVLV
                     EQAKASGKPDAIIEKMVDGRIRKFYEEVVLLEQVWVHDGESRVRKIVEKAGAKLTGFD
                     RFQLGEGIEKEENDFAAEVAKAAGQ"
     CDS             complement(714654..715439)
                     /codon_start=1
                     /gene="rpsB"
                     /locus_tag="GLX_06140"
                     /product="SSU ribosomal protein S2P"
                     /protein_id="BAK83026.1"
                     /transl_table=11
                     /translation="MAMPEFTMRQLLEAGVHFGHHTRRWNPRMAPYLFGVRNQVHIID
                     LQQTVPMLDRALKAIRDTVAGGGRVLFVGTKRAAADQIADAAKRCGQYYVNHRWLGGM
                     LTNWKTITGSIKRLRSIDEMLENGTQGLTKKEVLDITRDREKLERSLGGIKEMGGLPD
                     ILFVIDTNKEKLAVEEANKLGIPVVAVLDSNSDPRGVTFPIPGNDDAIRAIALYCELV
                     SSAVLDGISAELGASGEDFGASEELPVDPAVETAVTEAAASAE"
     CDS             715709..716140
                     /codon_start=1
                     /locus_tag="GLX_06150"
                     /product="osmotically inducible protein"
                     /protein_id="BAK83027.1"
                     /transl_table=11
                     /translation="MAITKYATAHWSGGLKDGKGEISTQSGSLKNQPYGFNTRFEDRP
                     GTNPEELLGAAHAACFAMALSGILGGAGLTATSLDTKSEIVLEKQGEGFTITAAKLTL
                     EADIPNATESQFRELAEKAKAGCPVSKLFNATITLDAKLKA"
     CDS             complement(716262..717353)
                     /codon_start=1
                     /locus_tag="GLX_06160"
                     /product="chorismate synthase"
                     /protein_id="BAK83028.1"
                     /transl_table=11
                     /translation="MSYNTFGHLFRVTTWGESHGSAIGCVIDGCPPGLVLDVADIQPW
                     LDRRRPGQSRFTTQRQEADQVEILSGVFEGRTTGTPISLVIRNTDQRSRDYGDIATRY
                     RPGHADVAYDMKYGIRDYRGGGRSSARETAMRVAAGAVARKVLGDMVSIRGALVQVGP
                     HAVDRARMDWGMVNENSLFCPDVAILPVWEEYLADIRKKGSSIGAVIEVVAEGVPPGL
                     GAPIYGKLDSDLAMALMSINAVKGVEIGEGFASACLTGEENADPMRMENGMLHFASNH
                     AGGVLGGISTGQPVVARFAVKPTSSILTPVPSVTRERENVDVMTKGRHDPCVGIRAVP
                     VGEAMMACVLADHLLRHRGQVGDYKPVVL"
     CDS             complement(717373..718212)
                     /codon_start=1
                     /locus_tag="GLX_06170"
                     /product="oxidoreductase"
                     /protein_id="BAK83029.1"
                     /transl_table=11
                     /translation="MSDGAPKISIKGALMKGKRGLVMGVANDRSIAWGIARAVAEQGG
                     ELAFTYQGEALGKRVRPLAESVGSTLVLPCDVSDDAAIDATFAAIEKEWGKIDFLVHA
                     IGWADKQFLRGRYVDTPRDAFLKALDISCYSFTAVARRAAAIMNPNGSLLTLTYLGAE
                     RVMPHYNVMGVAKAALEASVRYMAVDLGGEGIRVNGISAGPVMTLAANGIGDFRYILK
                     WNQYNSPLERNVSLEEVGGAGLYMLSDLSGGVTGEIHHVDSGYHIVGMKNPTAPDITV
                     AGN"
     CDS             718426..719031
                     /codon_start=1
                     /locus_tag="GLX_06180"
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="BAK83030.1"
                     /transl_table=11
                     /translation="MTLPLIALNADPFTLFDAWMADATAHEPNDPNAMALATATSDGR
                     PSVRMILLKGADRRGFVFYTNLNSRKAGELAANPHAALLFHWKSIRRQIRIEGPVEPV
                     TPAEADAYFASRSRISRLGAIASNQSHPLADRAAFEAAVAELEARYPGPDAVIPRPAN
                     WSGFRLVPQHFEFWQDRPYRLHDRVVWDRTGTAWHSERLYP"
     CDS             719111..719992
                     /codon_start=1
                     /locus_tag="GLX_06190"
                     /product="universal stress protein"
                     /protein_id="BAK83031.1"
                     /transl_table=11
                     /translation="MCVRRILLPLGGMSHAESALQVGGAIARMFDAHLAVLHVGTDMQ
                     EVGPLVGEGLSSVMVQDMITSALKESADRLHGVRAVFDAFIVREKIPVVAVDSPFSPV
                     GMHTLSASFIAHSGHTRSVVAFQARLSDLVVLRQPNPEGDVSSSDTLHAVLFESGQGV
                     IIVPPVAPPTVGQRICIGWNGTSEAASAIHHALPLLRRAQAVCILYSPAYQRPGPEAR
                     HVRSFLSLHGITAHIHEFGSDSRPVGEDMLAAAHAFNADMLVMGAYSHSRLRQMILGG
                     VTRHMLENSDITVLMSR"
     CDS             720151..720855
                     /codon_start=1
                     /locus_tag="GLX_06200"
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="BAK83032.1"
                     /transl_table=11
                     /translation="MENIMRIDADIMAELQEAGENAPEVLRVALTRLRGRIALVSSFG
                     AESAVMLALASEIDPAVPVLFLQTGQHFPETLAYRQELARMLGLRDVRDLQPAEKQIE
                     KRDPQGQLWAFDPDACCALRKVEPLDEAMIPFDAWITGRKRSQAATRQGLPVVEEAPG
                     GKIKINPLIAWTPRELDAEITRRNLPRHPLTLRGYPSIGCAPCTRPVTEGEDPRQGRW
                     AGQAKTECGIHLPTPS"
     CDS             720929..721723
                     /codon_start=1
                     /locus_tag="GLX_06210"
                     /product="sulfate adenylyltransferase subunit 2"
                     /protein_id="BAK83033.1"
                     /transl_table=11
                     /translation="MDDLDQLEAQSIFILREAYRKLKPLAMLWSLGKDSNVMVWLARK
                     AFLGRVPFPVMHVDTGKKFPEMYRFRDEYTKKWDLELLLGDCPPVEEIDPTLPPAARS
                     AARKTAGLAAMIDRYKLAGVIAGIRRDEQATRAKERVFSPRGSGHKWDVRNQPPEFWD
                     QYATPHEAGMHVRVHPLLSWREIDIWRYIEREGIPLVDLYFAKDGKRYRSLGDQDITS
                     PVESNASTVAEVIAELETSRTSERSGRAMDHESEDAFERLRVAGYL"
     CDS             721743..723635
                     /codon_start=1
                     /locus_tag="GLX_06220"
                     /product="sulfate adenylyltransferase subunit
                     1/adenylylsulfate kinase"
                     /protein_id="BAK83034.1"
                     /transl_table=11
                     /translation="MTMSTIPTPAPQEAATPIVIVGHVDHGKSTLIGRLLYDTDSLPD
                     GRVAQIIESSKKRGLAVEWSFLLDSLQIERDQGVTVDSTRIPFKLGTRQFVIVDAPGH
                     RQFLRNMITGAADAEAAVLVVDANEGAQEQTRRHAMLLRLIGIRHVIVLMNKVDIFNY
                     DQKKIEAAERDITTLLRQLEIEPTVFVPASAREGDNMAARSDKMPWYKGPTLIEALAA
                     VPAPSSRADLPLRLPVQDVYRFDTKRVVVGRIERGRIRVGDEVVIGTHGARARIATIE
                     SWHTAPQVAAVAGQSVAVTLEPDVIPDRGDFLFPADHAPLRAARIRTRLFWLRQEPLR
                     VGESFRLRLATAEHQVTVAAIDSVVRLEDLTEHPAEEVPPEGFAEITLAVSETMLFDP
                     FMPGTADGRGVLVDRNQQIVGGAPLIGIAESVTGRNAIHPTGSAVSPWDRARAKGHQG
                     GVFWMTGLPGAGKSTLARGAENRLFARGIDVSVLDGDTLRAGLCSDLGFSEADRRENV
                     RRAAAVARILAESGQVVIVALISPTVADRELARQIVGEGFHEIFIDTPQATCEQRDPK
                     GLYAAARAGKIEGFTGIDAPYEAPANPALRLETAGATSDETAATLATYIGDAIRLDDT
                     LRRQQS"
     CDS             723804..724202
                     /codon_start=1
                     /locus_tag="GLX_06230"
                     /product="hypothetical protein"
                     /protein_id="BAK83035.1"
                     /transl_table=11
                     /translation="MHRFLPVTYGNNEACCLKRISLQVDVRNNRRDSTGASVITANRL
                     LDGRIVWLAARGWSELVAHARVFDNTEIEDAIKQAKAMPEARTVVGIYGVQIDPDAAG
                     ITPLTVRERIRAFGPSVHPDFAPVEMQDVH"
     CDS             724192..725880
                     /codon_start=1
                     /locus_tag="GLX_06240"
                     /product="nitrite/sulfite reductase"
                     /protein_id="BAK83036.1"
                     /transl_table=11
                     /translation="MSTDTTTLPVGRYAYDQVDRTFLSQRVAQFREQVARRVAGDLSE
                     DEFKPLRLMNGLYLQLHAYMLRVAVPYGMMGADQMRALAHIARTYDRDYGHFTTRQNM
                     QFNWIRLEDTPDILEHLARVDMHAIQTSGNCIRNVTCDEFAGAAADELLDPRIHAEIL
                     RQWSTLHPEFTFLPRKFKIAISGSPHDRVAARFHDIGLVAHPGPQGRPVFDVFVGGGL
                     GRTPVIGVKLRDSLPEEDLLAYLEAIVRVYNGYGRRDNMYKARIKILMQALGIEAFRE
                     KVDAEFMLMNRADYRLEPAIVEGIRARFGIPPLTAPADAEQALAASRKADPAFDRWVR
                     TNTHPHRHEGFICAVISVKPDGGIPGDITADQMDLVADLADSHSFGEIRVTHMQNVVL
                     GHVRKDQLHDLWRKLAAANLATPNIGLVGDIIACPGLDYCALANARSIPIAQKLSARF
                     ANPELQERIGPLNINISGCINACGHHHAGHIGILGVDKRGQEFFQLTLGGSAGGDVAI
                     GQIIGPALPEDETVDAIARLIDTYLVLRHDNEQFLDTYRRLGATSFKDAVYASA"
     CDS             725867..726355
                     /codon_start=1
                     /locus_tag="GLX_06250"
                     /product="hypothetical protein"
                     /protein_id="BAK83037.1"
                     /transl_table=11
                     /translation="MPLLENGHVTQDRWHMTAEGEALPEGPVIVPLERLEEGLARAGN
                     APLGVAIAPDVDVAVLRTALPRLALVAVTFPSFRDGRAFTQARALREHLGFTGEIRAT
                     GKPLPDQYEFLLRCGVTTVQTERAEDISVWQQAHEIITIAYQPSTLHERPQGLGLRRF
                     LN"
     CDS             726454..727761
                     /codon_start=1
                     /locus_tag="GLX_06260"
                     /product="3-deoxy-D-manno-octulosonic-acid transferase"
                     /protein_id="BAK83038.1"
                     /transl_table=11
                     /translation="MTRAHMTENPCGALLGAGWWAVAALLAPLLRVNLRRRARRGREI
                     VACLPQRRGIASQKRPTGRIIWLHAASVGENVAIVPVIGRLVVSHPQLHVLVTTGTVT
                     GADVLMTRLADMPGHERVIHQFAPLDVPRWIDRFLAHWQPDVAALVESELWPNLINAC
                     QHRRIALALVNGRMSDRSLAGWRRAHCLLRRMLSAFAWVMARSTEDAERLIHSGASRI
                     ALVADLKDAAPALPCNPAELALLRHRLAGRPVWIAASTHPGEDVIIMAAAELVRHAVP
                     DALGILIPRHPERGTEIAAMSAPAPPRRTLEQWPAAHDSLWIVDTLGETGLFYSLSAP
                     VVLGNSLPGCAGGGHNPNEPARMGCPIAHGPQTGNFRVAYTRLGNSVRCVNTAADIAR
                     WVIPLLQQPASARALGARTRALAAPDPEIADQVARALVALGNE"
     CDS             727758..728747
                     /codon_start=1
                     /locus_tag="GLX_06270"
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="BAK83039.1"
                     /transl_table=11
                     /translation="MMRAPAFWWHPPSHPGWAARLLTPLGWLYGAATAYRLRGAGWSA
                     PVPVLCCGNIGAGGAGKTPLGLDLAQRAIARGRRPAFLSRGYGGRAAQSTRVDTTRHT
                     ARDVGDEPLLLARVAPCYVGTDRAQTARRAIAEGADCLIMDDGLQNPTLHPDVALVVV
                     DGQAGFGNGRLLPAGPLREPVRTGLARAQGTVIIGTDEYGVTRWLKPGYPCFTATLQQ
                     DVCNVPHGRPIIAFAGIGRPAKFFNGLARMGISPLRCIGFADHHAYSQADWQRLQALA
                     MRHDACLVTTPKDAVRLPALWQQQVHTVGLTLSWTAPTMPTHILDLWLDRKDG"
     CDS             728744..729679
                     /codon_start=1
                     /locus_tag="GLX_06280"
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="BAK83040.1"
                     /transl_table=11
                     /translation="MTRTAPSRPITLQMRLEAAFVRVLLALFRRIGPVRASNLGGWLC
                     RTVGPRLPVSRVADANLRRSMPELDGSMRRAVIYDMWDNIGRNAGEFPHLATLPRNSG
                     PGPGWDVVGEEHLVAQAARGGPTIFVSGHIGNWEMLPPVVARYGLPFSSFYRAPNNPL
                     VDRVLCDLRDEAMGQPVPLFAKGARGARGALGHILRGGHLGMLVDQKMNDGVEARFFD
                     QPAMTAGAMAAMALKLRCPVIPGYVERLGPARLRIHVLPPLDLPDGGNRIQDQMNLTQ
                     RVNDWLEGTIRQHPGSWLWLHRRWNVQLPNNMPKI"
     CDS             729834..730184
                     /codon_start=1
                     /locus_tag="GLX_06290"
                     /product="hypothetical protein"
                     /protein_id="BAK83041.1"
                     /transl_table=11
                     /translation="MHMMDQQFSSTNVVSLRQGLLPRHREYLMRWLQAGSCMGLCDAD
                     VLDRNEYDEADIEHVLVWVRENANPAYMVRPEGMGWVLIDQIRERPIATYRTFEAALH
                     AIRPVLSNGATVAA"
     CDS             complement(730226..731533)
                     /codon_start=1
                     /locus_tag="GLX_06300"
                     /product="ABC transporter amino acid transporter
                     substrate-binding periplasmic protein"
                     /protein_id="BAK83042.1"
                     /transl_table=11
                     /translation="MQGQDADSASPRAACKRLLLAGLAVSALTACASGGGSHHAPRAG
                     RNVGVLLPLSGSNARLGQEMLTATRMAMDTPTAPTLDVHDTAAPGSSAGAAAQAAIAA
                     GDGLILGPLTADETIQTAKVSVPASIPVLAFTSDISVVQPGVWALGIAPEQQVRRMVL
                     AAHQQGRQHFAAFLPNNRLGQALGQALQRVCDENGIQSPRIMFHDSTQDAITANLKTL
                     SAYDSRAAAAPPQPAPDAPAQTDATAAIDPANPDGAPPPSPPVAQDAPVAALPPPPFD
                     ALLLGDTGLQLGQVINALALAHVDSTQVQIMGPGLWAAFASKLGALQGAWYAAPDPAS
                     RQAFVQQFMARYHHMPTPLADLTYDSAALVKALDQSRPAGSPNGYSVQALTRPDGFGG
                     VDGAFGFLENGRTRRDLAIFQIVPNGGGRMVIPPAGRLRRSAN"
     CDS             731545..732537
                     /codon_start=1
                     /locus_tag="GLX_06310"
                     /product="tetrapyrrole/corrin/porphyrin methyltransferase"
                     /protein_id="BAK83043.1"
                     /transl_table=11
                     /translation="MSDASSSSPSKSQHATEHPAATSHDPVHSGESSLRHDANAPDTV
                     SVMHHDGELVLVATPIGNLGDISRRAIETLQASDLILCEDTRTSARLLREYGIHTRTR
                     PLHDHNEDRQIPALLHALGAGQRIAVISDAGTPLMSDPGYRLVRAVVAEGVRVSAVPG
                     PNAAIMALTLSGLPPHPFMFSGFLPPREAARREVLAQLHAAECAGLAATLIWHEAPHR
                     LAEMLATLADVLGPARPAAVARELTKRFEEVRRGTLADLAAHYGEHAARGEITVVVGP
                     PLASDSTTDDLDSQLRAALRTLSVKDAAALVAGITSLPRRTVYARALELARGAS"
     CDS             complement(732696..733337)
                     /codon_start=1
                     /locus_tag="GLX_06320"
                     /product="outer-membrane lipoprotein carrier protein"
                     /protein_id="BAK83044.1"
                     /transl_table=11
                     /translation="MRFRPMFAICGLSCLLAGGALPPVACAQEQMAVGASDHDHALLE
                     QVERHLDAISQLKARFRQTAPDGKESTGTAWIDRTNRRMRFQYDPPSPLLLVANHDQV
                     VFNDSQLDQTTTMPMDKTPLGLLLRPRLQLSGDVTVTGLLHDGHMLNVTLVRTDSPGD
                     GSMTLLFHDSPLRLRGWIIQDAQQETTRVDLLDITTSGGVPPDSLFSTDLPEH"
     CDS             complement(733413..734369)
                     /codon_start=1
                     /locus_tag="GLX_06330"
                     /product="hypothetical protein"
                     /protein_id="BAK83045.1"
                     /transl_table=11
                     /translation="MRKFSSLSDQEILALAISNEEEDGRIYSDFAYALRENYPDTSKI
                     FTDMSVEEDGHRRDLIDLYAQRFGPHIPLIRRQDIADFIVRKPAWQVQTQGIEAVRQH
                     ARHMEMDAARFYRQAALRTTDAATRKLLGDLAHAEDQHEQAANAIQDNRLPASKREGE
                     DEDARRRFVLQVIQPGLVGLMDGSVSTLAPVFAAAFATHLPWNAFLVGMAASVGAGIS
                     MGFAEALSDDGKLSGRGAPLLRGVICGLMTTAGGIGHTLPFLISDFTAAMVAAMVVVV
                     IELFVISWIRWRYQDTPFGSAVVQIVLGGLLVFAAGVLIGSS"
     CDS             complement(734541..735953)
                     /codon_start=1
                     /locus_tag="GLX_06340"
                     /product="glutamate--cysteine ligase"
                     /protein_id="BAK83046.1"
                     /transl_table=11
                     /translation="MSNPGAHNSNVIESFDQMVGLLAAGARPRAQWRIGTEHEKFGFV
                     KPDAAGSGHKPWSSPPYAPRGIEALLRDLAVEQGGTQWQEIIDRGALIGLKGQAGAKG
                     SSISLEPGGQFELSGAPLVSLHQTEAEMARHFSAIRPACAELGLGFAPLGFHPTATRA
                     DIPWMPKSRYAIMRNYMPKVGALGLDMMLRTCTVQVNLDFGSETDMARKMRVSLALQP
                     VATALFASSPFYEGKPNGYLSNRARVWTDTDNARAGMPLLFMRDGFSFARYVDWLLDV
                     PMYFIMHDGEMVDVAGCSFRAWLDGADLPGLPGVRPTMGDFEDHLTTAFPDVRLKQFL
                     EMRGADAGSPAMMLAQSALWTGLLYDDATLHAAETLVCEHAWEDYVALRADVPRAGLD
                     APWAGGSLRPLAARMIELATDGLRARGLTDAQGRDETRYLAPLHEIAAGGPTQAEAWL
                     AAYHGRWQGDVTRIFTEAAV"
     CDS             complement(736041..736781)
                     /codon_start=1
                     /locus_tag="GLX_06350"
                     /product="hypothetical protein"
                     /protein_id="BAK83047.1"
                     /transl_table=11
                     /translation="MKDCPRLFISPDTIPPMVAGGMLELGPAQAHYLGTVLRQQVGGA
                     VAVFNARDGQWHGVIDHLRRDRCHVRLVEQNRAPAATAGLCLLFAPLKRDATEAVIRM
                     GTELGVTRFRPVVTERTNTHRLNAARLESIACEAAEQCERLDVPEIDPLVPLVDLLAQ
                     WPEGISLFAALERSPPGPVVVPAQVGDSVLIGPEGGFSVREHDRLRGCAFVRPLSLGS
                     LVLRADTAAVAALALVGAGLKAVCDTGS"
     CDS             736942..737859
                     /codon_start=1
                     /locus_tag="GLX_06360"
                     /product="4-hydroxybenzoate polyprenyltransferase"
                     /protein_id="BAK83048.1"
                     /transl_table=11
                     /translation="MDQPVPHTDIRADGWIGRLPVRLRPYALLARLDRPIGTWLLFLP
                     GVWGILLPDHVLVRQRIFLVVLFGIGSVVMRAAGCVVNDMWDRDIDRQVTRTAGRPLA
                     SGALSMREAALFLAALLLIGFNILMSLNSLSQILGASSLILVGLYPLAKRVTWWPQLV
                     MGFTFGFGAPLGYAAAADRVDAALCALYGATIVWQLGFDTIYGFQDMEDDARIGVRST
                     SRLMSGHARLFVGTCYILTLTGLGFAAYLAHAGAGFWYLLPLPAALLGLQVRQLDEHD
                     PATCLRLFRFNRETGLAIALTVLAGTLTR"
     CDS             complement(737849..738598)
                     /codon_start=1
                     /locus_tag="GLX_06370"
                     /product="carboxymethylenebutenolidase"
                     /protein_id="BAK83049.1"
                     /transl_table=11
                     /translation="MIIHTHETADIPTPSGMMRVHVFRPAVAGCFPGLVLFSEIYQVT
                     APIRRLAAMMAGQGHVVCVPEVYHEYEPAGTVLAYDRPGTDRGNFLKFEKPLQGYDGD
                     ARAVLDWLEASPYCTGALATMGVCLGGHLAFRAALDPRVRATVCFYATDIHSHTLGHG
                     KKDDTLTRVGELRGEALMVWGRQDPHVPFAGRQMIREALEVAQCTYEWHEFNAQHAFL
                     RDEGHRFDAALFLQCMDMARNFLGRVLHVSA"
     CDS             738774..740147
                     /codon_start=1
                     /locus_tag="GLX_06380"
                     /product="gluconate permease"
                     /protein_id="BAK83050.1"
                     /transl_table=11
                     /translation="MGYEFITETVMSSLFALSLASLAIVSVVVLIARFRINPFIVLFM
                     VSLALALGAGMPPQKAITSFEAGAGRVLGHVATVIALGTMLGKMLAESGGADRIALTI
                     TSLAGKKRISWAMMVIGLLVGLPVFFEVGFVLLIPLAFTLARRTNTPLLLLALPMGAA
                     LSVTHAMIPPHPATLLALSAYHADIGRTILWGVVIGTPVAALAGPVYARFIAGRIGTV
                     QPSALEAQFIGHAQPESMPGFTITVLTILSPVVLMLVGSMADVVAAAHTPLNSTLHFI
                     GNTDIALALATVLSFQVFGTARGFSRETILKFTNDCLAPTALIMLLVGAGGGFGQELV
                     DSGVSSAITDLAVSAHVPLLVLAWLLAVVVRVATGSATVAMSTAAGIVGPILLRTHGA
                     SPELMVIVTGAGSVALGPLNDAGFWQIKEYLGLSVGQTIKTWSVIETLIAVLGLGFSL
                     LLSLFVG"
     CDS             complement(740249..740866)
                     /codon_start=1
                     /locus_tag="GLX_06390"
                     /product="nicotinamidase"
                     /protein_id="BAK83051.1"
                     /transl_table=11
                     /translation="MADARTGRMNPVTCTDALLVIDMQVDFLPGGALAVAGADGLVPL
                     INRLSHLPFGVVVASQDWHPADHVSFETCGGPWPVHCVAGTRGAALAPGLDQAAMGVL
                     LRKGLDPDTDSYSAFADNAHQHRTGLEGLLRERGISRVFVAGVALDYCVAHTARDARQ
                     AGFGTVVLHDACRAVAQDTQAVLAALDAQGINHAASVELLVQHTT"
     CDS             complement(740921..742351)
                     /codon_start=1
                     /locus_tag="GLX_06400"
                     /product="GTP-binding protein"
                     /protein_id="BAK83052.1"
                     /transl_table=11
                     /translation="MSSSFPSAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVADT
                     PGVTRDRKEGQATVRGRNIRIIDTAGLEEAAPDTLYGRMRASSESAVADADLVLFCID
                     ARSGITPADQHFANWLRRQGRPVLLIANKAEGRQGAAAAMEAFSLGLGAPLAISAEHG
                     EGIADLMAEIVDRLPPTDAPPVQKNTRRLRREQAESADGEVEDVRPPGPLRLAIVGRP
                     NAGKSTLLNRLLGEERMITGPEPGLTRDSIAVMLSDDEGPIQLVDTAGLRRKARIDET
                     LEKMSVSASIEALKMAEVVILVLDATLGVHEQDLQIARLIEREGRCCVLALNKWDAVE
                     DRAETRQAIKDRIEMSLAQMRGIPVVAFSAMTGAGINKLLPTVRRAYEVWNRRVATGA
                     LNRWFEMMIERHPPPLVDGRRLKLRYITQAKSRPPTFIVFGTRTDQLPEDYQRYLVNG
                     LRETFDLPGTPIRLLLRASSNPYAKS"
     CDS             complement(742368..743789)
                     /codon_start=1
                     /locus_tag="GLX_06410"
                     /product="dehydrogenase"
                     /protein_id="BAK83053.1"
                     /transl_table=11
                     /translation="MASPTPATPMPADRKTMKPALSRRHALLGAGAALLPALVACSSG
                     PKKKPLLIGHRSDVLHTTAGLTVDSDETQAVTLPAPTAVSAWPQSGITPDHRAVDIAW
                     RGTMNHMWTHDIGAGNSEPELLFYVALGDSGRGVIQATPVVQNGRIFVADAQGVIRGY
                     RWPTMHKLWEYNPKPRKMKSSNLGGGISVDGDTLYVVDGVGQALALDTATGKLKWRVN
                     IQTPGRSAPTIANGRLFFGTIDEHFYCLDAENGNLLWTYAATNADTVIYGQPAPAVAD
                     GVVLAGFGSGDLVALRAEGGEVVWADTLGSTNGQQALIDFSCVHGMPVIADGTAYAIS
                     TGSVLVAIDMRSGRRLWERGISGQNTPLVIGDWIFLLSMDEQLACLDRLSGHVRWITQ
                     LRQYENSDKQKRGVVWNGPILAGGKLVCISSFKDNGVVIVDPAQGHIESLHTLPSEVT
                     TAPIVVDNTLLLMDNNGYLLAYS"
     CDS             complement(743782..744582)
                     /codon_start=1
                     /locus_tag="GLX_06420"
                     /product="hypothetical protein"
                     /protein_id="BAK83054.1"
                     /transl_table=11
                     /translation="MAVCRAARGRICWGRQSRRAEYKAPCKRAGNDTNVADDIFTEVD
                     EEIRAERIRALARRYLVVAGVVVAGICIGAGGWQYSVSRAHKADAAVSAAYFTAMADA
                     ARAPDAADSGVAPLTTRQKAGLAELQALDTKARPPLRILARMERAALLAGSGDVPAAL
                     ALWEGVAQEKTVDPIIAALASLLWVQHQIDSGNPATLRSRLAVLDGAGQPWRGQAIEA
                     EALLDLRTGNTADARARFTRLAMDMTVNDGVRNRAEAMLQTMGGDAGG"
     CDS             complement(744691..745605)
                     /codon_start=1
                     /locus_tag="GLX_06430"
                     /product="lipopolysaccharide (LPS) heptosyltransferase"
                     /protein_id="BAK83055.1"
                     /transl_table=11
                     /translation="MHILFITSTRLGDAILSTGLLDTLLRRYPQADFTIACGPVAAGL
                     FAHMPRRVRTIEMVKRPYDRHWVDLWRQCRGTRWDMCVDLRGSVVSFFLRVGRRYVMR
                     GGRREGRRITHIGNLLGLDPAPMPVVWTNAEERARAVSMLPGGPHWVALGPTANWDGK
                     IWPAERFAAVFNALREADPAMRPVILYGPGEGERVRAQRVLAQLPDALDTGGRLSVTQ
                     VAALLGRCTLFIGNDSGLMHLAAATGIPTVGLFGRSKASEYAPAGPWARVVMAPGPVG
                     NAPMEGLSVVNVITTARSLLADRDRWKH"
     CDS             745690..746517
                     /codon_start=1
                     /locus_tag="GLX_06440"
                     /product="aminomethyltransferase"
                     /protein_id="BAK83056.1"
                     /transl_table=11
                     /translation="MARIAHLPDRAVLGISGADRVSFLQGLVSNDMTTVAPGHAVWTA
                     FLSAQGKWLADFFVFADPEGVRLLVDCDRTQADMLRQHLSRYRLRAQVEIGETGYAVH
                     AAWGDEFIPPAGYPTAPDPRLPQAGWRMLLGHRAPEATVDDVDYDRHRLALGLPDGVR
                     DCESGKTLLLEANFDQLNGISWTKGCYMGQELTARTRYRGLVRRHLLPVAADRELPPP
                     GTPVMVDETVVGEMRSSRDSIGMAMIRNEYIHDKTLAAGGHALHVKVPHWFALPDKA"
     CDS             746575..746991
                     /codon_start=1
                     /locus_tag="GLX_06450"
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="BAK83057.1"
                     /transl_table=11
                     /translation="MPYTPPDPSVRATMLDRIRFNADGLITAIAQQYDTGEVLMLAWM
                     NREALDETLHTGRVCYYSRSRHALWRKGETSGQVQTLVDARLDCDRDSVLLLVNQKGV
                     ACHTGRRSCFYNALRPEGIVEITQPEVSAEDLYGTA"
     CDS             complement(747210..748388)
                     /codon_start=1
                     /locus_tag="GLX_06460"
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="BAK83058.1"
                     /transl_table=11
                     /translation="MSCAAPTIWIMAGEASGDVLGARLMAALRVRSPGVRFVGIGGER
                     MQGQGLRSLFPLRDLAVMGLMEVLPRLRHLSRRLDQAVTDITACRPDMVITIDSPGFT
                     LRLLRRIAPLSIPRLHYVAPQVWAWREHRVREFPGLWERMLCLLPFEPEFFARHGLEA
                     RFVGHPVLQSGADTGSGAAFRARHGIGPGAPVLVLMPGSRRSEAPRLLPVFGQMLAIV
                     KQGMPDIVPVVPVAPVIADIVRAGVAKWPVQPIIVTDVHDKHDAFAAADAALTKSGTS
                     TLELAMAGVPMAVTYRVNPLTAAMARRLIRVPYVAMVNLLCGHRLVPELLQERCTPAL
                     LATTVVRLLRDPASRALQRTGFEHIRTLLRGPGVDPASAAADEIMDLLAATTVRTRSA
                     "
     CDS             complement(748599..749594)
                     /codon_start=1
                     /locus_tag="GLX_06470"
                     /product="ABC transporter phosphate transporter
                     substrate-binding periplasmic protein"
                     /protein_id="BAK83059.1"
                     /transl_table=11
                     /translation="MSGVLAMLLGTAGLPSLAHATEITGAGSSFGAPIYGAWGAAVAH
                     ATDIRLNYQTIGSGAGQNQVKARTVDFGASDAPMGAAQLAQNNLLQFPTVLGAIVVVV
                     NLPGVDAAHLCLTGELLARLYSGDITMWNDPAIMAENPGMDLPAIPVAPVRRADGSGT
                     TFVFTSYLARVWPRWAKEQGSGTSIEWPVGEGARGNDGIAAAVRNTEGSIGYVEYAYA
                     AGNHMPVVELRNRHGDRVMADQDSFSRAVATARWAQDATHAADVLDGDGAGAWPIMAA
                     TYALLPQDRADTPQGHAVRAFFDWSMRNGGEAALSLHYVLLPDDIRATIRDMLAH"
     CDS             complement(749629..752091)
                     /codon_start=1
                     /locus_tag="GLX_06480"
                     /product="phenylalanyl-tRNA synthetase beta subunit"
                     /protein_id="BAK83060.1"
                     /transl_table=11
                     /translation="MKFSLSWLRAHLETTATVEEICATLNTIGLEVEGVEDPGASLAS
                     FRTARIIEAVQHPNADRLRVCQVDAGEGFERVQVVCGAPNARAGLHVIFAPPGTYIPA
                     SGITIKAGKLRGEASGGMLCSLRELGLGEESEGIAELPEGTAPGQSYPLFAKLDDPVI
                     DIAITPNRGDALAVRGVARDLAAAGLGKLRPWRAETVEGHFDTPINWRITFPEACPWV
                     LGRVIRGVKNGPSPEWLKQRLESVGMRPVSALVDITNFFAFDLGRPLHVFDVGKLMGS
                     ELTICRGAGETFTALDGSEHVMTPDDCVIADGRGVQSLAGIMGGAESGVSDDTTDVFV
                     ECALFDPVIIALSGRRHNLHSDARQRFERGVDQALPPAALEAATRMILDLCGGEAGSV
                     VSAGAEPAWQRQAHLEFARLETLGGLVEEPDHAVHLLEGLGFKIRECDARHVVVDVPS
                     WRNDIATPMLLDQKPDLPAARAQAAAEGAVAIDPEVDLIEEVLRLRGLDSVPAVSLPV
                     SNAVPVPAFTLRQSRVASLRRQLAARGLLETVGFSFVAQEQAAEFGETPTDLHLLNPI
                     AADLDQMRPTPLVNLLAAVKSNAARGYPDLGLFEVGPGFGPDGQKLVAAGIRSGHSPR
                     MPGQSAHPVDLWQVKADALAGLAAMGAAMEGLGITTDAPSYYHPGRSGVIRQGPKLVL
                     GHFGQLHPALLAARGIDVSVCAFTLYPDMVPEPKRKRRGPPALSTFQPLRRDFAFVVE
                     ADVPAEKLLRAVKGAERNLIVAVSLFDAYEGDKIPAGHKSLGVEITLQPMDRTLTDAE
                     IEAVCERVLAAAQKSCNAALRN"
     CDS             complement(752095..753234)
                     /codon_start=1
                     /locus_tag="GLX_06490"
                     /product="phenylalanyl-tRNA synthetase alpha subunit"
                     /protein_id="BAK83061.1"
                     /transl_table=11
                     /translation="MRRVWPAGRYLLPAARREPVRGAMSDDLETLREQTVQALAAATD
                     QRAWDAVRVGTLGKSGSLTALLKQLGRMTPDERRTRGAALNRLRDELTRLIEARGQEL
                     EAAALNARLTAERVDVTLPCAPEADGALHPITRTIEEMAAIFGAMGFQIAEGPDIESD
                     WHNFSALNTPAHHPARTDQDTFYLPAEAEGQPERVLRTQTSGVQIRTMLGHEPPIRII
                     APGRTYRADHDATHSPMFHQCEGLVIEKGITLGHLKGCLSDFLRAFFQMPDLPVRFRA
                     SYFPFTEPSMEIDIGWSRRTGQIGAGDDWLEVLGAGMVHPRVLANCGLDAREWQGFAF
                     GMGIERLTMLRHGIPDLRSFYESDVRWLRHYGTNPLSPALLHEGL"
     CDS             complement(753354..753710)
                     /codon_start=1
                     /locus_tag="GLX_06500"
                     /product="LSU ribosomal protein L20P"
                     /protein_id="BAK83062.1"
                     /transl_table=11
                     /translation="MARVKRGVTTLARHKKVLAASKGFRGRSSTNYRIALERLEKSLQ
                     YAYRDRRNKKREFRALWIQRINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAYDD
                     AATFAEIVKKAQAALA"
     CDS             complement(753725..753928)
                     /codon_start=1
                     /locus_tag="GLX_06510"
                     /product="LSU ribosomal protein L35P"
                     /protein_id="BAK83063.1"
                     /transl_table=11
                     /translation="MPKMKTKSSVKKRFKITATGKVLAGPGNKRHGLINRSQKMKRTN
                     RGSQVLTEMDGRTVKQWAPYGLA"
     CDS             754153..754881
                     /codon_start=1
                     /locus_tag="GLX_06520"
                     /product="oxidoreductase"
                     /protein_id="BAK83064.1"
                     /transl_table=11
                     /translation="MTQRVAYVTGGSRGIGAAIAKSLAQDGYDIAISYARNEQAAQKT
                     VDEVKALGRRAMAIRCDGEGSGNRAAIQRVVAGMGRIDALVCNAGIYPYGDVTEMTDT
                     QVDAVLGLNVRAVMIETIEATRHMTQGGRIILIGSTFADRSPFPGISLYSASKSALNG
                     FARGAARDLGPRGITINVVQPGPIDTDMNPATGAAADMLRSFMCHKEYGKVSDIASVV
                     SFLASPQASFITGSALTTDGGLAA"
     tRNA            complement(756062..756135)
                     /locus_tag="GLX_t0080"
                     /product="tRNA-Gln"
     CDS             756309..757433
                     /codon_start=1
                     /locus_tag="GLX_06530"
                     /product="exopolyphosphatase"
                     /protein_id="BAK83065.1"
                     /transl_table=11
                     /translation="MVQHRLNAARHQQETLPSFAPVTNRHRARVPLYAAIDLGTHNCR
                     LLVARAGESGLRVIDSFSRAVRLGEGLHHSGKLAEAAMERTITALRACVARMGLYELH
                     SHRAIATEACRRAANGMDFIARVMHETGLNISVISAREEAELALAACNSLLHGHGGTT
                     GRDLLFDIGGGSTEIAWARIDRNARRHDLSGYVSLPVGIMTLGERYGSNIFTDAGYHT
                     AVEEIGSVLRGFDDVHCITREIARGNVMLLGTSGTVTTLASLAQGQGRYERAGIDGSS
                     LSIPQALDMIGNLRRGGMAGLVRNPVIGPDRARYLLPGCAIFEAIATTWPMANVTVAD
                     RGLRDGLLLRMIGDRRQHGGLAPLPFSLSLHHHMEHRVST"
     CDS             757446..758210
                     /codon_start=1
                     /gene="rrmJ"
                     /locus_tag="GLX_06540"
                     /product="ribosomal RNA large subunit 23S
                     methyltransferase RrmJ"
                     /protein_id="BAK83066.1"
                     /transl_table=11
                     /translation="MKQRSSTRVPGKARTSSLTPGTGDSSTDGRAAQTNRTKTVTVKK
                     ARGRTTAQHRWLQRQLNDPYVQAAQKQGWRSRAAFKLIELDDRFHLIQPGTRVVDLGA
                     APGGWTQVAVKRGAAEVVGVDLLPVDPVPGATVIEGDFNDPAMPGRLTDLLGGKADLV
                     MSDMAPNTTGHAPTDHLRIIGLAELALDFATRILAQDGAFVAKVFQGGSEKQMLAELK
                     RLFTQVRHAKPPASRKESSELYVVATGFRGLDAIQD"
     CDS             complement(758238..759167)
                     /codon_start=1
                     /locus_tag="GLX_06550"
                     /product="fructokinase"
                     /protein_id="BAK83067.1"
                     /transl_table=11
                     /translation="MMKERLCMGSYRIGIDFGGTKIEIAALAMDGAERVRRRITNPGN
                     YPAAIQAMCELIHGVDRELGGTGTVGIGIPGSISPDTGVIKNANATWLNNQPLVRDMT
                     AALGREVRIENDANCFALSEAIDGAGAGHHSVFGVIIGTGMGAGIVIDRKLLIGRNHI
                     AGEWGHVPLPWPRLEEFPMPKCFCGNEGCMERFLSGSALAQDWKGPGHRSAAHIEQEA
                     EAGDLTAIGALDRYMDRMARACAMAINFMDPDVIVLGGGVSNLESIYERVPRLMRRYA
                     ITPNCTTPIVRNRHGDSSGVRGAAWLWDDHHAA"
     CDS             759228..759536
                     /codon_start=1
                     /locus_tag="GLX_06560"
                     /product="two component response regulator"
                     /protein_id="BAK83068.1"
                     /transl_table=11
                     /translation="MHGHDCPHHGDMAPMSEIVLDARGLSCPLPVLKANRMLRGLQPG
                     ARLRVIATDRASVADFQAFCRETGHALIAFGEEGGTLSFVIRRRPDAAAGPATVSMPA
                     "
     CDS             759638..759868
                     /codon_start=1
                     /locus_tag="GLX_06570"
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="BAK83069.1"
                     /transl_table=11
                     /translation="MTQDLTHLSFEDALAELETIVRQLEVGQLRLEDAITSYERGAAL
                     RQYCQKKLDEAEARVQAIVQRADGALDAKPMD"
     CDS             759925..760812
                     /codon_start=1
                     /locus_tag="GLX_06580"
                     /product="geranylgeranyl pyrophosphate synthase"
                     /protein_id="BAK83070.1"
                     /transl_table=11
                     /translation="MARLRASMSARAKAIEGMIDRLIPRVEGGEARLIDAMRYATLGG
                     GKRLRGYLVAEVASLFKVAAGGADRVAASVEMLHAYSLVHDDLPAMDDDDLRRGQPST
                     HKKFDEATAILAGDALQTMSFDILANPLTHGSAEVRINLVRALADASGAAGMVGGQMI
                     DMEGEGRALSLEEVARLHALKTGCLIRYSAEAGAILGQASEDVRSRISAYGRDLGAAF
                     QIADDVLDATASAEELGKTAGKDEAAGKSTYVALLGVEGAAKEARRVAEQALSHIDIF
                     GPEADRLRDLVHYVVERRN"
     CDS             760818..762809
                     /codon_start=1
                     /locus_tag="GLX_06590"
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="BAK83071.1"
                     /transl_table=11
                     /translation="MTDSKTPNAIPTLGRYPQLDRVRAPHDMRNLSVEQLKQLADELR
                     AETIDAVSTTGGHLGASLGVVELTVALHAVFDTPDDRVIWDVGHQAYPHKILTGRRER
                     IRTLRQPGGLSGFTRRSESEYDPFGAAHSSTSISAGLGMAVAHHLRAEEDPAYRERNV
                     IAVIGDGSISAGMAYEAMNNASHCGPGAERLIVVLNDNEMSIAPPVGAMSNYLSRLMS
                     SRKFLSLRELAAKMAKRLPGRLERTAKKADEYARGIMTGGTLFEELGFYYVGPVDGHD
                     MNQLVHILRNLRDAEDVGPVLLHVITEKGHGYTPAESAGDKYHAVSKFNVVTGEQKKG
                     PSGPPSYTSVFAKELVRQAATDDRIVTITAAMPSGTGLDKFAKAYPDRFFDVGIAEQH
                     AVTFAAGMATEGLRPFCAIYSSFLQRAYDQVMHDVVLQKLPVRFAIDRAGLVGADGAT
                     HAGSFDIAYLGCLPGITLMAPSTEVELMHMTATAIAFDEGPIGLRYPRGAGLGLALPA
                     AGEVLEIGRGRIVREMARQSGPEQGGIAILSLGPRLEHALKAADMLAAHGLSPTVADA
                     RFAKPIDTALVEQLARNHAVLITIEEGSVGGFASFVMTHLAKTGLLDRVRFRPMTLPD
                     RFIDHNTQDAQYIEAGLDAAAIVDTALSALGLPQSRQMA"
     CDS             762834..763577
                     /codon_start=1
                     /gene="hlyA"
                     /locus_tag="GLX_06600"
                     /product="hemolysin HlyA"
                     /protein_id="BAK83072.1"
                     /transl_table=11
                     /translation="MAKRRVDQMLVDRGLVETRTRAQALIMAGLVHTPDRRIAKAGEQ
                     IPEDTPLTLKGQDHPWVSRGGIKLAHGLDHFCLSPAGLTCLDVGASTGGFTDVLLHEG
                     AAKVYAVDVGHGQLAWKLRSNTEQVVVLEKCNARALDTTIIPDPIGALVCDASFIGLR
                     TVLPAGLELCMPGAWAIALIKPQFEAGREAVGAKGVVRDPAVHETVCQMIRQWWSDLP
                     GWTVLGIDPSPITGPEGNREFLIAARKNG"
     CDS             763687..764925
                     /codon_start=1
                     /locus_tag="GLX_06610"
                     /product="iron-sulfur (Fe-S) cluster redox enzyme"
                     /protein_id="BAK83073.1"
                     /transl_table=11
                     /translation="MSSVAPTPTRSRDGTAASLLNDEERARIRAKSAQFAPPTAAMPD
                     GRRDLVGLSREELTDIMVEIGEKPFRTKQLWHWIYHQGATDFSRMSSIARPLQEKLAE
                     RFVVGRPGVVTEQTSQDSTRKFLFRFRDGQEAETVYIPDRQEDRGAVCISSQVGCTLS
                     CTFCHTGTQALVRNLGAAEIVGQFMAARDSYGEWPSPKGDTPRLLSTIVLMGMGEPLY
                     NYDNVAKAMRIIMDGEGIGLSRRRITLSTSGVVPMMDQCGAELGINLAVSLHAVRDDL
                     RDEIVPLNRKYPIKEVIAACRRYPAASNARRITFEYIMLRGINDSEADARELVRLISG
                     IPAKVNLIPFNPWPGSSYRPSTREQLEKFANIVMDAGFASPIRMPRGRDILAACGQLR
                     TESQRLRRVARPDDGTDAAQ"
     CDS             765041..766270
                     /codon_start=1
                     /locus_tag="GLX_06620"
                     /product="argininosuccinate synthase"
                     /protein_id="BAK83074.1"
                     /transl_table=11
                     /translation="MAARDVKKVVLAYSGGLDTSVILRWLQTTYNCEVVTFTADLGQG
                     EELEPARRKAEMFGVKEIFVEDLRETFVKDFVFPMFRANALYEGQYLLGTSIARPLIA
                     QRQIEIAEQVGADAVAHGATGKGNDQVRFELAYYALKPDITVIAPWREWDLTSRTRLL
                     AFAEEHQIPIAKDKRGEAPFSVDANLLHSSSEGKLLEDPAVGPEEIVFQRTISPEAAP
                     DKATEITIDFVSGDPVAINGVTMSPATLLTRLNELGRDNGIGRLDLVENRFVGMKSRG
                     IYETPGGTILLTAHRSIESITLDREAMHLKDSLMPRYAEIIYNGLWFSPERRMLQALI
                     DQSQHSVTGRVRLKLYKGNVICVGRESPHSLYDTRVVTFEDDEGAYNQADAQGFINLN
                     ALRLRLGAKIGRRGGAL"
     CDS             766281..766814
                     /codon_start=1
                     /locus_tag="GLX_06630"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BAK83075.1"
                     /transl_table=11
                     /translation="MPLHALPTICRGVMKRFSRVIPLLAAVAVALPLAACGGNKDDQP
                     ELTPAQFMDNVRKQPGVQTLPDGLAYKVLKSGPKDGAQPTINDSVMVIYEGRLPDGGI
                     FDSSEQHGHGAYMQMPLEMVIKGWQEALPKMHVGDTWMLYVPPELGYGHKSMGIIQPD
                     SPLIFKIQLLGVSPSGH"
     CDS             766892..767380
                     /codon_start=1
                     /locus_tag="GLX_06640"
                     /product="cytochrome c class I"
                     /protein_id="BAK83076.1"
                     /transl_table=11
                     /translation="MKIVTGRMASALRLACMTSTVVLLAGCTRYGQHGYARYRTNCGI
                     CHHGGEGMKGEIPPISGRVDRIAATTEGKQYLMHVLLNGLNGPLDIDGVHYNFSMPPF
                     RTHLSDEEIASILSYLATRGDTQPVPVFSAADVAAERAHPMTTSMVAEERRRLDALHP
                     LP"
     CDS             767429..768424
                     /codon_start=1
                     /locus_tag="GLX_06650"
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="BAK83077.1"
                     /transl_table=11
                     /translation="MQRLFSGIQPTGIPQLGNYLGAIRNWVALQRDHDCIFCLVDMHA
                     ITTWQEPATLRQQTLAQTAVLLASGIDAEQHILFNQSAVSAHARLGWIFNCVARIGWL
                     NRMTQFKDKAGKDREKHSAGLYVYPDLMAADIMAYKATVVPVGDDQKQHLELTNDIAQ
                     KFNHDYGIAFFPQVQPLIPPQGARIMSLRDGSKKMSKSDPSAQSRIEMTDDADTIANK
                     IKRAKTDSEPLPSEEAGLENRPEARNLVTIYATLSGKSVADVLAEFGGQGFGPFKEAL
                     TEVLVGAVAPIAAETGRLLREPGFLCDTLRAGANRARAIAEPIVSEAESLIGFLK"
     CDS             768444..768863
                     /codon_start=1
                     /locus_tag="GLX_06660"
                     /product="hypothetical protein"
                     /protein_id="BAK83078.1"
                     /transl_table=11
                     /translation="MRQELHSLHVSTRGKGLVPIDRPVLDWVAQSGIETGLLTLWCRH
                     TSASLTVQENADPTVRADIERYFETLVPEQPGRYIHEDEGPDDMPAHLRTMLTNTQLS
                     IPVADGRPVLGMWQGLYLFEHRARPHRREIVLHLIGT"
     CDS             complement(768969..769823)
                     /codon_start=1
                     /locus_tag="GLX_06670"
                     /product="S-formylglutathione hydrolase/esterase"
                     /protein_id="BAK83079.1"
                     /transl_table=11
                     /translation="MTTIKTLEEHAACGGRLGFYSHLSDSLGLEARFGVFLPPRALAG
                     ERVPVLHVLAGLTCTHETFLIKSNAVRFAARNGIALVAPDTSPRGAGVAGEGDAYDLG
                     TGASFYLDATTPAWRKHYRMGTYVGQELPELTQAHFALDGARRGIMGHSMGGHGALVH
                     ALRAPQAWKSVSAFAPICHPATVPWGEKAFAAYLGADRATWARHDATLLLEAGHTHPT
                     EILVDQGEADQFLYSQLKPELLAAAAGRTGQALRLRLHPRYDHSYWFIQSFIADHIDH
                     HATVLNAL"
     CDS             complement(769827..770942)
                     /codon_start=1
                     /locus_tag="GLX_06680"
                     /product="alcohol dehydrogenase zinc-dependent"
                     /protein_id="BAK83080.1"
                     /transl_table=11
                     /translation="MDVRAAVAFEAGKPLEIETVQLEGPRAGEVLVEIKATGLCHTDK
                     FTLSGADPEGLFPAILGHEGAGVVVEVGAGVKHLKPGDHVIPLYTPECRECKSCLSRK
                     TNLCTAIRSTQGRGLMPDGTSRFSFKGQPIHHYMGCSTFANYTVLPEIALAKIRPDAP
                     FDKVFYIGCGVTTGIGAVLFTAKVEAGSTVAVFGLGGIGLNVIQGAKMVGADRIIGID
                     INPAREAIGRQFGMTDFVNPRDLGPDGDLVGHLVEMTDGGVDYSFECVGNSTLMRQAL
                     ECAHRGWGVSTIIGVAGAGQEISTRPFQLVTGRRWIGSAFGGARGRTDVPRIVDWFME
                     NRIDIDSLITHKLPLERINEGFDMMAKGESIRTVVEF"
     CDS             771180..772055
                     /codon_start=1
                     /locus_tag="GLX_06690"
                     /product="hypothetical protein"
                     /protein_id="BAK83081.1"
                     /transl_table=11
                     /translation="MVINRKIGLWILMRESLLSLLLLCAWDIVVVVMFQIFHQEWMEQ
                     PTLPISLIGSALVLFMSFRNNTAYNRWWEGRTLWGAVTNNSRSFARQAGTILRGCPDL
                     TRAMAAYPYALRGALGRLDASEDINRLLPDSMKAGVEGKANIPAAILFQIGLRVDAES
                     RRLGIDGALQGQIDRILSDMSNAQGGLERIRNTPLAIQFSVLPKVVAAVFCIILPLSM
                     VQTLGWITPLGSSLVGLLFVALDKIGSDLQDPFGNTAHGMPMLTISRTIEIDLLQSCN
                     LPAPPPLLPVKGVQN"
     CDS             772104..772709
                     /codon_start=1
                     /locus_tag="GLX_06700"
                     /product="transcriptional regulator"
                     /protein_id="BAK83082.1"
                     /transl_table=11
                     /translation="MGGMSMFRTTQKGTVTDAMARTAAATTAAEAKSGKAIKDEDPFR
                     EGDAIVYAAHGVGRVDRIGVDEIAGTKLEMIQISFPGNQMTLRIPLSKARKSGLRKIV
                     SREIVDKAMAIIKGKPHVSRGMWARRAVAYQEKINSGDLVQIAEVLRDLRRNVDSLDG
                     SFSERKLFEAAQERFVAEVAVLEGKEPTEVLEKLTEVMKAA"
     CDS             complement(772769..774052)
                     /codon_start=1
                     /locus_tag="GLX_06710"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAK83083.1"
                     /transl_table=11
                     /translation="MSHDGLRAGMCSGLPRSLFSVWKMHYVPVMSVHVMARGSLVPIM
                     LAIASGMLAMGLALPALPLELQARFGCGTTMIGLIMGLQSGATLLSRPWAGRMADRRS
                     GRDTLLAGLGWTACSGLAYMLALLPVLAPAMQQAMIVLGRMSMGLGEGLIVTGGGIWA
                     VTLAAGSGRTGSAMSWVGLAIFAGLGVGTAIGGMIQAQAGFFYLCLVAVALPASGMVL
                     TLCLPPVRLHDGSHAGVQWKDLIGHTWTWGMTLGLSAVGFAAISSFLVIFYAARGWQG
                     GGWALAMFGVGHVSARLAGNHLVDRPDVRPMVATIMLTEAAGLALIWLAPGPAWGIAG
                     SFLTGLGFSLTYPLLALPVLRQVPPAAAGSAIGLFDVFFDIASGAGSVLSGLLAGVAG
                     PGSPFAMAMLAALTGSMMMLVLYNRQAVGAKTPAP"
     CDS             complement(774162..778361)
                     /codon_start=1
                     /locus_tag="GLX_06720"
                     /product="hypothetical protein"
                     /protein_id="BAK83084.1"
                     /transl_table=11
                     /translation="MPEHAPPTPPRGRRILRGVAFALGIPAGLVAVALGMVLVAANTG
                     AGQRAIERRLPGLTGGSVHLSGLGGRFPDALHVAHLELDDYRGAWLSIDGLQLDWSPL
                     RLLGRRAVISNLSMERLSIPRLSEDDPAHPAKKTPEQSSGSIHMGIDIRAVHVARIEV
                     GAALARIPAAFRLEGHARLADIAPVLDNFSIATLPPADITLALTRLDHPGTLALTTRL
                     DRRNVALDLHAHEGADGFVATLGQIPALAPLDLSLSLNGPRDDTQLALALATGAVQAS
                     AKGRVGLLSHHMALDVAATSPAMVLDGTTGWQGAHLAAHVGGTLERPTGNGMLDVDRL
                     TSNGAGFGALHLVADGLSGQGAGQPEHAAIHATITGLLVPGSQPALFAADPLRLDVLW
                     HPDDRGGPVDLSLTHPLVRLTGQVLTAGPIATTFHAELPTLAPLAAVGGTNLHGHAAL
                     DGSATLPTAGQDGHFGLDSHIALDGGLPIAVGLVGDAGHLNVAGTVTPAVHGARTLTF
                     TTLLAEGKALHLEATPTRIVTGTPLAVDVTAHLALSDLHVLASTLKGHMQADLHASGP
                     VNDLAASLTTQASIAASNTAAGDVQASLEMQHLPQVSQGALSVSGTVDRAPVQVALHM
                     DSNADSARHIILEHLSWKTLTGQADMTLPAGHLVPSGTLDLHMTRLADLRDLTGQDIG
                     GHLSATLHSTSATADAPAALAVNVDSALAAPIARIDRLVLKGRLLDPVGAIPTSDLDL
                     VVDNARFRDMSGHAHVTAKGPTSALNVTAQSGLDTPWTGAATLDTALQANIPASTIAV
                     HTLVAQARREQVRLDGPVSLTYGKEIALDHLRLGVIPPSGQPGSVEVAGKVRPALDLH
                     ATLAHLSPDLVVPFMPSLHAQGQLSAEARLTGTLDRPSGQVKVTGTGLKYHTDYTAAL
                     APASLDATATLNAGMARVDAQLQAGTQVNLGLHGTAPVNKAGQITLQADGNVDLAVAN
                     AYLGAQGMQAGGMLQMNVGVRGTPAQPRLGGTLTLANGLFHDFGQGIQLSAIHGTVNA
                     QGDRLVITDLVAQAGKGSLNASGSYGVLEPGQPIDLHVHADNARPLASDLITATLNGD
                     LDVKGQLASRIDATGNLTLKRVDINIPDSLPTSVAHLDVIRPGDEATREKAAPVSPLV
                     VGLGLDVSSPGQFYVRGHGLNTEMHGKIHVGGTATAPLVTGGFSLVKGGFSLGGISLD
                     FSKGQVGFNGTGVTHKIDPTLDFVAERSTNDGTARLNVGGYASAPKITFSSTPPLSQD
                     QILAILLFGTDTQSLSPTQMASIAAAVATLSGGSAFDPLGMVRKTLHLDRLQMSSSSN
                     GSGGNDTGAIEAGKYVMRRVYVGAKQATSGSGTQAQVQVDLTKRLKLNTTVGTGGNVT
                     GFTTPENDPGSSIGLLYQFKY"
     CDS             complement(778361..780328)
                     /codon_start=1
                     /locus_tag="GLX_06730"
                     /product="outer membrane protein"
                     /protein_id="BAK83085.1"
                     /transl_table=11
                     /translation="MTRLRHFRLARPVGVRVRRSAGYATLCALLTAFVPQAAVQAADP
                     QDYVTTLRPTGNADLDAALRASSDLISLQKTQAVSPFALTGRIHNDYSRLISALESYG
                     YYAGTITITVSDVDVKAAKGTEGAGHDGRDPDLPEWLQAIPAGRKAQVTISATPGSVF
                     RIGVVTLQPDKGDPPVHLDAEEQKAFGMKPGVPAQAESVLAAGAALQVALTEEGYALA
                     HVGTPQAWLRPDTHTLDLTYTVHRGPVVNLGAFDFAGLQRTHPAYIARRMTIAPGELY
                     QPSRIERARQDIASTGLFSDVQVNHDETLATDGTMPLGFSFREGKRHSVGAEGGYSTD
                     LGGRAGVTWTHNNLFGNAERLRLTALITGLGGSAEQGLGYDFYADLMKPDFGSRAQNL
                     SARLEGIKQELYSYRQTALLARVGVVRHVNRLWNVSFGGQIEQEQIQQMRATNSYFIV
                     ALPLTANYDGTGVDNPITPATHGVRVGASITPSASLTDGTSFFAIMQATVSTYFDLKH
                     FGLSRPGRSVLALRGTIGNVEGASTFAIPPDQRLYAGGSATVRGFRYQGVGPQFANTR
                     YAVGGTSMDAGSFEYRQRILQKFGAVGFIDAGQVTGNHTPFEGTLRVGAGAGARYYTP
                     IGPVRLDVAVPLNRPARGDKWELYVGLGETF"
     CDS             780733..782139
                     /codon_start=1
                     /locus_tag="GLX_06740"
                     /product="tRNA 2-methylthioadenosine synthase"
                     /protein_id="BAK83086.1"
                     /transl_table=11
                     /translation="MNSLFPPTGVAQPLPRTSSARGLHVITWGCQMNVYDSERMTDVL
                     RPLGYRAVNTPDDADMIILNTCHIRDRAAEKVFSELGRLRKVKEARAERGAGTVLAVA
                     GCVAQAEGREILARAPYVDIVLGPQTYHRLPEMVARAARAAGAVIETDFPVEQKFDFL
                     PADRVAPAGGAAFLTIQEGCDKFCSFCVVPYTRGAESSRPVAAVLAEARRLVAAGARE
                     ITLLGQNVNAYHGEGPDGGPWGLARLARVLADEVGVARIRYTTSHPRDMEDDLITAHR
                     DLPQLMPFLHLPVQSGADRVLAAMNRGHTADEYRVLVDRLRNARPDLALSSDFIVGHP
                     GETDADFADTMRLIRDVGFAQAYSFKYSSRPGTPAAGAGQQVAEDVKDARLQELQALL
                     RVQQDDFNDATIGLRAPVLFTGRGRKPGQISGKSPWLQAVNVEGPESLIGRIASVDIR
                     HRYTNSLGGVLTEETDRA"
     CDS             782136..783287
                     /codon_start=1
                     /locus_tag="GLX_06750"
                     /product="phosphate starvation-inducible protein"
                     /protein_id="BAK83087.1"
                     /transl_table=11
                     /translation="MREQTQSTLHAPRRGGRRLPPPDTAAANDRTVTLQFEDNALLAQ
                     LVGDHDRHLLHLERGFDVRLACRGNRIAITGGAQRVALTQGTLTELYRRARAGQVVDT
                     AAVDTAIRMAAHAFSAPAAAAARDLTTMQDTRTPIAPPRPSLADLPTIMTRRGPIAPR
                     SVGQGQYMDMLARQEMVFGLGPAGTGKTYLAVAQAVAMLQAGQVDRIVLSRPAVEAGE
                     RLGFLPGDMKEKIDPYLRPLYDALHDMMPGDQVIRRMGTGEIEVAPLAFMRGRTLAHC
                     FVILDEAQNTTPAQMKMFLTRMGEGTRMVITGDLSQVDLPRGVTSGLREAVETLDGLP
                     GIGMMRFESRDVVRHPLVARIVEAYDQRTEADRRPHRARSQQENNETSK"
     CDS             783271..783852
                     /codon_start=1
                     /locus_tag="GLX_06760"
                     /product="hypothetical protein"
                     /protein_id="BAK83088.1"
                     /transl_table=11
                     /translation="MKPRSSTGPAHGGGVADAPGGAGMPAPTAMPVGPDITVVDRRWN
                     RAIRHPVRLVTRAVNAALDATGNQGPVTVVLADDLTVRRMNWRHRGRNKPTNVLTFEY
                     APAHTPGAIWGGDIIIAFETLAREARAAGRSMAAHLAHLVIHGVLHLAQYDHHHPGEA
                     REMEMEEARLLSTLGFANPWKPGRMATARGARS"
     CDS             783849..784793
                     /codon_start=1
                     /locus_tag="GLX_06770"
                     /product="hemolysin/magnesium/cobalt transporter HlyC"
                     /protein_id="BAK83089.1"
                     /transl_table=11
                     /translation="MSRPGHDGTGGGEPPSGSRGKGFLSLFSRRRAEQGLRHSIAALV
                     KEADDAAGSEGEPGPSELDRQERALLANVLRLRGITADDVMIPRADIVAMPVDISLDE
                     ALAMMRRENHSRMPVYREQLDDIVGMIHVKDLIAYVGTSEAFRMEPLLRQPLMVAPQL
                     PVLDLLLQMRVRHVHLALVIDEYGGIDGLVTIEDLIETIVGDISDEHDEPTVNMIRER
                     PDGTLDVDARTPVATFEEKVGPVLTRDEREAEIETVGGLVFRLAGHVPTRGEIVAHES
                     GTVFRILDSDARHIRRVRVRLPPHDATHSQPEGQAGRP"
     CDS             784908..785531
                     /codon_start=1
                     /locus_tag="GLX_06780"
                     /product="thiol:disulfide interchange protein"
                     /protein_id="BAK83090.1"
                     /transl_table=11
                     /translation="MPIKRRTLLTLVPALITGGSLLSGRAMAQATDPRLTIRAAGNPQ
                     AKVQVEEWFSLTCTHCARFAAEIFPEVRSKLIDTGKVYYIFRDFPLDQVALTASMVAR
                     SLPPERYEPFVLALLSSQDRWAFGKDVNPEQEIQKMAALAGMSTDLFQQTIHDDKLRH
                     AIMDEEDRAQALYKIDGTPTFRFNGKEQVAQELTYDEFAKKVEAASH"
     CDS             785548..790083
                     /codon_start=1
                     /gene="smc"
                     /locus_tag="GLX_06790"
                     /product="chromosome segregation protein SMC"
                     /protein_id="BAK83091.1"
                     /transl_table=11
                     /translation="MTARFVRLRIAGFKSFADPVSVDILPGLTGIVGPNGCGKSNVVE
                     ALRWVMGETNARSLRGGEMDDLIFAGTTARAARNMAEVTLTLEGAAEVAPAPFTGQDE
                     LQVCRRADRGAGSGYRINGRTTRGRDVQTLFADLASGARSSAMVSQGRVSALVNARPE
                     ERRTILEEAAGITGLHGRRHEAELKLRATEANLARAEDLRLQLEARLGDLQEQSEQAG
                     RYRELSQGLREAETALLALLHARAHHNVAESEAALHTARADLKTAEELAENAVVADFE
                     MTRTLPALREALDTRRTALERFKVRAETIADELASAEATLATAQARLAECEGVQESAL
                     ARRDDASRMLTQLEAERAQMEERLAALPALQDTMQAERTTLAHNVSDLAVRVEQATTT
                     LREAQLQTTQARAVLETATAAHTGLAARHAELAAEIAALEADMPTEAAITQSDARIAE
                     AQVAATTALHAREDVTRAHSDAVLQAGLARNAATESARVHAQATQDANAVKTRLDALE
                     RDVTGLATRVEQARAALVPEAERTRLETVLHEADATLATIRTDLGGAEEARAQATQAE
                     ILANARLKEAHATRQAATEALRAAQAAHDRTASEAETLATGMQTLRGQAVPDSALHAL
                     TARRTEAEQALQAAHTRMDTAESALLAATRADEAQTARLAQIRATLSGLEAEADGLAR
                     ALHSDTEQTATSGVTLAESLHVPAGLETALAVVLADGLDAAVKGDAPRQWHDLPPASP
                     APFPATGICPLSTLMEAPPALSRALGAAGLLPEGMAGDSLQAGLAPGQCLVTREGALW
                     RWDGYVQAPNLPGRAALRLKQLGRLRELRAELKQVRTEIPALEEAAQAATTTRQHAAS
                     MLDTAREARSSAENALQTARTEEAELSRQHATIAAQLHTLSVQHETAQAARTEAEAAL
                     ARARAQEAALPDAAVLEQARQAAAQQATRAMDEEKRLRTARQQAETTVERARQTVQAT
                     QTSHNEAETRLHAMMPELERLRTDREALVTELATRQAHLASLPAPAMAQDAATQAAST
                     ATAAEQALKQAREAVATTTAGLEHERATRTALEQKMRETGSQLEARRARMADLAQALE
                     QAMVDEEAARSHLAALPDITELERALGVLRAQAAETRVREEELREALSALHAEETALR
                     QRFEASGQDMTQWAARVEAAGLEAEAAQARLDNARAEHDRAAPLPVAVRTRRDAIATE
                     LEDHAERHDAAAQALQQAQARVAELQQTRGVAQDTLTAAREALLRAEGRREQAQVLMA
                     QLMAESEPPPGIVPTDLSVGAETSLRRKVGRLERQREELGPVNLRAEIEAQDASGKID
                     TILHERDELQSAIARLRGMIGQLNREGRERLMAVFSRIDQHFQALFARMFNGGRAHLG
                     MVGNDDPLQAGLEIYAQPPGKKLATLSLLSGGEQALTALSLIFAVFRCNPAPVCVLDE
                     VDAPLDDANVGRFCSLLGDMVAEAGTRFLVVTHHQLTMAHMDRLYGVTMQERGVSRVL
                     SVDLERATEMVDSEPAR"
     CDS             complement(790213..791730)
                     /codon_start=1
                     /locus_tag="GLX_06800"
                     /product="acetyl-CoA hydrolase"
                     /protein_id="BAK83092.1"
                     /transl_table=11
                     /translation="MIDHTRIRNAALRAKITTAEQAAALVRPGSTVGTSGFTGAGYPK
                     AVPQALAELMEREHAKGNEYRIRLLTGASTGPELDGALAKVNGISFRMPYNSDPGLRA
                     RINKGETEYLDMHLSHVAPMAWAGFFGEIDTAIIEATAIREDGSIVPSSSVGNSKTWL
                     DTAKQVIIEVNSWQDAALEGMHDIWYGAALPPHRQPIPLLRPDDRIGGTSLKVDPAKI
                     VAIVETNAPDRNAPFSPPDETARGIAGHLMEFFRHEVKMGRLPPSLLPLQSGVGNVAN
                     AVMGGLEEGPFNDLTAYTEVIQDGMLGMLETGKMRVASATAFSLSPEAAESLNARMRE
                     FQKKIILRPQDISNHPGLIRRLGCIAMNGLIESDIYGNVNSTQIMGSKIQNGIGGSGD
                     FARNAYISVFMTPSTAKGGKISAIVPMASHVDHITQDSQVLVTEQGLADLRGLSPKQR
                     AEVIIANCAHPDYRPMLQDYYKRARAGSFGQQSPHLLTEALSWHQRFVETGSMMP"
     CDS             792297..793061
                     /codon_start=1
                     /locus_tag="GLX_06810"
                     /product="phosphatase"
                     /protein_id="BAK83093.1"
                     /transl_table=11
                     /translation="MAQAGLAAADSEHTQRAPTAPAHPLAGLLAGRKLRVVGDVHGDL
                     HAFRHAAATDRFVIQLGDLIDYGPDSAGTFRLMQQLMDERRGLFILGNHDRKLARALQ
                     GRKMRRDPPLMETLAQFMAEENADVHQRALADLAQAPPWVVIGQSVFVHGGFHIRMLG
                     EAPPPGLGTVTPLLSRALFGETTGRMQKDGYPERRLNWVDHIPAGYTVYCGHDRRSTD
                     GRPWVRHGRMGGRAIFTDTGAGKGGHLAWIDLPPLL"
     CDS             793107..793424
                     /codon_start=1
                     /locus_tag="GLX_06820"
                     /product="chorismate mutase"
                     /protein_id="BAK83094.1"
                     /transl_table=11
                     /translation="MNSTQAKHEAAQHKLEDLRRSIDNIDAALIYMLAERFRHTQAVG
                     RLKAANDMPPADPAREARQVARLRELATAARLDPDFAEKFLAFIIREVIRHHEAIAAG
                     TEA"
     CDS             793433..793981
                     /codon_start=1
                     /locus_tag="GLX_06830"
                     /product="phosphohistidine phosphatase"
                     /protein_id="BAK83095.1"
                     /transl_table=11
                     /translation="MTGAAPSAPPARQLLLMRHAHAAPAPFGEMGQDADMRRPLTPQG
                     RTMAARNGDILRQRRFAPELVLVSPALRTVQTLEALGSFYGDRQPAIRHVNTLYEATP
                     ATIRGLLYETPEKCSNIMILGHNPGLSALVWHWACGRCGPEHENMLQHGFPPAAMAWF
                     SADKAWNTATDSEIHLQDLSCR"
     CDS             794205..795503
                     /codon_start=1
                     /locus_tag="GLX_06840"
                     /product="citrate synthase"
                     /protein_id="BAK83096.1"
                     /transl_table=11
                     /translation="MSESEKTATISLNGKDVALPVLSGTLGPDVIDIRKLPAQAGVFT
                     YDPGYGETASCSSKITFIDGEKGILLHRGYPIAQLAEQATFMEVAYLLLNGELPAKAE
                     YDTFVHSIKHHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALSSFYHEGLDVSNAATR
                     YQSALRIIAKIPTIAAWAYKYTQGETFVYPRNDLSYAENFLSMMFAVPSEPYKVNPVL
                     ARAMDRILILHADHEQNASTSTVRLAGSTGANPFACISAGIAALWGPAHGGANEAVLK
                     MLAEIGHKDNIPEFIAKVKDKNSGVRLMGFGHRVYKNFDPRAKIMQATCHEVLSELGI
                     KDDPLLDLAIELEKIAIHDEYFVKRSLYPNVDFYSGIILKAMGIPTSMFTVLFAVART
                     TGWISQWKEMIEEPGQRIGRPRQLYTGAPERDFTPFDKRG"
     CDS             complement(795713..795967)
                     /codon_start=1
                     /locus_tag="GLX_06850"
                     /product="hypothetical protein"
                     /protein_id="BAK83097.1"
                     /transl_table=11
                     /translation="MDHRIVSVENSRISRKCERAVITAYQELRGVGTSDVSAFHACTT
                     LYRIHHPESSLNEARRLVSEWIDHHVIQKRPGPTNGCECD"
     CDS             796151..796954
                     /codon_start=1
                     /locus_tag="GLX_06860"
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="BAK83098.1"
                     /transl_table=11
                     /translation="MSFTTDDIFRRRQGMHDATGNGAGLSTGSTAWDRDAALMTARLL
                     LEIKAVNFRPDDPYTLTSGWKSPVYIDCRRIIFFPRARQKIMELAVEKIGRHVGYESI
                     DAVVGGETAGIPFAAWIADRMMAPMAYVRKKPKGFGRNAQIEGDVPEGMRTLLVEDLT
                     TDGSSKVQFANALRNAGAIVDHTFVVFFYGVFPGAYRTLADMNISLHALCTWWDVLEA
                     CAGKPYFAEKDAAEVRRFLEDPCAWSARHGGVGSAEEALALKAKRDAGS"
     CDS             796970..797806
                     /codon_start=1
                     /locus_tag="GLX_06870"
                     /product="glutamate racemase"
                     /protein_id="BAK83099.1"
                     /transl_table=11
                     /translation="MARILVFDSGIGGLGVVAQLRLLLPGVPIDYLADTAIFPYGEQP
                     DSTLRQRIVSLLGQAIARLCPSVVVIACNTASTLALDSLRATYDVPFVGCVPPIKWAA
                     DRTRTGTIGLLATRATVRRPYLQELHIRFAPHCTLLAHGARGLADMAERAFRGEPPDR
                     TQLAIELAGLFGQPGGAAIDVVGIGCTHYTFLLEALRESGPVGVAWLDPASAVARQTA
                     RVLAQTPAISRAPGAERVCFTALPPDFPALLPGLGRLGYGADAISLFAAGVNLAAHPI
                     EN"
     CDS             complement(797938..799014)
                     /codon_start=1
                     /locus_tag="GLX_06880"
                     /product="decaprenyl diphosphate synthase"
                     /protein_id="BAK83100.1"
                     /transl_table=11
                     /translation="MALAVSLPESDQTASQKDKGASRPMADGSEVALRDLAEYLADDM
                     AACNRAIVERMDSPVALIPQLAAHLVAAGGKRLRPLLTLASARLCGYRPDATHQRHVG
                     LAACVEFIHTATLLHDDVVDESSLRRGMASANAVFGNKASVLVGDFLFARSFQLMTDD
                     GSLKVMNILSSASATIAEGEVLQMSTQNDLSTRIDQYLEVIHGKTAALFAAACRVGAV
                     VAERDETVERALESYGTNLGMAFQLVDDALDYAADQAHLGKTVGDDFREGKITLPVLA
                     AYAAGSEEDRAFWQRVIERSEQQPEDLDHALQLIARTDAIHITLDRATEYADAARDAL
                     SIFPPSHLRQLLQDTASYTVSRLR"
     CDS             799037..799897
                     /codon_start=1
                     /locus_tag="GLX_06890"
                     /product="methyltransferase"
                     /protein_id="BAK83101.1"
                     /transl_table=11
                     /translation="MYQHGYEYMGGAGITVKPEHAGRGCAVVDGLPLPPAGIDPVTTG
                     TLLGGKVLYRQFPTGNRTGLEPVLMAAFVPARPGQVVVEAGCGAGAGLLCLANRVHHL
                     TGIGLEQDSATACLAAHNFSLNARDCLRVRTTTLPALPDDPLLSGPGLRRIDHAFANP
                     PWHGHDSSASGHMQRDLARRLPESGLAGWVRVLTAQLRHHGTLTLALPASLLAGGVSA
                     METARLGGIRVFPFWPHAGQAARIVLVQGRANTRAGSEMLPGLVLHEADGRFTPAARA
                     VLEDGAALPA"
     CDS             complement(800001..801002)
                     /codon_start=1
                     /locus_tag="GLX_06900"
                     /product="ribonucleotide-diphosphate reductase beta
                     subunit"
                     /protein_id="BAK83102.1"
                     /transl_table=11
                     /translation="MTDTAPAAEAHVEQSLLTANPVYKPFRYPWAYDAWLTQQRVHWL
                     PEEVPLADDVKDWHRTLTESERHLVTQIFRFFTQSDVEVNNCYMKHYSQVFKPTEVLM
                     MLSAFSNIETIHIAAYSHLLDTIGMPETEYSAFLKYKEMKDKYDYMQQFSVSDNYQIA
                     RTLAAFGAFTEGLQLFASFAILLNFPRHNKLKGMGQIVSWSVRDESLHCDSMARLFRV
                     FVQENPEIWTDTLRDDIRQICRDIVEHEDAFIDLSFEMGAVEGLDAEQVKRYIRFVAN
                     RRLGQLGLDGIYDIATNPLPWVDEMVNAVEHANFFENRATEYSRASTTGTWDEAFGD"
     CDS             complement(801112..803067)
                     /codon_start=1
                     /locus_tag="GLX_06910"
                     /product="ribonucleotide-diphosphate reductase alpha
                     subunit"
                     /protein_id="BAK83103.1"
                     /transl_table=11
                     /translation="MVLDGVSGGMVDGSASGDGTVQGKDSATMPEMSEMTDMLDNVVQ
                     LPGHHPVRVDRSRDALLTAFGKATLDNRYLMPGESYQDLFGRVASYYGADAAHAQRLY
                     DYISRHWFMPATPVLSNGGTTRGLPISCFLNEANDSLRGIVDLWNENVWLASKGGGIG
                     SYWGNLRSIGENVGRNGKTSGVIPFIRVMDSLTLAISQGSLRRGSAAVYLPVWHPEIE
                     EFIELRRPTGGDPNRKALNLHHGVLVSDAFMRAVADDDEWALLSPKDNTVIRKVSARG
                     LWIRILTARMEQGEPYIIFSDHVNNARPEHHKLAGLEVKTSNLCAEITLPTGMDQHGR
                     ERTAVCCLSSLNLETWEEWKDNPQFIEDVMLFLDNVLQDFIDRAPDDMERARYAAMRE
                     RSVGLGVMGFHSFLQANNVPFESVVAKSWNRKIFKHIRAQADAASRKLAEVRGPCPDA
                     ADYGVMERFSNKMAIAPTASISIIAGNASPGIEPIAANVFLQKTLSGSFTVRNRHLDR
                     LLTERGQNTSEVWSSITLNKGSVQHLDFLTQQEKDVFKTAFELDQRWVIEHAADRAPF
                     ICQAQSINIFLPANVHKRDLHQIHYMAWKRGVKSLYYCRSLSIQRADAVSDGQEKRDM
                     SHREGSGPADKAGPATTTDYEECLACQ"
     CDS             complement(803296..803760)
                     /codon_start=1
                     /locus_tag="GLX_06920"
                     /product="molybdopterin converting factor large subunit"
                     /protein_id="BAK83104.1"
                     /transl_table=11
                     /translation="MPRVTIRVQAEVFDSTHETTALLAGQAEVGGVGAFTGFVRGGGS
                     LVALELEHYPGMTETMMRQIAESACARFGLAGCTIIHRVGRLKVGAPIVLVLCASAHR
                     AAALEATEFMMDWLKTHAPFWKREEFADGHSAWVEPRACDDAATTRWGTLGA"
     CDS             complement(803768..804022)
                     /codon_start=1
                     /locus_tag="GLX_06930"
                     /product="molybdopterin converting factor small subunit"
                     /protein_id="BAK83105.1"
                     /transl_table=11
                     /translation="MLRILYFAWLRDRLGRSGETVSLSAGVDSVADLISQLRARGGAY
                     AEVFARPELIRVAVNQSFATNAATIAANDEIAFFPPVTGG"
     CDS             complement(804076..804615)
                     /codon_start=1
                     /locus_tag="GLX_06940"
                     /product="hypothetical protein"
                     /protein_id="BAK83106.1"
                     /transl_table=11
                     /translation="MPDRQGKGENAVRNAIVLSLLLCLAGCGGFGKILSDNTELPGSL
                     PNTPHADVENLRRVAGHAPQMLPIMQQEHNIWPMLPSGQAALAAIGAGPDGPRSAVER
                     SRLVEREVDLPVGGEMQIGNDPAPDGMQAEGLPVSALPSVGEATHKDVSDSAIIVPNG
                     DGTSTVVGADGTVHEQQAP"
     CDS             complement(804677..805276)
                     /