LOCUS       AP012029             3532378 bp    DNA     circular BCT 07-OCT-2016
DEFINITION  Anaerolinea thermophila UNI-1 DNA, complete genome.
ACCESSION   AP012029
VERSION     AP012029.1
DBLINK      BioProject:PRJNA60099
            BioSample:SAMD00061114
KEYWORDS    .
SOURCE      Anaerolinea thermophila UNI-1
  ORGANISM  Anaerolinea thermophila UNI-1
            Bacteria; Chloroflexi; Anaerolineae; Anaerolineales;
            Anaerolineaceae; Anaerolinea.
REFERENCE   1  (bases 1 to 3532378)
  AUTHORS   Oguchi,A., Ankai,A., Fukui,S., Takahashi,M., Yashiro,I.,
            Hosoyama,A., Narita-Yamada,S., Kishi,E., Watanabe,Y., Ichikawa,N.,
            Takasaki,K., Sekiguchi,Y., Hanada,S. and Fujita,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-DEC-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Bioresource
            Information Center (NBIC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Narita-Yamada,S., Kishi,E., Watanabe,Y., Takasaki,K., Ankai,A.,
            Oguchi,A., Fukui,S., Takahashi,M., Yashiro,I., Hosoyama,A.,
            Sekiguchi,Y., Hanada,S. and Fujita,N.
  TITLE     Whole genome sequence of Anaerolinea thermophila UNI-1.
  JOURNAL   Unpublished (2010)
COMMENT     ##Genome-Assembly-Data-START##
            Genome Coverage       :: 16x
            Sequencing Technology :: Sanger
            ##Genome-Assembly-Data-END##
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps
            and the genomic and proteomic data of the microorganisms
            analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..3532378
                     /db_xref="NBRC:100420"
                     /db_xref="taxon:926569"
                     /mol_type="genomic DNA"
                     /note="strain coidentity: NBRC 100420"
                     /organism="Anaerolinea thermophila UNI-1"
                     /strain="UNI-1"
     CDS             complement(57..194)
                     /codon_start=1
                     /locus_tag="ANT_00010"
                     /product="hypothetical protein"
                     /protein_id="BAJ62035.1"
                     /transl_table=11
                     /translation="MNLKTHSLYKFSNFIHKQEGLSTVFRKLSTIFVENEENAGFYIW
                     G"
     CDS             complement(534..1280)
                     /codon_start=1
                     /locus_tag="ANT_00020"
                     /product="hypothetical protein"
                     /protein_id="BAJ62036.1"
                     /transl_table=11
                     /translation="MTPIPLSEVAQFVEENIGRFHERRLERLQNLKLKEVLKRKNPYL
                     FKAKNIHVAHDLVKSLLDAFLSSQEETVFGEFLEQLAIFVCKRVYGGRKSSSEGIDLE
                     FEKDGVVYLVSVKSGPNWGNSEQIKKMRLAFQKAIKTLRTNQPKINVQAVNGCCYGKE
                     YRDHGDYIKMCGQEFWTFISGNERLYLDIIEPLGHRAKERNEAFQREYARIINLFTDE
                     FSRDFCQDGIIDWEKLVAFNSEKKESEKKN"
     CDS             complement(1258..2133)
                     /codon_start=1
                     /EC_number="2.1.1.113"
                     /locus_tag="ANT_00030"
                     /product="putative N-4 cytosine-specific
                     methyltransferase"
                     /protein_id="BAJ62037.1"
                     /transl_table=11
                     /translation="MRVETRLMLGDCREKLKEIPDNFIDLIFTSPPYADSRSNTYGGI
                     KPDEYVEWFLPISKELLRVLKPTGTFILNIKEKVVNGERHTYVIELILEMRKQGWLWT
                     EEFIWHKKNSYPGKWPNRFRDAWERLLQFNKQRHFHMYQEEVMIPMGSWADKRLKNLS
                     HTDLVRDNSRVGSGFGKRVANWIGRNKVYPTNVLHLATETKNRNHSAVFPEDLPEWFI
                     KLFTREGDWVLDPFMGSGTTNRVAQRMGRNSIGIEILPEYFALSQQSIQPVLEVPEQL
                     MLLEEKEPYDAHPPE"
     CDS             complement(2130..2270)
                     /codon_start=1
                     /locus_tag="ANT_00040"
                     /product="hypothetical protein"
                     /protein_id="BAJ62038.1"
                     /transl_table=11
                     /translation="MSLRAPERGEAIPVNKGIASFPTVEIFRNDTFYFLEPLFNQVII
                     KV"
     CDS             complement(2300..3697)
                     /codon_start=1
                     /EC_number="1.8.1.4"
                     /gene="lpd"
                     /locus_tag="ANT_00050"
                     /note="protein synonym:dihydrolipoyl dehydrogenase"
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="BAJ62039.1"
                     /transl_table=11
                     /translation="MNEYDVIVIGAGPGGYVSAIRSAQLGLKTAIVDKQWLGGVCLNV
                     GCIPSKSLLKNAEVAHTLRERGREFGFAFENLTLDYSVAVKRSRQVSDRLTKGVGFLM
                     KKNGIDVHMGTARLTARDTVRVTDKDGKVTDLKAKNIIIATGASAAVIPGVKVDGEKV
                     VTYWEAILQTRLPKSVIVIGGGAIGLEFSTVWNAYGSEVTIVEMLPRIAPLEDEEISA
                     ELTKAFQKRGINVLAGHRVQSVETTESGVRVVVSGESGEKTLEAEQALLAIGFKPNSR
                     DLGLEEVGVKVNERGFIEVDERMATSVPGIWAIGDVTGKLLLAHVASAQGIACAEAIA
                     SLPVQPIDYRMIPRATYCQPQVASFGLTEAQAKEAGYSVKVGRFPFQPNGKALGLGDY
                     TGFVKIIVDEKHGEILGAHMIGPEVTELLPELTLAQRSELTIEEVARNIHAHPTLSEV
                     IMEAAEAALGHAIHI"
     CDS             complement(3831..6086)
                     /codon_start=1
                     /locus_tag="ANT_00060"
                     /product="putative signaling protein"
                     /protein_id="BAJ62040.1"
                     /transl_table=11
                     /translation="MKLPVHFQKEALRISGLYLLFAGLWILFSDRLLEWLVPNPHRLA
                     LFQTYKGWGFVLITALLLYLTLRARLTILEQERSQRLRVSQQLETYLSVSPVMNYVLE
                     ASPDGKPKPLWVSENIEHILGFTPDEALSFEWWVTHVYPEDRQRALELSAKVLQYGYA
                     DLEYRFFHKNGSILWIRDQMRLMRRDEKNGNVEIIGTWSDITERVQSQQRIQQQLDML
                     SALTGQARALAESLQVENAAQETVRLACQVLGAKLAWLGRAEPDGHVTVLTVYPPEHT
                     YPHQIGVRWDETPHGNGPTGRAIRTRTLQVVPDLLSQPNIPEWRELLLKHELYTNAAF
                     PLISRGRVFGALTVYSDQIGFFNEERLQTFQTLAYLAAAALENARLFGQTTRRLEQIS
                     ALREIDQAISNSLDLSLTLRVALKQLREQLQVDAADVLLLDPLTQQLEYAASVGFSSD
                     EIEQIRLRVGEGPAGRAARERQLVFIPSIQEEIQQFRWGDLLQNEGFTCYYGTPLIAK
                     GQVKGVVEAFLRRSQPLDEEAVDFFQTLAGQIAIAVDNATLFEELQRSNADLILAYDQ
                     TIEGWSRALDLRDRETEGHSQRVTELTLKIARAMGMSEEQLVHVRRGALLHDIGKMGV
                     PDAILLKPGALNDEEWAIMRQHPTLAFQMLLPIQYLRPALDIPYCHHEKWDGTGYPRR
                     LKGEQIPLAARIFAVVDVWDALRSDRPYRPAWSVEKTLAFIQEHAGSHFDPRVVEVFM
                     RVIREEGEKNF"
     CDS             complement(6175..6597)
                     /codon_start=1
                     /locus_tag="ANT_00070"
                     /product="hypothetical protein"
                     /protein_id="BAJ62041.1"
                     /transl_table=11
                     /translation="MLPSDDLSYLLAHMSPALHSRGYRFRSLPEEEALPWMTQSLGWF
                     REEEGITLILPTPAGEEEWACITLSVYSSLTAVGFLALIARHLAEADIPLNVVSAVHH
                     DHLFVPWERRTQALQVLENVIRQARHTSGEDCTHRPDC"
     CDS             6941..7396
                     /codon_start=1
                     /locus_tag="ANT_00080"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BAJ62042.1"
                     /transl_table=11
                     /translation="MEGEGLNGFKGFQLDFRSGVPIYEQIVAHVRQQIESGTLQPGDQ
                     LPTVRQLALELRVNFNTVARAYRLLDEAGLISTQQGRGTYILEQPPPERGERLRQRTL
                     EEMTEDYLMGALRRGYDLEEIEQVFYRAVQRRREGQYELTDEQKGQMED"
     CDS             7400..8386
                     /codon_start=1
                     /locus_tag="ANT_00090"
                     /product="hypothetical protein"
                     /protein_id="BAJ62043.1"
                     /transl_table=11
                     /translation="MSQSMQPNEGSKTRRESKEAVLTAQARSAQDAHVNPLAVALFIV
                     FITLAVVLAAVLEARGAGDIAIVTAVLLPTLIGVYILFAFRMARQWEKAVVLRLGRFH
                     SLRGPGVFWMLPVIDSIATWIDHRVMVTPFSAEKTLTKDTVPVDVDAVLFWVVWDAEK
                     AALEVEDYRAAITWAAQTALREVIGQMPLADILVGRAKMDADLQKIIDERTTPWGVTV
                     QSVEIRDIIIPQALEDAMSRQAQAERERQARVILGESEKQIAESFAEASRAYQNNPTA
                     LHLRAMNMLFEGLKEKGALVIVPSSAVDTMNLGGLSGVVALGQQHLPKEGME"
     CDS             8481..9131
                     /codon_start=1
                     /locus_tag="ANT_00100"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62044.1"
                     /transl_table=11
                     /translation="MSKKAINITILLIVLAMLAFGAWAYPRLPEQAPSHWNARGEVDG
                     TMPRIWAILLMPLMTLGIGYLLVYIPAIDPLGRNVEQFRRVYHLFIAGFCVYMAYVHG
                     LTLLAGLGIAFNMTQMLLPAMGLLFIGIGSLLKHARPNWFIGIRTPWTLSSEAVWQET
                     HRVGAWIFRAAGALSVLAAFLPPMLSPWVIMVAVLGAAFGTVVYSYVVYRRVNPKG"
     CDS             9240..10172
                     /codon_start=1
                     /locus_tag="ANT_00110"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62045.1"
                     /transl_table=11
                     /translation="METIIVEHLTHAFGERRALEDLSFTVGEGEVFALLGPNGAGKTT
                     TVRLLNGLYRATAGSVRVLGLEPATQGEQVRAQTGVLTESPALYERLTARQNLRFFGE
                     MAGMPAGELRRRMEELLEFFDLAERADERVATFSKGMKQRLALARALLNRPKILFLDE
                     PTAGLDPEASRQVRELIASLRRENGQTVFLCTHILTEAERLCDRVLILHQGRALAVGS
                     LAELQQRFNPGVWVEVQLLEPRAIAPGDLTPALQVQAQDALLRVQVSRLEDIPTLIHR
                     LAGLGTPILRVEPLRPSLEEIYFKLQDQAEGGQP"
     CDS             10169..10996
                     /codon_start=1
                     /locus_tag="ANT_00120"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62046.1"
                     /transl_table=11
                     /translation="MNLQRLWTLARKDWADAFKNTSVVVPMIVLPFFFVVLFPVLFIV
                     IPAFSPQIGQSLASDPDIQPLLNNLPPFLQPYTQGLDVQRTVIVLMLGLMLSPMFLIL
                     PLMTSTVIAADSFAGERERKTIEALLYTPASDRELFFGKVLAALIPAVGLTWGSFLVY
                     TLVVNLASYWTMGWVWFPLPTWYPLIFWISPALSLLGVAFTVWISARNPTFMGAYQMS
                     GVLVVLVLPLLFGQIAGVVYLTVEVGLLAGAVIWAVALGLTRFVAHGFNRQRLLAGL"
     CDS             complement(11073..11207)
                     /codon_start=1
                     /locus_tag="ANT_00130"
                     /product="hypothetical protein"
                     /protein_id="BAJ62047.1"
                     /transl_table=11
                     /translation="MIKGVYVQTKGTLQWYVPARTIRHPLSLLVTTARPETAERRTSA
                     "
     CDS             11308..11718
                     /codon_start=1
                     /locus_tag="ANT_00140"
                     /product="putative Rrf2 family DNA binding protein"
                     /protein_id="BAJ62048.1"
                     /transl_table=11
                     /translation="MQITRQADYALRAMVYLARLSPNQRASTSQIAEEQHIPPSFLAK
                     IISQLSIAGLIHTSRGARGGVTLARPPEEITVLDVVEAIDGPIALNECTSPSGVCMFG
                     EDCPMKPIWCDTQKELIDRLRRTTFAQALATQTR"
     CDS             11729..11986
                     /codon_start=1
                     /locus_tag="ANT_00150"
                     /product="hypothetical protein"
                     /protein_id="BAJ62049.1"
                     /transl_table=11
                     /translation="MQRTPVARSWVVMMHGGFAALDWGNGLYLDLTRGQFFTATEKDV
                     SHRASDADLDLLVRLGCIEGYDRLNVYLTSLPEPPHETEKS"
     CDS             12059..12697
                     /codon_start=1
                     /locus_tag="ANT_00160"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62050.1"
                     /transl_table=11
                     /translation="MQTLLSTLRRRRWVWMLVNLALIALLTAVVPPEKTLGERIRLVY
                     FHGAWVWTGKIAFALAGLSGLAALIFLPARSRLYPRWAEISLALGRTGLFFWLTYLPV
                     SLLVQQINWGGIFWDEPRWRIPATFGVVAVLVQVAISLFDLPWLTVLVNAVFGAALWL
                     ALGGAENVLHPDSPIFSSNSVPIEGFFVALLGLSLLFMAQFALWMHDRRRPA"
     CDS             complement(12648..13361)
                     /codon_start=1
                     /EC_number="3.2.2.-"
                     /locus_tag="ANT_00170"
                     /product="putative DNA glycosylase"
                     /protein_id="BAJ62051.1"
                     /transl_table=11
                     /translation="MSASPDPRHLERAQTVYRLLEAAYGIPEWRNPLPPLDELVSTIL
                     SQNTNDRNRDLAYQRLRERFPTWEDVRDAPLEQVIEAIRPAGLANQKGARLQEVLRQI
                     TAERGGLDLSFLQDLPAEEARTWLLRFKGVGVKTASIVLLFSLNKPAFPVDTHVHRVS
                     GRIGLRPPQMSAEDAHAYLAQVFTPEQYAAGHLNLIRLGREVCHARKPACPRCPLRAV
                     CEWATQGGAGRASTGQTAP"
     CDS             complement(13387..14892)
                     /codon_start=1
                     /EC_number="2.7.1.12"
                     /locus_tag="ANT_00180"
                     /note="protein synonym:gluconate kinase"
                     /product="putative gluconokinase"
                     /protein_id="BAJ62052.1"
                     /transl_table=11
                     /translation="MSPCFLGLDAGTGSCKSALLDENGNLIAEGSGAYRLPVHQTTTD
                     QDAEAVLAGILQAGREALEKAGIPPQEVAGISLGAAMHSLLAVDAHGQPLTGAMTWAD
                     NRAQAQADALRGTPEGDALYRRTGCPIHPMYPLYKARWLKEHRPELFRRAAKLVTLRD
                     YALYRLCGVWVTDPSMASSTGWFNLHTFGWDANALAFSGVSAAQLPEIHPPDTSFPLR
                     PSPLADALGLLPGTPVTLGCSDGVNSNLGAGAVREGQAVLMIGTSGALRQFSAQARFH
                     PGQGSWCYAVERGRFLAGGAINNGGLALTTLRDWFAALPGASALTVEDLLALAEQAPP
                     GAGGLVALPFFSGERSPDWNAQARGVFFGLTPAHRPAHLARAVLEGVAFRLRAVMEML
                     AETGTVIREIRASGGFVRSPLWLSIVASVLGQPLHLPASGETSSRGAAFWAMRGAGAL
                     ADFDILPERIAIVQTVHPDPLAQERYQRVYPLAQSLYRALLPFYDALAHLD"
     CDS             15102..15479
                     /codon_start=1
                     /locus_tag="ANT_00190"
                     /product="hypothetical protein"
                     /protein_id="BAJ62053.1"
                     /transl_table=11
                     /translation="MPEKSRQIIVGGGGFFRTLSNQVRLIARLVADRRVSPLVKVLPI
                     ASVVYMFIPTDALPLLPFDDAALIWLANSLFLEMCPQDVVEEHRRAIEGDTTIVEIPP
                     QKPAPEDDNIIDAEFREEGPLSS"
     CDS             15479..16867
                     /codon_start=1
                     /locus_tag="ANT_00200"
                     /product="hypothetical protein"
                     /protein_id="BAJ62054.1"
                     /transl_table=11
                     /translation="MVIKEVTLRFVRRLFPLILLLGVLLAACSPQATPSPQPPTTTAP
                     APSAPETPTLYAPPAASNAGGTVPTLEGYQPPAETTPVPTSEAAYPAPGGNTVSSVTA
                     FPDPAQFTWVQAAAGFQRPLDLADLSADGSRLLVLEQRGVIALVENGARRETPFLDIV
                     ERVGSSGNEQGLLGIALHPRFNENGFFYVNYTDRKGDTVIARFTANAERTAADPASEY
                     VLLRVDQPAANHNGGGLTFGRDGYLYIGLGDGGQGGDPWGNAQSLKTHLGKLLRISVD
                     GGEPYAIPANNPFADGQKGLAEIWAYGLRNPWRFSFDRLTGDLYIGDVGQNLYEEIDF
                     LPAGSPGGANFGWDYREGLHPYEGTPPADAVFVEPVAEYAHPVGCSVTGGFVYRGAAL
                     PEFQGVYLYADYCTGKVWGLLRQADGTWKSQELFQLGGVSVSSFGQDALGEVYITDHQ
                     NGALLKLVRQSQ"
     CDS             16890..17138
                     /codon_start=1
                     /locus_tag="ANT_00210"
                     /product="hypothetical protein"
                     /protein_id="BAJ62055.1"
                     /transl_table=11
                     /translation="MAKRVWQTIKVQYCRHVGREVSLEAEVIYPDEHLPDEKPRIVAH
                     RCSRGAECGLLSEAACIWAGTNPDVDPFAEKPDTPETK"
     CDS             complement(17223..17846)
                     /codon_start=1
                     /locus_tag="ANT_00220"
                     /product="hypothetical protein"
                     /protein_id="BAJ62056.1"
                     /transl_table=11
                     /translation="MARTPKPSGRKLSPKGTPLRKRSTKQRELRQRILIVCEGKQTEP
                     NYFKRFRVNAVVEAFGLGRSPLDLVKYAQDYRKKEGFDQAWVVFDRDNVQASQFNQAI
                     SEAQKSGIKVAYSNPFFEVWFLLHYGYHNTPMNREKYIEKLSQNLKRPYQKNDSSLYD
                     DLLSRQSTAISNAQRLLASYTPHDPAQDDPCTTVHLLVEELNKHLIP"
     CDS             complement(17815..19146)
                     /codon_start=1
                     /locus_tag="ANT_00230"
                     /product="hypothetical protein"
                     /protein_id="BAJ62057.1"
                     /transl_table=11
                     /translation="MLIEFSVANFRSFYQTVTLSLLATPLKEKESRLNTDNLFEVNRL
                     KLLRSAAIYGANASGKSNLVRAIGFMRRFVLDSATEFQSGEKIPVERFRLNREARQKP
                     AVFQIIFALNNKRYRYGFEVDEERVHSEWLYQTVQRESLLFIREGNDYEVSTPFRREA
                     PAKLREMTRSNALFLSVMAQFNSPLAVSLLEWFRKRLQVVSGLKDEFYAPYTMKQLQE
                     HEPFRQFAREMIRLADTGITALSVKSESLDSTKIPAELRKFLQEIAEKTGKPAEEISL
                     RSVETTHPVYAGENFVGNETFDIDDESDGTQKFLYLLGPLFDVLKEGKVLVIDELDAR
                     LHPMLSREIVRLFNSPETNPQNAQLIFATHDVGLLGECLLRRDQVWFTQKDRFGASEL
                     YSLAEMKERIDASYLKNYLSGRYGGIPLLGGLRPYVEDILKHGTNTEAERS"
     CDS             19300..20949
                     /codon_start=1
                     /locus_tag="ANT_00240"
                     /product="cytochrome c family protein"
                     /protein_id="BAJ62058.1"
                     /transl_table=11
                     /translation="MVTPKRSVVLWGLPLFVLILLSACAAPVTSSPTPAIAPEEAFFK
                     PSSNCAACHQGLKDSTGADVSIIPEWQTSVMGNAALDPYFRASVQMELLNAPQYADAI
                     QSKCATCHTPMARVTQKAQGQETALYGEQGVLAVGHPLGKLALDGVSCTVCHQIPQPA
                     ADLRHSGDLAIDTATPMGERPLYGALPITEQNRQTMQAASGFVATQSEHVRQSQLCAT
                     CHELYLNYITADGTLSSGDALFYEQTPYSEWLASQYAGQASCQDCHMPQAQGAAPISS
                     ITPQNTYQPFFRHTFTGGNVFLLTLLRDGSVEGVRNPGGTGLDAHIARTSEFLQTRTA
                     VLSITPPRQEGETLAFDVRIDLLTGHKFPTSFPSRRAWLHVTVKDASGKVVFESGGYD
                     REGKISGNDNDDPKAYEPHYTRITAPDEVQIYEPVMQTVSGEVTTYQMLAASYIKDNR
                     LLPRGFDKTQAPKVSEVIGDALNDADFLGGGDTVQYRIPLGSARAPFTVEAQLLYQSV
                     SYRWAKNVLDSQSEPAKDFGAMLAKVGNVPVVVASASAQSR"
     CDS             20956..21882
                     /codon_start=1
                     /EC_number="3.2.2.24"
                     /gene="draG"
                     /locus_tag="ANT_00250"
                     /note="protein synonym:ADP-ribosylglycohydrolase"
                     /note="protein synonym:dinitrogenase reductase-activating
                     glycohydrolase"
                     /product="ADP-ribosyl-[dinitrogen reductase]
                     glycohydrolase"
                     /protein_id="BAJ62059.1"
                     /transl_table=11
                     /translation="MKMTLQNRFRGCLLGLAVGDALGTTVEFRPRGSFEPLTDMLGGG
                     PFHLKPGQWTDDTSMALCLASSLVACRGFDPRDQMERYCRWQDEGYWSSTGDCFDIGG
                     TVAAALARFRATGEPFAGSTDPYSAGNGCIMRLAPIPMFYYPDLDAAEHYAAESSRTT
                     HGAAECVDASRLMARMLVRALAGKSREEVVLGDRETFTGSPRITAIARGEYLEKDEAQ
                     IRSSGYVVHTLEAALWCFWRSESFADAVLRAANLGEDADTTAAVCGQFAGAFYGETGI
                     PAGWLEKLALQEDIRALADALAEGKEEQRLGG"
     CDS             complement(22006..22935)
                     /codon_start=1
                     /locus_tag="ANT_00260"
                     /product="hypothetical protein"
                     /protein_id="BAJ62060.1"
                     /transl_table=11
                     /translation="MKPLHISPSGKWLFHATPQGNVMVWDLSGGTLHAVCDGLWIGHS
                     LDEEHLLTQTPEGVKAWNLPRGEEEPLALLKAELFALHQRVVVRKQPYTLQLDLLDVL
                     TGEMVLNLRFEQDPRYHPRLEACALAPDDRSLLITLAGEFGGQAWAHGYVLGVPGGAR
                     RVKFKVNRHQPPAFFAFTAQPFQVLLQDEMYHLTVLNLEQDRFEQDVWVSGFSGAAAF
                     FPLLPAVLAVSVWEPIVDPAISPFSVQFLDLRRTSGERMRRAAVIAVFQESQPVHDMI
                     FTPDGQTLAVLVSTGAIHLWNLAQGRIERTLEL"
     CDS             23068..24483
                     /codon_start=1
                     /EC_number="3.5.2.2"
                     /locus_tag="ANT_00270"
                     /note="protein synonym:DHPase"
                     /note="protein synonym:dihydropyrimidinase"
                     /product="D-hydantoinase"
                     /protein_id="BAJ62061.1"
                     /transl_table=11
                     /translation="MRTLIKNGTLITAAETFRADILIEGEKIAAIGADLTAPDARVLD
                     AEGKLVLPGGVDVHTHFDLPMFGTVSSDDHYTGHKAAAFGGTTTVIDFVSQDYPNLRQ
                     CVDAWHERVGGKAAVDYSFHMNITHLYPDTLAELPALLDEGISSVKVFTAYNNRLRLP
                     DDDILRVMRVAGKHGILTMMHAENGDVIELLVAEALAQGRTEPVWHARTRPAWSAVEA
                     VLRGAALAGMADAPLYVVHMNAAGEVDMLAYARAQGLPVMGETCPQYLFFSEEDLQRP
                     DGAKWICSPPVRTPADQERLWQGLADGTLQALATDHCPFFYDGTQPIEYEGKPVAIPG
                     KELGRGDFTRIPNGLPGVGDRLPVLWTYGVGAGRLTPNQFVALTATQPARIFGLYPQK
                     GALLPGADADIVLWNPAQRLTYGVRYAHHRTDYNLYEGWELQGFPETVLLRGQVIVHQ
                     GEWRGRPGMGRFLKRSSGEVI"
     CDS             24487..26085
                     /codon_start=1
                     /locus_tag="ANT_00280"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62062.1"
                     /transl_table=11
                     /translation="MLALIPPAVLLLGALTILILRRTRPGVGYAWLTGVLSALLASAF
                     LLFLRWRLPQQVVVQNWLPLSQFTDSPILGLDSISWLYAMSLGVLALGTLLTASARLQ
                     RDVSPTAWAGILSILAVAMLAVYAANLLSLVLTWTLMDLMELVILQANSRERRLGVQT
                     VTAFAVRVSGSFLALTAILMARGQNLPPTFASLAPREALFLLIASGLRLGVLPLHLTA
                     VQGSVARRGLGTALRMASAASVLPVLARLPAGAVPAAWQGGLLALSALAVLYGASAWL
                     AAPDALSARPFWLIATAGMAVACVLHGQPLASLAWGVLLILPGAVFFLYSASQPGTVV
                     FPLIALAGMAGLPFTPLAAGWSGILPRTFSPLEWAFLFPLPLLMLGALRFSLMEGENL
                     RQMERWIQVVYPLGLMVLILGYFLVGVLGLALFPTRESLIGGGVTLALFALGFGLFNL
                     ARRRFSGLIESEALRRSVAQAGAFLADLFGLMWLYRFIGWLYQRVAGVFDLFTSLLEG
                     SGGMLWVFVLLALFISLIRAEVAR"
     CDS             26082..26678
                     /codon_start=1
                     /locus_tag="ANT_00290"
                     /product="hypothetical protein"
                     /protein_id="BAJ62063.1"
                     /transl_table=11
                     /translation="MILEWLFRGLEIAALAAAVYLLVGQEWRHGLVALAVVYAVTAVY
                     ILSVWSPGLAAVKLVTGWMAVAVLGAAQPAEGWRESPPPGWVGTAFHLVAAALVALLV
                     YSVAPLMARYFPVSAPVMHGGLILAGMGLLHLGMSTRPFREVVALLTTLAGFDLLYTG
                     VEQSILVAGVQSLITLGLALVGSYVITAPSMRTGEGQE"
     CDS             26675..27862
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_00300"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62064.1"
                     /transl_table=11
                     /translation="MRLLLIHNDYQQLGGETLAFDAELSLLRQAGHEVILYRRSNEEL
                     RHASALQKFLLGLSVLHSPRAVREVRQLIRTHRPEVAHVHNVFPLISPAVYRLLADEG
                     VPVVQTLHNVRFLCPNGLFYTQGRLCERCKKGNTLHAVRWRCYRNSYPASALYALAIG
                     WHRRRGTFARITRAIALTPFTVQKMVESGLFRAGQMEVLGNFIPDPLPEARSAPPVNG
                     YVAFLGRLSEEKGAHLLIEAARHLPGVTFRLAGEGGQRASLEQRARGLSNVEFVGQIP
                     PEQRWDFLRGAALAVVPSTVYEQFSLAALEAMACGVPVIAARIGGLPYLVEDGVQGRL
                     FTPGNVEELVERIRGLLADPAQAHALGQAGRRTVEERFTSARHLEGLMSIYRKAIHGE
                     TLA"
     CDS             27859..29250
                     /codon_start=1
                     /locus_tag="ANT_00310"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62065.1"
                     /transl_table=11
                     /translation="MNAPLIWILFPLFFAFILWLVRWREGWVMRLGVVLCLLLALLAW
                     LLPIGTGFRVFGNRWEIEPTLALAGRQLVVQNNDRPLLIFVYLIAAFWFGGSREARAH
                     RFMIPYGLAVAALLLAALSVQPFLYAALLVELAVLLSIPLVAPPGKPVGTGALRYLIF
                     QTFAMPFILLAGWALSAVEANPANTFFPLLAQIFLGVGFALWLAVFPFYAWMPLVAEE
                     ADPYPLGYLLMLLPTTFLLLGVRYINAVAWLKDLSALWEVLRLTGVVMILTAGGWAVF
                     QRHLGRLFAYAVTIETGTSLLALSLNTPQSMETFAMLFLPRVLALALWALSASVMRSG
                     GKGLRFEDLDRAAETFPFASAGLATAYLSLAGLPLLAGFPARFLLLEELATRAPLSAV
                     LALAGTGGLLLSGFRVLAVLTGGYFGPREPRETPFQAILISVGVVVLILLGFLPRLLF
                     PAMLGLVPAILMP"
     CDS             complement(29438..30217)
                     /codon_start=1
                     /EC_number="3.1.-.-"
                     /locus_tag="ANT_00320"
                     /product="putative esterase"
                     /protein_id="BAJ62066.1"
                     /transl_table=11
                     /translation="MPLIHADFFSQALQLCVEVDVILPLRPWKGTGTRDDSRHPTLYL
                     LHGLSDDHTIWQRRTSIERYVEEYDLAVVMPAVHRSFYTDMKAGYRYWTYVSEELPYV
                     MRSLFPLSDKREDNFVAGLSMGGYGSFKLALSHPERFAAAASFSGALHMALAYQDPTP
                     EWQAELNRIFGSLDEYQGSANDLFALAEQAKASGKPLPTLYAWCGTEDFLLPANHLFR
                     DHAEKLGLPLTYREGPGDHSWKYWDEQIQVFLQMLPLKKLA"
     CDS             30533..31273
                     /codon_start=1
                     /locus_tag="ANT_00330"
                     /product="hypothetical protein"
                     /protein_id="BAJ62067.1"
                     /transl_table=11
                     /translation="MEASLHWIYLSPHFDDAVLSCGGMIVEQTRRGERVEIWTVCGGF
                     SDRNRPLPPFARQMHEELGVGANLVSLRRAEDRTACALIGASVRHGMLPDCIYRFLPD
                     GSPLIRRSEDLWLPVHPAEMDLAVRLRRNWASRIPRDAQVVAPLSYGNHVDHRLTRMA
                     AEGLDRPLWYYADFPYAQWHNLPLDAGLPEERILRVEVGAEALARWQDAIAAYTSQVE
                     RLFGSEAGMREQVEAFYRRGGGTFLWRR"
     CDS             31453..31725
                     /codon_start=1
                     /locus_tag="ANT_00340"
                     /product="hypothetical protein"
                     /protein_id="BAJ62068.1"
                     /transl_table=11
                     /translation="MCYTLTMQAYRAYWHAWAQTLQRWGLNEFAAALLEGAAPLSILM
                     GQVITLSQPLLGAWVSTEKLEALAHLCEDDEERIAFASFLREENTT"
     CDS             31722..32477
                     /codon_start=1
                     /locus_tag="ANT_00350"
                     /product="hypothetical protein"
                     /protein_id="BAJ62069.1"
                     /transl_table=11
                     /translation="MIWLESILGLGLVLLAGALTLILSLPALRKRKVVLRTIPALQRA
                     RRALGLSVEDGSRIHLSIGKASIFSPTNASALVGLSTLERVAQLSLVSDRPPVATSGE
                     GTLTVLSQDTLQAAYRIANVPEQYDPERGRLTGATPMSYTAAALPVIHQERISANLFV
                     GNFGPEVGLMASASEHENAFSLGASDALDAQSVLYVTAEETLIGEELFAVPAYLQAGS
                     IYQTSLRVQDILRWVVIGLMVLSAILGLAGVSL"
     CDS             32474..33106
                     /codon_start=1
                     /locus_tag="ANT_00360"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62070.1"
                     /transl_table=11
                     /translation="MRSPVMTALAIAAGLIVLLGYLIPPEWTSLAYIQAVRAVFIGWA
                     VVLAGIAAWVGVIHLFLTHLRRMSARREADRYSVLVVLAFLATAVAGMILTPADPGFQ
                     QAVLAIQVPVEATLLGLLAVTLVFASMRLFQRRKGVMAIVFVVSVVFFLLLGAGLLMP
                     LQQTPLLGGLIGFFERLPIAGGRGILIGIALGSLMTGLRILLGADRPYSG"
     CDS             33110..35875
                     /codon_start=1
                     /locus_tag="ANT_00370"
                     /product="hypothetical protein"
                     /protein_id="BAJ62071.1"
                     /transl_table=11
                     /translation="MAEKFCPTCGKSNPEDALICQFCGARLEAEDLPDWLSALRTPSA
                     PSGGEAGGGKDLPDWLKEIRSQSEAERGTPLDLFAPEGGEEEAPIPDWLSGLSGGETP
                     SAGAEEPLPWEIPAEPAATPPESPAPAPSAEEGDWLSGLREWQTPAEEVPEIPPEAGF
                     SLPEQPEEEFTPREAIPDDMAAFFASLGAQTAPAEQPAGEELPPWVAGFGAEETAPAE
                     QPAGEELPPWLAGAGFGAEETAPAEQPAGEELPPWLAGAGFGAEETAPAEQPAGEELP
                     PWVAGFGAEETAPAGQPAGEELPPWLAGAGFGAEETAPAEQPAGEELPPWVAGFGAEE
                     TAPAEQPAGEELPPWVAGFGAEETAPAGQPAGEELPPWMAGFGAEETAPAGQPAGEEL
                     PPWVAETPSAEEAPEAPAVPEWVTDEGFEKFRAEHEQPAPAPAEESGLPDWLTTFGQM
                     EEKPEEMPAEPVSPFVDESLPEWLSGVKPPPEPAGPVVPPLIEPEEQPAPVEGEAPFA
                     VELPEWLGTAPEETAEMAEQVPAVEEETPAESLAPAELPAWVEEMRPLEAVLPSQTMV
                     EEGEQRLEEAGPLKGLVGVIAGEEIVSRYRKPPAYSVRLKVSERQRANAALLENVLAL
                     EAKPREIVPEASRAPQVILRVILALLLVLSLLTMLAPSFTITEMNPAAVPGLQAFYQR
                     VNALPENAPVLLAVEYEPSHNAEMRFASSALLRHLMDRNARLFIVSTVVGGPVLADEL
                     VREAALARPQYVVGERTLNLGYLAGGTTSLLEFAQNPRRAAPSALDTALTGVGAWDRP
                     VAQGVNSIQDFVLVIVLTDSPEVGRAWVEQVQPLLGSVPLMMITSAQAEPMLAPYLGS
                     AQVQGLVSGLRGGAGYERLMSAGGEASRFWGAYQSAVLMGLILFLFGIVISALSGGSK
                     RSGRRKA"
     CDS             35879..36535
                     /codon_start=1
                     /locus_tag="ANT_00380"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62072.1"
                     /transl_table=11
                     /translation="MMEWVWMIVGVVLTLMVFSYIFGDNFLFRVATYLFVGVAAGYVF
                     VVVFYQVLMPRLIEPIFLGTMAERVLAVVPLLGAALLLFKVSPRLAFLGKAPMAFLVG
                     VGAAVAIGGSVFGTLLGQVSAAGAPFRSGSGILEGLLALIGAVGVLAYFQFSAPARAS
                     LSGEVPKRPAWMEALAWVGQVFLGITLGALFSGVLIASITALLDRVQAILLLLARLLS
                     "
     CDS             36548..38284
                     /codon_start=1
                     /locus_tag="ANT_00390"
                     /product="hypothetical protein"
                     /protein_id="BAJ62073.1"
                     /transl_table=11
                     /translation="MASVIDAESFLAIDIGSTTTRALLFDVVDGTYHFLAAGSAPSTW
                     AAPFHDVGEGVHLALTRLQEITSRPLMDEGSRLILPTRPDGSGVDRLALTLSAGADVR
                     MVVIGLLEEVSLASARRLASTTYGKVVESLGLNDHRRQDAQLDALLQANADFFILAGG
                     TEQGATRSVSKLVELVLLALKTMRQESRPKILYCGNQALTKKLKEVLSRYTEVFTAPN
                     IRPTFDQEDLVPAADALAKMTVSLRGQQFGGLSGLGQLTATPVQPTAAATLRLMRFLS
                     ELYDPAKGVLGVEVGSHATYLAGAIGGRERLKVFRPLGNGLGMEGTLERISPADVARW
                     VPMEVSTQEVEDYLWQKSLFPATIPATATTLAIEQGLVREILRYAAQAYLEDYPDCAM
                     TFEPIFAGGAALAQTGSPVQSLLMLLDGLQPTGVSTLFLDPYGLMPALGAIAGANSLL
                     PVQILESGAFQNLGAVICPVSDAKPGTPILKARVVFEDGNEVKVDVKQGSLVPLPIRH
                     GQSARLYLEALRGTEIDPRRKTAGGFKIVGGLCGAVIDARGRPLNLPAEPNRRRELLL
                     RWTQALETRRPV"
     CDS             38317..39372
                     /codon_start=1
                     /locus_tag="ANT_00400"
                     /product="hypothetical protein"
                     /protein_id="BAJ62074.1"
                     /transl_table=11
                     /translation="MLAQVTHILGLTSIRRVRTLPVSGRVLVASRQKVNASDVIAEAQ
                     IPAQHVLVDVRRALRLGSVEQAQRVIVRNEGERIFAGDVIAETGGLFPRMVRAPADGQ
                     VVMIAGGRVIIEVQSQPIQIFAGVPGYVVEVIQERGAVIEGQGALIQGAWGNDRVAEG
                     MMINLLNSPDEELTRQKMDVSLRGAVVVGGMCSDPEVLRMGEELPLRGLILSSMSASL
                     VPVARSVSYPVMLTEGFGRIPMNEAAYTLISTNDKRDVALSTPFRPQAGERPELIIPL
                     PAVGEPAADFAYFKPDQKVRILGAPYPSHVGVLVRLLPGLTTLPNGVRAQAAEVRLSK
                     DTLVVVPLANLEVIQSV"
     CDS             39397..39984
                     /codon_start=1
                     /locus_tag="ANT_00410"
                     /product="hypothetical protein"
                     /protein_id="BAJ62075.1"
                     /transl_table=11
                     /translation="MSDQNPFEDFDFGEETPSEPQPQEEKPSNRNFLIALGVIGGIFV
                     LVAIALVAVVLFVLPQRNAALREQQQAQLAANTATAFAATENAQQALLLLTPSATPIP
                     TATPVPPTNTPVIVQPPTATPTLTPTSVSDAQKATLSAQQTQLAAGKFTATVLPTSTA
                     LPETGFADQVGLPGMIGIGVALVVIILVARRLRSS"
     CDS             complement(40247..41515)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_00420"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62076.1"
                     /transl_table=11
                     /translation="MDALDARTLRAVFSFVLTLLQLPAMGVFLYFITLSAFAWVRRQE
                     PNAAQFPLKHRFALVVPSHNEQLVIGKIVENLKALDYPADLYDIVVIADNCTDATAQA
                     AREAGALVLERFDAIRKGKGYALEWVFPQLFQRTPAYDAVCIFDSDNLVSPNFLKEMN
                     KHLCLGHKVVQGYLDSKNPLDTWISANNSIAFWIGNRMYQLPRSYLGLSNVLGGTGMM
                     IASDVLKSIGWGATCLTEDLEFTVKVVLQGMKVHWAHDAVIYDEKPLGLRQSMRQRVR
                     WMKGQADVISRFFIPLLKRFWTQRDWVALDLAVYILQPVFILVNFFCLIMGLILSAVF
                     PQPVQSETNAVISQILFLLMLYMNGFFLFLEGRASPAVLGYFLTYPLYNLTWIPVVMV
                     GFWKKNHKEWSHTLHTRVLDLREVPHVRKA"
     CDS             41946..42782
                     /codon_start=1
                     /EC_number="2.1.1.113"
                     /locus_tag="ANT_00430"
                     /product="putative N-4 cytosine-specific
                     methyltransferase"
                     /protein_id="BAJ62077.1"
                     /transl_table=11
                     /translation="MSTNHKLIIGSSVNMPEIPDESVHLVVTSPPYFNAPFDYKGLYS
                     SYQNYLEMLKQVAREAYRVLANGRIFVLNIDDMLVDGEKFPIVADATRIFLDAGFRYR
                     DRIIWKKPEGYLRISRRSGVLLQNPYPMYFYPDNLLESIIIFQKGRFDYKSVPQDVRE
                     ASKINIKEFQENKWYMTLWEMVNVLPNSPLEKDIAAFPEELPYRCIQLFSYVGETVLD
                     PFCGSGTTMKVARQLGRNSIGIEINEALIPIITTKVGFGNQHGLFNGEDTFECLIRQE
                     EK"
     CDS             42785..43849
                     /codon_start=1
                     /locus_tag="ANT_00440"
                     /product="hypothetical protein"
                     /protein_id="BAJ62078.1"
                     /transl_table=11
                     /translation="MHIHATIEGIQYQPFFGRKLNEYDISHLQEALQTDASFLLRFPD
                     SSQVAVSVWVSPKRTRSYPFARVYDTYGFQGKKITLIPVYKDEGFDGERDYLQWDTVS
                     LMSLLGVYVILGFYSHAEKNPHYPNKITRQQMDINFLLEQFHAVMNYRSDALHWNLVQ
                     TERLAEIGRLACESYRVISERTGVKMHSFEAVEKRLAVFSAGREKFISFSRRMAQEAQ
                     EREFRTVQPKENLKGKKAKITILNYLGGEYHFTCDEVEIHENSLLLMEGKHSRDASLP
                     SLSDIKDGLLKMILYTNLKDVSLNGMKYIPQPVLKLTTGELLHETPQIVETLNILLRE
                     ARANGFWVMLNENLIGSDER"
     CDS             43846..44262
                     /codon_start=1
                     /EC_number="1.20.4.-"
                     /gene="arsC"
                     /locus_tag="ANT_00450"
                     /product="arsenate reductase"
                     /protein_id="BAJ62079.1"
                     /transl_table=11
                     /translation="MKKRVLVLCTGNSCRSQMAEALINHDLGERWQAFSAGTQPAGYV
                     HPLALKALAEAGIVHEGESKSVEQFYGQDFDVVITVCDDAAENCPVWLGRGKRVHIGF
                     PDPAKVEGTDEEKWRAFVQTRDAIRERVCGYLAGLE"
     CDS             complement(44264..44404)
                     /codon_start=1
                     /locus_tag="ANT_00460"
                     /product="hypothetical protein"
                     /protein_id="BAJ62080.1"
                     /transl_table=11
                     /translation="MGEWLAFIGLGLSSFPSGLSEFYPTSGAQAQKNSRRGRLKGKFL
                     LE"
     CDS             44382..45119
                     /codon_start=1
                     /locus_tag="ANT_00470"
                     /product="hypothetical protein"
                     /protein_id="BAJ62081.1"
                     /transl_table=11
                     /translation="MNASHSPKAALRGEPSYVWRAGQERRLKMMLAAAGERIHGRVLV
                     DGCGVGMYLARFVPLAQQAVGLDIEHERTVEAHQSAPQVVCGAGEALPFPENHFDFLL
                     SHEVLEHVQDDARAIREMVRVLKPGGRIALFCPNRGYPFETHGIYWRGRYRFGNIPLV
                     NYLPRRWRDRLAPHVRVYTAGDLQRLFAGLPVRVVQRTIVFGAYDNIIARRPALGKVL
                     RAVLQALEATPLRIFGLSHFWVVEKIG"
     CDS             complement(45195..45863)
                     /codon_start=1
                     /gene="mgtC"
                     /locus_tag="ANT_00480"
                     /product="putative membrane protein, MgtC family"
                     /protein_id="BAJ62082.1"
                     /transl_table=11
                     /translation="MIPEGEIFVRVLVAALLGAVIGVEREISNQPAGMRTHIVLVVGA
                     ALAMTLSINLSMQFAGLAPGGDPARLAAQVLSGIGFLGAGAILRFGANIKGLTTAASL
                     WTMAVVGLVTGAGYFAVAGGVTALLLVVLTLLNLLENRVINPTVTVEFTVVVEEEPGV
                     IPKIRALLEEHSRALESFRLRHHVRHARFRVDAVVRLNRGKDAETLQQKLSELKGVKI
                     VRYL"
     CDS             complement(45910..47583)
                     /codon_start=1
                     /locus_tag="ANT_00490"
                     /product="hypothetical protein"
                     /protein_id="BAJ62083.1"
                     /transl_table=11
                     /translation="MASGNPVIGYIVGGNLKQAVRARLLVPTRDVQEGAFVVIEDGDF
                     KFYGSVTNIELGSTDERFADEQSEQRLPADLAKLLHGQTLFTTLEIMLSQMAHSPEDL
                     SPPLFNGPVAVKTIPSHHAQVRLADAGDFAEIFGDPHAPGNLVVGYNREQGHPIPVRL
                     GELVKRSSGVFGATGTGKSFLTRIVLAGIVHHNVAASLIFDMHNEYGPNGIDSDRNQI
                     VPGLRGKFPGKVRLVGLGKTNIINGMTVDFTLEIGEEDIETGDIEMLTRELNLKETTP
                     TVLAALERQFGKRWFSEFKNMKVGTKVEGEDGKPVPAPDSVEFWAREAGVHELAAVGL
                     HSKLQRVFNLPYIVPKPAAAPLKALLDHLEKGHHIVLSFGEHDHDLDYLLVTNILTRR
                     IREAWQKKTDEYRSDPQNKPQPRPLVIVVEEAHKLLSREMASQTIFSTIARELRKYYV
                     TLLIVDQRPSQIDDEVMSQLGTRICGWLGDDDDISAVLSGLPGKEALRGFLSRLQPKE
                     EAMMMGWGIAIPIPIRTRKYDEEFWKDLLGDPLQKKDEAELLKNLGIRD"
     CDS             complement(47618..48931)
                     /codon_start=1
                     /locus_tag="ANT_00500"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAJ62084.1"
                     /transl_table=11
                     /translation="MSMMVKRLQLALIHTAVAVTLVPINSTLNRVMIKELGISAALVA
                     LLASLPYVFSPLQVLIGSYSDHHPILGLRRTPYIVLGLLFCAAGVVLAPLAAVEIPVQ
                     PVLGLLLTLLVFMAWGMGFNLASVSYLALASEISGEKGRSRTVAIMWVMMVVGIILTA
                     ATLGGMLERFDYAALNRAFLTVALGALGLGALGLIGLEKRVSAQPALPLDEERESWQV
                     IFRKVFANPEARLFFGYLLLLLTALLGQDVLLEPYAAEAFGLSVSATTRITSIWGGVM
                     LVAMLATGFLETRLAKKTLARAGGWVGLLGFALIALSSLLAQRGVFYGGVLLLGAGTG
                     IATISNLSLMLDMTTARVGLYIGAWGIASALARLVGNLLSGVVRDAVTFTTQNALAGY
                     LTVFILQALFLLVSLFLLSRVDVRRFRERESLPFAERAAIAGDLS"
     CDS             49207..50091
                     /codon_start=1
                     /EC_number="2.7.1.23"
                     /gene="ppnK"
                     /locus_tag="ANT_00510"
                     /product="putative inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="BAJ62085.1"
                     /transl_table=11
                     /translation="MDSHSHPVPQRILILAYPATPGALEQVEPLMTYLKDAGVPQVAG
                     GSFLDKDLLERLQAKDFDLLIALGGDGTMLRAGHLCAPLGIPVLGINMGRVGFLTEIR
                     KEEWQQGMDLLLQGRYRLEERMMLKAELWRGETSLGSWLVLNEVVVCRGRFVRPIRVQ
                     ACVDGYTLTTYVADGVIAATPTGSTAYALAAGGPIMPPELRNILLIPVAPHLSMDRAI
                     ILSQGACVELRVQTDAEHEAVVSVDGHSPLPLENGDQVSVQSSDLTVHFVRFEDPGYF
                     YRNITAYMEQNPSTGARS"
     CDS             50088..50612
                     /codon_start=1
                     /locus_tag="ANT_00520"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62086.1"
                     /transl_table=11
                     /translation="MSEMPSVPQPVCYRHPDRETLLRCSRCERYICTSCAVLTPTGYR
                     CPECIRGQQKVYETTQWWDYPLAFFIAGVISLLGSWVAQFMGFFTIFIAPVAGFFIAE
                     AVRWAVRKRRSRLLFRVTAVAAALGGLPIFIVMLVSLLMGGGVGGILSLVWSGLYMVL
                     VTSSTYYRLSGIQV"
     CDS             50619..52361
                     /codon_start=1
                     /gene="recN"
                     /locus_tag="ANT_00530"
                     /product="DNA repair protein RecN"
                     /protein_id="BAJ62087.1"
                     /transl_table=11
                     /translation="MLSELRIENFAIIDHLTLTFRPGLIAFTGETGAGKSIILDAIAA
                     VIGGKVEPAMIRAGAERALVEATFSLPEEIRPAVHEILEREDLLDDPETLLLAREIRR
                     EGRSVARVNGRAVSAGLMRELGSYLVDIHGQSEHLSLLNVKEHIHLLDRFAGLQDALD
                     DYRKAYQRLQGMRRELDKLRQMEADAERRTDLLTYQLQEIESARLRVGEDEELRKERD
                     RLANAENLAALAQQSLTLLDEGAPDTPALSDLAGQLVQLLHGMVRMDASQSDLLEQAE
                     TLAELASDLSRSLQTYLDGIEFNPRRLAQVEERLDLIHKIQRKYNGSIESALAFAEKA
                     RAELETIAHATERIAELEEEEASALQELSERARTLSERRREAARRLESAVERELSDLS
                     MNGARFAVDFRTEPDPAGLSLPDGSRVAFDALGFDRVEFLIAPNPGEGLKPLVKIASG
                     GETSRLMLALKNVLAQADYVPTLIFDEIDQGIGGRVGAVVGEKLWQLGRRHEVLCVTH
                     LPQLAAYGDLHFSVRKQVHGGRTTTQVQPLDEENRLNELAVMLGGLNPANLAAARETR
                     LAAQQRMQELAVKP"
     CDS             52358..55849
                     /codon_start=1
                     /locus_tag="ANT_00540"
                     /product="hypothetical protein"
                     /protein_id="BAJ62088.1"
                     /transl_table=11
                     /translation="MNRPARIHLLGTPAVYFESQPLEIPRREVRTLLYFLACQREPVS
                     RTRLTLLFWGDYPEETARKRLRESLARLKSIFPIRDLIQTPGEEVFLHPQYFFCDALE
                     FENNARTLLTTLASIPLMTPLPELLATQLRRTVTLWSGKCFLADVRLPDSPDLEWWRL
                     SHGDFLLGMQTRLLERMAAHETAQGNVEQAIEWLNRGLEFAPLDEGLNHALLELLERR
                     GWFSQAQSHLEEMTRRFTAEEQPLPSWIEAWRGRLRVSLERTSASVSRGEPPSPLPWV
                     GRKEALDALHRACFRGGVVLIIGEEGAGKTRLVYQCLSQAPAMRRLLSVTASPQDRTL
                     PYHSWVQILRKGVLPQHWQALSKNWLGFFSLLLGELREAFPDLPPPSSETAFLPTMAF
                     EGLERILNVVKQETPLALWFDNVHWCDESSLEALEYLIHQNFFDENALLVLSTIPNPA
                     SPTLSRILRDVPLTQTTLIELRGLTRQEVRWLLQKLGNVEPKPELVDRLHRESGGNPL
                     LLQELLRAMVQDGSPSALVTGAGNTLSRRLHALIRRRLEQLTPQARQVLEGAAVLGSE
                     FALPHLLRILSLPEEQAVQGVEELLRAQLLTHAEGSSYRFQHEMVHTVTLLNLSDPYR
                     RLLHRRAAQMLKEQAGNQPRALAGRIADHLEQAGENLPALEYWVEAARYHRRVYAVQQ
                     ARQAFQHAERMLEQLGMGAPDDLVLTLYEEWCAMAFDLHQFWESQRAAERLLSQGYLR
                     QNARLLASALLEKALAAELQNRAEEMQEYLASAVPYLETVNDDALWLRYAFHQGGIAS
                     VVRGEVKDALRVFGKAWVRWRGESDRRLLELHANLGSRYAQALISAGRLEEALQVGEQ
                     ALEEARRAVSHSAGARILPALALANVYLGRYDLALRQAEMAQAMLRHMDNHRILAVVH
                     SIFAMVMLAKGNLSALWTFLEQMKRETREAQVHTIEAWTQRVWGDTLQLLGAIEESNR
                     VYEQVLLLPVGDIYRAEAVVRLGLGRVLAGQGEAGLSLLEDISQTAQAGGMGLVVRLA
                     DAARALALALLGRCEESSTLTERLSAEGHLLDLLTFTFAHLAMCVVALKQNRLLEARM
                     KAMALASRAGEHDVLFMEIYALVVLIHTARRMGEDTALFEAQLHERLNRLVVNARHTP
                     LEDYAGRLQGWIATFLQ"
     CDS             complement(56126..56659)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ANT_00550"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ62089.1"
                     /transl_table=11
                     /translation="MTSIWIRPAVPEDAPALAQVHVETWRAAYRGIVDDEFLNSLDVA
                     HREERWRQYLTSGESATFVATTDRGQVVGFVNAGAEREGLKPNMGEVYAIYLLPAYHR
                     QGIGMRLMRRAARWLKSQGMRACLVWVLAENLPARRFYEALGGVLSREQNITIGRQIL
                     REVAYVWEAIEDLLAED"
     CDS             complement(56656..57468)
                     /codon_start=1
                     /locus_tag="ANT_00560"
                     /product="zinc transporter"
                     /protein_id="BAJ62090.1"
                     /transl_table=11
                     /translation="MMEWFAQQAPVLQALMGTLFTWGVTALGSAMVFFFKSINRRVLD
                     TMLGFAAGVMIAASFWSLLAPAIDLAQENGQPGWLPAVAGFLAGGAFLWLVDRILPHL
                     HLGLPLEEAEGIKTSWQRSILLVLAITLHNFPEGLAVGVAFGAVAAGIPSATLAGALA
                     LALGIGLQNFPEGAAVSVPLRREGFSRFKAFLYGQASGLVEPVAGVLGAVAVLLMRPL
                     LPYALAFAAGAMIYVVVEELIPEAQQEKDTHAATFGAMLGFAVMMFLDVSLG"
     CDS             complement(57559..57714)
                     /codon_start=1
                     /locus_tag="ANT_00570"
                     /product="hypothetical protein"
                     /protein_id="BAJ62091.1"
                     /transl_table=11
                     /translation="MLQLYPADGKNLFALAQNMGEKHGSPRQEPSRTASLPASRFVLK
                     ESPSKIV"
     CDS             57713..58480
                     /codon_start=1
                     /locus_tag="ANT_00580"
                     /product="putative methyltransferase"
                     /protein_id="BAJ62092.1"
                     /transl_table=11
                     /translation="MNNSLYDDLSEDYDRFVNWEQRLKVELPFLLRHLPHGRVLDAAC
                     ATGWHAIALAQQGFQTAGADLSPQMIAVARRNAQAAGVTLPFEVAGFGDLARAFAASL
                     PFDGLICLGNSLPHLLTPQDLARALADFAACLRPGGTLILQNRNFDAVLARGERWMEP
                     QVFRKGRKTWLYLRFYDFLPEGLIRFNMVRLTRERMGWTQRVTSTFLRPLRMAEVMEM
                     LREAGFEALETYGSMEAGGVPFDVHTSGNSIVVAHKA"
     CDS             complement(58671..59021)
                     /codon_start=1
                     /gene="rplT"
                     /locus_tag="ANT_00590"
                     /product="50S ribosomal protein L20"
                     /protein_id="BAJ62093.1"
                     /transl_table=11
                     /translation="MARVKGGPKGHLRHKKILKMTEGYFGTRHRLFRRANEAMLKSLW
                     YATRDRRVRKRDMRKLWIARINAAARLNGLTYSQFIHALKQAGIALNRKVLANLAVRD
                     PKAFAAVVEKAKAA"
     CDS             complement(59127..59363)
                     /codon_start=1
                     /gene="rpmI"
                     /locus_tag="ANT_00600"
                     /product="putative 50S ribosomal protein L35"
                     /protein_id="BAJ62094.1"
                     /transl_table=11
                     /translation="MPRKVKPGKFKLKTHKATSKRFRLTGSGVLVRTKGGKSHLRRRT
                     SKRTKALFTEMLPVQGEGIIKRVERLAPYLKKQD"
     CDS             complement(59567..61093)
                     /codon_start=1
                     /locus_tag="ANT_00610"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62095.1"
                     /transl_table=11
                     /translation="MVKSWQKILALILGSAVLAALTAWLSPGAFWRGFGASFLLIGGS
                     ALALFGLWRGMGGGKHLALWMTLAFVLRLGLGLFFSLAYPLWGYDEPEYNAGYVFRDA
                     YHRDREAYAVALSGERLLFNPNLELGSDQYGGLGMLSALVYRTLSTDAHRPALVLILG
                     AFFFALGVPFLYRAAQARLTERAAQIAVWIYLLYPDGLFFTASQMREPFMLGLLCVGL
                     WAVILWREHPRAALTAGALAVAGMLFISTRSAVFVVGILVLLAWLEFTARHPGRGWKA
                     LGWLGILLAGGVAFALTWGWFREAAVYDRVLTLKASGRLAAFIADVGDRYILPTIVGY
                     GLAQPVFPAALVEPAIPLAKVVILLRSAGWYALAPLLVYALWAGWRATSEDDQRLILW
                     AAGAFWAWALISALRGGGDMTDNPRYRMLLLPLGGLAVGWALEFARRTADRWLGRILA
                     VEGIFLAVFLQWYLSRYLHWGGRLSLPAMGALIAGLSALVLVGGWVYDRLRPPRPSSR
                     "
     CDS             complement(61087..62214)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_00620"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62096.1"
                     /transl_table=11
                     /translation="MKIACIATAQVPSITANSIQVMKVCHALARNGHEITLYVPGRQA
                     TEWEHLADLYGITQKFSIRWVPALPLWKRNDFALQAVRLARRERAELIYTWAIQSAAL
                     ALMLGMPAVYEAHDLPTGRLGPLWMQAFLRLPGRKRLVCITRALRRALEARLRVHLPE
                     HQVVIAPNGVDLERYRHLPDPPTARAQVGMAQSLTVGCSGHLYAGRGGDLFLALAQRF
                     PHAQFLWAGGRDEDVQTYRQRAQEQALENVTFTGFIPQTRLPLVQAAADVLLMPYGRS
                     IAGSSGGNSAEICSPMKLFDYLAVGRAILSSDLPVIREVLDEDTARFAPPEDVEGWAA
                     ALAPLLADETLRQRLAEQARKRAEQYDWQERQQRILGGGAW"
     CDS             complement(62211..63005)
                     /codon_start=1
                     /locus_tag="ANT_00630"
                     /product="hypothetical protein"
                     /protein_id="BAJ62097.1"
                     /transl_table=11
                     /translation="MEHPLTLVTFNLRTAEAQDGEFSWARRRDMVVECLRDLDADLIG
                     LQEVHDDSQARDVRSAFPEYEWIGVRRGGNGAAPLEMNVALVRRGAFEVLEQQFFWLS
                     RTPEVPGSISWGSAYVCTAIFLRLRSCRNGAEAAWFNTHLDYLPQARLEGAKLLRRRI
                     EALPPDCNVLVTGDFNAGKRSCVYRTLLGEGASCHRLRDAYRAVHTDGRGEGTFHAFG
                     MLPRPQAIDWVLVSKDLPVEDAGVACVSVGGVYPSDHYPVWAKVRL"
     CDS             complement(63022..63573)
                     /codon_start=1
                     /locus_tag="ANT_00640"
                     /product="putative phosphoribosyltransferase"
                     /protein_id="BAJ62098.1"
                     /transl_table=11
                     /translation="MTQRETYPIDIAGVHRELPLFEIKPGLRIAILNILGDTELVTAC
                     ARALAEKLTAVEYDVLVTAEAKSIPLAHALSVETGKPYVILRKSYKPYMGDALRAETL
                     SITTGQPQTLYLDEKDREMMKGKKVIIVDDVISTGSTLQGMRMLLQKAGAEVVAEAAI
                     LTEGERAKWSQIIALGHLPVFTD"
     CDS             complement(63580..63846)
                     /codon_start=1
                     /locus_tag="ANT_00650"
                     /product="hypothetical protein"
                     /protein_id="BAJ62099.1"
                     /transl_table=11
                     /translation="MSACYCYLLECADGTYYTGWTTDPQRRARQHNAGRGARYTRTRL
                     PVRLAYIEPQPDRATAMRRERQIKRLSHAQKQALCASFVNLSEE"
     CDS             complement(63869..64855)
                     /codon_start=1
                     /EC_number="1.3.1.12"
                     /locus_tag="ANT_00660"
                     /note="protein synonym:PDH"
                     /product="putative prephenate dehydrogenase"
                     /protein_id="BAJ62100.1"
                     /transl_table=11
                     /translation="MSVQITLIGLNQIGASFGLALANAAEQIHRVGHDKDPDMARMAQ
                     KMGAVDKLVFTLPAAVENADVVILSLPADELRFTLEAIAPYLKPGCTVVDTSPIPATS
                     TVWAQKVLPREDRYFVTLTPTVSAKYLLESDRGTASAQADLFKDTMMMITAPAGTDSS
                     ALTLAESLAEMLGAKPIFSDAVEVSGLLASSHLLPELLSAALVNATAGQPGWSDIRKI
                     AGQMYARMTEPAFFFEEKGKLGQNQIVSHEVLVAVLDHFIRELVEMRDAIARQDGEAL
                     HARFEQARQARQSWWSQRLKNQYPEASEQKSPGMPRFGESIGRLLGIRPKRD"
     CDS             complement(64931..65569)
                     /codon_start=1
                     /locus_tag="ANT_00670"
                     /product="peptidase M50 family protein"
                     /protein_id="BAJ62101.1"
                     /transl_table=11
                     /translation="MFNVDPISLISRAITLIVALTLHEYAHARTAQAFGDPTPEMYGR
                     VTLNPLAHLDPLGSLMMIFVGFGWAKPVPINPYVLSRRSTAAPMLVALAGPFSNFLLA
                     LAAAIPFRAGLIPVNEAISGSSFLPQFLLNFIVINLLLMFFNLIPLAPLDGDKIIEFF
                     LPPSWAQALERIRPMGPMLLMVILFVLPWVGIDVFGTLLYPPIGNLLRALVY"
     CDS             65611..65832
                     /codon_start=1
                     /locus_tag="ANT_00680"
                     /product="hypothetical protein"
                     /protein_id="BAJ62102.1"
                     /transl_table=11
                     /translation="MKRMLPDIQLNDIVTLRKPHPCGGYEWKVVRLGADIGLECLTCG
                     RVILLSRRELSRRMKKIRSGESHDSTPPR"
     CDS             65810..66949
                     /codon_start=1
                     /locus_tag="ANT_00690"
                     /product="monogalactosyldiacylglycerol synthase family
                     protein"
                     /protein_id="BAJ62103.1"
                     /transl_table=11
                     /translation="MIPPLPAEPRRIVFLFSDTGGGHRSAAEAIIEALDVLYEGRIAC
                     EMVDFFKQYAPPPMNLAPEIYPPLSRMPALWGMGYRISDGPRRTRVFYSAIWPYVRRH
                     IQQLMAEHPAHLYVSVHQLINTPMARALAGTGIPLVTVVTDMVTTHAAWYARGATHVV
                     VPTEEAFRRGVNAGLSPEQMTVVGMPVALRFQRLNEAREDIRRRLGWNENLPVALMVG
                     GGEGMGPLEEMARAVDEAQLPVTLAIVTGRNQALRMRLERRRWHIPVHVYGFVTEMPA
                     FMRAADILVSKAGPGTISEAFISGLPILLYSKMPGQEDGNVTYVVETGAGLWTPTPEE
                     LVSALRRWLEHPEELRRAAEVCRQLARPDAASEIARILARYAGIS"
     CDS             complement(67210..67911)
                     /codon_start=1
                     /locus_tag="ANT_00700"
                     /product="putative peroxiredoxin"
                     /protein_id="BAJ62104.1"
                     /transl_except=(pos:67669..67671,aa:Sec)
                     /transl_table=11
                     /translation="MSEPEGCVKPSRGPLVEMSEQTETVVVPKEVPMIRAQVGKPAPD
                     FELSALVGNGFKNIRLSDYKGKWIVLCFYPGDFTFVUPTELSAVAVKYPELQALGVEV
                     LAISTDSRFSHKIWQEEELSKMVEGGVPFPLLSDAGGRVGSIYGVYDENAGVDIRGRF
                     IIDPDFVIRAMEVLTPEVGRNVAELIRQVKAFQHVVATGEVTPSGWQPGKPTLKPGPE
                     LAGKVWKVWKPDMAF"
     CDS             complement(68037..68819)
                     /codon_start=1
                     /locus_tag="ANT_00710"
                     /product="hypothetical protein"
                     /protein_id="BAJ62105.1"
                     /transl_table=11
                     /translation="MSRKILVLTLASAVVSAILLFVGTTVMGFFSPVSADSLPALVLG
                     KRVTNDTALQAQSGADDTPTPTPFQPAPTETALPTATFSPQETPAQQPTPIPAVSLTI
                     AQLLANPGAYLNQMVSLSGMVNVISRELFLLNDGTGQIVVDVEEDGVAGALSNGMTVT
                     VVGRFDDYSKGGSYKIEACTVTDSSGKVWSNQCHNHDEDDDTSLTSTPHDDKDDDHKS
                     TLQPTRTDDHDDDHDRSGKSTPKPTQSDDDHEDDGDHRNKDD"
     CDS             69098..70537
                     /codon_start=1
                     /locus_tag="ANT_00720"
                     /product="sodium:neurotransmitter symporter family
                     protein"
                     /protein_id="BAJ62106.1"
                     /transl_table=11
                     /translation="MPGSFFTGTTFLLTGGLFIMANESVHNQAPAKRSGFATALGALI
                     ATLGSAIGLGNIWKFPYLTGENGGAAFLVLYLLATFLVGLPVMISEILLGRAGRANVI
                     TTMRKLSPSPRQPWWLIGAAGALSAFLIMAFYTEVAGWVFAYVVRSLTSNILSTDPQV
                     TLQTFNALVSDPFQSLLWQWVVLILVGGIITFGVAKGIEATTKRLIPLLFILLLIVDV
                     RALTLPGAGAGLAFLFKPDFSKISTTAALIALGLAFFKLSIGMGAMITYGSYWKDDQN
                     IPSTTLRVVLSDLAVSLLAGIAIFPVVFTYGFEPAAGTKLLFITLPAVFAQMPLGNVF
                     IFLFFLLTSFAATGAMVSLVEVLVAFANEQFHLSRKAATWITVGLLALVGSTAALSNS
                     TLAGFTPFGKTLFDLYDFVTSNVLLPVGGLFIAIFVGWVLKPEQVIAQLTNGGTLSNH
                     GVVRVFLFVVRYISPLLVLVVLLDSLGVF"
     CDS             70712..72727
                     /codon_start=1
                     /locus_tag="ANT_00730"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62107.1"
                     /transl_table=11
                     /translation="MRLRRLEVIFLLGVLLVHLSAVLAPVDALLDRWFTTDDAFYYFQ
                     VARNISEGKGSTLDGIHPSNGYHPLWMAVLVPVFTLARVDLVLPLRLTVLLSVLMSAG
                     TGILLYRFLSRFLHPGLGMLAAVLWVFFPPLHQIITRQGMETGLNAFFVMLLLVEVQA
                     LLSRPAGQDTFRDALRLGCIGALTLFSRLDNIFFVGFAGVVLIFRERRAYLFWLGYLI
                     AGVSAGMLAFFLRVGFPRFLMEFQRGLDVFVGVSTLLKLLMGFGLGLFTPVWKGWRKE
                     LLGVALNAGLSAAAGGVAVIGLSAAGVVGSFPRLTIVLDAVLSGVFFLAVRRGMVRKT
                     AMPDEALSPMDELRRALPLWLKRGLGYFLPLGGLLIAYMLMNLQVFGTPTPVSGQVKH
                     WWGTIADVVYVKPVHSIPALFGVFSPLGQSPWWFLFQPVTLLTGGQSGTAWTAGLLLF
                     WLGVVLEGVRRGVWRRGGQGVDMLAVLFMACLMHILYYTSSDYANMRPWYWVNETLAG
                     MMLLFFALDGWWAGVPAPGRETRVRLWSALACAGLWLWGSFQVLESFALQKPTVPAYY
                     LQEAAYLEAYTPPQSKIGMPGGGATAYFVRHRTVINLDGLINSYAYFQSLKDNRGREF
                     LDRLGLDYVFGASGVIEQSAPYYTLLAERLEPVGEFEGFRLYRYRVP"
     CDS             complement(72737..74023)
                     /codon_start=1
                     /locus_tag="ANT_00740"
                     /product="hypothetical protein"
                     /protein_id="BAJ62108.1"
                     /transl_table=11
                     /translation="MTPGPKRTGWWLFLIALLYFIALIFPNARGAQSERMLLVTSLDE
                     PVTYQYVVRMLTPASDFKDLFSRWVLYGDYHYGYPFYFFSALAVLPVRLIYGAEFTNY
                     TALNLLLLRQAISVLPMLLAILLLVYEQTRFRTLWQSLALTAVMFLVPAFVRNHLQWW
                     HPDALSVLAVTLVLVFLRRDDLRFGRFFWLAAAACGVAVGIKFAGVFFFLTIPIYLFM
                     GYRQKRLTLPQVFTKGALFVVVALLALVLSNPFLYNEGARQELMRIQTEKVEVLGSGY
                     EDASPYYQKGPAFWKWTLSTWYGHPLFLAFLGLSLLVGCLRGPNQRFNGLILTYILPQ
                     AVYLLWFVSVKPDHYWLPVMVPLFSTALTLPTALVEGWFPAVSRRAWLRRGLLALLVA
                     VLMAQSAVFLLRPYSGVIAQVQNAMHIEEIYYDSSR"
     CDS             complement(74240..75274)
                     /codon_start=1
                     /locus_tag="ANT_00750"
                     /product="hypothetical protein"
                     /protein_id="BAJ62109.1"
                     /transl_table=11
                     /translation="MREKFTPEEKKVLQTLEALRVVPERRAESHARGKEAFLAEARRM
                     KSEGIPVSPAPVARLTVWNRLFGTKKEVFRMSPLVTLMLIVSLLFGGTGVTAVAAQNS
                     LPDEPLYPVKLLTEQVRTELTTREQAQLALMLELANRRAEEANRLMAMGKAPSEALLA
                     RWQTHLEQATRLALQLGDEEARQALLRVQETLRQQMQWASSTASPARVREMLQEQQRL
                     VEQGIAEPEQLRQRLRQNAPMQTAEPGENRNPWTDETPTPGSGYGPGPGTGDCTTCTP
                     TGGGSQNPWTDETPTPGSGYGPGPGTGDCTTCTPTGGGSQNPWTDGTPTPGSGYGPGP
                     GNESGGNRKP"
     CDS             complement(75271..75828)
                     /codon_start=1
                     /locus_tag="ANT_00760"
                     /product="RNA polymerase ECF-type sigma factor"
                     /protein_id="BAJ62110.1"
                     /transl_table=11
                     /translation="MNDMEEAALLEKARAFDLDALAEVYDRYSPPLYLYALRLLGDEA
                     LAEECVADTFHRFLQALRHGGGPQSHLQAYLYRMAHNWITDIFRRNPARWQELAEDET
                     TPEQANSPSLEAQADLLLERERVRRALMALTPDQRQVVVLKFLEGWDNEAIARAVGKP
                     VGAVKSLQHRALASLRRWLGKEEQG"
     CDS             76005..80966
                     /codon_start=1
                     /locus_tag="ANT_00770"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62111.1"
                     /transl_table=11
                     /translation="MSRKTLVWLILTALILVGAVVLVERVVHYASLPSNLPPQEVVVV
                     GQNRFIPGTQAALRLQVRDPFKGNPIPDAEVSLALRPKAGGNALTLYTGRSDANGMVE
                     ASFVVPMVDAPEQTLLVTSKSPLGTEQLEQPVHVAREYRVLLSSDKPLYQPGQVIHLR
                     ALALDAFDLRPAAGRDITLTIADGKGNKVFRKTLTTSAYGAAWTDFQLADEVNTGEYK
                     ITAQMGNTSSEKTVRVERYVLPKFKVEMRTERTYYQPGQHVNGTLTANYFFGKPVAGG
                     EVTLEGYTFDVQRNTVFTLEGTTDEQGQYTFAFDLPVFMTGSELEGGMGRFYLQATVT
                     DGARHAETANLSLPVSANGLVVDIVPEGGYVRAGLENIFYLFTRYPDGTPAEATVQVT
                     FTDSNTTFTVQTDAYGLGEVRVIPPQPYVYITLQAQDRRGASAYREVSFEGEWTGESI
                     ILRPDKPVYRVGETMNLTLFSTQAQGTVYLDIVRGGQTLSTRSVPLQGGRAEVAVDLS
                     PEMYGTLELHAYKILPSGTITRDTRLVVVDPANDLSLAVQPGQDTYRPGEDAQLDVQV
                     SGADGAGVAAALGIAIVDESVFALAEQDPGFARLYFLLESEILTPRYDLHGYELPDLA
                     YSQRFEQTSPTLRQDVERAARASLAEAVRAGGKSAFSLAASSRPQSLNRARQMQVSFF
                     NRLSGVFFPVFLLTAAGAVFGVVCALARQKRFWRSFFTALGILLGLILLILLIPWGNY
                     SWDRSIGGRLTGFLQTFFEKMDALIVLFPLVGLLGISGLAGTAIRRRDWTLGGTVLLL
                     VLAFVSLVLFLIAGRFGNRFPSSGGLISLLIFYLLVMLSGWVRTAGFLWERAFTPAFF
                     GAALAIFLTLGWTPMLMMMGAASAPAPMAEDFGVPERRLVQGAVPMAPQPTLAPGMVM
                     EKGVESGGESQQPAQQEPRLRQYFPETMIWIPDAVTDENGFLRLNFPVADSITTWRIT
                     ALASSADGRLGSVDAPLRVFQDFFIDLDLPLALTVGDEIAVPVGVYNYLPEPQTVRLV
                     LEQAEWFDLLDEPEKSMTIGANEVSVVYFRIRAKAFGAQPFKVTAYGSRLSDAILKSV
                     QVYPDGKPIRLSASDRLEAGKPFQQSFFFPPEAIPGTQKVLVKVYPGVFSQVVEGLES
                     LLRMPFGCFEQTSSITYPNVLALDYLRTSGKSAPEVEMKAEEYINLGYQRLTTFEVAG
                     GGFSLFGNPPADRMLTAYGLQEFADMARVHPVDEALVRRAADWLMSQQASDGSWENDR
                     GLVHENTWQSLGNDRLPVTAYVVWSLIDAGFVDESATQRGIIYLHGHLNEAKDPYVLG
                     LVANALVAADRAHGADIGTDANAALGELALQAQRNGSQVFWQSSVATFTGAEGRTGSI
                     ETTALAALAMLRAQVYPDLTNGALAYLIAQKDSFGTWHSTQATVLSLKALLEGIRMGG
                     EKMDARVTLTLNGGQTRTLQVTPDNFDVVQMVTFDDVPLGRENVVEMTMEGQGNLMAQ
                     VVGSYYLPWSQMSRYPDLFPMDEGLDLRVTYDRTELSVADTVTVQVAATLKQEGARAE
                     AVMLDLGIPPGFSVMTEDLDALVTRYSDVLPAETRLERYELTGRQVLIYLTGMKGGEP
                     FTFTYRLRARFPLRAQAPSALAYDYYNPQQQGELPPQLLVVNP"
     CDS             complement(80970..84368)
                     /codon_start=1
                     /EC_number="3.2.1.23"
                     /gene="lacZ"
                     /locus_tag="ANT_00780"
                     /product="beta-galactosidase"
                     /protein_id="BAJ62112.1"
                     /transl_table=11
                     /translation="MTSLNDWENPAVQGIHREPMHATLLPYSDVADALRNERERSPYF
                     LLLNGSWKFHFSPTPEDAPAGFEAPDFDDSAWDTLPVPSNWQVLGYGIPRYLASSYAF
                     DTSACPKVPHDTNETGSYRLTFSVPETWRERQVFLVFEGVDSAFYVYLNGKMVGFSKD
                     SRLPAEFNITPYLKEGENVLAVRVFRWSDGSYLEDQDMWFLSGIFRDVYLIARPPAHI
                     RDFVIHTPLTDDYRHARLEVTLFLKNQSARSFQGLTLEAALYDPAGNPAHGWVRSATF
                     DLLGESEETFVLSDDVPDAALWTAETPNLYTLILSLRDAHGNLLEVLRHPVGFRTVEV
                     HDGKIFVNGSPIILRGVNRHEHLPQSGHAITVESMIQDILLMKQANINAVRTSHYPND
                     PRWYDLCDQYGLYLIDEANIESHGLWDRFAKDPAWRTAFLERGSRMVIRDRNHPSVII
                     WSMGNESGYGENHAALAEWMHTHDPTRPVHYESARNEPYLDILSAMYPRLDQLVEYAT
                     APGETRPFVLCEYAHAMGNSPGNLKDYWDIIETYPRLCGAFVWDWVDQGLERTTPDGR
                     RWYAYGGDFGDSPSDFSFCCNGIVFPDRTPHPAYWEVKKVYEPVRVEAVDALQGRLSL
                     RNRYAFRDLSHLTLRWQVTSAGEVWQSGEMPVPPVSAGESREIVLPLESLPDESKHEV
                     ILEVSFRLKEDEPWAPAGHEVAWEQIVLPIPRTAPLPVPLEKMPALTVKEDGAQVTLN
                     GGAVTACFDRAAGKLVSLQIEGRELLAQAPKVQIWRAPTENDLNTWGDERAALRWRAA
                     GYDQLEESVSQVLFRALSPYSARMVVHSRLAVPNHITLPPFETAEQRLRLFQNGLNVY
                     FDDAALDALIARLGVKDDLPKKVEKTARTQALVQVMAQSGRIADLLETARAFLLERGQ
                     SLPYDVQELLSRGVSDIYLPRAAFDLTTTYTFYTSGDLLIEVDFVPAVSGLPFLPRLG
                     IEAVLQPGMERVQWYGRGPHEAYSDRQESARVGVYQMHVDDLFVPYVVPQENGTRSEV
                     RWVCLRDEAGNGLGVCAEAPFFFSAHHYTVEDLAQARHPHELTRVPEVILHVDPFHSG
                     LGSASCGPGRLERDQVKAEEHYFRLRLRPLMADDSPWALSRQRL"
     CDS             84724..85338
                     /codon_start=1
                     /locus_tag="ANT_00790"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62113.1"
                     /transl_table=11
                     /translation="MDLWNILSFMALGFTLGSIPFAYILARVFTGRDVRAIGDGNPGA
                     ANAWKAGGWRIGLLAVFFDLCKGFLPLFLAQRAGLSEWALVPVALSPILGHALQPFLQ
                     FRGGKALAVSGGVWLAWIGPRVFPVYASLTLPVLALQEEHAWAAFSGTLALLAYALWL
                     GTSPALMVFAALNMVLIGWTHRRELAHAPRPRAWVGHLLSRREA"
     CDS             85335..86507
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_00800"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62114.1"
                     /transl_table=11
                     /translation="MNGLPTLSLFEHAPQMAVFFLTLGVFIALSNFFLVRRLGDYPAP
                     NTFPRVSVLVPARNEEANIEACLRSLLTQDYPNYEVLALDDHSTDGTGAILARLAAEF
                     PHLRVLKGEPLPPGWLGKHWACHQLAQAAQGDLLLFTDADTRHAPAMLRRAVAAQVAE
                     DADLLTAFPYEEAHSWGEKLIIPVMGFGIFSFLPVALAQRLGWRGLSVTIGQFMLFRR
                     SAFEAVGGFAAVRAHAVDDVALGRRILEQGFRWRLLDATEEVHCRMYHNLREAVDGFT
                     KNVFAFFDYHVLLYVLAWTWVSICFLEPPLALMGAALNFPLTDFPLPLAQIAVVETLF
                     LWVIAAMRFRFPPLVILFYPLSIALFVMIAVRSLVFTLQGKAEWKGRALSRPALRW"
     CDS             86651..89806
                     /codon_start=1
                     /locus_tag="ANT_00810"
                     /product="hypothetical protein"
                     /protein_id="BAJ62115.1"
                     /transl_table=11
                     /translation="MKFRLVLLILFCLAVLPVHPVHASASLEAPPPRFQRLSVDEGLS
                     NAAVMCILQDRDGFLWFCTQNGLNLYDGYRFTIFRPDPANPYSLQSSIVLAGVETPDG
                     ALWFGTDGAGLARYDKATQRFTHYRHDPADPRSLPNNSVWSLFVDSQGALWVGSRGGL
                     SRWDGEGRDFTTYLPNPNDARPLSKWVLRIGEDSTGSLWVGTRYGLNRLDSQTQIFSV
                     FLPDPKNPGAISSEQVWAIYQDSRGTLWFGTRFGGLVRFDPVTESFTAYRHDPANPAS
                     ISDDTVWDILETPDGMLWLGTEKGGVNRFDPLTGRAEAFRTSPNNPESLSSDDIYRLF
                     QDRSGVLWAGSRNGGLNKLSPVRQRFRLLKAQPGEENGLSTSNISAVWTRGDGVLWIG
                     TQGGGLNKLNRRTGEITVYRADPANPNSLGGDTITAFYQDRADTLWIVTSGGGLSRMD
                     IPSETFTTYRRNPDDPASLPSNFLTSIVPAGQGRFWLGTLGFGLVLFDPFTGKAQTYR
                     HQAAKPASLMDDTINALLADGDRGLWIGTHRGGLDYLDFRSGEFHHALHNPANPRSLS
                     DNTVFSLYRDRQGTLWVGTLSGLNRYDPALPGFRAYHLADGLPNETVYGIREDETGCL
                     WLSTARGLARLDPSSGEVLTYTLEDGLQSNQFNIYSDFRAPDGELFFGGPGGLNAFYP
                     AQLSRNEAPPSIVFTGFSLFNQPAPVGSEVLPQDINTLSEISLPYDQNVFSIEFAALD
                     YQSPAQNRYQYKLEGFDRDWLPAGAHRTATYTNLNPGTYTFLVRASNNDGVWNEKPRA
                     IHITIRPPWWQTRVFYGLTLMGLIGLVLGIIRWRTAEMRRRTRELERAVCERTHELSE
                     ANRKLEGEIDERIAVQRELERLVRTDPLTGVFNRGHFFASLDEEFAREQAWERRRYAV
                     ILLDVDHFKRVNDQYGHLVGDQALITIADILRKNVRMRDIVARYGGEEFVIYMPETSV
                     GEARAVAERIRRVIEEQTRVLHGFPVTASMGIAVKSSEEEGTRFDEVLQRADTALYTA
                     KHRGRNCVVVYGEAEGEREQN"
     CDS             complement(89837..90466)
                     /codon_start=1
                     /locus_tag="ANT_00820"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62116.1"
                     /transl_table=11
                     /translation="METEPAKSGKMSWYQVMAQVYSQPSVESYQDVVSCQGIRFSRVY
                     LWIFSSTLLAMLIPLVLYYATGGKIVHDDLKRTFLLGNAGMGIYFAAGVGTALLAPLI
                     FMAGAGILHWLAQRLGGTGHFEPLVFLLGAVYTPGNLLDQLLEGFLPPVLGLVFRLGL
                     LLIMAYLSILSVKAVHRLSWGKAVLVFAIPVLIIALLSGCYLGFLLLGR"
     CDS             complement(90892..91761)
                     /codon_start=1
                     /locus_tag="ANT_00830"
                     /product="putative cobalt ABC transporter permease
                     protein"
                     /protein_id="BAJ62117.1"
                     /transl_table=11
                     /translation="MLVCRGGAMSVILFQSTGRRTLFHRLDFRSKAVLMLAVTVTAFI
                     WEDPLAQAGLALAVFLACVLGGVRWAYLRVIFLLMTPLFILLMLTHGFFNVQQVRSLL
                     GGAPLTYLLRFPEDWWLIGGGGLTREGLLYGLNAVLKTLSVVMIVPLVIFTSDVDQVV
                     VGMVRARVPYTLAFIFSATLRFFPLLFAEAQTIIEAQRLRGLAVERLRPWERVQVYAR
                     IAVPLILGALVRSQQLEVVLQSRAFSGSPQRTFLHESRLSPADWAVMALALGGMALAV
                     VLRLTTGFGSFHG"
     CDS             complement(91734..93536)
                     /codon_start=1
                     /locus_tag="ANT_00840"
                     /product="putative cobalt ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ62118.1"
                     /transl_table=11
                     /translation="MAHTPPDGGEFSPPSFCLLVQSSRMDNHPPLVRFESVSYQYPHR
                     SDFALQEINLSLRRGELLGVIGATGAGKTTFCLTLNGIVPQFYGGRFFGKLSVAGLDT
                     VDTPIHQLARHVGMVLEDPETQLIATSVENEIAFALENLNVPAEEIRARIPRVLEMVR
                     LENLPKRHPSELSGGQKQRLAIAAALAVQPDLLVLDEPVSQLDPQGAQEVFAVLRELN
                     RTLGMTMIISGHAAEELAESAQRLILLAGGKIAAEGTPEEIYGNIPLLEACGVRPPQV
                     TQTFWLVRHLLPKAQALPVRLDEGMRLLDALPRPARLPQMPPAAAPRPPAEPLIAVRD
                     LHHTYPNGTQALCGVTLDIRAGEYLLIAGQNGAGKSTLVRHFVNLLQPTRGEVRFSGQ
                     DTRTLSTADAARRIGYVGQNPDVQLFNRTVEEEIAFALKHLHYPADEIRRRTEAALEA
                     LRLNDVRQRHPFSLPKGDRARVVIAAVLALEPEVLIFDEPTTGQDLAGATAILDITRD
                     LHRLGKTVLVITHHLYLMPGYAERVILLGRGRLLLDAPLREAYHNLAALERTALTPPQ
                     AVKLAQALGARWQVSLPLLTPQEVAQCWSAEGAP"
     CDS             complement(93692..95065)
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /gene="trpB"
                     /locus_tag="ANT_00850"
                     /product="tryptophan synthase beta chain"
                     /protein_id="BAJ62119.1"
                     /transl_table=11
                     /translation="MSNQTRFLLSENDIPRFYYNVLADSPVPPAPVLNPITREPVTPD
                     FLSAIFPMEIILQEVSQERYIEIPEPVREAYKLYRPTPLIRALRLEKALDTPAHIYYK
                     YEGVSPSGSHKTNTALAQAFYNKISGTRAITTETGAGQWGSALSMACRFFGMDLEVYM
                     VKVSYEQKPYRRFLMETYGAQVFASPTTRTQAGRAILEKDPNSPGSLGIAISEAVEAA
                     ATSGGAKKYALGSVLNHVLLHQSVIGEEALKQMDMAGEYPDMVIGCVGGGSNFAGIAY
                     PFLRYNLTEGRNTRLIAVEPKAAPSLTRGVYGFDYGDTARMAPIVKMHTLGHDFIPPA
                     IHAGGLRYHGMAPSLSAFYDAGLIEAVAVGQRAVFEAAVLFTQQEGILPAPESSHAIR
                     VAIDEALKCKETGEKKVILFNLSGHGHFDLSAYNKYLSGQLEDYDFPEDAIATIAQRL
                     PQVSIPA"
     CDS             complement(95645..97018)
                     /codon_start=1
                     /locus_tag="ANT_00860"
                     /product="hypothetical protein"
                     /protein_id="BAJ62120.1"
                     /transl_table=11
                     /translation="MAQKYLFRKRSSSNPYTILALTVILLAMVAVLRGLQTQQIEPLF
                     LPTPTPTRTSNSYALEGQTHFQAGNLKGAIEAYQQALQSEPSNARIWMELAQIQTYSY
                     KSLTTREAQRQRLAEAIESANRAVELAPEDSSAYAIRAFVRDWNAGLLESDEERSRLL
                     VEAEQDAQKALLLDKNNVLALAYSAEILNDQQKWDQARQYIQLAVERNPNLMDVWRVQ
                     AAILESFGDYQGAIQAYDRAIELAPNLTFLYVQAGVIYRHLGMTQTDKTLSAQYYATA
                     LDYFAKAVNKNKQLGIEDPVPYIAIGKVYTQMGEFFVAALNAKKALQIDPYSPDLYGQ
                     LGMVYFKARNYETAIPALQCAVEGCSPQVSCEVRECDPASDPPIEIQGIPLEPNDPTT
                     VVYYYTYGSILAGLYRPVGETKDYCDRALNVFDKVRALYAGDSTVMGIVEASESICAS
                     FGITRKP"
     CDS             complement(97022..98251)
                     /codon_start=1
                     /locus_tag="ANT_00870"
                     /product="hypothetical protein"
                     /protein_id="BAJ62121.1"
                     /transl_table=11
                     /translation="MYLSGSRWSMTRRKRRANPLRLIVLIAAVGVMLYVNQFVVPNTP
                     PLFVPTPTPTRSPESFLQEARAFAAEGRFTQAEAAYQQALQADPKNITIYLELARLQA
                     LYGKYAEAQKNAENAILLNPNSSLAHAIHGWALGLQGEYLPAQAELNKAIEIEPGNGL
                     AYAYLAEVLALQKIEGKDDPTTLEKAIEASRKAVELAPDQMESYRARGYVLEITSNYA
                     DAVVAFQQAIALNDNLADLHLALGRNYKAQDIYDKAIEEFNKAIALRPDDPRPYVETA
                     LTYLRYGEYAKAAQYAEQAIQQDPTDPFLYGYLGTIHYRTSNYNQAVKFLRLATRGGL
                     SETGATVQGLPLDATSQYLYTRYGISLAYVGECGEALQISQALQQAFPDDQVNLDNAA
                     EIVRICETGGASPTPTP"
     CDS             98417..100309
                     /codon_start=1
                     /locus_tag="ANT_00880"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62122.1"
                     /transl_table=11
                     /translation="MSLLIANHLSKSYGALDVFRDLNLSIPHGARIGLVGVNGVGKTT
                     LLRILAGEEEPTTGEVQIARNCRVGYLPQRPHFSHQRTLWQECLSAFAPLLQMQEDLQ
                     ALEARMSAGDHSEETLAQYGKLQEAFERAGGYTYETRIRQTLQGLGFSESDYQRPLNK
                     TSGGQQTRALLARILLSQPDLLLLDEPTNHLDIQAIEWLENTLKEWQGAVLLVSHDRY
                     FLDQVVEQIWEMTPALEIYPGNYTAYLHQREERYRRRMEEYEAQQAFIEKEEEYIRRN
                     IAGQNTAQAKGRLKRLERLLETARLTPPVKPRALRLQLTPAQRSGDLVLRTQGLAVGY
                     PDERRVLFRVPDLTLRRGECAAVIGPNGAGKTTFLKTILGILPPLEGEVVLGASLQVG
                     YFAQAHEGLNPDHTLMEEISAAAPNLLPAQIRDYLARFLFTEDDVFKPVRVLSGGERG
                     RLALAVLALSKANLLLLDEPTNHLDLPSQEILQAVLSDYEGTVLLVSHDRYLIDALAT
                     QIWEVRPEARTLRVFEGTYSQYREVLRAEEEARRAQAVTVKPAEKPAPRTTPSRNKER
                     ERLKRQQELEAEIQRLEEQLAALSRALETPPPDPAKVHKLGQEYLHLQQTLEQKLHEW
                     LEGEGH"
     CDS             100441..102309
                     /codon_start=1
                     /locus_tag="ANT_00890"
                     /product="hypothetical protein"
                     /protein_id="BAJ62123.1"
                     /transl_table=11
                     /translation="MDWTQLGIPEEAKAILKAAPRVISPASEQELVDLACGGRESKFF
                     EVAYEVPGVGRVVEATVARVRNGVAANYPEPYMRRRDPNCLVVGDDLPTDKPRFAERF
                     GEPFEGLRQQTFDWLKSQELIVFAFNAGADEIGLGALVLCPANAGFFALGLAMLQGML
                     NPAAIPADFHPAAVVYVAPVFRHTHFQGKQVVVHNRLPHVYEMFSYNLYPGPSAKKGV
                     YGMLLSLGEKEGWTTAHCSTVRVITPYDNEITIMHEGASGGGKSEMLEQAHRAPDGRW
                     LLGRNLVTGEERYLQIPRACELRPVTDDMALCHPSIQANHGKLRLKDAERSWFVRVDH
                     IRRYGTDPFLEGLTAQPERPLLFLNIDAVPGARALIWEHIEDAPGKPCPNPRVIIPRA
                     IVPNIIENSVTVDIRSFGVRTPPCTREKPSYGIIGLFHILPPALAWLWRLVAPRGYDN
                     PSIVETEGMSSEGVGSYWPFASGLQVRHANILLDQFAAYRRMRYILVPNQHIGAWKVG
                     FMAEWIAREYLARRGSARFRPEQIRPARCALLGYAMHQMQVEGQQIARWFLQVDTQPE
                     VGEEGYDQGAQMLYEFFQRTLQPFLTEDLDPLGRQIITCALDRGTLQDFEALIPAE"
     CDS             102487..103878
                     /codon_start=1
                     /EC_number="3.6.-.-"
                     /locus_tag="ANT_00900"
                     /product="putative ATPase"
                     /protein_id="BAJ62124.1"
                     /transl_table=11
                     /translation="MDLFDHAHQEQMKSEAPLAARLRPRTFDEMVGQEHIIGPGKLLR
                     RAIETDRLFSSIILWGPPGTGKTTLAQLIAQYTQAHFEVISAVLAGVPDLRRVIQEAE
                     ERRKLYRRRTILFVDEVHRWNKAQQDALLPHVESGMITLVGATTENPYFEVISALVSR
                     SRIFQLLPLEEHHLSILFDRALSDPERGYGKISVQVDPEARAHLIRVSGGDARNLLNA
                     LELAVESTPPDENGVRHITLDVAQESIQRRAVLYDKNGDAHYDTISAFIKSVRGSDPD
                     AALYWLAKMLAAGEDPRFILRRLIILAGEDIGLADPHALQVAVSAAYAFDYIGMPEGI
                     YPIAEATLYLATAPKSNSVGEAYYSALERIQQEGAGPVPVHLMDASRDARGLGHGKGY
                     LYPHDFPDHFVPQQYLPASLQGTIFYNPSDQGYEAQILERLKRWRAWKTAQTEPASHE
                     NTDHPAVDSPRRD"
     CDS             103832..104488
                     /codon_start=1
                     /locus_tag="ANT_00910"
                     /product="putative phosphoglycerate mutase"
                     /protein_id="BAJ62125.1"
                     /transl_table=11
                     /translation="MKTPTILLLIRHGETNFVVQGRLPGRLPGVVLTEKGIQQARALS
                     ERLAEAPIRAVYASPLERARETARPLAEAKGLPILTAEGLNEVDPGGWAGRTLKSLRR
                     LKAWKALREDPGRFAFPGGESFPEAQVRIVAQIEELRRRHPGEMIACFTHADVVRLAV
                     AHYLLMPLQALHRLAAAPASLSVVVFGEDGEVQVPHVNQVDGLALTPPPEKKPHGTGR
                     "
     CDS             104749..106182
                     /codon_start=1
                     /locus_tag="ANT_00920"
                     /product="putative signaling protein"
                     /protein_id="BAJ62126.1"
                     /transl_table=11
                     /translation="MSEEERHFEMLFEYAPIALMEQDFSAIRQRFEALRAEGVNDLEA
                     FLQNHPEEIDRCMGFIRVVRVNQHTLKMYGVPDRETFLSNLPHFFRDDMRRHFREELL
                     ALWQGALTWSGEGINYTLQGNPFDVLLSWRILPGAEETWQEVLVSLEDITARRNAERA
                     LEASANRLRGLFENSPISLWEEDYSQIKAIFNDLRSQGVEDLRDYLVEHPEVVTACMQ
                     KIRVLEVNRKTLELFGASSVDDLRAHVDRIFRDEMREHFARELVHLWEGELSYEAEGI
                     NYTLQGEPLYVHLHLSVYPGSEETFERVLVALEDVTSRHKAEEYLRYLGTHDVMTGLY
                     NRAHFQDEMKRLNEHRSVPVTLLMADLDRLKLVNDTLGHDEGDKLIRCAAEVLKAAFG
                     ANDLVARIGGDEFAVLMMNAGEQDGREAIARLETLIRLNNRFYGEPRLSLSMGFSVSQ
                     PGENLELAMRRADTEMYRNKREHHHEG"
     CDS             106385..108145
                     /codon_start=1
                     /locus_tag="ANT_00930"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62127.1"
                     /transl_table=11
                     /translation="MNPKLFRNLLYIALAMILIGGLLASAVQTDFGRVTIKDVRFAAP
                     NGRLYSALLYIPKGVSAEKPAPGILAIHGYINSRETQDGFAIEFARRGYVVLALDQSG
                     HGYSEGPAFADGFGGIEGLRYLRSLDIVDKNNIGLEGHSMGGWAVLIAASVFPDGYQS
                     VVLQGSSTGTYGAPDGTPEFPRNVAVVFSQWDEFSGLMWGTPRAADVGKSDKMKALFN
                     TQEDIQVGKIYGDINAGTARVLYQPRVSHPGDHLSQVAIGHAIDWFQKTLQGGNPIPA
                     SSQIWYWKEIGTLIALLGFFLFLVAAGGLLVEVPYFKAIVDPLPAAKGLTGWGWWLGA
                     LLTAAIGPLTLFTFTTWAGKIFKASWFFPQNITTQVTFWAVLNGLISLALLLLWHFLL
                     VKKSERGGGDEYGLTWNGKLNWVKIGRSFVLALCIVLLGYATLLVTDFLFKTDYRFWV
                     FAVKLMSPTHFAIALRYLIPLFVYFFLASLALFAQMRRADFGLWKEVAVNALIFIVGY
                     TALQLVQYIPMWTRGMLFDPTQPLWTIIGYQFIPILGLAGALTTFFYRKTGRIYTGAF
                     LNALLFTWIVVAGTATHFPL"
     CDS             complement(108241..108906)
                     /codon_start=1
                     /locus_tag="ANT_00940"
                     /product="hypothetical protein"
                     /protein_id="BAJ62128.1"
                     /transl_table=11
                     /translation="MPRKTVFFVLLLIVLMVGFSGCQSTPTPEPTMDPAVWTQTAVAA
                     QTLEQGTQEALQTAQARLNVTPSPTLTSTPAPTRTATPTVTPTITLVPTRTSTPLPSA
                     TITNTPSPYTCRLVSQVPRDGSTIKPNTQFTVTWTVQNVGKVIWEDIGIDLVQMGGDK
                     IAVQTIYDLPRTVKPGESVDLQVELKAPEATGYYRTDWKLAIVDQGFTFCPLYVDFWV
                     SDR"
     CDS             109078..109266
                     /codon_start=1
                     /locus_tag="ANT_00950"
                     /product="hypothetical protein"
                     /protein_id="BAJ62129.1"
                     /transl_table=11
                     /translation="MGGFIFSLRSGGETQAFASMSSTRSGIGIAHIPNGLGVVRSPQV
                     HAQVLNLCHIPGDMPYSR"
     CDS             complement(109254..110111)
                     /codon_start=1
                     /locus_tag="ANT_00960"
                     /product="hypothetical protein"
                     /protein_id="BAJ62130.1"
                     /transl_table=11
                     /translation="MNTTPIALITDSTCDIPPAYLEQYGIIVQPHVLIWNGVEYRDRV
                     TLSSEEFYRRIQSEGTLPTTAQASVHDFLSLFHSLQEQGYREVVVILLSGHFSGAMLS
                     AQQAAQQSPIPVHVYDSRAVTAGLAWQVLAAARARERGASAQEMLAAADEVRRKVRLV
                     IALDTLEYLHRGGRIGKAAWLAGSILQIKPLIRVNHETGIVEAYGVERTRQRVIEAMI
                     KRFFKEVAGEGRLHVAVMHGMAEEEAQAIAARIRQEHPNAEVYVHLTGPILGLNTGPR
                     ALALGGYRE"
     CDS             110147..111553
                     /codon_start=1
                     /gene="radA"
                     /locus_tag="ANT_00970"
                     /product="DNA repair protein RadA"
                     /protein_id="BAJ62131.1"
                     /transl_table=11
                     /translation="MIFMAKIQTRYVCQNCGRVAARAMGRCPQCGAWNSMVEEIIAPP
                     STPAKSPSASSSPGGFTSQPRRLDEIEGDHEARLPVPIGEFARVLGGGVVPGSITLVG
                     GDPGIGKSTLMLQVALEMAQERRVLYISGEESERQVKMRAVRLLNGRPVPENLFLLTE
                     TNLDSMLEHVRSLAPSVLVVDSIQTVYLPALESSAGSVSQVRECASRLRDLAKSAGIS
                     IFVIGHVTKEGIIAGPRVLEHIVDTVLYLEGDRYQSYRLLRSVKNRFGATSEVGVFEM
                     LERGMSEVLNPSEAFLAERLVNVPGSAIAVTMEGTRPLLVEIQGLTSPSPLTLPRRTP
                     NGIDGNRLLLITAVLTRRLGMRLAEQDVFVNVIGGLRITEPAADLAVAAAIASSMKDT
                     PVRANAVLIGEVGLSGELRMPSQMSARLREAAKLGFDTAIIPRRIRKGGEAYPEGIQV
                     LEARSLREALNLALLAGG"
     tRNA            111703..111776
                     /locus_tag="ANT_t0010"
                     /product="tRNA-Pro"
     CDS             111845..112168
                     /codon_start=1
                     /locus_tag="ANT_00980"
                     /product="hypothetical protein"
                     /protein_id="BAJ62132.1"
                     /transl_table=11
                     /translation="MEKAPRKVDAVVEAVHYTPEGKIDFVRLHERRGAVFGDHILVRR
                     EDLMQRLRAKQVIYSGRRLAPWGNQFEFGAPLRLVNHNGGEWVRCGEDDSAEARDLLK
                     GVPVL"
     CDS             112175..112936
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_00990"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62133.1"
                     /transl_table=11
                     /translation="MFAGQATVSAPFLSIILPAHNEEHRLPPALESLHAFLSAQSFSF
                     EVVVVENGSTDRTREVLAEYAARFPYLVPLTDERRGKGLAVQRGMLTARGQYRMFCDV
                     DFSMPVEQISRFIPPALPGVEIAIASREAPGAVRYGEPVVRHIIGRGFNTLVRWVALP
                     GLQDTQCGFKCFRGDIAERIFPLQTLHGWTFDVEVLFIARRLGYRVVEVPIPWYYNAE
                     SKIRVLRDSYAMFADLIRIRLNARRGMYDGAPASR"
     CDS             112914..113588
                     /codon_start=1
                     /EC_number="3.1.26.4"
                     /gene="rnhB"
                     /locus_tag="ANT_01000"
                     /note="protein synonym:RNase HII"
                     /product="ribonuclease HII"
                     /protein_id="BAJ62134.1"
                     /transl_table=11
                     /translation="MARPPLADLPHDPTLAFEQSLWQAGVLHVAGVDEAGRGAWAGPV
                     AAAAVILPSGDSALLERLHGVRDSKQMTAKAREGFAEVIRQTALAWGVGFASVEEIET
                     QGIVPATRLAMMRALQACALSPTHLLIDALRLPEIPLPQTSLIKGDARSLSIAAASVL
                     AKTARDALMRDLARQYPQYGFELHKGYGTARHRAALEQWGPCPLHRRTYRPVMHLSDL
                     WEKSAG"
     CDS             113884..114222
                     /codon_start=1
                     /locus_tag="ANT_01010"
                     /note="fragment"
                     /product="putative protoporphyrin oxidase"
                     /protein_id="BAJ62135.1"
                     /transl_table=11
                     /translation="MPEKILIAYATKYGSTAGIATTLGEALGARGLQVDVRPVREVRT
                     LEGYDAVILGSPVYMGNWLSEAVTFVRTHQAELSRLPVALFTVHMLNQGEDETSRAAR
                     QGYTAPVRTL"
     repeat_region   114205..114212
                     /rpt_type=flanking
     repeat_region   114213..115412
                     /note="Similar to IS6 family"
     repeat_region   114213..114239
                     /note="27bp imperfect inverted repeat"
                     /rpt_type=inverted
     CDS             114298..115326
                     /codon_start=1
                     /locus_tag="ANT_01020"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAJ62136.1"
                     /transl_table=11
                     /translation="MKIILQLPQVKRKKPARPKRCPYCQGETFQRWGVEKRRIEDVKV
                     RHVEVVRYRCTRCRRTFRDYPEGVGNGRHSERLKKLSVILWSLGLSYRRVAGVLRIFG
                     LRLSHMSGWRHVQAEGEKLMGELKWKSVRVVGVDGAWVGGKGVMVAVDLGDGSLLEVA
                     EVDEKDSRALFTWLKRLKEMHDIGAIVSDDLAIYKQLTDELEIGHQVCQFHVRRWVKH
                     ALKGLQAELDPAWQGVLEKVEEILRDLPLHGDRLLHRLWKSLPGRSTPPEGKRTPLEK
                     LRDLILRLSRDWQRYVAFYADVGIPWTNNRTEQMIGRLKSRAQQARRYKTTAGLLRGS
                     TVACQFWA"
     repeat_region   115386..115412
                     /note="27bp imperfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   115413..115420
                     /rpt_type=flanking
     CDS             115446..115601
                     /codon_start=1
                     /locus_tag="ANT_01030"
                     /note="fragment"
                     /product="putative protoporphyrin oxidase"
                     /protein_id="BAJ62137.1"
                     /transl_table=11
                     /translation="MFFAGKIDYYTLSFFDRLITRLVAKQSGQSKPVNDLRDWEKIRR
                     WAEEVFA"
     CDS             complement(115614..116555)
                     /codon_start=1
                     /locus_tag="ANT_01040"
                     /product="hypothetical protein"
                     /protein_id="BAJ62138.1"
                     /transl_table=11
                     /translation="MLADLNRQLLETAETLRRKTALIKEKQTLENTLQRLRREVDDLE
                     TRTRQIRARLQALEGTSLQAGWHSLLGDRDEQITSARQELQSLEGQIKKAQRAVEETE
                     ARLLGLDAQLKSLAGMEERLENLLRQKEQALMSSQHPLGGELQALYRRQSDLRAEKRE
                     VGEALQIGLNALDRLKEAIAALESASGMGVWDMLGGGALISAFKHSRLNDARAALEQA
                     QAALNHFARELRDVQVSREPALEMGGFELFFDVIADGLLVDWWVQSKISTALKHTRDQ
                     HDALIAALNHLNQRYRQLEQEEEHLRQRRQEILRSPV"
     CDS             complement(116744..117853)
                     /codon_start=1
                     /EC_number="1.5.1.28"
                     /locus_tag="ANT_01050"
                     /note="protein synonym:N-(1-D-carboxyethyl)-L-norvaline
                     dehydrogenase"
                     /product="putative opine dehydrogenase"
                     /protein_id="BAJ62139.1"
                     /transl_table=11
                     /translation="MTQTLSITVIGAGHGGKAMAAHLALMGHRVKLFNRTADHIFAIQ
                     QRGGIDLESQEYGPRGFGKLECATSDMGEALADAQLIMVVVPSSAHADIARAAAPHLK
                     DGQVVVLHPGRTCGAIEFVMVLRRSGCQADVTVAEAETFIYASRSDGPAQARIFRIKE
                     AVPLAALPAKRTHEVLDLIHVVYPQFIDGGNVLQTGLNNMGAIFHPALTLLNAGWIEA
                     THGDYQFYIDGVTPSVARVLEALDRERITVAAALGIRARSALEWLKMAYDAVGSDLRE
                     AIHNQPGYYGIKAPTTLNHRYIFEDVPMSLVPIASLGMQYGVSVRGMDSIIRLACIVH
                     NTDYWRRGRTVENLGLRGLSVEELTHFVMEGELAV"
     CDS             complement(117919..119559)
                     /codon_start=1
                     /locus_tag="ANT_01060"
                     /product="hypothetical protein"
                     /protein_id="BAJ62140.1"
                     /transl_table=11
                     /translation="MKTVVAAALGECVHVAGVMNFLRLAELAGWRTVFLGPAVPVEKV
                     IETARKERADLVGVSYRLTPETGEMLLAQFAEAADDLHAAGVRFAFAGTPPVAERARK
                     LGFFERIFDGSETPDAVLTYLRGEGGDPSNQPIPPQTTVERIRWKAPYPILRHHFGLP
                     TMEDTLRGIEQIAEASALDVISLGVDQDAQENFFKPEKQDPRRRGAGGVPVRTPDDYR
                     ALYQASRRGNYPLLRTYSGTDDFIRLAEMYMETIHNAWCAIPLFWFNQMDGRGPWDLE
                     GSIVEHQEVMAWYGARNIPVELNEPHHWGMRDAPDTVFVASAYLSAYNARAFGVHDYI
                     AQLMFNSPPGLSDAMDLARMLAVLEAIEALASEDFRIWRQTRTGLLSYPLEPAAARGH
                     LAASIYLQMAVKPHIVHIVGHTEAHHAATAEDVIEASRIARKAIENAVAGAPDMTADP
                     RVQARKEELLADLEVTLDAIRALAPAGVPDPLVHAPTLAKAVAAGVLDAPHLRNNRFA
                     PGRVNTRIIEGKCLAVDAEGKPLSERERVEQALSAVRE"
     CDS             complement(119918..120517)
                     /codon_start=1
                     /locus_tag="ANT_01070"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62141.1"
                     /transl_table=11
                     /translation="MPLSKRLFDLTLAVLALVLLSPVLLFTALAVRLGLGKPVLFRQP
                     RPGYRGRVFTLYKFRTMRDALAPDGTPLPDDQRLTPLGRFLRATSLDELPELFNVLKG
                     EMSLVGPRPLLVKYLPLYTPEQMRRHEVLPGITGWAQINGRNALSWQDKFRLDVWYVD
                     HWSFWLDVKILILTVWKVLRREGINQPGQATASEFDGTN"
     CDS             120705..120884
                     /codon_start=1
                     /locus_tag="ANT_01080"
                     /product="hypothetical protein"
                     /protein_id="BAJ62142.1"
                     /transl_table=11
                     /translation="MLKKYEPEIERLTLIPSDGGRFEVEVNGRLVYSKLKTGRHAEPG
                     EVAEQIQTILEKGQV"
     CDS             120881..121867
                     /codon_start=1
                     /EC_number="6.1.1.2"
                     /gene="trpS"
                     /locus_tag="ANT_01090"
                     /note="protein synonym:TrpRS"
                     /note="protein synonym:tryptophan--tRNA ligase"
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="BAJ62143.1"
                     /transl_table=11
                     /translation="MSKKGRVFSGARPTGRQHLGNYLGAMKNYVALQKDYDCIYCIVD
                     LHALTTLETTRDLKQNTFEMALDWLAAGIDPRESIVFIQSHVPQVTELSLILSMVSPL
                     GKLTDLPTFKEKVRMQPNNVNLGLVSYPVLMTADIVLYETDIVPVGIDQASHIEFARE
                     TVRSFHYRYNTTVLKEPEIKLTEVPKVLGTDGQQKMSKSLNNHIELALTPEETTKVVM
                     TMVTDPQRQRRTDPGNPDVCNVFSMHKVFSSPEEVEMINTECRRAGIGCVDCKKRFAA
                     NLNASLAPFREKRAALAQNPDEIWDILHDGANRARVIAEQTMVKVREAVGLP"
     CDS             121895..123577
                     /codon_start=1
                     /EC_number="6.1.1.18"
                     /gene="glnS"
                     /locus_tag="ANT_01100"
                     /note="protein synonym:GlnRS"
                     /note="protein synonym:glutamine--tRNA ligase"
                     /product="glutaminyl-tRNA synthetase"
                     /protein_id="BAJ62144.1"
                     /transl_table=11
                     /translation="MTESAAPSHFIKEAIEEDLRSGRFNYVRTRFPPEPNGYLHIGHA
                     KAICIDFGMAEAFGGECNLRFDDTNPTKEDTEYVEAIKEDIRWLGFDWGDREYYASDY
                     FEQLYEWAVELIKKGLAYVDDLSPEEIREYRGTLTEPGRESPYRNRSVEENLDLFRRM
                     RDGEFPEGSRTLRAKIDMASGNINLRDPVMYRILHTPHHRTGSKWHIYPMYDFAHGQS
                     DSIEGITHSLCDLAYEDHRPLYDWFLDALGIFHPRQIEFARLNLSYTILSKRYLKQMV
                     EKGVVRGWDDPRMPTLRGMRRRGYPPEAIRDFIDRIGVSKNESLVDVALLEHCVRENL
                     NKTALRVMGVLDPLKVVITNYPEGQVEYLEAINNPEDPSAGTRQIPFSRELYIEREDF
                     REVPPPKYYRLAPGREVRLRYGYFIKCEEVVKDEQGNVVELRCTYDPATRGGYAPDGR
                     KVQGTLHWVSAAHAVDAEVRWYDRLFTHPTPDDVEEGKSFLDYLNPDSLKILTGCKVE
                     PSLANAPVGARYQFERKGYFCVDPDSTPGKPVFNLTVELRDTWSKIEQTLKK"
     CDS             complement(123750..124916)
                     /codon_start=1
                     /locus_tag="ANT_01110"
                     /product="secretion protein HlyD family protein"
                     /protein_id="BAJ62145.1"
                     /transl_table=11
                     /translation="MTWKKSILSAVIVLWLAGCSALPWAQSAPQATPVPTVSENGGVL
                     AEAKLVPNDSASLFFLSGGTLAEVLVSEGEQVQAGQVLARLSESAQAQATLAQAKAEL
                     LAAQQALDTLNKKAALTAEQARVAMLEAEREAVQAWQAFDRLDTRATRDRIDDLRERA
                     ADLQQELQDREETLGRYSNLAADNPTRKRAEDDVEQARLRYNDASRELNQLTNEVELA
                     RARWDLANQRLEDARRTYEARQELKPDPDELALAQARVEAAQAAVAAAKEALSRLELR
                     APFDGTVVEVRYSPGESVAPAQTVLVLADLSEWYAETVDLSEKDVVKIKAGQAVEIIP
                     DALPEVTLKGEVERIALFPLERGGDVVYRVRVRLLESDERLRWGMTVDVRFPQE"
     CDS             complement(124939..127347)
                     /codon_start=1
                     /locus_tag="ANT_01120"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62146.1"
                     /transl_table=11
                     /translation="MIPPRWQKILSDFIGNPTRSVLVILSIAVGLFAMGAINNTRLQA
                     AQLMANNYAAVNPANVILYTSPLREVDLEPLRRLDGVAQVEGMHSATLRIRNNEGDWV
                     RLSVLAPPDYAEKEINQVLVMQGTYPPAERTVAIDQYKLKELTVFPDRTVEIQLPSGR
                     VRRVPMSAVVQDQTIGASRADGGFFLAPAQAFTTWETLEWLEIDPCINLVYVTASRDA
                     DNPDYLRQLGRQVADELESNGHVVISYAVNGRHDHPNSNYTEALSSILILLSLLVLFL
                     SGFLITNTLQALLAQQVQQIGVMKSVGATSGQIALLYLSLIELYGLIAFALSLAPTRW
                     MTGVFLNLLHGGINTPLAEPQLLPETRLWMGILALAVPALAGSAPILRAANISVREAL
                     SGVAPQSAALREGRLMRRLRQIRGLSRPLLISLRNTFRKRLRLILTLITLTLGGAIFI
                     ATLNTRVSLQNYIERLRYYFLADVSITFQVPYRLSEVRHDLMSLPDVSVVEGWNGARA
                     ELVLPNGTGESITVIAPPEGSQMVRPILLSGRWIQPGDRYAIAVSERFLDLLPDLSPG
                     DTIRLRINDREREWTVVGIFQLVGKSAGFLSYANGEALGAEIHQGGRFTNVRVLSTNP
                     NLTLEEQKEFGRRVEQLLEDRGYRVDEVTAGLRLKEISANGLNILTAVLLLLSALIAA
                     VGSIGLMGTMSMNVLERTREIGVMRAIGADDRHVLNIVLGEGMLIGLISWALSVLSAL
                     PISKLLANSISYALFEAPATLTFTPTSVVLWLGAVLVLSVVASAVPARSAARLTIREV
                     LSYE"
     CDS             complement(127344..128396)
                     /codon_start=1
                     /locus_tag="ANT_01130"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62147.1"
                     /transl_table=11
                     /translation="MNAPAAPYISLQDVVKTFPAPGGEVMVLKHIYLDIQPGEYVSIV
                     GKSGSGKSTLLNMITGIDHPTSGTVTVAGTQPHRLSESQLAGWRGVTIGIVFQFFQLL
                     PMLSLLENVMLPMDFCNRYPPAEREGRARALLEQVGLGDMVDKLPGAVSGGQQQAAAI
                     ARALANDPPLIVADEPTGNLDERTAEGVLALFDGLVARGKTVVIVTHDPALVKRTQRT
                     ILLSDGEIVNPFIAQALPHLSHPQLLQLTHLARPQTLSRGESLTLPPYAPGLLVLTQG
                     KLALWKPARRGEILWRELRPAQALTAQDVAFHTPLRLQALEDSAWLEIPAEAWETWLA
                     QSGARASLAPVTEKRA"
     CDS             complement(128393..129103)
                     /codon_start=1
                     /locus_tag="ANT_01140"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62148.1"
                     /transl_table=11
                     /translation="MNTSPILTLKQVRKTYLSGDQPLEVLKGIDLEVYAGEFVLIYGK
                     SGSGKTTLINMIAGIDPLTAGEVWFDGVNVHRLNENQRARWRGRNVGIVYQSFYLMPT
                     LSLLHNVMLPMDVCGLYHPRRSPQRALELLRMVELEEHAHKLPSAISGGQQQRVAIAR
                     ALANDPPLIIADEPTGRLDSITAATILEIFLNLARQGKTILMVTHDLSLMPLASRCFR
                     LEGGLVHSCPVEERTPAP"
     CDS             129255..129923
                     /codon_start=1
                     /locus_tag="ANT_01150"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BAJ62149.1"
                     /transl_table=11
                     /translation="MSENLPALPRQDRRISRTRRQLREALMALILEKGYDAVTVEDIA
                     ARADVGRTTFYLHYRDKEHLFLESITQIADELAEQMYALFPQGQAVQEDQVGDHAMRP
                     IVLVFRHAAENADLYRAMMRGEGGLIAITRLRELSASYALEFMRLFLKEAQTSLPLEV
                     IASYFAASLLGTLTWWLEAGMPYPPDEMAHMFRRLAMRGVWEALGVTPPSSSAGQEEI
                     QRLR"
     CDS             130089..130757
                     /codon_start=1
                     /locus_tag="ANT_01160"
                     /product="hypothetical protein"
                     /protein_id="BAJ62150.1"
                     /transl_table=11
                     /translation="MKPFFSLSVLLLSAVLMLTACAGSGEIRAIPLTPLPSATPLPTS
                     TPLPTATPVPMPTEAATLPAERVESCLVGRWIVSDASPYFQTAFQGTDIVLGGTSGNA
                     WYNFGEAGIFLLEAIQFAQSAAVKTDVGEVPVDVVMDGIALARYRVEGDKVFFREQSV
                     TSLVFQVEAFGETLGLDPAGLLGDAAAGETAFLFECVGADRLLLTPPLDNYGVFPLVL
                     ERYP"
     CDS             131018..131962
                     /codon_start=1
                     /locus_tag="ANT_01170"
                     /product="putative signaling protein"
                     /protein_id="BAJ62151.1"
                     /transl_table=11
                     /translation="MQMQVNERVKGPYKQWLDHLFDGVYVVDMHRRIQYWNAAAEELT
                     GYTAGEVCGTRCSDNILEHVDFAGKALCKEGCPLHATLQDGQRREALVFLHHKNGHRV
                     PVHIRVSPLYDDEGKVTGAIEVFSDHSQHLTIAKELEHYKQESLLDPLLRIGNRRYAQ
                     MVFQVRQYEYGVTQTPFGALMLDLDLFKHVNDTYGHHVGDLVLKMVTQTIVRVLRGSD
                     ALFRWGGDEFLAFLPAITSGGLLVASERIRSMVEASFVMVEGQRIQTTLSVGATLAVP
                     EDTLESLVERADLLLYQSKQKGGNHCTVEERFPHNGGK"
     tRNA            132031..132107
                     /locus_tag="ANT_t0020"
                     /product="tRNA-Val"
     CDS             132316..134187
                     /codon_start=1
                     /EC_number="6.1.1.3"
                     /gene="thrS"
                     /locus_tag="ANT_01180"
                     /note="protein synonym:ThrRS"
                     /note="protein synonym:threonine--tRNA ligase"
                     /product="threonyl-tRNA synthetase"
                     /protein_id="BAJ62152.1"
                     /transl_table=11
                     /translation="MQTFARPRLGAGVLFQVKEVGMLSKAQERYEDSHIFRVRHSCSH
                     IMAQAVLELFPNAKYAIGPAIEDGFYYDFDLPRTLTPEDLEHIEKRMKEIIKGNHDFI
                     RQEVSAEEARQIFKDQPYKLELIDGLEKGEVDEDGNPLEEKPVISIYKHDKFVDLCRG
                     PHVANTREINPKAVKLMQVSGAYWRGDEHNPMLQRIYGTAWETPEELEQYLWRLEEAK
                     KRDHRKLGKELDIYLFDDEIGPGLPLWTPRGGAIIEEIEKLAKEMEFKYGYERVRTPH
                     LAKEDLYLRSGHLPYYAESMYPPMELEGVRYYVKPMNCPMHHKIFASKPRSYRELPVR
                     LAEYGTCYRYEKSGELFGLMRVRSMQMNDSHIYCSEEQFEQEFVGVIHLYLEYFRLFG
                     IQDYLMRLSTHHPRGLGKKYVNNPELWRKTEDMVRKALDNNGIPYVEIADEAAFYGPK
                     IDVQVKSAIGREFTLATNQVDFAQPERFDLKFINEKGEEERPLIIHRAPLSTHERLIG
                     FLLEHYAGAFPVWLSPEQVRIIPITDAQNEYAKQLERRLRALEVRATADLDSDRMNAK
                     IRKAQLLKIPYMLVVGEREAQAGAVALRKRDGTQQTLSVDEFVALLQEKISTRAADL"
     CDS             134325..136421
                     /codon_start=1
                     /locus_tag="ANT_01190"
                     /product="hypothetical protein"
                     /protein_id="BAJ62153.1"
                     /transl_table=11
                     /translation="MTLPQDYLERVYAGVLGKIIGVYLGRPFEGWTYEQILERLGEIH
                     YYVHDRLGVPLVVTDDDISGTFTFLRALPDFGNTFDLTAEQIGQTWLNYLVENRTVLW
                     WGGMGNSTEHTAYLRLKHGIPAPRSGSMALNGKVVAEQIGAQIFIDGWAMVCPGEPDR
                     AAELARRAAQVSHDGEAVFAAQVLAAMEALAFVEPDLNRLLDEAVRLIPGDSLIYRLI
                     ADLRHQRARTDDWRETLAFIFRHYGYDRYGGNCHVIPNHALIHLSLLYGGDDFQRALS
                     IVNTAGWDTDCNSGNVGCLLGIKNGLAGLDAGPDWRMPVADALYLPTAEGGSCVTDAL
                     QVAQWVAGIGCALHGEPAPKLKGGVRFSFDLPGALQGFTALEGAPVRLENVCGYSERG
                     QRALAIHYAHVAPGVPARVATATFLRPDAFQMKTYDLFGCPTLYSGQVVSAEVCADER
                     NAAVAQARLFIEVYDEDDRLVSIPAPVQSLAPGGRQRWTWQIPDTQARPIARVGLEVL
                     DSAHTPGTLYLDWLDWQGAPQVCLTRPARRGQAWQLAWVNAVSHLDTSNEPLRLIQDE
                     GRGLLAQGTLDWRDVEAQAVCTPHLARAFGLAVRVQGLERYYALVLAHPGTARLICRW
                     YGKDEVLAEVPLAWDWGQTFTLSLRAEGVRLTALVDGVPVLQAEDARLQGGAVGLLIE
                     EGRLGVEQVCVRGRQV"
     CDS             136552..138360
                     /codon_start=1
                     /locus_tag="ANT_01200"
                     /product="hypothetical protein"
                     /protein_id="BAJ62154.1"
                     /transl_table=11
                     /translation="MKPLRWLNAVIGVFLLVLAGAPILPARAEDFPPDEPERKALITV
                     EFTRYFWWLAEWEGNEVVCRLAVEHEGIPTYNEIEGLCGKKVAQRWLESKPCNLAETP
                     AGLCPGLYALEIGSEPASREVEVTLPLPSVWIHLEDCAPLPGDRACTRMPVLRLEGRE
                     PLPNETILSIQGIFNGEAFTCAGAECRLPLQPTGQDGTVMEFWADSSFGDSSEHYTAR
                     VRVLPWGDFMDPDGGGRDARLWYVDILSTQYTDGEIAACAFTWQSFPDVNGPPQWLTT
                     PPSIEDLRTDTGFYYLAGALIQNGLVDTSACLDGGLTAVNVASACGVEAARPLLTEWQ
                     NRFDGEIWQAAQDTGVPARLLKNVFARESQLWPGVFHTTREAGLGQLTEKGADTILLW
                     NPEFFRQFCPLVLHQSTCDLGFGNLKAAEQALLRGALVRKVNASCPDCPTGIDISEAQ
                     YSVRVFAEGLLANCEQTGRILRNLTGMEPGRLSRYDDLWRFTLVNYNAGAGCLSTAAR
                     RVLNNGEALTWENLAAQLDPACQGAIGYVEDISGERRILPTPTPWLGGAPIQVTPPRV
                     LATPTPAPLFPTVTPTAQPTPSNGTPTPTLEGYLSP"
     CDS             138767..140158
                     /codon_start=1
                     /locus_tag="ANT_01210"
                     /product="putative hydrolase"
                     /protein_id="BAJ62155.1"
                     /transl_table=11
                     /translation="MTTLLVKNISFLVTMDGARREIVNGAIFARDGIIEQVGQTADLP
                     ATADRVLDLNGYIVFPGLINTHHHFYQTLTRVVPAAQDANLFNWLKTLYPIWARLTPE
                     DIYISTQTALAELALSGCTTASDHLYLYPNGSRLDDEIAAAREVGLRLHASRGSMSLG
                     ESKGGLPPDSVVDSEEHILRDSQRLIEQYHDPKPGSMVQIVLAPCSPFSVTGDLMRES
                     AVLARQYGVHLHTHLAETQDEEVFCLQKFGMRPVEYMESLGWVGNDVWFAHAVHVNPA
                     EIEVFAHTGCGVAHCPSSNMRLASGIAPVMPYIKAGVKVGLGVDGSASNDGSHMLEEV
                     RQAMLLARLSAGLQGASLSGQDAPPLMTARQALELGTRGGAAVLGRNDIGALEAGKCC
                     DFAAIRLDRLTYAGAQHDPVAALAFCAPQNVDILSVGGNLVVEDGQLRTVDVPRLVER
                     HNRAAQRLVTGEA"
     CDS             140175..142013
                     /codon_start=1
                     /EC_number="3.5.4.2"
                     /gene="ade"
                     /locus_tag="ANT_01220"
                     /note="protein synonym:adenase"
                     /note="protein synonym:adenine aminase"
                     /product="adenine deaminase"
                     /protein_id="BAJ62156.1"
                     /transl_table=11
                     /translation="MFPLGFLSTAMVERQVKRMSQSFRLISTRTLVDCAMGRVPADLV
                     VRNARWVSVQSGEILPHTEVAVKDGRIAAVGEDVRQTIGPNTRVLDAQGRYLVPGLLD
                     AHMHVESGMLSVAQFVRAVLPHGTTGMFIDPHEIANVLGLRGVRLMVEEALLQPIHVF
                     VQVPSCVPSAPGLETAGAVLGAEEIREALSWEGVIGLGEMMNYPGVQYCDEDVHAKLE
                     ATRQAGKVIGGHYPSPLLNHEFAAYAAGGAMDDHEGTRLEDALARVRNGMRAMLRFGS
                     AWHDVKEQVRAITEMNLDPRYFLLCTDDSHSATLIQEGHMDRVLRHAIAQGLPPMTAI
                     QMATLNTAEHFGVSREMGMIAPGRWADMLLVSDLVNFSVEMVIAKGQVVAQDGKLLVE
                     PPALHYPDWALRTVHLPRALTAVDFRLPADDSRTTANVIGIIENQAPTRHLHMNVRPV
                     NGEIQVDLSRDLAKVALVERHRPSGKVQVGLVHGFGFTQPCGIASTVAHDSHQMIVIG
                     TDEEDMACAANRLMQTGGGQVVISRGEILGEVQLPIAGLISSAPAEQVARQAESVLEG
                     FRACGCHLNNPNMQMSLLGLVVIPELRISDLGLVDVRRFQIIDVLE"
     CDS             142036..142767
                     /codon_start=1
                     /locus_tag="ANT_01230"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BAJ62157.1"
                     /transl_table=11
                     /translation="MELNGKNTHPYQRLQDQLAQLIAATPPGGRLPAEPELARQLNVS
                     RATLREAMRSFEGQGLIRRRQGVGTFVVGQPAVIETGLEVLESIETLAHRMGMDVSMG
                     DLNIREVNANPEEAALFDVPQGTPLVQVRRTIHTAGRPVAYLVDILPEDVLTPQDLER
                     GFTGSVLDLLLRRGSPMLTRSVAEIQAVAADAKVARWLEIQRGDVLLMFKARLYSAEE
                     RMIDLSYSFFLPGYFRFQVVRRVGN"
     CDS             142786..144000
                     /codon_start=1
                     /locus_tag="ANT_01240"
                     /product="putative hydrolase"
                     /protein_id="BAJ62158.1"
                     /transl_table=11
                     /translation="MVESHVVQLIQERVRTAEEDIIRFLREICAIPSMESQIGPVGER
                     IGAEMRKLGFDEVRFDKMGNILGRIGNGPKVLVYDSHIDTVGVGDPAEWPYDPFEGKI
                     ENGCLYARGAVDEKGSTPGMVYGLAIARDLGLLDGWTVYYFGNMEEWCDGIAPNSFVE
                     VDPGVRPDFVVIGEPTMMKVYRGHKGRLEFKVTARGKSAHAASNHLGDNAIYKLLPVI
                     AGIRDLEPALGDHPFLGHGKITVTDMKVRTASINAVPDEAVIFIDRRMTFGETKEQVI
                     EQVRALIPEKDRESVTIEELFYDEPSYTGFVFPVDKYFPAWALDEEHPLVQAGQKTRT
                     LIGLPEAPSGKWDFSTNGIYWAGKAGIPSIGFGPGDERLAHAMAEHVPLAEVVKAAEF
                     YALLPRIIQETK"
     CDS             144036..145016
                     /codon_start=1
                     /EC_number="2.1.3.3"
                     /locus_tag="ANT_01250"
                     /product="ornithine carbamoyltransferase"
                     /protein_id="BAJ62159.1"
                     /transl_table=11
                     /translation="MQTNLRGRDFIGDLDFSKEEVETVLDVAWDLKRKRALGEPHPLL
                     RDKTLAMLFFFTSTRTRGSFEAGMAQLGGHAAFIDSDTTQIAHGDTAKEIGEIFGRYF
                     DGIAIRQCDWQFGNKYINEVARYSRVPVLNMQDDIYHPFQCLADLMTIMEKKGRDLRR
                     RKIVVSWAYAASYSKPISVPQSLILQLTRFGADVVLAHPPEFKLMPEIVEMARENARK
                     YHSGFEIVHDMDEAFKDADVVYPKSWGPLVTTTDKNEGKVLIEKYRDWITDQRRMDLT
                     KEDSIYMHCLPADRNLEVTDEVIDGPHSVVYDEAENRLHVQKAVMALTMS"
     CDS             145050..146009
                     /codon_start=1
                     /EC_number="2.7.2.2"
                     /locus_tag="ANT_01260"
                     /product="carbamate kinase"
                     /protein_id="BAJ62160.1"
                     /transl_table=11
                     /translation="MKMSRKKTAVIAIGGNSLIKDNAHQKIEDQYQAAKETCYHIADM
                     IEAGWNVAIGHGNGPQVGLILRQSEVAAKVEHLPETPLDVCGAESQGLIGYLLQQNLQ
                     NELFRRKIHQNVATVITQVLVDKNDPAFQHPTKPIGGFMTEEEAKRKAEELGWTVVED
                     AGRGWRRVVASPDPKEVVELDTIKALIEAGVIVITVGGGGIPVIDKGDGDYVGIAAVI
                     DKDFASSLLAQEINADIFIISTAVEKVALNYGKPNEKLIDRMTVAEAKQYIQEGHFAK
                     GSMLPKVQACIRYLEAGGKEALITSPENIGRALRGETGTWIVP"
     CDS             complement(146256..147215)
                     /codon_start=1
                     /locus_tag="ANT_01270"
                     /product="putative hydrolase"
                     /protein_id="BAJ62161.1"
                     /transl_table=11
                     /translation="MSFVSQLFLGVLRLFPFVPHSNWSIHQQRDVLEFYARLLLHTPP
                     GVRIGFAAAGGPRAEWLIPERNTPDQVILYLHGGAYTVGSPRTHREMVGYLSLFARTR
                     ALVVDYRLAPEHPFPAALEDALAAYHHLQRLGYPPHKIAFAGDSAGGGLAMATLLALR
                     DRGEPLPAAAALMSPWTDLAGVGESVKTHETRDPLINPADLPVAARLYLRDLDPRHPY
                     ASPLYGDFHGLPPILVHVGTEEILYTDSTRLVERLLEDGVDAKLVVWEGMWHVFQLFT
                     LRVPESWRSLRQMGSFLHHHLSRAQAEETNPQSIQKEKVPVQP"
     CDS             complement(147246..148049)
                     /codon_start=1
                     /locus_tag="ANT_01280"
                     /product="hypothetical protein"
                     /protein_id="BAJ62162.1"
                     /transl_table=11
                     /translation="MITFTKEDLIEKIHQISREGWKKSVKQTIERRNDGAVGNTLECL
                     LGLSENNLPIPNAQEWELKGQREHTSSLITLKHLEPSPTALQIVSCILLPNFGWRHKE
                     AGKKYPNDEKSFRSTTDAIHYTNRGFKLVLDRNARKLRFTFSKDHIDASDPSIKEWAN
                     SVPDSLCPEPYWGFQDLEYAIGSKIKNCFYVIAESKIENRHEFFLYKKLFVLSGFDFE
                     RFLNCIEMGLVFVDFDARTGHNHGTKFRIKQNSWKNLYKSVQEINLLEE"
     CDS             complement(148046..148969)
                     /codon_start=1
                     /locus_tag="ANT_01290"
                     /product="putative methyltransferase"
                     /protein_id="BAJ62163.1"
                     /transl_table=11
                     /translation="MNDTYTGISLPLKVKEAQTLYRTKLSIGYTRTCSCPPNHLSCLS
                     AKEWIKCQLGVWQFNYEGRDIRDKSIHPATFPISLSKKVISLFTHEGELVLDPFVGSG
                     TTLVAARDLNRNAVGFDLQEKYIDLCAERLATNNLFNNAQQVAIHDDARNIPNYLEPE
                     MVSLIWTSPPYANLLNRKRLNKSRRDRKNEQFGKIEQYSQDPSDLGTMPLEEYTRAMG
                     EIFEKLLPLLKPRGHCVINVPDMWWEDKRITIHVSLIEELRQRGYELRNIIIWDRTNI
                     VNKIGIFGWPSNYITMGTTFEYLLDFWRPSQ"
     CDS             complement(149069..149707)
                     /codon_start=1
                     /locus_tag="ANT_01300"
                     /product="hypothetical protein"
                     /protein_id="BAJ62164.1"
                     /transl_table=11
                     /translation="MHWKRDLASKFFDGILPVIVLYLLWQTILLPMGILYHRSGGPGL
                     MVYALALIAVAVYSFQRGLNTRSAETTRGWYGMAGGLVAWAATEFASMLSEGKLSGLD
                     TAIALLLAILITTLMWRQYLPVGARFFLTTYLANGVGHILMTFFRLLAGTSPAAMLFF
                     LILGYAAIAITLGGLIWIMFFSERRLQRMWAALIILLAGSAAVYIFRGGWFG"
     CDS             complement(149711..151027)
                     /codon_start=1
                     /locus_tag="ANT_01310"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAJ62165.1"
                     /transl_table=11
                     /translation="MPTTLSTPKPVSRIPNTFRALRHYNYRVWFIGQTISLSGSWMQT
                     MAQQVLVYRLTGSAAALGFISFIGLIPLIPFSLWGGSLTDRFPKRDVILWAQVVMMAQ
                     ALLLSWLTWSGRVQVWHIYALSLLLAAVNAVDLPARQAFTVDMVEGKEDLTNAIGLNS
                     AMFNLARALGPALAGLVVAAIGEGPAFFFNALTFVPVILALLSMRNLPQSSRPPQAHS
                     TVRHILEGLRYVISKPVQLLLMSLVAVSAFLSMPYNTLMPVFAQDVLSESAQPVIARV
                     CEGPARLFSCQSPQALPLGMLLTAVGVGAVLGALFVASLPAESHRGRWLTLGNLGFPL
                     ALLFVAVSRSFLFSLFMMMAAGWMFVLQNALANTLIQMTAPDEVRGRVMGFYTMTIQA
                     FMRLGALQAGYVADWIGAPLALGMGALLSLLYGGWVALFKPVIRRL"
     CDS             complement(151347..151823)
                     /codon_start=1
                     /locus_tag="ANT_01320"
                     /product="hypothetical protein"
                     /protein_id="BAJ62166.1"
                     /transl_table=11
                     /translation="MIYLIDGHNLIPHLPGLNLAQIEDENRLIALLQNFARQRRCTVE
                     VFFDKAPPGRAGKHRARNITVHWVEEGKTADSAIIAVLQRLGKRAVEVTVVTSDRQIL
                     AEARTRRAKTLSSDEFARQLLSARTPAASAGAEKPDKPSEDEVEEFLNLFRKKKDK"
     CDS             151865..152398
                     /codon_start=1
                     /locus_tag="ANT_01330"
                     /product="hypothetical protein"
                     /protein_id="BAJ62167.1"
                     /transl_table=11
                     /translation="MRRPRTSLWLYLLLNIVVSAATMLAVLYFWERAHGRAQSILPVF
                     PTPSAAEASPTPTSLPPEEMLPSPTPYTGEPLVQIIAVIGATDPQQEYVVLKRVGQGD
                     LNMDGWVLRDEDGNELRFPAGLTLFPNGGLLIYTRAGTDTVSELYWNRTEAVWRSGEV
                     VTLLDPAGQVHATYTVP"
     CDS             152465..154126
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="dnaX"
                     /locus_tag="ANT_01340"
                     /product="DNA polymerase III gamma and tau subunits"
                     /protein_id="BAJ62168.1"
                     /transl_table=11
                     /translation="MAQALYRKWRPRLWEQVVGQDHIIQTLRNAVRTGRVGHAYLFAG
                     PRGTGKTTTARLLAKAVNCLEEDPAKRPCDQCAHCIAVNEGRFLDLIEIDAASNTSVE
                     DVRDLRDKINFAPSQGRYKVYIIDEVHMLSTAAFNALLKTLEEPPAHAIFILATTEVH
                     KIPATVLSRCQRHEFRRVPVQQIAALLRQKAAEDGLAVDEDALLMIARQATGSFRDAI
                     SILDQLSSTGERVTLEMVQSVLGTAAGEPIRLLVDAILARNAAQGLQIIQQTLDGGAD
                     PRQFARQVVDYLRGLLLVRMNNAALVDATAETRAQMAAQAGSFEVDRLVEVIRLFNTA
                     ATEARTAVHPGLGLELALVEATLEKSLPTMMSVSPTPLSAPSSAPQPAASPAPSIPGK
                     EGQAKGSPAPSAKPAASSASMPSSPAPAPSSVSGLTQEHLRQNWERVRALVKGRNSLT
                     AAALNSCRTYTLRDGVLVLVYQTEVLKQKMETEDNLALLRTALKQVLGVDVPVRCVVS
                     PRGTLPDESEGGSGNSMVHVARSLGGELVDKREHPFPDAEESGTF"
     CDS             154141..154485
                     /codon_start=1
                     /locus_tag="ANT_01350"
                     /product="hypothetical protein"
                     /protein_id="BAJ62169.1"
                     /transl_table=11
                     /translation="MAKGFNRPPVGGGGNMMAQLKKLQEQMEQAQARLAEETVTGTSG
                     GGAIKVVMTGDQHCKAVEIAPELLQEVDADMLQDMLLAAINQALELSRQKQEEMLGPL
                     AGGLGGLGGLGF"
     CDS             154486..155091
                     /codon_start=1
                     /gene="recR"
                     /locus_tag="ANT_01360"
                     /product="recombination protein RecR"
                     /protein_id="BAJ62170.1"
                     /transl_table=11
                     /translation="MAGLPAPLEALITAFERLPGIGPKTASRLAFFILRQPDEVAQQL
                     AEALLAVKSQTANCPVCFNIMLAGQERCQICADPRRDESQLCVVEDPLDVLVIERTGG
                     FLGRYHVLQGVLNPIEGIGPEQLRIRPLIERVQEGRVREVIIATNPSMEGDATALYLR
                     QQLAPLGVRITRLARGLPMGGDLEYADQNTLLRALAGRQEL"
     CDS             155409..157331
                     /codon_start=1
                     /locus_tag="ANT_01370"
                     /product="hypothetical protein"
                     /protein_id="BAJ62171.1"
                     /transl_table=11
                     /translation="MKQKSMLVLALVVIASLVLAACQPQTIVKTVEVTKEVKVVETQV
                     VEKTQVVEVERKAFTTPHPILSDLKVRQAMYHCTNKLDLVKAGYPLISDEDAAKLIMD
                     TFIPKDHWAYAGEGAVQQYPFDPEKGKALLEEAGWKLPEGANVRQKDDGTVLALKFYT
                     TTAAFRQAWAAVWEKQMAACGIQILRNHVPASWWFGDTTGLQVRDFEIGAFAWVGQAD
                     PGGQTLWACDQIPLPENNWQGQNYMGWCNPKADEAIKKANNTLIKEERIKWYKVVQEE
                     YAKDVPAIPLFNRTETFSAVSTLQGFAPTPGEEYYTYNVYDWERPGKDTIVIGFTQEP
                     ASLFTLVESAMVANLAAGLMGFRSYTSLNYDFQPETMKQLSTIENGLAQNNDVEVKEG
                     DMVLDAAGNPVKLEKGVKVINANGEEVEFDGNPVKMKQLVVKYEFRDDLKWQDGSPVS
                     QADFELGYKIACDRESGATTFITCDKTQAIEFNGLSYTVTWLPGVQDPLYFLAPYGFY
                     PSNQPIESEGPYKGKTLKDVPAKDWATLPEVAEKPWSYGPYVIKEWVKGEKMVFEANP
                     YYYRPVKTKNLVIAFVTPENAEAQLLTGAVDLLGSETLAGLTEQLVNAEKEGKVKNYV
                     IAGATWEHIDFNLWVK"
     CDS             157432..158631
                     /codon_start=1
                     /locus_tag="ANT_01380"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62172.1"
                     /transl_table=11
                     /translation="MTSYLIRRLFQMIIVILVSAAASYALLNLAPGGPLTGLRQMQQN
                     SRFRITEEDFARIRAYFELDLYLPVRFSRWLIGFPSGPVKIFGQELFANVPVGCYKEI
                     QATFQDAKGNFSVRTIGCKEYVYLKDLEGRRVSKGVLRGDFGNSWRLNRDRPVVDLLV
                     SRIPNTVKLMGISTLLALVLGLPLGVYSAIKQYSRFDYIFTSLAFMGSAMPTFFFGIL
                     SIMIFSILPNRLGWFYLPAGSATAVRDYTIPLLGTVKAGSGLDQGLHLVLPVFVLTIV
                     SIAGWSRFIRGSMLEVMRQDYVRTARAKGLTERVVIMKHALRNGLIPFVTIVVFTLPG
                     LIGGAIITETIFSWPGMGRLYFLALGDSDYPTAMAILFLTAVLTVIATLLRDILYTIV
                     DPRIRFS"
     CDS             158645..159634
                     /codon_start=1
                     /locus_tag="ANT_01390"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62173.1"
                     /transl_table=11
                     /translation="MATKAATVSSESMRTVKEETPFAIVMRRFRKHRLAMISLGVMIF
                     IFLVSLFAQQIAPFEPDEVDVNARFVAPGTTVQGKLHLFGTDNIGRDYFSRLLYAGRI
                     SLTVAVLSVLISELIGIVIGSISGFYGGWIDTILMRFVEFLLTIPSLPLLLIVSSMLI
                     RNPDLIPIPDVVLNVLGKVMLLRPSDARQAVLIVIVLAGLGWLTSAQLMRGMILTLRE
                     QTFVEAARSLGASNTRIIFVHMIPNALAPIIVDASLALAGYIVAEASLSFLGFGIQDP
                     IPTWGNMLSATQTYMYDRPWLPLIPGLPIFLCSLAFNYIGDGLRDALDPRLKQ"
     CDS             159660..160688
                     /codon_start=1
                     /locus_tag="ANT_01400"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62174.1"
                     /transl_table=11
                     /translation="MNESTQNKPLLEVKNLKTYFFTEDGVVKAVDGVDFHVNQGEVLG
                     LVGESGCGKSVTSLSIMRLLGVPGKVVDGEIYFAGQDLLKLPESEMVKMRGNRMSMIF
                     QQPQSSLNPVFTVGDQVAEVLMIHQNLGKEAAWNRAVELLAMVGIPDPARKAKAFPHE
                     MSGGQAQRVMIAMALALAPELLIADEPTTALDVTIQAQILDLIQEMREKLGTSVILIT
                     HDLGIIAEMAHRVAVMYAGRIVEEASVKELFENPMHPYTKGLIASIPILGKVTDRLEV
                     IPGSVPNLINLPPGCRFAPRCRLREQYGLEICTRDEPELVEVKPGHKVRCWLYADKDD
                     HRAPLSVA"
     CDS             160712..161698
                     /codon_start=1
                     /locus_tag="ANT_01410"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62175.1"
                     /transl_table=11
                     /translation="MSNSSMNSKDLIIVKNLKKYFPVRAGVFQRVVAHVKAVDDVSFT
                     IKEGECLGLVGESGCGKTTVGRTMLRLTEPTAGSVFYEGTDIFKLKGRDLKAMRRNIQ
                     IIFQDPYASLDPRMPIGESVMEGLKIHNIGNPKERFDIAIDTLRKVGLEDYHARRYPH
                     EFSGGQRQRIGIARALALRPKFIVCDEPVSALDVSIQSQVLNILKDLQQEFGLTYLFI
                     AHNLSVVEHISQRVAVMYLGKMVELADRDELFRNPLHPYTQALMSAIPIPDPNIKRER
                     IILKGDVPSPLNPPAGCRFNPRCPVAMEHCKVEEPPFKEVSPSHWVACWRVG"
     CDS             161856..163040
                     /codon_start=1
                     /locus_tag="ANT_01420"
                     /product="response regulator receiver protein"
                     /protein_id="BAJ62176.1"
                     /transl_table=11
                     /translation="MALRRILVVDDARDVGRMVQEALRSAYKGVPVVYAPSAEEAMLE
                     TSTMAVDLMIVDIRLPGMSGFDLVRRVRARQPEMQVIMITGLSPDENLKQMSAEVGAA
                     RLLSKPISIADLLSAVEEVVGVKGADLSLPAAKERKTTPRKSKTSELPPAVEIPAPPV
                     EVPEAPLPSLSEVLANLRGSLGAYSVVLLDDAGHITARAGEWMPDQPEEHIVPAVLAA
                     VSAVEKLGRQVLDGHASNALFVQGAQVQVVAAPVGRFTLVVYLRNGAGTLRLALAVEE
                     ILAAQTQIAETLERMGILIKPVTSTLTPPVEEASAAVGMSGLESPMEEVLAEETPVDL
                     KGLEELLAKPEEVLPPVDADSFWDAVVEEKGEIKVNPDSLSFEEARKLGLLPPEDAEP
                     QA"
     CDS             complement(163253..164665)
                     /codon_start=1
                     /EC_number="1.1.1.44"
                     /gene="gnd"
                     /locus_tag="ANT_01430"
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="BAJ62177.1"
                     /transl_table=11
                     /translation="MTLANIGVIGLGVMGRNLVLNMERNGFTVAVFNKTTAKMHEFIQ
                     GDAAGKRIVGYETLADLVKGLERPRRILLMVTAGAAVDAVIAELKPLLEPGDILIDGG
                     NSYFLDTERRSRELEASGLWFVGMGVSGGEEGALWGPSIMPGGSPEAWQALAPILQAI
                     AARAEDGAPCVTHIGPGGAGHYVKMVHNGIEYADMQLIAEIYDLLSRGAGMSADQLAD
                     VFAEWNEGELKSYLIEITSHVLRRKDDLTGKPLVDVILDEAQQKGTGKWTGQNALDLG
                     APVPTIQAAVESRSLSAMKERRVLASRVLGGPKPMYQGEVKPLVEAARQALYAAKIIA
                     YAQGFELMSMASQEYQYNLQLAELARIWRAGCIIRAALLEEITAAYRRDPALPNLLLD
                     PAFAQAVAERQTNWRWLMQTAIGMGIPTLALSSALAYYDAYRSERLPANLIQGLRDYF
                     GAHTYRRLDREGVFHTRWNE"
     CDS             complement(164714..165544)
                     /codon_start=1
                     /locus_tag="ANT_01440"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62178.1"
                     /transl_table=11
                     /translation="MSELHPYALFSLQERVAVITGGAGGLGSVMARVLARAGAQVIIL
                     NRTLEKAEHLAKAVRQEGGKALAMRCDVLRPEVLRTARQRIVETFGRVDILINAAGGN
                     RPAATTAPDQSFFRLSPAAMKAVFDLNLFGTIYPCQVFGERMAEQGNGVILNITSMTA
                     LRPLTRVVAYSAAKAAVANFTAWLAVTMAREYSPAIRVNALAPGFFVTEQNRFLLVED
                     NGEPSPRGRDVLAHTPMGRFGEPEDLAGAVLFLVSDASRFVTGTVVTVDGGFSAFAGV
                     "
     CDS             165695..166204
                     /codon_start=1
                     /locus_tag="ANT_01450"
                     /product="hypothetical protein"
                     /protein_id="BAJ62179.1"
                     /transl_table=11
                     /translation="MRREILTWNDVDQLIDHLIPQFEVEFDALVLITHGGLIPGGMLA
                     EALKVNDIFIAAVDFPNELEAEKQRERARLLAWPKFLQFPDESLLRGRRILVVDDVWG
                     SGRTMTAVKNRVTASGGIAYTCVLHFNPYRSLFGTLRPDYYAAITDAYIVYPWEIKRG
                     PEAVLLRDF"
     CDS             166327..167253
                     /codon_start=1
                     /gene="era"
                     /locus_tag="ANT_01460"
                     /product="GTP-binding protein era homolog"
                     /protein_id="BAJ62180.1"
                     /transl_table=11
                     /translation="MSEQIPAEFKSGFVAVVGRPNVGKSTLMNRFLGQKIAAVSPRPQ
                     TTRRRQLGILTLPQAQMVFVDTPGIHKPVHKLGEYMNQVALDALRDADVVLWLVDASV
                     KPTDEDRLCAQRILEALGQNPANVLLALNKMDQVPEDQRAGRLKGYQDLLSSAWVVWI
                     SATSGAGTQDLLDEILRRLPEGPPYYEEEQITDLYEREIAADLIREAALIHLKDEVPH
                     AIAVRIDEYKERSEDTAYIAATLLLERESHKPIVIGKGGEMLKRIGTTARLEIESMSG
                     RKVFLDLRVKVMENWRDNPALLRSLGYVVRKD"
     CDS             167258..167917
                     /codon_start=1
                     /locus_tag="ANT_01470"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62181.1"
                     /transl_table=11
                     /translation="MNTWLLVLTFAACVLEWVAVLQKSRWHDFTKPLPMILLILWYSL
                     SGGWTGQGVWFGLGLAASLLGDLLLLRERTFLPGMGAFFLAHVFYITGLWHGAPPQMG
                     LAVLFLAVVAVALGWLAWQARGEAWRRLKQAGMALPVTAYALILSAMTFSALLTLARP
                     DWNPQGALLLALGAVLFFLSDAILAWDRFLRPLRAPEVLMIPYLLGQVGIAVGAWLTF
                     A"
     CDS             complement(167987..168628)
                     /codon_start=1
                     /locus_tag="ANT_01480"
                     /product="hypothetical protein"
                     /protein_id="BAJ62182.1"
                     /transl_table=11
                     /translation="MPQPPPPESQRPARESLPAEQRHRESEFPGSFPDFQSQSFPFSL
                     LTLQPLSGIIQITAGGSHTCALTAASEVYCWGSNRSGEAGIGGYSDLAAPVIPVPGLS
                     GISAIAAGKAHTCALTGAGTVYCWGYNYFGQLGDGTTTSSPTPVQVSGLSNATAIAAG
                     EDHTCALVIDGTVRCWGMNWYGQLGDGTLGYYSLPIQVMQSLPVKTYLPAVSR"
     CDS             168850..169371
                     /codon_start=1
                     /locus_tag="ANT_01490"
                     /product="MarR family transcriptional protein"
                     /protein_id="BAJ62183.1"
                     /transl_table=11
                     /translation="MIGRVLFSRLIISWLNNFAKADMKKFPFPETLDFILHQVCHLHH
                     HRVRQVFESLGLYRGQPPILRMLWDEEGLTHNELAARLNVTPATMSRTLQRMEKAGFL
                     VRKPDPADQRVSRVYLTEHGRAVQEQVQQSIQRIEEETFAGFSAEELPVLRSFLERIR
                     ENLWRATGEKELH"
     CDS             169407..171155
                     /codon_start=1
                     /locus_tag="ANT_01500"
                     /product="putative ABC transporter"
                     /protein_id="BAJ62184.1"
                     /transl_table=11
                     /translation="MKPSGWKVLRFLKPYWLWIVLAPLLMLLEVVMDLMQPRMVERIV
                     DQGIANLDLPFVLQTGLLMFGLAVIGATGGMSNGIFAEMTVQGFGADLREALFRKVQS
                     FSFRNLDAFETGQLITRLTSDVAQLQEGVLITLRMLVRAPLLLIGSLVMAIVTSPQLA
                     FLPLVLMPIELLAVVWIVRKATPLFTLVQEKLDALNGVMEENLSGMRVVKAFARAAHE
                     KQRFAHANRALTDQAVRAGRTVAVMPSFMMLTMNLGIVGVLWFGGVQVVRGGMQVGQI
                     IAFVNYLMTTLFSLMMVSQMVIQFSRAEASARRIEEVLETEPELQDAPNAICDVRLKG
                     HIVFDRVTFRYDGADSEPVLKEVSFTAQPGETVALLGMTGAGKSTLVHLIPRFYDVQG
                     GRILIDGMDVREIDQKTLRRNIGMVLQETVLFSGTIRDNIRYGKPDASEEEVIAAAKA
                     AQAHDFILTLPEGYDTVIGQRGVNLSGGQKQRLAIARALLIQPAILILDDSTSAVDVE
                     TETRIQQALEDLMRNRTCLVIAQRISTVLKADKILVLDDGRIVAQGTHAELLANSPIY
                     QDIFESQLGNGVKIYG"
     CDS             171148..173010
                     /codon_start=1
                     /locus_tag="ANT_01510"
                     /product="putative ABC transporter"
                     /protein_id="BAJ62185.1"
                     /transl_table=11
                     /translation="MAEIRRAPAQPPATPPPMMGFRPGGGPPFGFLQGGEKSRDARGT
                     LLRLARYLRRQRWVLAGTAVLVIFVTAVDLLGPYLMSLAIDRFIKGGDLPGLARLIGW
                     MILTYLVAAGGTWLQTYLMVGVAQQAVRDLRDDLFGRMQALPLRFFDQHAHGDLMSRL
                     TNDMENISNVLATSFSQLISSLFGLMGVLILIFMLNVPLAVVSLVVMPLTYVITRAIA
                     RRTRCGFRQVQQALGALNGIIEETITGERTVKAFVREETVTAQFSQVNQRLRGVALRA
                     RVLTSFMGPLMNMVNNLGLAIVACTGGVLAVQGMATVGEIAAFINYAGRLGRPLNQIA
                     QLFSTIQSALAGAERVFEIMDQIPEQDAPDAKPLTHVRGEVEFDHVSFAYEPGVPVLK
                     DVCLHARPGEMIALVGPTGAGKTTIANLLTRFYDVDEGAIRIDGQDIRRLKMDDLREK
                     LGLVLQDTFLFSGTVMDNIRYGRLDASDEEVIAAAQLANADPLIRRLPHGYHTLLSER
                     GSNLSQGQRQLIAIARAVLADPEILILDEATSNVDTRTEKHLQEALMRLMKGRTSFVI
                     AHRLSTIRDADQVLVIHEGRIIERGTHASLLAQQGFYYRLYQSQFKGLPVPANG"
     CDS             173217..174305
                     /codon_start=1
                     /gene="recA"
                     /locus_tag="ANT_01520"
                     /note="protein synonym:recombinase A"
                     /product="protein RecA"
                     /protein_id="BAJ62186.1"
                     /transl_table=11
                     /translation="MARKSQPPVPIPSRPDPLDEARRAVLDKALGDITKRYGEGAIMR
                     MGEAQHMAVEAIPTGSLSLDIALGVGGVPRGRITEIYGPESSGKTTICQHIVAEAQRM
                     GGVAAYIDMEHALDPAYAARCGVDVENLLISQPDTGEQALEIAETLVRSGAVDVVVID
                     SVAALVPRAEIEGDMGDASMGMQARLMSQALRKLSGAINQTKTTVIFTNQLRQKIGVM
                     FGNPETTTGGMALKFYASVRLDIRRIQSIKLGAEIIGNRVRVRVVKNKVAPPFRTAEF
                     DIMYNEGISKVGDVLDLATSLDIVTKRGAFFSYGDVRLGQGRENAKEFLRQNPDLLQE
                     IELAVRQRAMSGELPLPLAGGDEDAEEL"
     CDS             174322..174816
                     /codon_start=1
                     /locus_tag="ANT_01530"
                     /product="hypothetical protein"
                     /protein_id="BAJ62187.1"
                     /transl_table=11
                     /translation="MSLALILLILAGCGGLPARGTPTLAPFRPAPPLPATPTPLTNPA
                     DLVLPLSTPVCLDNLTFLSDVTIPDGTEVEPNSTLDKRWEVQNSGNCNWDERYRLRLI
                     AGPAMQAAEEQALFPARSGNKAIIQVVFQAPAEPGQYRSAWQAYNAEGQPFGDVIFID
                     IVVK"
     CDS             174854..175405
                     /codon_start=1
                     /locus_tag="ANT_01540"
                     /product="hypothetical protein"
                     /protein_id="BAJ62188.1"
                     /transl_table=11
                     /translation="MRKLTLIVLVAFLALSACASPVPSSTPVPTLGETRDVTGGGFSF
                     QIPPDYSASVEGGRVDLSDKQGSLLLHLYGEPADVGETSLEKIVDSIVSEAMLRGNGV
                     YEKSAVYTVTIAGVKGNGYDLIGTYFGAPFEGQAVIVPRKSGGFFFGMGLALGQGEEG
                     RWQKEGKAVFQAMLQTVQFTDKP"
     CDS             complement(175439..175678)
                     /codon_start=1
                     /locus_tag="ANT_01550"
                     /product="hypothetical protein"
                     /protein_id="BAJ62189.1"
                     /transl_table=11
                     /translation="MMRTGMLWYDGDAHADLQTKVQRAAAYYQKKYGIMPTLCFVHPS
                     MLPEEPVRSGVIELRPSKQVLPNHLWLGVPEGGAN"
     CDS             complement(175682..176539)
                     /codon_start=1
                     /locus_tag="ANT_01560"
                     /product="hypothetical protein"
                     /protein_id="BAJ62190.1"
                     /transl_table=11
                     /translation="MSTLRPLPPLQPLRPFPNLRETGQRVAQRVGDALQSRTNPAAGG
                     RRRPPMPRRLPPDTALLGVGKDGLPVLLDLGDPTPGAVLILSDDRSARREILRGVLES
                     GMQTNPPHRLQYLILSSQPERWWMWRSEGGYERHSLGIEALEAEPCTRWLKSLAELVE
                     QRRMGMRGGPAVLILIDDLEAVMSLGYDAMVQLDWLIKQGAEASVWVLATAPASSTAS
                     LTRWMRLFKTRILGWTSDPGVYSTLPLIEENLPALEHREQFCVRLPEGWLTFELAGKP
                     LPELSETEE"
     repeat_region   176610..176616
                     /rpt_type=flanking
     repeat_region   complement(176617..177859)
                     /note="Similar to IS4 family"
     repeat_region   176617..176646
                     /note="30bp imperfect inverted repeat"
                     /rpt_type=inverted
     CDS             complement(176624..177763)
                     /codon_start=1
                     /locus_tag="ANT_01570"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAJ62191.1"
                     /transl_table=11
                     /translation="MDKYIPMRSFMEEFFDDEITAAKAAEIGQAMLVARSLRLTEIAG
                     KMRGGSAASYKRIQRFLQKVDPRAMLWRLFCEQAEYVIGDPTEIERPQAWKTEYVGTL
                     KDGKTRGFWVLLLATPYRGRALPCGLLTYSSKTIAADRSSRNVNHVRAFAGLKDLLGE
                     RPLVLDREFSYLELLLNLVEEGVNFVIRLNLGHHPPRFWDAEGREVVLSLAPGEKVIH
                     PSVWYKGKVCVNLIGVWKKGLAEPLWVMSNLEPERAWQVYLWRMKIEETFRDLKGLLG
                     MTRLMNKRQENMEKMVAMLLLVYAIALLIGEGLRDRLYGSPNQLQENVDVVLHKTGKK
                     WRRYSGLFILLKQKWWLPPREWQSIVKEALASFVAIVRPTVLTHV"
     repeat_region   177830..177859
                     /note="30bp imperfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   177860..177866
                     /rpt_type=flanking
     CDS             complement(177942..180680)
                     /codon_start=1
                     /EC_number="3.6.3.-"
                     /locus_tag="ANT_01580"
                     /product="cation-transporting ATPase"
                     /protein_id="BAJ62192.1"
                     /transl_table=11
                     /translation="MSNPSNETEWYQQSVEETARLLDTSPHDGLSEAEAARRLQQYGF
                     NELIDRGGKSPWKILLEQLTGIMTVVLVIAGVISFILGDKEDAIAILAIIVLNTALGF
                     SQEYRAEKAMAALKKMSAPLVKVRREGHTREISSREVVPGDVVLLEAGNLIPADGRLA
                     EAVNLRIQEAVLTGESEPVEKITAPIAKEHPPLGDQRNRAFMGTLVTYGRGALIVTAT
                     GMRTELGKIAEMLQTVGQEKTPMQKRLEQLARTLALAALGIVVIVFGLGILRGEDIRL
                     MFLTAVSMAVAAIPEGLPTVVTIGLALGAQSMLKRNALIRKLPAVETLGSVTTICSDK
                     TGTLTENRMTVTVLDVANYELDLKEQMQNFSPRVRRDQVEPVLRENGAIPLVLTAGAL
                     CNDAVLEADPRRPDEYTSVGDPTEGALVIAAARAGLWKEELEQIFPRAAELPFDSERK
                     RMTTVHRVPQSALPDLYAGFFAEGREPYIAFTKGSVDGMLEVSTAVWVEGKIVPMDDH
                     WRERIRQSNDKLARGGMRVLGMAYRLRSSDAVNAADDPLESGLIFLGMAAMMDPARPE
                     VFDAVQTAKQAGIRPIMITGDHPLTALAIARELGIAASERVITGAELARMDVPALAQA
                     VKEVSVFARVSPEHKLKIVEALQSNGEIVAMTGDGVNDAPALKKADIGVAMGITGTDV
                     SKEAADMVLLDDNFATIVAAVEEGRRIYENIRKFIRYTLGSNLGEILVVLGAPFLGMP
                     IPLTPLQILWVNLVTDGLPGLALTVEQAERGTMRRPPHPPRENVFARGLWGNIFYAGF
                     MMTVLTLIVAYSAWSMGLEAWRTMAFTTLTLAQMGNALALRTGSESVFREGFFKNRAM
                     IGAVLLTFVLQLAVVYVPFLQPFFATQALTAAELGVCLLANAAMFGLVELEKRLRR"
     CDS             complement(180880..182148)
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /gene="ppiB"
                     /locus_tag="ANT_01590"
                     /note="protein synonym:PPIase B"
                     /note="protein synonym:rotamase B"
                     /product="putative peptidyl-prolyl cis-trans isomerase B"
                     /protein_id="BAJ62193.1"
                     /transl_table=11
                     /translation="MKLRWQWMMLALCLSSLGMLAGGCSPAPAPLSPQPSPSATLALN
                     IPKTTPLPETMDCVLVSVEPTPTPSTEPPLFPPPSAQDWTQGPENAVLTFIEYTDLQA
                     PASLALDWSLTRLRERYPEKVRRVFRHFPLPANDKSLLAGAAAEAAGAQGKFWEMTHL
                     LLERQEEWTPLPEAEFRAWLEARAADLALDVPTFLSALDDPAIRLSLQQAQEEGFRLG
                     IPTMPFVLVNQRMYQGPRDYRSLETLLLLEDLKSRQFRQCPPFVIDPARTYVAVLETT
                     QGELRIQLFADQAPQTVNNFVFLARQGWYDGVLFHRVLPGYIAQSGDPSGSGFGTPGY
                     AFADELNALRFDQPGRVAMANAGPNSNGSQFFIAYTALPDLDGQYPIFGQVIEGLEVL
                     NRLTPRDPSSPADLPEGDRILRVRILEAAP"
     CDS             182301..183236
                     /codon_start=1
                     /locus_tag="ANT_01600"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62194.1"
                     /transl_table=11
                     /translation="MSGVLSIATTTVRLPVGPASSGGSAEMDLSFLVIILQLIFLEGI
                     LSIDNAAVLGAMVSSLPDTQPIPWPPALKRVGHWLDGVLGPQRLAALRVGLLGAYVGR
                     GLMLLAASFIIRNPWLKLVGAAYLIRLALDDLSAPGEQGAEEDGEVRPVRQAGFWLTV
                     LNVELMDLAFSLDNVVAAVSLSDHILVVMLGVAIGILVMRFAAGIFSYVVEREPILKS
                     AAYILVLSIGIELVLEELGIMEFSDWARFGISMSIIALSLAYAHLPFLRIFRPVLVWL
                     SQGFGIINALIVWVLAPLRGLVYLVRLAFRRPEKA"
     CDS             complement(183346..184017)
                     /codon_start=1
                     /locus_tag="ANT_01610"
                     /product="hypothetical protein"
                     /protein_id="BAJ62195.1"
                     /transl_table=11
                     /translation="MIRLGWLKHRNIPFEVPAEPLMYMLAVGYVGESQNASAFFRWFY
                     NKVAEDDRRLVVYHENKSSAVKGDWDWAYQHPTFYTEVLGEEALEETLNDLSESGNVR
                     GYDPFMDEPDFEDIDVVDSYAMTVLSPAETTLWQSTYVSDCSLMQLITPASFALSGSD
                     LFRKDKEEDIGGFDVLFIEPFDMPSASLVRLSPRVPFVLPNQLQAGEYLLYYFGQWDV
                     LVTEP"
     CDS             complement(185434..185925)
                     /codon_start=1
                     /EC_number="1.16.3.1"
                     /locus_tag="ANT_01620"
                     /product="ferritin"
                     /protein_id="BAJ62196.1"
                     /transl_table=11
                     /translation="MLSKRLLEEMNTQIKLELYSAYLYLAMAAHFEENNWGGFAKWMA
                     MQAREEQEHALKFFEYIHDRGGKVTLQAIDAPPSAFGTHEEIFAEVLKHEQSVTARIN
                     LLYSIAVEDKDYASQEFLNWFVKEQVEEEKNAAQVLEWLKMAGGAVPALFQINALLAQ
                     RGD"
     CDS             186062..186538
                     /codon_start=1
                     /locus_tag="ANT_01630"
                     /product="hypothetical protein"
                     /protein_id="BAJ62197.1"
                     /transl_table=11
                     /translation="MNLSAILVSQFLAGLEMLKQTITLCPEDLWNAPQDKNPFWQVTY
                     HALYFVHEYLAESPETFVPWEKHREVYDFDETQTFEPYDQAALLEYLAFLENHVRERL
                     PQLRLDEVEGHGSRSMLTAELQIYSLRHLMVHTGELMERLGARTGANIDWVGWVHD"
     CDS             complement(186535..187119)
                     /codon_start=1
                     /locus_tag="ANT_01640"
                     /product="hypothetical protein"
                     /protein_id="BAJ62198.1"
                     /transl_table=11
                     /translation="MPAFDHFDLLAPFYERFIHPRPPEDLLAHLHLPVDGALLDAGGG
                     TGRVSQFLRDQARLVVVADLSCRMLAQARQKNGLCPVCSHTERLPFPDHAFARIIMVD
                     ALHHVCDQRATARELWRLLQPGGRLIIEEPDLRRFAVKLIALAEKLALMRSHFLAPPD
                     IAALFDEPQAQVSVIAGTFNVWVVVEKPASPSAA"
     CDS             187260..188150
                     /codon_start=1
                     /gene="pdxS"
                     /locus_tag="ANT_01650"
                     /product="pyridoxal biosynthesis lyase PdxS"
                     /protein_id="BAJ62199.1"
                     /transl_table=11
                     /translation="MEENITGSFAVKKGLAQMLKGGVIMDVVTPEHARIAEDAGAVAV
                     MALERVPADIRAHGGVARMSDPELILKIMDAVSIPVMAKCRIGHFVEAQILEAIGVDY
                     IDESEVLTPADEEHHIYKHAFKVPFVCGARNLGEALRRIGEGAAMIRTKGEAGTGDVV
                     EAVRHARAVMGEIRRLQNLPDEEVMAFAKEIGAPYELVLETRKLGRLPVVNFAAGGIA
                     TPADAALMMQLGMDGVFVGSGIFKSGDPAKRAAAIVKAVTHYNDPKILAEVSRNLGEP
                     MVGRQISAIPESELIAGRGW"
     CDS             188161..188736
                     /codon_start=1
                     /EC_number="2.6.-.-"
                     /locus_tag="ANT_01660"
                     /note="protein synonym:glutamine amidotransferase
                     glutaminase subunit PdxT"
                     /product="glutamine amidotransferase subunit PdxT"
                     /protein_id="BAJ62200.1"
                     /transl_table=11
                     /translation="MKLGVLALQGDFIEHQTMLERLGVEVQQVRLPSHLEGLAGLIIP
                     GGESTTIGKLAVDFGLLEPLREFGRQRAIWGTCAGAIFLSKDVGRPQPLLELMDITVQ
                     RNAFGRQVDSFETDLDVSFMGKEYNGRPFHAVFIRAPIIEKVYGNARALITLGDGRIV
                     AAQQGKLLATSFHPELTGDDRFHRYFVELAR"
     CDS             188808..189674
                     /codon_start=1
                     /locus_tag="ANT_01670"
                     /product="hypothetical protein"
                     /protein_id="BAJ62201.1"
                     /transl_table=11
                     /translation="MGLLLTRGGVLAPLSVLASLDPLRGSFTAVCPSQKGFPSLIGRM
                     VYTPGERSAHLAFLLPVSGVEHPGLPALMESLAATAGAWGALNLLAEVEETQPALEAF
                     RRSGFAVYGWQSIWKFDSPPASRRSGEWRPPLPTEENAVRSLYQLLVPPLVQAAEPFA
                     GHTGERLVYRQGGEILAYADLLYGPEGVFIQPLLHPGLKQPEEALQALLGCFISLPAR
                     PVYVAARSYQAWLEPVLNRLGGYVSPRQALLVRHLVATARVGVLARQIAGESFNHEAT
                     VPMIQSSTIYKN"
     CDS             189679..191295
                     /codon_start=1
                     /locus_tag="ANT_01680"
                     /product="hypothetical protein"
                     /protein_id="BAJ62202.1"
                     /transl_table=11
                     /translation="MTQRRITDDLHVLMGVLPPRIAEAVQNANNSDQLLEIVMDLGRK
                     PVARFTTGDLVLLEEEVTHEDLDFTVSRIGEFDADNRAGLERTLHRISAIRNRRGHIV
                     GLTCRVGRAVYGTIDIIQDLIESGKSVLILGRPGIGKTTMLREAARILAEKKRVVIVD
                     TSNEIGGDGDVPHPAVGAARRMQVPKPSLQHEVMIEAVENHNPEVIVIDEIGRELEAA
                     AARTIAERGVQLIGTAHGRTLENLLLNPTLSDLVGGIEAVTLSDEEARRRGTQKTVLE
                     RRAPPTFDVLIEIQERDRLAIHPDVAAAVDALVRNNPLPPEIRYRDAEGNIHVEKPPA
                     QPAARNGYGAMQAGFRRLMSEPAGGRASETAYSHREEMESEPRSMRTERLQPIRIYPY
                     GVARNRLQQGAKRLGVPALIVRELAEADVLITLRAYYRSRQQTILEAEQRGMPIYVLR
                     ANTNTQIEQLLAELFNLSMQPEDGEDLEATIAQTQAAIQMVMNGERYVDLAPASAAIR
                     RMQHEMARQYQLTSHSYGKEPNRRVRIYRE"
     CDS             191363..191980
                     /codon_start=1
                     /EC_number="2.7.4.9"
                     /gene="tmk"
                     /locus_tag="ANT_01690"
                     /note="protein synonym:dTP kinase"
                     /product="thymidylate kinase"
                     /protein_id="BAJ62203.1"
                     /transl_table=11
                     /translation="MFITFEGPEGSGKTTQIRLFAEFLRARGYDVLTTREPGGTEISD
                     QIRAVLVNLRNTAMHPRTEILLFQAARAQLVEQVIRPALSRGTLVLSDRYADSTLAYQ
                     GYGHGYPLEELRRLIDFATGGLIPDLTFLLDVNPAQGLERKQREGEWNRLDAYDLGFH
                     QRVRAGYLEMARAEPHRWVVVDATQSIEVIQSDIRRCFEQRLAAR"
     CDS             complement(191928..192734)
                     /codon_start=1
                     /locus_tag="ANT_01700"
                     /product="hypothetical protein"
                     /protein_id="BAJ62204.1"
                     /transl_table=11
                     /translation="MIQPAFFPTLPPEVEDMDIESLCSALESIRRPLVQAIFADLYRN
                     PFWEDRYGETGIVHISRDLDQHLDYLLTAVRLRSPEYLTEYFRWVRHSIILRGMCTRH
                     LEQVLDSLASHTGAMLPLETSQALSVFLDAARASLSYNHFACRSLSPTIDFIATQVAG
                     HIYPDEAQAARRELCRRDILIHLSYLMDAVEKANPEIFFGYLEWLRAFDRKYGISTRE
                     LVLTFSEMHRQIVQRLGEETAQPFTHIFTHLPALNGQPAAAQSNGGYRSE"
     CDS             193004..195046
                     /codon_start=1
                     /locus_tag="ANT_01710"
                     /product="hypothetical protein"
                     /protein_id="BAJ62205.1"
                     /transl_table=11
                     /translation="MKKARASLKWQTVLLVVVTSVAIISGLILASLLLFQQSYLNLEQ
                     QAVRQQTHLVVSLIQKEQEKLERFVQDWGPWDDTYWFAQNQNPDYVKDNLTETTFASQ
                     GFNLFLVVDKEKRVVFYRQYHLERGEWVNYPSVGFLEEILRHPYLSERAENVAPLEGV
                     LSTGDGLWLIAGYPILRNDFSGPRAGTLVVARQLTESFRERLAAQSGLQVEFEKIPAG
                     EETTWEGVVSPVKVQRLDAEWVRGSVVFRDLYLRPAFRVSVRVERAIYHQGQEVISFF
                     VVTLMLSGAVYGLVVSRGVQALAIHPLVKLVERLQHIRETEDLSLRMPEEGHNEIALL
                     AQHINATLEALERSAERIRKDQDRLNHQARHDALTGFPNRLYFFERLQQAVQRVQHTP
                     DLRPALIFIDLDGFKMVNDTYDHAMGDRVLRIFAERLKRSLRGSDFIARLGGDEFAIL
                     LEDTVSLDEAVRVAERLIQITRQPFDLDGRQVFLSMSAGIAQVLPNQRGEEILRNADM
                     AMYAAKGKGKSRVMVFDEEMHQQLRDQLELANDLRVALEEDQFTLYYQPVVRLPDGWI
                     TGVEALLRWKHPRRGVLLPSVFLPVAQAHGLMPLVDRLVVEKALAQLRAWNEQGLPAV
                     RLALNFSALSLQETSFTEWLEAMLRNIAFLLSVWKWKCWRPRWHRISVISCSRWSG"
     CDS             195025..195411
                     /codon_start=1
                     /locus_tag="ANT_01720"
                     /product="hypothetical protein"
                     /protein_id="BAJ62206.1"
                     /transl_table=11
                     /translation="MQSLERLKRLGVHLCIDDFGTGYSTLWALKQMPMDTLKIDRGFV
                     QGLPHDQDNAAIVQAMIVAAHTLDMEVIAEGVERGEEYRFLVEHGCDRAQGFLFAHPQ
                     SAEHTAKVLKLGRLVRFPLGEFARKV"
     rRNA            195826..197323
                     /locus_tag="ANT_r0010"
                     /product="16S rRNA"
     tRNA            197478..197551
                     /locus_tag="ANT_t0030"
                     /product="tRNA-Ile"
     tRNA            197586..197661
                     /locus_tag="ANT_t0040"
                     /product="tRNA-Ala"
     rRNA            197961..200915
                     /locus_tag="ANT_r0020"
                     /product="23S rRNA"
     rRNA            200989..201105
                     /locus_tag="ANT_r0030"
                     /product="5S rRNA"
     CDS             201181..202422
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_01730"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62207.1"
                     /transl_table=11
                     /translation="MNIAMLSYHTCPLATLGGKDTGGMNVYVREVTRFLGMRGVHVDV
                     FTRSQDEHVPHVLHDLGFGNRVVHLPAGAETWLPKRQLVDFIPQFAEGVLRFAREKGI
                     HYDLIHANYWMSGIAAETLKAEWNVPVVTMFHTLGLMKNRIARSPEEMEGEYRINGER
                     RVLQISDRIIAATLAEKAQLQFLYQADEGKIRIVPPGVDTARFYPIPREEACEAIGIP
                     PEDRMLLFVGRIEPLKGLDTLMRAIAILRECGVQCHVPHYLAVVGGDPSASGEKLSDE
                     MARLQALRRELHLEDLVLFLGKRAQDTLPYYYSAAEVLIMPSHYESFGMVALEAMACG
                     TPVVASQVGGLAFLVQDGLTGYVVPDGDPQALSERLRLLLMDGELRQRMGLQAAAYAR
                     QYAWENIVERLLGVYSEVLTC"
     CDS             202436..204394
                     /codon_start=1
                     /locus_tag="ANT_01740"
                     /product="hypothetical protein"
                     /protein_id="BAJ62208.1"
                     /transl_table=11
                     /translation="MRKALLGWKILRALGWRALTWYAVYRLGLWTGHFARQKPPAVPP
                     SARLRPLWHLPDAAHLRAAGGEEAYRNLMAEAEDILAGQVRLYGGEKVPLQFTPPLPL
                     RPWTAYEGGRHLPPGVDIKDLWEPARFGWAFVLGRAYRWSGDERFPAAFWTYLETFDR
                     ANPPYQGVNWLSGQEVALRLLALLFAGDVFAASPHTTPQRLSRLTAMVVEHAARIPPT
                     LAYARAQFNNHHLSETLGLYAAGLALEGMPQAERWREQGWRELNRALQRQIAADGTYC
                     QHSVNYHRLMLHLALMADAFARREGRAWQAETSARLRAATAWLSACLDEISGRMLNLG
                     HHDGAWILPLSAGGIADGRPTVQAAALAFGGGAALPPGAWDELALWLNLPALGEGGQL
                     SRSPAVHRLGERGDWAVLRTARLTSRPAHADALHVDLWHGGVNLLKDAGTYRYNAPAP
                     WENGLAGALVHNSITVDEHEPMTRAGRFLWLDWDHSWVTEEDEMQVTAVREGYLRLGI
                     LHRRTLRRVERGRWRISDYLLPYGKRPSLHTFTLHFLLPDWRWQVQGQDAVLLEGEGL
                     RMRLQVQARAEPLPGKRPQAAGEMSLHLQVIRAGEVVWGEGQASPVLGWYSPTYGARE
                     PALSLRWQVTAAPPLTLESEVVVQEANP"
     CDS             complement(204512..206266)
                     /codon_start=1
                     /locus_tag="ANT_01750"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAJ62209.1"
                     /transl_table=11
                     /translation="MSRRVFWRILAPLMGLILLTLAGVTLYLSSLFYQNNLQRMQTYL
                     LQEARLMRNLLMPLILEDPQNPQINQIVRESARLVGERITVVLADGRVVGESEKPLDQ
                     LENHLSRPEVQEALSNREAVEIRFSTTIGEEMLYVAIPVVSQNQQVVAVIRLAASMGA
                     IRQEQQTLNGSLFIAALIAAAFAVLIAVWITRRVLAPLEKLSATAQQLAEHTGETARN
                     EGDEIRRLQAAFQTMSEHLREQVSQLRAERQKLHSVLKNMKDGILLVDENGKISLINP
                     AAAGMFGIEETRAIGASLIEAVRHHTIVELWERTRHSEQPQDGEVEVLPEHRFLQVVL
                     TPLGKETGNATLLVFHDLTRERRVERVRRDFVSNVSHELRTPLASLKALVETLQEGAL
                     EDPPAAQRFLRQMEIEIDNLTQMVRELLELSRIESGLVPLQRRPVSPCEILRRGAERM
                     RLQAERAGLTLQVDCPESLPEVFADAERVEQVLVNLTHNAVKFTPPGGEITLGVKQEG
                     QAICFWVRDTGVGIPPEDLERIFERFYKTDRSRSGEGTGLGLSIARHIVETHGGRIWA
                     ESQVQQGSTFFFTLPLEK"
     CDS             complement(206272..206988)
                     /codon_start=1
                     /locus_tag="ANT_01760"
                     /product="OmpR family two-component response regulator"
                     /protein_id="BAJ62210.1"
                     /transl_table=11
                     /translation="MAEKILVVEDERALQETLEYNLKRQGYEVQVAGDGILALDLARE
                     FQPEIILLDVMLPGMDGFELCRRLRQEMNTPVLMLTARTEEIDRVVGLEVGADDYMTK
                     PFSMRELLARVKAMLRRVRMIREEMQKSEESTQKESEKRLLSGNLELNLARREVRLNG
                     VVVAVKPKEFELLHFLMKHRGQVLSRDYLLKELWGWDYFGDSRTVDVHIRWLREKIEP
                     DPAHPVRIVTVRGAGYRFEG"
     CDS             complement(206963..208189)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_01770"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62211.1"
                     /transl_table=11
                     /translation="MHILLIHQAFVSLGEAGGTRHHELARYLVQRGHRVTIICSPVSY
                     LTGKVETRTSQEEEEGITIRRAYTYAALHRSFFHRVLAFVSFMLSSFWIGLSVRQVDL
                     VWGTSPPIFQGVTAWALARLKGVPFLFEVRDLWPAFAIAMGVLRNPLLIGASQALERF
                     LYRHADRVLVNSPGFIDHVTARGATWVELVPNGADPEMFDPAARGEAFRAAHGLDGHF
                     VVLYAGAHGPSNDLGVVLDAAEHLQDEPRICFVLVGDGKEKPALMKQAQERGLKNVLF
                     LPPAPKAQMGEIMAAADACLAILKPLELYKTTYPNKVFDAMAAGRAVVLAIDGVIRQV
                     VEETGAGVFVPPGDAQALAQAVRMLADNPQAAREMGEAGRRCVERRFHRQVLAEQLAL
                     IMEQMGGENGRKNSGG"
     CDS             208691..209986
                     /codon_start=1
                     /locus_tag="ANT_01780"
                     /product="putative ABC transporter substrate binding
                     protein"
                     /protein_id="BAJ62212.1"
                     /transl_table=11
                     /translation="MSKKFWYSLIAVLMLTALVLSACGGAATQAPAQTQPPAQGGKEV
                     EVFSWWTGGGEAAGLEAMIKVFNAKYPDIKFINAAVAGGAGTNARAVLATRLQSGDPP
                     DSWQGHAGQELIGTYVAGNQIQPLNDLYESEGWLKVMPQTLIPLISQDGKIYSVPVNI
                     HRANVLWYNPKILEDNKIAVPTTIDEWFAAMDKLKAAGVTPLALGEQWTKMHLLETIL
                     LGTLGAEKYNGLWNGTTDWGSAEVKTALENFQKAMTYANTDSASLSWQDAAQLVVNGD
                     AAFNVMGDWAEGYFRELGKKPKVDYGWAPVPGSVGVFQFLSDSFVLAVGAPDPEAAVA
                     WLKVAGSKEGQEAFNPVKGSICARTDCDKALFGEYLQSAMDDWASNVVVGSLTHGVVA
                     NDSWKSEIDTALGLFVSNGDLAAFQSALVNACKSSGPCK"
     CDS             210065..210952
                     /codon_start=1
                     /locus_tag="ANT_01790"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62213.1"
                     /transl_table=11
                     /translation="MFKNKDRYLSFLLVLPSILAVMIFIYGFIGWSIRVSLSQWKGLN
                     PNFAWAGLNNYIELFSDPRFMVDIRNTVIFTVVFVVGCIVVGFFLAVMLDQGLKGEAF
                     FRTLFLFPMAISFIVTGVVWRWLMNPATGSRMSGLNLLFSYLHLDFLINNWHTTPTWG
                     IAAVALAAIWQMSGYTMALYLAGLRSIPLELREAAQIDGASEWQIYRHVILPILTPVT
                     LSALIILGHISLKVFDLIIAMAGKQLALDVPAIYMWQTTFDGLFYARGAAIATLLLIS
                     VAVLIIPYMWFTLRSEKQL"
     CDS             210949..211773
                     /codon_start=1
                     /locus_tag="ANT_01800"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62214.1"
                     /transl_table=11
                     /translation="MKAKSLRIGKNWLYAPLIFMSIFYLLPMYVMLVTGFKPFEEVNL
                     KTMWALPHTIAFDNYVEAFRHLAPSLRNSFVMVIPATIISSFLGSLNGYVLAKWKFKG
                     ADVIFPLILFGMFIPYQSILIPLVQFMKSANLTGIPGLILAHVIYGIPITTLTFRNYY
                     ASLPQELIEAARIDGANMLGVYRWILLPISIPSFVVVLIWQFTSAWNDFLFAVVLTGN
                     EQWPITVALNNMAGSQIIAWNVQMAGSLLAALPTLLVYLFLGQYFLRGLLAGSLKG"
     CDS             211781..212770
                     /codon_start=1
                     /locus_tag="ANT_01810"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62215.1"
                     /transl_table=11
                     /translation="MAQKPLNWGILSTAHINRALIPVLQSSKRTRLLAVASRSLESAQ
                     AYAREWSIPRAYGRYEDLLADPDIDVIYNPLPNHLHADWTIKAVQAGKHVLCEKPLAL
                     TLSEVDAMREAAQAHGKIIAEAFMYRHHPQTLKVKEIVDSGILGAVKMVRGAFTFTLD
                     RPGNYRLEPSMGGGSLWDVGCYPLSYARFVLGAEPLEVFGWQTLNPAGCEMSFVAQVR
                     FPGEAFLQFESSFERPPRAFMEFVGSEGRLEVPDPFKPGLSTRLLLTRSGRTETIKVK
                     GKELYLGEVEDLCDAVQMGKPPRISLEDSRGNIAALLALIESAQRGVPVAVKG"
     CDS             complement(212784..212924)
                     /codon_start=1
                     /locus_tag="ANT_01820"
                     /product="hypothetical protein"
                     /protein_id="BAJ62216.1"
                     /transl_table=11
                     /translation="MNNFIIGRFTRRASHPIGVIFPPERDKGKLYPQTCLDHLKKCGW
                     VF"
     CDS             212972..216937
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="dnaE"
                     /locus_tag="ANT_01830"
                     /product="DNA polymerase III alpha subunit"
                     /protein_id="BAJ62217.1"
                     /transl_table=11
                     /translation="MSFAHLHVHTQYSLLDGFSNPKQLVARAKEMGMPAVAITDHGTM
                     FGVIEFFQAATAAGIKPIIGLEAYMAARRMQDRDPKLDKSSFHLLLLAENQTGYQNLL
                     KIASAAQLEGFYYNPRIDHDFLAEHHEGLICTTGCLSAEIPEALKEGDVERARKLADW
                     YYEVFGAENFFFELQNHDIPELQAVNRQLIELGKRYNARFIATNDVHYINPEDARLQD
                     VLLCIQTGNLLSEPKRFRMSVDTFYLRSPEEMSRLFADIPEALSNTLLIAERCNVDLT
                     SKGYHLPRFPVPEGYTAETYLRELCEQGLRRRYGTRADDPVVRERLEYELRVIHQMGF
                     DAYFLIVWDLTQYAQRNGIWYNARGSAAGSMVAYVLGITMVEPIEHGLIFERFLNPGR
                     ISMPDIDLDFQDDLRPRMLEYCASRYGDDKVAQIITFGTLGAKAAIRDVGRVMDIPLA
                     EVDRLSKMLSTAPNKNVTIREALETVPEFKAAYEEADYLRDLIDTAARMEGVVRNAGT
                     HAAGVVITDEPIVQYLPLHRPTSGSEESPIKTVTQFEMSIIESLGLLKVDFLGLATLT
                     IMQRACQLIEQRHGVRLNLHNIPTDDPETYEFLAQGHTAGVFQLEGSGMTRFLVQMRP
                     QTLDHVIAMVALYRPGPLDFIPTYIRRMHGEEPVQYRHPALEPIFKETYGIPVYQEQI
                     MRAAVELAGYTMSESDELRKAIAKKQKDKLLKHREKFIKGAVQRGIDEETAAAIFDDW
                     EEFARYGFNKSHAADYGVIAVQTAYLKKHYTAEYMTALLSASKNETEKVAFYVADAKN
                     LGVPVLPPDINTSGWDFTIEDQPDGKPAIRFGLGAVKNVGQNAVEMILQAREEGGPFQ
                     SLTDFASRVDLRSVGKRSLECLIKVGALDRFGNRKALLEIMDTILNVSASHFRAVSSG
                     QLTFFGATVGANVDAIENIHLPFTTSMDTREQLEWERELIGLYVSDHPLNPYWNSMRK
                     RLSYYSNQLADLRNHTPVSVGGMVTRFRQHQTKNGKPMAFVTLEDLRGPIELVIFPSA
                     WEKYHTLVHMDAILIAEGKVDTESGDPKVLVDKLSEVALEVVAGEDTGTASWSSSMEL
                     EWEKPPFEMGIEEEEVAPEALVVAEARVEYAPAAPAPVAAPVQPSAPVQHANGNGKSA
                     PLNPVDGLEPPEEPPDWHLYGYEMTPEDASLPLEEPLPSISVPAPVKREPVVPSPAVP
                     GISSADTVSIGSAFPNVPLIIPPYGQTSLSGDAPRMVKITLRSTGDRQRDVRRMRRVY
                     NKLHSHPGNDRFAFWIFEGKSGYLFEFPNETTCVSEELLEELYGIVGRENVLVEPIPI
                     H"
     CDS             216965..217951
                     /codon_start=1
                     /EC_number="2.7.1.11"
                     /gene="pfkA"
                     /locus_tag="ANT_01840"
                     /note="protein synonym:phosphofructokinase"
                     /note="protein synonym:phosphohexokinase"
                     /product="6-phosphofructokinase"
                     /protein_id="BAJ62218.1"
                     /transl_table=11
                     /translation="MIMFKTSLRTIGVMTSGGDAPGMNPAIRAVVRTALANGIRVIGI
                     EDGYEGMLNGRFREMGARDVGGILQRGGTILRTARSMEFKTPEGQRKAIRQLSSAGID
                     AVVIIGGDGSLTGGMKLQEQGVPVIGIPGSIDNDIYGTDMCVGVDTALNTIVDAIDKL
                     RDTASSHNRAFFVETMGRNCGYLAVQAGIICGAEMAIIPEYETPFKEVAEAVEDAYKR
                     GKSHCIIVVAEGAKLNANELAAKLQEMNVGFDTRVTVLGHVQRGGKPTAFDRFLATRF
                     GVKAIEFLLSGQTGVMTALTGRDITPIPLATVVNNRRTLSEEYIKMARILAR"
     CDS             complement(218013..219197)
                     /codon_start=1
                     /locus_tag="ANT_01850"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62219.1"
                     /transl_table=11
                     /translation="MGYNIPMRQKLSSWWNRLPESWRFVLPIWLGMRLLTAIIGIGVW
                     KIRPLPPPVGMRFYEGLEPVYLGLRGMLIGVWQRWDTIFYQIIAEQGYSLTKISHFFP
                     LYPLTARVTARLTGLETLEAMVLVSTLAYLAALVLLYVLLADTFDTTIARRGVLALAV
                     FPSSFFLFALYPHGMELALILASVWLARKRRWLGCALTALLAGLTHSTALPLSLILLV
                     EAVRFIRQQTHPWRWAVLSVAGMPALGIGLFWAWRIAQGFPSIPEVIAREFFRYPTPP
                     WENLLKWLVLLPQHLPAPDWIINSVALILVVWSLLWGWKKIPASWLTYQVLVLLMTLG
                     LGDARDPLYSLNRYILASFPLFVALGWWADTPLKRLLGFAVGVFGQLALLAFFLLWIF
                     VG"
     CDS             219543..219917
                     /codon_start=1
                     /EC_number="5.4.99.5"
                     /locus_tag="ANT_01860"
                     /product="chorismate mutase"
                     /protein_id="BAJ62220.1"
                     /transl_table=11
                     /translation="MSIRGIRGATTVDENTAEAILAGTRELLLALMQANPALKPEDIA
                     SIFFTMTEDLDAVHPALAARQLGWVEVPLMCAREISVPDSVQRCVRVLIHWNTDMPQN
                     AVRHVYLRGAVTLRPEYAVDVK"
     CDS             219949..221025
                     /codon_start=1
                     /EC_number="2.5.1.54"
                     /gene="aroF"
                     /locus_tag="ANT_01870"
                     /note="protein synonym:3-deoxy-D-arabino-heptulosonate
                     7-phosphate synthase"
                     /note="protein synonym:DAHP synthetase"
                     /note="protein synonym:phospho-2-keto-3-deoxyheptonate
                     aldolase"
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /protein_id="BAJ62221.1"
                     /transl_table=11
                     /translation="MMIIMRADATQEQISQVVARVEAVGLRAHLSRGQERTLIGAIGD
                     DRTIDKGHFAVLPGVDRVVPILRPYKLASREFSPENTVFPLDGVSIGGNEIVLIAGPC
                     SVESRAQLMEIAHAVREAGAHALRGGAYKPRTSPYAFQGLGEEGLELLAEAREETGLP
                     IVTEVMAPEMVPLVAKYADVLQIGARNMQNFALLHAAGESQRPVLLKRGMSATIEELL
                     MAAEYILSHGNRRVILCERGIRTFENATRNTTDINAIPVVKSLSHLPVILDPSHSTGK
                     WEYVLPIARAAIAAGADGLIVEVHPHPEEALSDGGQSLKPERFVEMVEQVRRIAQAIG
                     RDVAPSPHRERLASPLGAGRRDEQ"
     CDS             221155..222072
                     /codon_start=1
                     /EC_number="1.3.1.12"
                     /locus_tag="ANT_01880"
                     /note="protein synonym:PDH"
                     /product="prephenate dehydrogenase"
                     /protein_id="BAJ62222.1"
                     /transl_table=11
                     /translation="MSTESEEDFFRSLRVAIVGLGLMGGSLALALRGRVRAVLGVDTH
                     APTRQQALERGAVDTVSADPADLLPQADVVVLATPVQSILHLLERLPDLHPGRAVVLD
                     VGSTKREILAAMVHLPQRFDPLGGHPMCGKEHSSFEHAEADLYHGAAFALCPLERTSA
                     HARQVAESLVQAVGARPLWLDAETHDRWVAATSHLPYLLASALASSVPPQAAPLAGPG
                     YRSTSRLASQPADLMLEVLASNRDYLLTTLRRAQLRLDLLAQALEAEDWQSLRALLAE
                     SAHQRESLLNLHGEKPHESHREPRRTPAR"
     CDS             222032..223357
                     /codon_start=1
                     /EC_number="2.5.1.19"
                     /gene="aroA"
                     /locus_tag="ANT_01890"
                     /note="protein synonym:5-enolpyruvylshikimate-3-phosphate
                     synthase"
                     /note="protein synonym:EPSP synthase"
                     /note="protein synonym:EPSPS"
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="BAJ62223.1"
                     /transl_table=11
                     /translation="MNLIVSPGAPLRGEVRIPGDKSISHRAALFAALAEGESLIENFL
                     DSGVTRAMLNALTALGVTWRLEDECLEVRSPGWRRWKIPAEPLFCGNSATTLRLLAGA
                     LAAAGIPAVLDGTPGLRRRPMERIVDPLRAMGVPITAAEGGGAPLTLQARPAESPLRG
                     MSHTLAVASAQVKTCLLLAGLAADAPVEVVEPTLSRDHTERMLKGMGVALEDARLPGG
                     AAWVRLHPPQQPLPPLRGSIPGDFSAAAFLLAAASIVPGSDVLIRGVGLNPTRTGLLE
                     TLREMGARIEITHRREVFGEPVGDVRVQASALRAGRVQGERVVAMIDEFPAFAAAALH
                     AEGISTVRDAQELRYKESDRIAALVQEVRRLGGIAEEHPDGFDLSGGAALGGTVHPHG
                     DHRLAMALAVAGLAGVKSVIIEQAEIMAESFPDFVATLQALGAQVKVTP"
     CDS             223354..224232
                     /codon_start=1
                     /EC_number="1.1.1.25"
                     /gene="aroE"
                     /locus_tag="ANT_01900"
                     /product="shikimate dehydrogenase"
                     /protein_id="BAJ62224.1"
                     /transl_table=11
                     /translation="MSALCLGLLGFPLGHSLSPRLHTAALSAMGLEGEYRLYPVPPLP
                     EGETAWRALFERLRAGDLHGLNVTIPHKQTVMKELDFCEDEARIIGAVNTLGVDDSGR
                     VWGANTDSPGFLRDLYAQLGDVLPLQGGRALVLGAGGAARAVVYALIRAEWEVWVSAR
                     RGEQAQTLAESLRTFLPYAPLTALEGVPPREALPPRLNLLVNATPLGMSPHPDTLPWN
                     EALPIPEGTAVYDLVYNPRETRLLAFARACGAPAAGGLGMLVEQAALALERWSGQMVP
                     RSVMWQVVAEDSNPQT"
     CDS             224236..225429
                     /codon_start=1
                     /EC_number="4.2.3.5"
                     /gene="aroC"
                     /locus_tag="ANT_01910"
                     /note="protein synonym:5-enolpyruvylshikimate-3-phosphate
                     phospholyase"
                     /product="chorismate synthase"
                     /protein_id="BAJ62225.1"
                     /transl_table=11
                     /translation="MEEGETMTLRFLTAGESHGPALSVILDGIPAGLPLNEDILARDL
                     TRRQQGLGAGARMKLEHDRARILGGVMAGVTTGAPLALLIENADHARWKGKDIPPFTT
                     PRPGHADLSGALKYGYRDLRPALERASARETAARVAVGAVCRHLLGQFGIQVGGYVVS
                     IGGVESRLEGMPYAERIARALESDVSCPDAQAAEDMRAAIRTVMQARDTLGGVIEVAA
                     LNVPPGLGSYAQWDRRLEARIGAALLSVPAIKGVEFGPAFANTRLPGTQVHDPIRLEG
                     ERIIRTGNRSGGLEGGITNGEPLVVRAAMKPIATTLTPQPTVDLAQGVETETRYERSD
                     FCPVPRAVVILEAMLAFVLTDALLEKLGGDSLAEILPRFERLRQARLSDLPMDGTPHR
                     FWEDA"
     CDS             225426..226991
                     /codon_start=1
                     /EC_number="2.7.1.71"
                     /EC_number="4.2.3.4"
                     /gene="aroK/aroB"
                     /locus_tag="ANT_01920"
                     /note="bifunctional protein"
                     /note="protein synonym:3-dehydroquinate synthase"
                     /note="protein synonym:SK"
                     /note="protein synonym:Shikimate kinase"
                     /product="shikimate kinase/3-dehydroquinate synthase"
                     /protein_id="BAJ62226.1"
                     /transl_table=11
                     /translation="MSAGEWFFLYGAPGSGKSTLGRALAERLDLPFFDLDALIVEQAG
                     VDIPAIFAREGESGFRARERQALHELLAGDGGVAALGGGALLEDANRRAVEAHGAVLC
                     LHADIETLQARMSHAAEERPLVAGENWRERLRSLLERRAGHYASFPLQLDTTHLSPEQ
                     AVEEAQRLLGVFRLRGMGTSYDVRVRFGGLDACGSLLCRRGLKDPLALVSDDRVMPHH
                     GERLRAALEDAGYHVVPVILPAGEEHKTLRSLETLWSAFLQGGLERGSTVIAIGGGVI
                     GDLAGFAAATYMRGVRWVAVPTTLLAMVDASLGGKTGADLPQGKNLIGAFHPPALVLA
                     DPQTLETLPEEEIRAGLAEVVKHGILADPELFYLCEQGWEAVLGRMGEVIRRGMAVKV
                     GFIERDPYEKGERAALNLGHTVGHAIERASGYRLRHGEAVAIGLVVEAQLAEQYGIAR
                     KGLAERIAACLQGLGLPTRIPAGLDANAFRAALQVDKKNADGRVRFALPEDIGAYRVG
                     VPLEVDWSAYLSG"
     CDS             complement(226998..227450)
                     /codon_start=1
                     /locus_tag="ANT_01930"
                     /product="hypothetical protein"
                     /protein_id="BAJ62227.1"
                     /transl_table=11
                     /translation="MAIYRDAPYPPCHFTVDLGTGETWSPNTGLLEVVFPEARLVVAD
                     YRPGNSKTPEPQKVQTGVEYGTLILRRTVNGSLDWYQWWNEFRNGSTGNTRSVTIHLM
                     NEDLSNVVLTWKFFRARPVNHLFSNLTGLGGELFVESLELAFERLEME"
     CDS             complement(227488..227922)
                     /codon_start=1
                     /locus_tag="ANT_01940"
                     /product="hypothetical protein"
                     /protein_id="BAJ62228.1"
                     /transl_table=11
                     /translation="MNPLSRIRAPADQPLQDGYTRTLEALRHEERLLAVCLPLLLLAV
                     LVLFIPAVGGLGSPPLRPLLTAINLTGILLTLLTLWLARNLLERIRARVEACREMETR
                     LCLPALQESSVLDTHPLNLLFSALIILLLGGWILHLIVVWSL"
     CDS             complement(228126..229709)
                     /codon_start=1
                     /EC_number="6.3.5.-"
                     /gene="gatA"
                     /locus_tag="ANT_01950"
                     /note="protein synonym:Asp/Glu-ADT subunit A"
                     /product="aspartyl/glutamyl-tRNA(Asn/Gln)
                     amidotransferase subunit A"
                     /protein_id="BAJ62229.1"
                     /transl_table=11
                     /translation="MELCDLSAVELYRLLRERKTSAVEILQSTLERIGEVEGRMGALE
                     NSDLTEEDKQKVHAFITLTDERALEQARRVDARLAAGEDPGALAGIPVSIKDIFCVKD
                     TPTTAASRILANFTAPYTATPVERLEQSGALLVGKVNLDEFTYGSSNESSAFKPTPRN
                     PWDPSRVPGGSSGGSATAVAAGESVLSLGTDTAGSIRQPASFCGVVGLKPTYGRVSRY
                     GLIAFASSLDCPGPLAKDVSGAAMMLQVIAGADPKDSTTATVPVPDYLAELEKGVKGL
                     RIGLSPDYFRITYPTPDGGFEQQPLPAEIEQAVYRAADLLRQMGAEIIEDVPMPNTRY
                     GIPAYFVISRVEAASNLHRYDGVKYGYRTPQAVADLREMYRKTRAEGFGIQPKLRILM
                     GMYVSAAQYSARYYQRALRVRTLIRRDFEQAFDRNGAYRLDALLTPTTPTTAFEMAAV
                     YGDSVLMQYADQLTVPANHAGVPGLSIPAGLDAQGLPIGIQLLGADFSEDILLRIGRA
                     YEIATQGEAWRQARPRVLA"
     CDS             complement(229716..230036)
                     /codon_start=1
                     /locus_tag="ANT_01960"
                     /product="hypothetical protein"
                     /protein_id="BAJ62230.1"
                     /transl_table=11
                     /translation="MTDEITPELFAHLVELAALELDAQEAEYLRRQLNYQLKAIHELE
                     AIPLDEDTPITSHGVAYTPEISQPPRADEWHPYPAPQDILSQAPEVDDGYIVVPETPT
                     TPLE"
     CDS             complement(230046..230498)
                     /codon_start=1
                     /locus_tag="ANT_01970"
                     /product="hypothetical protein"
                     /protein_id="BAJ62231.1"
                     /transl_table=11
                     /translation="MRLSGWDVLSIVLLAGMAFLILIFSIIFINPYVMINPYPPPTPV
                     PTLFVPSPTATLRALPTIARTSPFEVPTATPRPLRPTSTLPPTATGFRLPTFTPTPTR
                     TSTPTNTRTPTNTPTFTVPPTYTSTPVTPSPTPVTPTEPVSTIYPPSP"
     CDS             complement(230644..230913)
                     /codon_start=1
                     /locus_tag="ANT_01980"
                     /product="hypothetical protein"
                     /protein_id="BAJ62232.1"
                     /transl_table=11
                     /translation="MEGFLIILALALGIYFVCKVDQDRDSQQKANRFFMEEEEEKQRR
                     EEIIRSGIAYNAWNHMRNHDGNPYNDSVGSAFTPGTDAWKANRRF"
     CDS             231361..232548
                     /codon_start=1
                     /locus_tag="ANT_01990"
                     /product="hypothetical protein"
                     /protein_id="BAJ62233.1"
                     /transl_table=11
                     /translation="MKKLLLSLVLMLWAVSACAPRIPPVPSLQAQSLPEATPSPSPAP
                     TFTAVPSPTETLPAPVPSSGSLLPFTQLTRLDALNGWGVRDTRVLRTTDGGRTWQDVT
                     PSDLHSEMTVTLSGFFPSAEEAWVCLPALDRYDSGTLYRTTDGGQTWQSAPAPFGWAN
                     FFRAPASAQTVLAQVSLQGLVELHRTRDGGQTWELVMRSTAGDEDAPGRLPVGMHTQW
                     QIAAQDEQTLWAAGISPAVDGLYLYRSGDGGVRWERRPLDLPQSPSGFYAEGLRFFDG
                     QSGAFSIFYGSETFQRAFFVTRDGGASWQLTPGIPAVGNTWSAPDALHWWVWDGENLR
                     LSQDGGWTWQTAPANPPETPESLVFSDPLTGWAVQYDENGHRLYGTTDGAQTWELLAE
                     DVP"
     CDS             complement(232552..233295)
                     /codon_start=1
                     /locus_tag="ANT_02000"
                     /product="hypothetical protein"
                     /protein_id="BAJ62234.1"
                     /transl_table=11
                     /translation="MNGTSTPYRIGTSGWTYDHWRGLFYPENLPKTRWFAHYAQTFDT
                     VEINATFYRTFGESTYRKWREQAPEGFTYVLKAPKPITHYKFLQDVEADIRAFWESAA
                     LLGNQLGMILLQLAPSTPYDPERLRAALRTFPDPARVAVEFRSERWLTDETRALLEES
                     GACFCDADAPRAPLRGWLTGRTAYLRLHGRSRWYAHCYTDAELDEIAALARRHVEQVA
                     ERVYIFFNNDFEGYAPENARSLIQRLAPR"
     CDS             complement(233412..234173)
                     /codon_start=1
                     /EC_number="2.8.3.6"
                     /gene="catJ"
                     /locus_tag="ANT_02010"
                     /product="3-oxoadipate CoA-transferase"
                     /protein_id="BAJ62235.1"
                     /transl_table=11
                     /translation="MDTAYTSSELMIINAARLLRDGDVVFVGVGIPNLACNLARRTHA
                     PNLYMIYEAGVIGARPNRLPLSIGDPTLVSGAAAVCSMYDIFTLYLQRGNVDVGFLGG
                     AQIDRFGNINATVIGDYAHPKVRLPGSGGSMEIAAWANRCYIMTPHQKRRFPERVDFH
                     TSAGFLSGKGERQASGVRGKGPQAVVTNLGILEPDENGELILTALHAGATVEMARENT
                     GWALKVAPSLRITEPPTAEELRILREELDPQGIYR"
     CDS             complement(234177..235079)
                     /codon_start=1
                     /gene="catI"
                     /locus_tag="ANT_02020"
                     /product="3-oxoadipate:succinyl-CoA transferase, B
                     subunit"
                     /protein_id="BAJ62236.1"
                     /transl_table=11
                     /translation="MSKLCTLSDAVSRLIHNGDTVYLAGFTHLIPFAVGHEIIRQGKK
                     NLTLARATPDLIYDQMAAAGCARKIIFSYMGNPGVGSLKVLRRMLEAGQLEWEEYSHF
                     GMITRLQAGAAGLPFLPMNLTAAPDLERVNPNYKRLTDPYTGREVMALPPLNPDVAVV
                     HVQRADEHGNAQIWGILGEQKEAAFAAERVIVTAEEIVPEEVIRSDPNRTIIPEFIVD
                     AVCHVPYCAHPSYTQGYYDRDNAFYLEWDRISESDEAVQDYLKEWVYGVRDRAEYWEK
                     LGEETHRRLAVSPRYAAPVNYGEY"
     CDS             complement(235084..235314)
                     /codon_start=1
                     /locus_tag="ANT_02030"
                     /product="hypothetical protein"
                     /protein_id="BAJ62237.1"
                     /transl_table=11
                     /translation="MRKPLGSFFFSVGLVLLVLFVFSDIAEQPQFGLFAGGAVCLILG
                     TALWLTSPRPASGEPPARFRTVKKLMQRKKKA"
     CDS             complement(235319..236905)
                     /codon_start=1
                     /locus_tag="ANT_02040"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAJ62238.1"
                     /transl_table=11
                     /translation="MTAESPFKLTYATMFNPPEELHTRFEEALAKVKAGLGKEYGMII
                     DGKERFADEKFVDHNPANTNEFLGIFQKGTVQDAHDAVAAAKKAFYKWSHTPWQERVA
                     LIRKAADLIDQRIFEIGAAVALEVGKNRMEALGDVAETADLFRYACDSMEKNNGFIVE
                     MGRDPLTGFQSTNFSVLRPYGVWLVISPFNFPAALTGGPSAAALVTGNTLIMKPATDT
                     PWTARLLAECLRDAGIPDGVFNYVTGPGSTLGQALIDHPDIAGVTFTGSYDVGMKIYR
                     DFAQSRWVRPTILELGGKNPAIVSRHANLEDAAVGIVRSAFGLQGQKCSACSRVFIEE
                     PVYDELVERLVALTNKLTIGDPTARNVYMGPVINASSYRDYQNFAEELHQSGRVLTGG
                     KILTEGEYAKGYFVTPTLVADLPADHRLWQVEMFVPITTIAKVSNLEEAMTRANEVMY
                     GLTAGFYGSPEEVEWFFDRIEAGVTYANRPQGATTGAWPGFQPFGGWKASGASGKNAG
                     GVYYLPLYMHEQIRTLVKRL"
     CDS             237151..238137
                     /codon_start=1
                     /EC_number="3.1.3.11"
                     /gene="glpX"
                     /locus_tag="ANT_02050"
                     /note="protein synonym:D-fructose-1,6-bisphosphate
                     1-phosphohydrolase class II glpX"
                     /note="protein synonym:FBPase II glpX"
                     /product="fructose-1,6-bisphosphatase class II"
                     /protein_id="BAJ62239.1"
                     /transl_table=11
                     /translation="MSASTPTRNLALDLVRVTEAAALAAGRYMGRGDKIAADRAAVEA
                     MRWVLNSIEMDAVVVIGEGEKDEAPMLYNGERLGLGVPPELDLAVDPIDGTRPLAMGL
                     WNSICTVALAPRGSMFNPGPALYMEKIAVGAEARDVIDLNAPVRDNLEKIARAKDERV
                     EDLTVVILDRPRHEALIREVRACGARIRLIPDGDVAGALMTALPETGMDVLMGIGGSP
                     EGVIAACAMRCLGGNLQGRLVARTPEEEIRLREQGYDLQRVLTLDDLVSSNDVFFAAT
                     GITSGDLLRGVDYFGNGATTDSLVMRGLTGTVRRIQATHRLDKLGRISPIAY"
     CDS             238147..238305
                     /codon_start=1
                     /locus_tag="ANT_02060"
                     /product="hypothetical protein"
                     /protein_id="BAJ62240.1"
                     /transl_table=11
                     /translation="MLEERPLTACPSCGGEIDLTYADVGDTVICVVCGAELRVLSLDP
                     PDVEEIEA"
     CDS             complement(238722..239873)
                     /codon_start=1
                     /locus_tag="ANT_02070"
                     /product="hypothetical protein"
                     /protein_id="BAJ62241.1"
                     /transl_table=11
                     /translation="MMGELSMALNQHLRQNLHLVETSTAPTLDEHFADLFNLSRLLNQ
                     TNRLEQILKTIARHSLSLLQVVYCRILTLEEDGRLITRLVEIDERLPELQRRRLERLP
                     AALREYHRALHSQGVVVYQAYDFVYTPMVRQNLGLNDLNSLCLVPMRVADETIGLMVL
                     GDHWRKEEALFNEERIRLAVMIADQAAAAIHRTLLNARLHESQVTAIRALVAMLEQRD
                     LYTGDHSRRMTELAGKLAHQMGCPPEEVEAVRWAAILHDLGKVGIPDETLRKPAELSA
                     EEWKLMKTHPLKGAEIILMLSGLEHVAMLVLAHHERFDGTGYPYGLSGNRIPLGARIL
                     AVVDAYTAMTDGRVYRPAISHPEALAELRRCAGSHFDPQVVEAFLALFN"
     CDS             complement(239903..240184)
                     /codon_start=1
                     /locus_tag="ANT_02080"
                     /product="hypothetical protein"
                     /protein_id="BAJ62242.1"
                     /transl_table=11
                     /translation="MVTSFQESNLTGPSRTRPEQELSRLLTAAVISPHFRRLLLSNPA
                     QAIASGFGGEAFHLQGEEQQQLAAIQADDLADFALQVSALRLFSVTPQR"
     CDS             complement(240188..240790)
                     /codon_start=1
                     /locus_tag="ANT_02090"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62243.1"
                     /transl_table=11
                     /translation="MILLGAFSVGLVAVGLRALILRRELHPFDVRWMGLLFVAFLPQW
                     FAFVLPTRFEIPDVWASLALVSSQIGLLLFALANVSKPGFPLLALGLASNLLVILLNG
                     GWMPISPEMVQRVLPQASPDFWQIGARLGTGKDIVLPVEQTRLWVLSDIFFIHYGWNR
                     AAFSPGDVLVALGVIRALWSLADRPAPARVSASPVAAQEG"
     CDS             complement(240800..240925)
                     /codon_start=1
                     /locus_tag="ANT_02100"
                     /product="hypothetical protein"
                     /protein_id="BAJ62244.1"
                     /transl_table=11
                     /translation="MSTLVSLFADSRKVRLVVFALMLVLFILGAGAPEDAGGFFH"
     CDS             complement(241148..241846)
                     /codon_start=1
                     /locus_tag="ANT_02110"
                     /product="hypothetical protein"
                     /protein_id="BAJ62245.1"
                     /transl_table=11
                     /translation="MQKAHPKLLLLGWILLAIAVMFIYGDTVLRRSSQPFPHPTATLM
                     PSETRVPPVESSGVTMRWLNAYPQWGDHYRVELCYTLPDQRDWLLSNPFRKTSPLLKI
                     SGQDLLPIEEGTMYWRQDAGSKVVERCSYLLFFVGQPASGEEFLTLQVRFLIAPQSGQ
                     PEVCQPIRDIQGQRGENLTMSCIPRKGFPAKLIERLPLFLLQNDAVLRRPMESIEWDT
                     LEGEWTFTFPVAPP"
     CDS             complement(241931..242596)
                     /codon_start=1
                     /locus_tag="ANT_02120"
                     /product="hypothetical protein"
                     /protein_id="BAJ62246.1"
                     /transl_table=11
                     /translation="MNKLSIRASFSGMVIAGVASLMALALILFGIIHTVAGNTVTKDQ
                     GLNKGPTRIGDITVELLGGRQIKDQFQVEVCYTLPDERDWLISISPTDTLLRINDKDY
                     TVSEAQMISREKGSNGQYNLRCEALLFPVQNVPAGTPFQITLSKISVSESEIFDCAAL
                     QKKIDAIQPGISIQCATQPHVSGFHAVSWPRGITQAEANALAHDIASDARKGSWIFKD
                     VSE"
     CDS             complement(242625..243206)
                     /codon_start=1
                     /locus_tag="ANT_02130"
                     /product="hypothetical protein"
                     /protein_id="BAJ62247.1"
                     /transl_table=11
                     /translation="MKVERFDGRLNMSTLVSLFADSRKVRLVVFALMLVLFILGAGAP
                     EDAGGVFQKGYKSVSHSHFTNILSDPEINTGAQGVNCSGSACNNTDPGTTGCNVDAAT
                     IHRKVFTNTKVQLRFSDTCQTRWSKTINKASINFYGNATLRYYYYGAVYLGPGYSVYS
                     NQRFGMGYQACGKVGASPMNYLINDTDKCTAVY"
     CDS             complement(243414..244556)
                     /codon_start=1
                     /locus_tag="ANT_02140"
                     /product="hypothetical protein"
                     /protein_id="BAJ62248.1"
                     /transl_table=11
                     /translation="MNCFSKFVHFLILLLGAFPLSSCNILGQKMEIQSFPVKEFPFAL
                     ELQPVPLEDAMPYFNDPLIQEQIEGIESITQDGWQSIHVVSVAGNSPEQLQVGPSIVI
                     KPGKPLMGFILFFNTHQYDRNLGMLTVLDGEQVIIKTSQGIEKRPSLFLERNKWQAFR
                     FFMDPLPEGLHTLIMTAIVEPGLNFYVSERKVKLTTYETDVLGHRDSPIEFKKLLWVT
                     SDSPQSVEDWPPSVRTPAPDQVVSVLSARLVGYKPRFGESQWLYYYDEVRPGDLLTYY
                     LTLGGQTSTEIPGEQRLPMDILVFWDDKLTQRTRLQIPVQAVVNKTYLSYPIEVPKDL
                     PPGKHNLTAIGYPYPGYLHSWLGDRSWNPPVYFNSYVLAHFPILVK"
     CDS             complement(244568..244966)
                     /codon_start=1
                     /locus_tag="ANT_02150"
                     /product="hypothetical protein"
                     /protein_id="BAJ62249.1"
                     /transl_table=11
                     /translation="MIEEIEPNKDALRAASDGVVPGPNGEKMTIVNRYFPYHLGAVKT
                     DGWAEANFRQPGLSWITCKSKGYNDRGQDSGWKETHGPFGGTSCGPTPKATIALALKP
                     ATYTSVTQAFWKWSTGEETSGEARQTHYEP"
     CDS             complement(244963..245136)
                     /codon_start=1
                     /locus_tag="ANT_02160"
                     /product="hypothetical protein"
                     /protein_id="BAJ62250.1"
                     /transl_table=11
                     /translation="MKVELFDGRLNMSTLVSLFADSRKVRLVVFALMLVLFSFATSGF
                     VFASNEEPPLPSL"
     CDS             complement(245341..245532)
                     /codon_start=1
                     /locus_tag="ANT_02170"
                     /product="hypothetical protein"
                     /protein_id="BAJ62251.1"
                     /transl_table=11
                     /translation="MTSDEIVMFLGFLVFLLYPAIAIYVALQKKRTCFALGIFLSIFI
                     GLGPFVSTYFFLASTKNRE"
     CDS             complement(245653..246324)
                     /codon_start=1
                     /locus_tag="ANT_02180"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62252.1"
                     /transl_table=11
                     /translation="MKTLLEAHNLSKLYGNGRSQVVALKDVSISLFPGECLALMGPSG
                     SGKSTLLSILGLIIRPTSGCVLVQGKPVEEDERSRARLRNEFFGYIHQEFAVIENETV
                     EKNVMIPLQYARIKPSRQERQSRILQLLKQLNLDWAVHKNVSFLSGGERQRVAIARAI
                     INHPSVILADEPTAALDRKSAEEIMGFVLSMRDQGCSVLIATHDERIAKTCDRVLHLV
                     DGRLL"
     CDS             complement(246327..247439)
                     /codon_start=1
                     /locus_tag="ANT_02190"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62253.1"
                     /transl_table=11
                     /translation="MREALLDEVRDGFLLAFRRWPVMFMLAGMITLATVVLSFALSDV
                     LSEGYVLRGARALREHHAVFFTAYYPEGGEVSRIEDATVKSLMNWIDQQRAYTSIVYN
                     MALDDPDFAGGYPTLILFGDVVPNLFPEMHLCVPVPCAVRGAKVRGDAVDSINVGGIE
                     ILVKQIFPRGAAFFDVNAAGLPLDHRIVIRAPTEVIPVLHPIEQEELITRTVLLDPTD
                     SMVYEFISGAARGGLFLVPHEVSMEQPKQFREIMMRSAMYLVGMVAFLVLALMTFVSS
                     ARLAIQQERREFKIRQMYGATPWHISLRIGGFLAAVILLPETALLFLLQRFLVIAGAL
                     EPNAPIWVMILLVIVFAFLWHTLVHEVLKKEGLGGW"
     CDS             complement(247417..248412)
                     /codon_start=1
                     /locus_tag="ANT_02200"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62254.1"
                     /transl_table=11
                     /translation="MKVRLFLTSFFLGILSMFAVWAFQWTLDSWKEITFDLPGEVTVL
                     RLIKRAQGVATADASAVQEKLKAYLRDQSLTLIVSSSGDGRPEIVVYDPHHLVTWFPG
                     CPSEDTHPGGMDAYIFRGTYSEKLWISSLNVPFLPQGAIVRGIISAPHRAGTLQYARC
                     VGGELLPEGQYTFNTADPAQAQQIVRMLYQMGFVAQSNTKLPFYLYLIQNPLMVIPGF
                     FLLAAWGCVLLYWLLYLHGRKREFGIRVRHGALPDDLVWENFLVGLPGLVCGTTLGGL
                     VAGILVAAISQVLLSPAEVLTIVSTIGITFFIVVGVWLATLFVVVRFGYERSLTG"
     CDS             complement(248422..248781)
                     /codon_start=1
                     /locus_tag="ANT_02210"
                     /product="hypothetical protein"
                     /protein_id="BAJ62255.1"
                     /transl_table=11
                     /translation="MQKKLLSGIIAIGIAFVITITVLAGGMNYAYAWETLGGARWNGY
                     IQIQACYNDNGNHAKQGYHRFTRQAGPPLDTGRMYTSQATSPQDCTIRSRQDSVWDSP
                     LWGDQYTTRYFYDFVWW"
     CDS             complement(249081..250004)
                     /codon_start=1
                     /EC_number="5.4.99.-"
                     /gene="truB"
                     /locus_tag="ANT_02220"
                     /note="protein synonym:Psi55 synthase"
                     /note="protein synonym:tRNA pseudouridine 55 synthase"
                     /note="protein synonym:tRNA pseudouridylate synthase"
                     /note="protein synonym:tRNA-uridine isomerase"
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="BAJ62256.1"
                     /transl_table=11
                     /translation="MMENPMDVRNTVSGVLVVDKPVGMTSHDVVQIIRKGTNIRRAGH
                     TGTLDPRASGVLVVLIGPAVRLSEYVSASDKRYQAIIRLGTSTDTYDADGRITGSGSV
                     PVESITEEQFEQALQQFVGEIEQVPPPYSAIKVQGRKAYEMAREGEEVDLAPRKIKVY
                     SLELLEWAPPEAVVDIYCSSGTYVRSLAHDLGQVLGCGAHLVGLRRTKSGRFTLRDAV
                     PLRKLREAFQDGTWYQYLIPAAEALADWPALELTDKQVEEVRHGHRIPAEEPVPGNMV
                     RGVSVLGELVALLEYLPEENLWQPRKVFFQS"
     CDS             complement(250085..251065)
                     /codon_start=1
                     /locus_tag="ANT_02230"
                     /product="hypothetical protein"
                     /protein_id="BAJ62257.1"
                     /transl_table=11
                     /translation="MNGLERYDSPAQALQHARRIRILTHIRPDGDAIGSMLGLGLSLQ
                     AAGKQVQMILPDGVPAPLRFLPGSSQIVRSAAEEADLLVVLDSSDLPRTGGLPENAQV
                     DVNIDHHITNTRFARLNWVEPDAVATAAILAEQLPAWGFPLEKDAASALLAGIITDTI
                     GFRTSNTTSKALRLAADLMDRGADLPELYRAALLLKSFEAVRFWGFGLERLQRKNGLF
                     WTVLYQQDREATGYNGNDDADLINFLSSTECDIVVLFNEQKEGKVKVSWRSRPGIDVS
                     ALAVQFGGGGHPAAAGAEIPGTVEEVRQQVLAATEQLLRDAREMSKSNGQ"
     CDS             complement(251062..251469)
                     /codon_start=1
                     /gene="rbfA"
                     /locus_tag="ANT_02240"
                     /product="ribosome-binding factor A"
                     /protein_id="BAJ62258.1"
                     /transl_table=11
                     /translation="MPSKIRLKRIEDRIREDLAELLVREVADPRLAGISVTDVKVDRE
                     LAYADIFVSAVEGQARKEEVLEGLRHAAGFLRSALAANIELRTFPRLRFHWDVTPERA
                     DHIERLLASLREQEGASPASPTPTPPEDEDDEA"
     CDS             complement(251510..253291)
                     /codon_start=1
                     /gene="infB"
                     /locus_tag="ANT_02250"
                     /product="translation initiation factor IF-2"
                     /protein_id="BAJ62259.1"
                     /transl_table=11
                     /translation="MSDNGRKRIELPMSITVRELAQRTEASPIQVIKILMSNGVMANI
                     NQQIDFDTAAIVVSELGFEAVPESLVEEEKVETGEIPLWRRIILSEKPESLIPRPPVV
                     TILGHVDHGKTTLLDAIRNTNVAEGEAGGITQHIGAYQVEHKGRLITFLDTPGHAAFT
                     AMRARGAQGADIVILVVAANDGVMPQTREAIAHARAARVPIVVALNKIDRPDANPDFV
                     KRQLAELDLVPDEWGGNTLVVPVSAKQRIGLEDLMEAILLTAEGIEIRANPKGKVIGT
                     VVEAQVDKSRGPIATLLVQNGTLEVGDVIVAGTAYGKLRAMFDFRGRKIRAAGPSTPV
                     QVMGLSEVPEVGELFTRYDSEREARAVVEQRKQEAAAKAARAPKATLEELFSRVQAGE
                     EKELRLILKVDVQGSLEPIINSINDLPKGEIKVNILHAEAGNVTDNDVLLASASKAII
                     LGFNVQAESSARRLAEAEGVSIRLYDIIYRLTEDLEKALKGMLEPETKEVVVGKANVL
                     AVFTISKVGNVAGCRVTEGEIRRNGRVRVYRNGKQLFDGEIASLKIQKDDVREVRTGY
                     ECGIGIRNFNDIQPGDVIECYVIEKNA"
     CDS             complement(253400..253744)
                     /codon_start=1
                     /locus_tag="ANT_02260"
                     /product="hypothetical protein"
                     /protein_id="BAJ62260.1"
                     /transl_table=11
                     /translation="MTKKTGQRVKHVPQRTCVGCRQVLAKRELVRVVRTAQGVRLDPT
                     GKAAGRGAYVHALRSCWERALKGALAHALKTKLSDEDREQLMAYAAQLPQEEAGESST
                     ALTGQQGNEMMP"
     CDS             complement(253799..255700)
                     /codon_start=1
                     /gene="nusA"
                     /locus_tag="ANT_02270"
                     /note="protein synonym:L factor"
                     /note="protein synonym:N utilization substance protein A"
                     /product="transcription elongation protein NusA"
                     /protein_id="BAJ62261.1"
                     /transl_table=11
                     /translation="MKNEFVLAFNEVLEEKQLPRDVILKALESAMVSAYRRAVNASNA
                     QQVEAKVDLDTGKVTIYAEKEVVEQVREPLTEVSLEEARRYNPHVQLGDMIVVESTPR
                     DFGRVAAQTARQVIQQRIRDAERQMQLNHYAKQVGEIVSGVVQAVNAQGLTIGLEMRA
                     EGTMPRKEMIPGERFRVHDRVRALIAEVKDSPRGPQIILSRTHRNFLRRLLETEVPEI
                     YHGIVEIRSIAREPGERAKVAVSATQPGIDPVGACVGIRGVRIQAIVRELHDEKIDVI
                     EWNADPAVYIAKALSPARVTGVYLDDKSSVNKTATVVVPEDQLSLAIGRDGQNARLAA
                     KLTGWRIDIKSLPEAAAEALHRLQTDPEYAQIAELEREAAEAVSGLLARKAEGRPLSA
                     EEYDRMAQFVDRVQRRATRRAMEKKAEEDNRVQSVRASIPAEAFQTGILDSGLPEHVA
                     YLLQEGGFSTVGDVVMQMKLDPDQILKLQGIGPRAMSEISALVERTVVTAQPQEAEAV
                     ITETPAAEEETPQPAIEATAEVAPETTLPVEAVEPISQPEAVAQPAAPATEEEETEEL
                     SFDELFTLRADVPVDVADEEEEEAPADKKGKKAKKKKKGARFVEYDPDRDVTFIRKKH
                     KRGEDWDWE"
     repeat_region   255834..255841
                     /rpt_type=flanking
     repeat_region   complement(255842..257041)
                     /note="Similar to IS6 family"
     repeat_region   255842..255868
                     /note="27bp imperfect inverted repeat"
                     /rpt_type=inverted
     CDS             complement(255928..256956)
                     /codon_start=1
                     /locus_tag="ANT_02280"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAJ62262.1"
                     /transl_table=11
                     /translation="MKIILQLPQVKRKKPARPKRCPYCQGETFQRWGVEKRRIEDVKV
                     RHVEVVRYRCTRCRRTFRDYPEGVGNGRHSERLKKLSVILWSLGLSYRRVAGVLRIFG
                     LRLSHMSGWRHVQAEGEKLMGELKWKSVRVVGVDGAWVGGKGVMVAVDLGDGSLLEVA
                     EVDEKDSRALFTWLKRLKEMHDIGAIVSDDLAIYKQLTDELEIGHQVCQFHVRRWVKH
                     ALKGLQAELDPAWQGVLEKVEEILRDLPLHGDRLLHRLWKSLPGRSTPPEGKRTPLEK
                     LRDLILRLSRDWQRYVAFYADVGIPWTNNRTEQMIGRLKSRAQQARRYKTTAGLLRGS
                     TVACQFWA"
     repeat_region   257015..257041
                     /note="27bp imperfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   257042..257049
                     /rpt_type=flanking
     CDS             complement(257377..257655)
                     /codon_start=1
                     /locus_tag="ANT_02290"
                     /product="hypothetical protein"
                     /protein_id="BAJ62263.1"
                     /transl_table=11
                     /translation="MKAWRYGLVVVVLLGLFVWFAHPAVAEGTVCGDDGCAEDKPGSG
                     CTEDCKPGEPGGGGKKEEPPSYPEEPPYAGGNSTCSLIESVPAVEPAL"
     CDS             complement(257682..258842)
                     /codon_start=1
                     /locus_tag="ANT_02300"
                     /product="hypothetical protein"
                     /protein_id="BAJ62264.1"
                     /transl_table=11
                     /translation="MKSILRFLSVFVLGLSFLLSACAGIAPTPTPTPLPTETATPQPT
                     PTPEPTSTPAPTPTPTVDPCATQPERWTFSLPVDPISKQPYPNFWMNLSPACALKNLE
                     PWIAFSMMIQNGYSIQEAAQTLGLEDNPYLAPLKEGKPQKYVRWFGIEEQKVDGFNLP
                     GRYYWWLPSMYLPVDVRFYYFDADTDRYEARLVLWGCARNVNAKLADGVSPEAQKVVF
                     QAVCAVRKYYPGVQSSWWEQDLPEGTAGGFTRKHIPGKRAFEPDETQYGEGVHAAKPD
                     QPAYAGMLYYAYIGDGQWYYIGEDNAFDLMGFDSVEEMEAALQRNLELVPGSQVWDLQ
                     WLKQTYGVDARPVPQEYRTMLDHYKSDPAFKALVDKALEIQGEYSDRYEDKK"
     CDS             259042..259629
                     /codon_start=1
                     /locus_tag="ANT_02310"
                     /product="hypothetical protein"
                     /protein_id="BAJ62265.1"
                     /transl_table=11
                     /translation="MKGEWKYTRAVNPRLLRSEPMRRCTLGECRAACCLYGVWLAVEE
                     RDDLLEHAALIAPHMPPALRDPTVWFRGEETADPYAPSGRVIHSNVLPAPEHYGGTAC
                     VFLREDHKCALQVAGEAAGFHPWRFKPFYCILHPLDLDEQGRITLDETPAMLAEEGSC
                     LRPSETLIPLMRTFEPELIHLLGDLPEQNSSDERR"
     CDS             259616..260548
                     /codon_start=1
                     /locus_tag="ANT_02320"
                     /product="phosphotriesterase"
                     /protein_id="BAJ62266.1"
                     /transl_table=11
                     /translation="MNGGEPMPVLHTTLGALSAPPEGIILPHEHIFVDLRPLDAPNHG
                     QAKTEDVVALMAPELKRARAAGIAALVECTPEGVGRHVEHVLAVSQAGNFPILVPTGI
                     YREPWVPAWAHHADEGILQSWMMGDLEVGVGNTGVRAAFIKLSMGDDGITPVERKILR
                     AAARAGAKTGAAIGSHTIRGRVVLEQIDELEACGFDPHRFISIHAQAEPDFALNLEVA
                     HRGAWIEYDGIGWSEDEAYIRRILDMLEAGFEGQILLSMDRGWYDCAQPGGGTPHPFT
                     YLVEVFLPKLRAAGVDEATLRRLTVENPFRAFAR"
     CDS             complement(260681..261535)
                     /codon_start=1
                     /locus_tag="ANT_02330"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62267.1"
                     /transl_table=11
                     /translation="MQTEFGLSQPSWRSHLRALWMIAVNNWKHHWRYPLNAVSDMLQP
                     LVWLAPVYFMGQAFSVNGRAEGFAGFAGTDDYMSYIILGTALTNFIMAVFWGMGFSLK
                     WDMDGGVLEANWMAPLPRPLMLVGRTLSSLATTTLTSLGMILIGALVWGFHPTGNALS
                     AVLVAVPLLIGLYGFGFAFAALVMILREANTLVDSGSYVVMLLSGANFPVTVLPKWLL
                     PLSLALPLTYGFDAVRAILLKTRTLLPLNVEIAILLASMVLMIVIGLRAFYALERRVR
                     QMGTVGQY"
     CDS             complement(261551..262432)
                     /codon_start=1
                     /locus_tag="ANT_02340"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62268.1"
                     /transl_table=11
                     /translation="METVLLPSTQSKSLSRTTWAAQLRALGAIIWREYLHFVRYPTWI
                     IAFIIWPILFPATYIFSSFALAGPGGSGVARFLEVAGTENFLGYIVVGTTVWMWANTM
                     LWNVGFALRGEQMRGTLESNWMTPTNRFFFLLGSGPVHAASTLMFFIFTVVEFRLFFH
                     LTFDANLLSLLAVFLAALPALYGLGFTFASLVITAREANTFVFLVRGIVMIFCGITYP
                     LTVMPQWMQAVAEWLPPTLIIRAARLAALNHAPLEAVSRDLLLLLAYGAFWLALGYLT
                     FSQIERRARLKGALNQY"
     CDS             complement(262445..263482)
                     /codon_start=1
                     /locus_tag="ANT_02350"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62269.1"
                     /transl_table=11
                     /translation="MSDYAIEALDLVKKFPRRAPAESSAAPKNPLARLFQRPPKSEFT
                     AVDHVSFQIHRGEIFGLLGPNGAGKSTTIRMLCTLLEPTSGTARINGYDVVRDANRVR
                     QSLGIVLAGERSIYWKLTGRENLEYFAALYHIPPEIARKRIDELLDYMELTSRANELV
                     EKYSTGMRQRIVLSRALLARPPIILLDEPTLGLDPQAARRIREMVLDLKRQGHTILLT
                     THYMEEADQLSDRIGIIDQGKIIALDTPAALKQRIRQQDVIKMEVAGWKPEMTGAIQS
                     LPGIRQMVTRFLEQDGIWEIHLQTENSRAVLPHLIERVNTNGTHLVNLNIVAPTLEDV
                     FIHLTGKALRD"
     CDS             complement(263699..264505)
                     /codon_start=1
                     /locus_tag="ANT_02360"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62270.1"
                     /transl_table=11
                     /translation="MKVQNKVFVVTGGGSGIGRALVLGLLARGARVAAVDLNPATLQE
                     TANLAGEKQANLSTHVANIAQREAVEALPAQVIERHGAVDGLINNAGIIHPFVKVNDL
                     TYDVIERVMNVNFYGTLYMIKTFLSYLLQRPEAHIANVSSMGGFVPVPGQTLYGASKA
                     AVKLLTEGLRSELMDTPVKVSVIFPGAVGTNIAANSGVNIQSHGGQSSRAMKVLQPEE
                     AARIILDGIEQDRARILVGSDSTFMDRLSRLSPERAAKLIYQQMKSLLAG"
     CDS             complement(264771..266138)
                     /codon_start=1
                     /locus_tag="ANT_02370"
                     /product="hypothetical protein"
                     /protein_id="BAJ62271.1"
                     /transl_table=11
                     /translation="MHTESGVTPYAEIPCCPDLKTSPTCDVLDFRRHLVFPTSVRTEQ
                     GQIVRVEVIFHVRFTRCSGPLALGDIVYSTTLLPGEKVRLATTDRRSRFSFDSESKLS
                     YRSEQISEEQYRLRSLRAFMSDQNVEDRGGENFQEEGKWDFHGDASGSLGFFSVNADT
                     NAKGSHSASSSRDYLREFRAHAEMSDNLSVEATRRAHSLSIGEVSSRTHVQGESEDHF
                     ESASREFSNPNKCHAVTFLFYRINKTEKIRFELVSIERRVLDPVALMPVPAAPYKPTG
                     AVATVPQEVPATSTKRLEIQEIALASEARARSSQVGLANPQLLSTRFAAGVATAAVSA
                     IPAAALGFQQPLSDEVRAKALAEVDAQLVKQGLIERVGGQVSKRIKAEIDYERETSIP
                     TAGVIVKSCMDDCGICEPEVALREKLELERLELENKLLAKRIELLEKSQEYRCCPGGE
                     GEGGG"
     CDS             266252..267196
                     /codon_start=1
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /gene="folD"
                     /locus_tag="ANT_02380"
                     /note="bifunctional protein"
                     /product="methylenetetrahydrofolate
                     dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="BAJ62272.1"
                     /transl_table=11
                     /translation="MNRRNGSIMTSNTLSAKKEEHNMPAQILDGAAMAEKIRQQIAQE
                     VAQRLAEGKPAPGLATVLVGDNPASQVYVKSKHKACQQVGIRSMGYELPATASQQEVM
                     DLVKRLNDDPAVNGILVQLPLPSGLDEEKVLGAISIEKDVDGFHPINIGRLAQKGREP
                     LFVPCTPAGCMVLIESVLPDLNGANAVVLGRSNIVGMPVALLLVRANATVTICHSRTR
                     NLKEVCRSADVLVAAVGRAEMVRVDWVKPGAVVIDVGINRVEDATQPRGYRLVGDVAF
                     DEVKDVAGWLTPVPGGVGPMTIAMLLQNTLRAARLSDV"
     CDS             267333..268622
                     /codon_start=1
                     /EC_number="1.1.1.-"
                     /locus_tag="ANT_02390"
                     /product="UDP-glucose/GDP-mannose dehydrogenase"
                     /protein_id="BAJ62273.1"
                     /transl_table=11
                     /translation="MHMRFQHICVLGLGYIGLPTASTFATHGLRVTGVDVNPAVLNSL
                     QNGETHIYEPGLRTLVQAAVKSGNLAVSPQPVEADAYIIAVPTPFKEGKKADLSFVIA
                     AAEAIVPVLRRGALVVLESTSPPRTTEDVVRPILERSGLKAGQDFYLAYSPERVLPGQ
                     ILRELIENTRVIGGIDSASAEAGRDLYGVFVRGEIILTDATTAEMVKLMENTYRDVNI
                     AIANEFARLAERFGINVWEAIALANRHPRVRILNPGPGVGGHCISVDPWFLVEAAPDL
                     ATLIRTAREVNDSQPHFVVERVRQAAGLLEGLRVAALGLAYKADVDDLRESPAIEVCH
                     LLSQAGAQVRAYEPFKPDAVIEGVETVPTLGEILDEADVLLLLVGHTVLRNLDPVEVA
                     QLTAARIVVDCVNGWEPERWRFNGFHYYRLGDRKEVG"
     CDS             268627..269766
                     /codon_start=1
                     /EC_number="5.1.3.14"
                     /gene="wecB"
                     /locus_tag="ANT_02400"
                     /note="protein synonym:UDP-GlcNAc-2-epimerase"
                     /note="protein synonym:bacteriophage N4 adsorption
                     protein C"
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="BAJ62274.1"
                     /transl_table=11
                     /translation="MIRVLSIFGTRPEAVKMAPIVRLLAQTPGIESKVCVTAQHRQML
                     DQVLEVFNIQPDIDLNLMKPNQSLAQLTADIFTHLDPVLREVQPDWVLVQGDTTTVMA
                     AALLAFYHRIRVGHVEAGLRTNDRYQPFPEEINRRIAGVVADLHFAPTEHARRNLLAE
                     NVPPQSIVVTGNPAIDALRWITAQPMPQEAEDLLARMDVRPGGRQLVLITAHRRENFG
                     KPLEDICHALRALAEEYADRLALLYAVHLNPNVQEPVYRLLSGIPNITLTPPLDYLPM
                     AHLMQKAHLVLTDSGGIQEEATSLGKPTLVLREVTERPEGVEAGVLKLVGTDPQRILR
                     EARLLLEDEQAYRAMAQAANPFGDGHAAERIVEALLKASQSASPA"
     CDS             269770..270813
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_02410"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62275.1"
                     /transl_table=11
                     /translation="MSQPVAASASLCLLPRLEGLGGPASFRGRLSAALIRRGWQVHQN
                     PDESACRAILVIAGTRDLPALWRARRRGVRIVQRLDGMNWLHRRRFTGVRHFLRSELN
                     NALLAYIRRFLADAVVYQSEFSRRWWERVYGRVEHSAEVIYNAVDLQEYSPQGVEHPP
                     ADRWRLLVVEGHLHRGNWLGLENALVLARQLDGWQGKPAELWVAGDVAEELRRRAEEL
                     LPGKVRWLGIVPRRDIPALDRSAHLLFSAELNPPCPNAVIEALACGLPVAGFAEGGLP
                     ELVGGDGGVLAPWGSDVWKLQTPLSRDALAEFVRQLLIEGEAPRRRARARAERLFDLE
                     TMAEGYLRVLLSE"
     CDS             270887..271036
                     /codon_start=1
                     /locus_tag="ANT_02420"
                     /product="hypothetical protein"
                     /protein_id="BAJ62276.1"
                     /transl_table=11
                     /translation="MSSSTQRPSPRRPYPPFWEKSIPFILALVGLAVLALILISLAVL
                     LGWLK"
     CDS             271070..271798
                     /codon_start=1
                     /locus_tag="ANT_02430"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62277.1"
                     /transl_table=11
                     /translation="MTFFNTVLPFLSSAVSFVFAALVLRRFAQKGGAHLLLWGIGMVF
                     YGIGGFCEGFYGAFGWNPLIFRLWYLFGAMLVAAWLGQGTVYLLVRRRGIAHALMILL
                     ALGSLFGAVRVFGAQLDPSLMTGGLHTGSELSGKAIITAGVRTLTPIFNLYGTLALVG
                     GAGYSAFLFWRKRVLLHRTIGNVLIAVGALLPAFGGSFSRMGVPGALYISEFLGAVLL
                     FAGFLRATTPLPQESATAVEAQKA"
     CDS             complement(271863..272804)
                     /codon_start=1
                     /locus_tag="ANT_02440"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62278.1"
                     /transl_table=11
                     /translation="MNEFWLTIISYAKLILLTIVPFVLAGQGTMLGGRTGIFNVAQEG
                     IMLVGASVGFLVSFLTGSNALGMLAAMLAGGLFGLALAYFTTHLRMDQFVIGLALFFI
                     GVGLSTLLPKIIIGVTLTPPLIPTLKDIPIPGLSQIPVIGEIFFKQNVLVYFSILLSI
                     GLWWYLYRTQAGMELRAVGENPQAADSLGVNVPRARYWTAILGGMLMGLAGAYLPMVY
                     TGTFTENMVKGRGWLAIALTFFGGWKPDTILYGALFFALIEVLAYRVQVLGTAIPYQF
                     LLMLPYLATILVMMFSFRKARVPAFLGQNYDREKRAL"
     CDS             complement(272801..273835)
                     /codon_start=1
                     /locus_tag="ANT_02450"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62279.1"
                     /transl_table=11
                     /translation="MKKSNGLLKIARAVLPYLLAVVAAFAAAGVFIALMGFDVFKAYG
                     TILFTSFRTPNGFVQTLLKFVPLVLQALAFTIPLTAGKFNIGGEGQLLVGATAATVAG
                     IVFAQLPPILLVPLVLLAGVLGGALWGLIPGWLLYRFGINEILTTVLLNFVSFNLVNY
                     VCTGPLRDPAAGHPTTIAIGQNGWLPMLINNPPLHSGILLAILVVAVVYYAITRTVSG
                     YELVATGANPRAAGVFGINTRWMFIASLVIAGGVGGLSGALEVAGVQHRLIEGMQHNF
                     LVLGLIIGLIAKGNNLAVPFVAFFISVLEVGASAMQRTLMIPVEMVFIVEALILVFVL
                     LSDLVQKRVS"
     CDS             complement(273849..275393)
                     /codon_start=1
                     /locus_tag="ANT_02460"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62280.1"
                     /transl_table=11
                     /translation="MNAPILLHMRGVSKAFGSTQALQDVSFELRQREIHGLLGGNGAG
                     KTTLMNILFGLYRADAGEIFLNDQPIHISGPKDAITHRINMVHQHFLQVGSFTVLENI
                     LIGAPRKNRWNNRYDAEIQKIRTLQERFGLEVPLDALIEDLPMGMRQKVEILKALYRG
                     VQVLILDEPTTNLTPQEVDALFQSLRVMVQEGLSVVFITHKLREVMSVCDRITVLRNG
                     RNILTLDRKEASEEAFVRAMVGESMDMSRSVIFAHAGQDLPAPAPVPLLRLEGITTAP
                     DEGSVALKNVSFEVREGEIFGIAGVAGNGQRELAEVVMGLLPVQAGQILLRHQALPHP
                     DSRRGLKGDFAYIPEDRLHDGFLPRATVAHNLILGLHRRPPYSNGRVIDWKTVHARAL
                     DLIAQYNIKASGPEDMGGNLSGGNIQRVMVARAFSAAAPVLVAHNPTRGLDIPSMDLV
                     YQRLLERKRQGQATLLISEDLDELMLMSDRIGVLYKGELLGIVERPAFEKYTIGQMMS
                     GIRPQA"
     CDS             complement(275474..276466)
                     /codon_start=1
                     /locus_tag="ANT_02470"
                     /product="putative basic membrane lipoprotein"
                     /protein_id="BAJ62281.1"
                     /transl_table=11
                     /translation="MKRVLFVVLLLALVLAACTPATPTQPAKTYKLAAIFPGVINDSD
                     YNTLGYMGAEAVKKDLGIEMAYSETVAVPDIDRVMREYIDQGYNIIWTHGGQYVNQTI
                     ELAKQFPDVVFIAEGDAKPAEMPANVWFIDRNFHIGFYGVGALAARITQTGKIGYIGG
                     LTLPFSYAEVHAMQQAIKDSGKNVELKAVWAGDFNDPTKARQVADTMIAEGYDVLVGS
                     LNNGMLGVFEAAKATTDKKILVTAKYTDKTSIAPDNYVTSLLYDFVKPMKDIVGKIQA
                     GEKGGYYPLGFDTGVSLQTPFKNVDPAVEEEMKAVINDLVSGKIQVVKDTSEIK"
     CDS             complement(276803..277450)
                     /codon_start=1
                     /gene="infC"
                     /locus_tag="ANT_02480"
                     /product="translation initiation factor IF-3"
                     /protein_id="BAJ62282.1"
                     /transl_table=11
                     /translation="MFKRVIYIYLLKDGEKPISTQTFRVNEMIRVPEVRLIGPGGENL
                     GVVPIQEALRIARDAELDLVEVAPGATPPVCRVMDFGKFLYERAKKEREAKKAQTRIE
                     VKEIRLRPKTNEHHRGFKTRDARRWLLEGNKVKVTVRFRGREITYPELALEDLREIAE
                     ELSDIATIEQAPVLEGKVMTMVLSPAKPGKKKGESQPKAASSTSETPAAEPQQQS"
     CDS             277612..278112
                     /codon_start=1
                     /EC_number="1.15.1.1"
                     /locus_tag="ANT_02490"
                     /product="putative nickel-containing superoxide dismutase"
                     /protein_id="BAJ62283.1"
                     /transl_table=11
                     /translation="MLYQLLNQWDETFGLDEARAHCDIPCGIYDPHLAQMAALTVIRM
                     VDLMEDLVKGEIKETMTFHNSLTRYILIKEEHAELCKREIRVIFGDFIKKEHVEKYPE
                     LPTLFHKIMQAGSKARQSASREAGLELLALVNRFAEIFWEIKGIPTKRVKAPYKPEEE
                     IVYPVL"
     CDS             278109..278411
                     /codon_start=1
                     /locus_tag="ANT_02500"
                     /product="hypothetical protein"
                     /protein_id="BAJ62284.1"
                     /transl_table=11
                     /translation="MILKFLRVRGASLAPLLKDGDFVLASRLPLWFRPPRTGEIVVFT
                     HPAYGRLIKRVAQILPNGSLIVRGTDIDSVDSRTFGAVQPHQVEGVVIARIARPER"
     CDS             complement(278460..279245)
                     /codon_start=1
                     /locus_tag="ANT_02510"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62285.1"
                     /transl_table=11
                     /translation="MDTSMIQVQNLSVELGNQPILREVTFSVQRGEILGILGPNGAGK
                     TTLIRALSGILPPAAGQVQVLGRAVHRLTESQRARLIAVVPQARHLPPAFTGREVVQL
                     GRTPYLNWLGNLSAHDHACVQRALERASALELADRLVGELSGGEQQRLLLARALAQET
                     PILLMDEPTTHLDLHYQISLLETVRHLVDEEGMTVVMALHDLNLIGRYADRLGLLVEG
                     RLIALGTPEEILTPDLLSPVYRVPLQRLSSGDGGRPIILPTVL"
     CDS             complement(279258..280280)
                     /codon_start=1
                     /locus_tag="ANT_02520"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62286.1"
                     /transl_table=11
                     /translation="MKHTARPLLFSIPPLFLSLLLSVAVGSVFIPPATLFHLLGVRLA
                     GGTIPAEWQSFAVIVFDLRLPRTALMLLTGAALGGSGAAFQGLFRNPLADPYLIGVAS
                     GAGLGAVLTLTGGLPRSLAGYFTVPVAAFIGALITVAVVYSLARVGRTVPTTHLILAG
                     VAVSSFTSALTSFLMLTSTGELRRALVWLLGGASIGGWRPVLGALPYIVVGLGVLCLS
                     GHALNVFQFGEEQARQLGLPVERVRLIIVAAASLATAAAVAYAGIIGFVGLIVPHLMR
                     FFFGADYRHVIPLSVLGGATLLLLADVLARVVMAPQELPVGMITALSGAPFFLWVLQR
                     TRQQVY"
     CDS             complement(280294..281310)
                     /codon_start=1
                     /locus_tag="ANT_02530"
                     /product="putative ABC transporter substrate binding
                     protein precursor"
                     /protein_id="BAJ62287.1"
                     /transl_table=11
                     /translation="MKRFQSLLLVLALFLVSLSACAPAATPTPTPTLAPTATAVATAT
                     IAPTPTFTVTVAPTIEVPDGMGGTLTLEAPAQKIISLAPSNTELLFAVGAGSQVIARE
                     EFSNYPQEAQALPSVGGSMGKYDTEKMVSLQPDLVLASPLTAPETLQALKDLGFTLVV
                     VPNPITLEDMYANIELVGKITGHENEAQELVASLKDRQQKILAVVAKASSKPKVFYEL
                     DASQDPAKPWTSGPGTFIDQLITLAGGVNVGASLQGEWAQISLEELLVQNPDVILLGD
                     ANWGVTPESVAQRTGWEKLDAVKNGKVFPINDDLISRPGPRQIDGLAELVRLLHPELA
                     SQVP"
     misc_binding    complement(281403..281613)
                     /bound_moiety="cobalamin"
                     /note="Cobalamin riboswitch as predicted by Rfam score:
                     38.24"
     CDS             281730..282755
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="holB"
                     /locus_tag="ANT_02540"
                     /product="putative DNA polymerase III delta' subunit"
                     /protein_id="BAJ62288.1"
                     /transl_table=11
                     /translation="MTWEISGHDWAVDLLKGHIQRGEVRHAYLFSGAAGIGKRTLALR
                     FAQALNCPTPLAPGEPCRTCRVCRQIEQMSHVDLSVVQSEGEGMVLKVDQARELQQTL
                     ALLPRELPYRVALLLRFHEANASAQNALLKTLEEPPARAILLITATSPEELLPTIVSR
                     CEVLRLRPLAPEACAQVLIKRGVPAEEAQWLAHLSGGRPGYALNLHAQPDLLEARRRT
                     LEDLLHLLGAPRRERFAYAERLTASRGKERERLLQTLPLWLSFWRDVMICASGSGLSL
                     THLDFAEQIQRVAEQVGLARAAFVTRRLEEHLQRLESNPNMRLLVEMSLLEMPRLAEE
                     VSAAPRE"
     CDS             complement(282733..283134)
                     /codon_start=1
                     /locus_tag="ANT_02550"
                     /product="hypothetical protein"
                     /protein_id="BAJ62289.1"
                     /transl_table=11
                     /translation="MSDWFLRAFRKTPPRDFRQQLYAHLEAEERRLALLWRSTAAVLL
                     ILIALSPTFLNAPSRSAFVPSRTSPSQAESTITSTVPEWEQELPAGWVYYPPGEIEAF
                     GPMDYRAEQKRRASPPETPMFIAMVIPGERR"
     CDS             complement(283131..283664)
                     /codon_start=1
                     /locus_tag="ANT_02560"
                     /product="RNA polymerase ECF-type sigma factor"
                     /protein_id="BAJ62290.1"
                     /transl_table=11
                     /translation="MQELELTQSAQAQALTLDWESVYTELLPRVYNYFRYRGLEDEVA
                     EDLTAQTFEKAWRKRASYRHDLAAFSTWVLRIAHNVAMDYHRTHGRQVSLEEMEVHGG
                     EAHPEESMMARDEILRLRRLLAQLPPREQELVALKYGSGLTNRTIAQMTGLSESNVGT
                     ILHRVVQMLRAQLKGEE"
     CDS             283805..284143
                     /codon_start=1
                     /locus_tag="ANT_02570"
                     /product="hypothetical protein"
                     /protein_id="BAJ62291.1"
                     /transl_table=11
                     /translation="MYMILLVLDDPNLLDEVLQAWHDAGVFPLSVIESTGIHRRKKRV
                     PMRYVFDEGVELEGHVTLYGIAPSLEKVQTCLKACEEITGDLDLPSTGVFAAWQIEAF
                     HGLSEEDTLP"
     CDS             284140..285123
                     /codon_start=1
                     /locus_tag="ANT_02580"
                     /product="putative sodium/calcium exchanger membrane
                     protein"
                     /protein_id="BAJ62292.1"
                     /transl_table=11
                     /translation="MMWIQFVITSAVIVLAAIKLAEYGDVIALRTRLGGLFIGTILIA
                     AATSLPEVLTTLSAVRQAFPNLAAGNLLGSNTFNMFLLAVLDVLARNERVLRKVALKH
                     ALSGSLAIFSIGLVLFFMIADLPLKIGWVGVDSLLIMLAYFAAMYLIQASNVGDVPGQ
                     IEIPEGTPSLAVALLGFGIAAGALIYVTPFMVSASAEIAEVTGLGTTFVGSTLVAAVT
                     SLPEMVTTLAAMRLGAYDMAIGNLFGSNLFNMFALGLTDVFYTPGRFLAVIDPSFLLV
                     GMLGLLMTGMGLIGNLARLRRRIWFIEADALALAVLYLGGMYLLYLRGISP"
     CDS             285228..285815
                     /codon_start=1
                     /locus_tag="ANT_02590"
                     /product="MarR family transcriptional protein"
                     /protein_id="BAJ62293.1"
                     /transl_table=11
                     /translation="MPSRSSQEILAYLREYVRRYSPVDESEYPTGGLEIATFIRILFH
                     IIKDLEETHVDDLELSGPRVNLLFRLLWEEERGNSQGLTPSELSHNQHVTRNTISALL
                     NGLEEQGLIVRELDKEDRRLFRIKLTDKARQTLYRIIPERLVFIRALVSGLSVDEQQQ
                     LVALLAKLFDSIHEHRCPQGEVAVRDDGSSPLMED"
     CDS             285821..287743
                     /codon_start=1
                     /locus_tag="ANT_02600"
                     /product="putative ABC transporter"
                     /protein_id="BAJ62294.1"
                     /transl_table=11
                     /translation="MNMRRPHSPGGAGTPPMSMKGLSRSFSLLKNYRGVAFLAYFSLF
                     ISTAAMLMVPQITQNIIDAITHGLMAQKIAEIPAAFQSMALQKLGWTAEQFARYRDGG
                     VQAVIWSGVLIVLFAIARGLFAFSQGYNAERVSQGVAFDLRNRLFEKIQRLSFSYHDQ
                     NQTGQLMVRATDDVDKVRLFLGQGLLIALQAVVLLVAALIILSATNYRLMLTILPILP
                     VAMAVFFIFSRIAQPLFLQVQQKLSRLNTILQENLAGIKVIKAFVQEPVQKQRFNQAA
                     EDLMSQQIKVSRTFSFLFPFVFLIANLGQALIQYAGGRQIIEGTLSIGEWQKFSMYLF
                     YVFFPLGQLGFVINQLAQASASANRIYEILDAESEVKNKPDAIELPPIQGRVEFRNVT
                     FRYFGSNEPALDEISFIAEPGQTIALLGATGSGKSTIINLIPRFYDVTSGSVRIDGYD
                     VRDVTIESLRRQIGIVLQDTTLFTGTIRENIAFGKPEATQEEIEAAAKAALAHDFIMS
                     FPEGYETRVGERGTTLSGGQKQRIAIARALLLNPRILILDDSTSSVDTVTEYQIQQAL
                     NRLMEGRTSFVIAQRISTVRNADQILVLDRGKIVARGRHEDLLEESPIYAEIYHSQLI
                     EDAPAVAALSGASAAE"
     CDS             287763..289748
                     /codon_start=1
                     /locus_tag="ANT_02610"
                     /product="putative ABC transporter"
                     /protein_id="BAJ62295.1"
                     /transl_table=11
                     /translation="MGMGRGPGGPMGMLAQETSKPVNPSVTLGRLFREFKPYTAILLL
                     VLVMILANAWVQVISPDLTGQIVDCYLAPALAQQVQSQSGVPAALTGGTARLSDSGQN
                     NCWYTKNPGGTKEEILRGLGGLILLITGLFVGGAIIGGLQFFLMSWAGQHVLKDLRVR
                     VFDHLHNLSLKFFNENEAGNLMSRITNDMETLQQALNFALVQTASGLVLLVWVAITML
                     NKSVPYALVGMAMVPFMILATNWFSSRARQAFRVARKEIGRVSANLEESISGVREVQA
                     FSREEQNIQAFRESSASYRDANIRAVAYTAALSPTLEALGYLAMALVTVVGGVYILNG
                     KDFFGTSLSLGLVITFMGYVQRFNQPIQQISTLWANIQSAIAGAERIFGLLDTQPDVV
                     DAPDAIEMPTIQGRVEFDHVHAEYVEGVPVLEDVSFTAEPGQTIAIVGPTGAGKTTII
                     NLIPRFYDVKQGQIRIDGVDISRVRADSLRRQIGIVLQDTFLFSDTVMNNIRFGKPDA
                     SDEEVIAAAQLAHADNFIRRLPQGYQTILGEHGAGLSQGQRQLIAIARAALVNPRILI
                     LDEATSSVDTRTERQIQIALENLLRGRTSFVIAHRLSTIRNADQILVIENGRIVERGR
                     HEELLAKRGAYYTLYMKQFVHGEATADSGVSAAPQPA"
     CDS             complement(289909..290373)
                     /codon_start=1
                     /locus_tag="ANT_02620"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62296.1"
                     /transl_table=11
                     /translation="MYAFLLPLHNILRWLLLIAALFAVGRALWGWLARKPWQALDDRA
                     GLIFTTVMDLQVLVGLLLYVAFSPLTQTAFQNFGGAMGNATMRFFAIEHILIMVIALV
                     LAHIGRAQARKASEALSKHRRAAIWFGIALLLVLLAIPWPFSGVPRPLWRWF"
     CDS             290552..291439
                     /codon_start=1
                     /locus_tag="ANT_02630"
                     /product="putative phosphate ABC transporter substrate
                     binding protein precursor"
                     /protein_id="BAJ62297.1"
                     /transl_table=11
                     /translation="MRRALWFFAVIILILFLSSCASRTVQGETLSTEPSYYIQNKGSD
                     TIVNLALRWAEAYQQAHPEVRISVTGGGSGTGIAALIDGTVDIANASRAMKKEEIEAA
                     RAKGIEPVEHVIARDAIAVIVNPSNPVSQLTLEQISLIYQGKINNWREVGGEDRPIVR
                     LSRETNSGTHVYFLEAVVRLGQKDNKALFSPDTLLLPSSEGIITEVRDNPNAIGYDGL
                     GYVTPEVKVLAVAKTADDPYILPSVETVNSGAYPISRDLYMYTQKEVNAAVQAYLDWL
                     LSPEAQKIVLELGFVPVRQ"
     CDS             291455..292351
                     /codon_start=1
                     /gene="pstC"
                     /locus_tag="ANT_02640"
                     /product="putative phosphate ABC transporter permease
                     protein"
                     /protein_id="BAJ62298.1"
                     /transl_table=11
                     /translation="MENTAQRSEWFINLLIKVSGYSSILFVTLILIFLLREGLPALGV
                     TPLSNLFGERWYPIESYFGILPLMFGSLVVTVGALVIAIPFGVGTSVFISEIAPPWVN
                     SVVKPLIEILAGLPSVVLGFLGIQVAAPLFREAFNLPTGLSAFTGAVLLALIATPTIV
                     SITEDALNAVPPAYRQAALALGATKWQTIWGVTVPAARSGILTAVMLGIGRSIGETMA
                     VMMVTGNAPVLPHGLSAIFMPVRTMTATIASEMGEVANGSPHYQVLFFIGIVLFLISL
                     VINVAASWVSLRSRTRAERVLS"
     CDS             292359..293219
                     /codon_start=1
                     /gene="pstA"
                     /locus_tag="ANT_02650"
                     /product="putative phosphate ABC transporter permease
                     protein"
                     /protein_id="BAJ62299.1"
                     /transl_table=11
                     /translation="MERSLISARIQQRIGFSLLGVVTFVTVLPVLLIIGYIILKGMPA
                     ISWEFLTAMPRNGMRDGGILPAIIGTFYLTLGTAIFSVPLGIAAAIYIAEYAPDNFLT
                     RLIRIAIINLAGIPSVVYGLFGLGLFVLFLRLGTSILAASLTLSIMTLPVIISTAEEA
                     LRSVPQAFRTVSISLGATRWQTIWRIVLPQAMPGIITGIILGLERAAGETAPILFTGA
                     AFFLPRLPQSPMDATMALPYHIFVISTSVPGMPIQIQYGTVLVLLVFVLGMNLIATFI
                     RQRARAKRQW"
     CDS             293213..293980
                     /codon_start=1
                     /gene="pstB"
                     /locus_tag="ANT_02660"
                     /product="putative phosphate ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ62300.1"
                     /transl_table=11
                     /translation="MVISMDKIRIEHLSIRYSDGTESLRDINLSIPANQITVLFGPAG
                     GGKSTLLRALNRLNDLADVQEVSGQILFNGINILDPKLNVVELRRKIGMVFSRPVVLP
                     LSIYQNVSYGLELMGERRKSKLDEAVERALRRAALWDEVYDRLHDPANAISGGQQQRL
                     CLARVLALEPEVILLDEPTSALDPVSTARIEGLMQEIKEQYTIVWVPHNVQQAARMAD
                     YAAFFLQGELVEHGVGETLFVKPRDQRTQDYVTGRFG"
     CDS             complement(294047..294421)
                     /codon_start=1
                     /locus_tag="ANT_02670"
                     /product="hypothetical protein"
                     /protein_id="BAJ62301.1"
                     /transl_table=11
                     /translation="MFFVLYVLHDETKLSAVLDAWDEAGVTGVTVLPSTGMGRIIKHG
                     ALREDMPLIPSLQALLKEHEEILNRTLFSIVESREVVQRIVENTEKVVGPLADPNTGI
                     LAVLPVLEVYGLRSREDHEKRP"
     CDS             complement(294426..295643)
                     /codon_start=1
                     /locus_tag="ANT_02680"
                     /product="putative sodium/hydrogen antiporter"
                     /protein_id="BAJ62302.1"
                     /transl_table=11
                     /translation="MPMSPFLQLSITLAIIIFAAKIAGWVSQRFGQPSVFGELLVGVL
                     LGPSLLNLTHLPFITDSHLDEIVRELGEMGVLILMFLAGLELELGEMARNGRVSVLAG
                     LLGVVFPVGLGAAVGFASGMETRSALFLGLALGATSVSISAQTLMELGILRSRVGLGL
                     LGAAVFDDIFVILLLSVMTALVDGASGASAVIMTILRMAGFLVLSVLVGMYVLPFFSR
                     LLARLQISRGNVAMAVVVMLVYAVAAELIGGMAAITGAFLAGMMVGRSGEKRSVENGF
                     AMLGYSFFIPIFFVDVGLRINLTELPLEALWLALIVSLVAVAGKWIGAGLGAKLAGFT
                     WRESMQLGAGMISRGEVGLIVAAIGLSEGLLSREFFSTVVGMVLISTLITPPLLRWVC
                     TLPSPKPKVREVS"
     CDS             295742..297391
                     /codon_start=1
                     /locus_tag="ANT_02690"
                     /product="putative isobutyryl-CoA mutase"
                     /protein_id="BAJ62303.1"
                     /transl_table=11
                     /translation="MTIQEELQRWEDKVLKPLLSKYPERKPEFTTSSGIPLPRLLTEK
                     PVDYLKDLGFPGSYPFTRGIQPTMYRGRFWTMRQYAGFATAEESNRRYRYLLEQGQTG
                     LSVAFDLPTQIGYDADDPMASGEVGKVGVSISSLEDMETLFQGIPLERVSTSMTINAP
                     AAILLAMYIAVAKKQGVDPAKLRGTIQNDILKEYVARGTYIFPPAPSMRLITDIFAYC
                     AKHVPYWNTISISGYHIREAGANAVQEVAFTLANAVAYVNAALQAGLQVDEFAPQLSF
                     FFNAHNNFLEEIAKFRAARRLWAEIMRERFQAQDPRSWMLRFHTQTAGSTLTAQQPEN
                     NIVRVTIQALAAVLGGTQSLHTNSMDEALWLPTEKSVRVALRTQQIIAYESGVADTID
                     PLGGAYVIEYLTDEIVNRAREYLKKIDEMGGAQRAIETGYMQSEIQRSAYEYQRAVEK
                     KEQIVVGVNAFQTEENLTLERLKVDPAIEAAQRERLAALRTRRDNQKVQELLTRLEQA
                     ARTSENLMPLFIESVENYATLGEIVGVLRRVWGEYVPPAWL"
     CDS             297413..297817
                     /codon_start=1
                     /EC_number="5.1.99.1"
                     /locus_tag="ANT_02700"
                     /product="putative methylmalonyl-CoA epimerase"
                     /protein_id="BAJ62304.1"
                     /transl_table=11
                     /translation="MSEIKKINHVAIVVGDIDQALTFWRDALGLELHHVEDVPSQKAV
                     VAFMPVGDSEVELVKPTTDDSGVAKFLAERGGGMHHLCFEVDDLEAKLADLKAKGVRL
                     INETPIELPGRKMAFIHPKSTGGVLVELYQLI"
     CDS             298008..298868
                     /codon_start=1
                     /gene="fdhD"
                     /locus_tag="ANT_02710"
                     /product="putative formate dehydrogenase subunit FdhD"
                     /protein_id="BAJ62305.1"
                     /transl_table=11
                     /translation="MAFLGEQNMAQTSRRVFYWQYQQGEWQALSGEVIAEQAVTLTVN
                     GEEWITLMCTPHQLEALAVGFLYNEGLIQSLEEVAILQPCENEHNVDIWLTHALSKPR
                     RWRRTSGCTGGMTQVDGEEDLRVPFWGQAQVEAEQIIQWMEELYRHQELYHTARGVHA
                     SALSDGERVVVQCEDIGRHNTLDKLSGWVLLNNFSGAQRIVLTTGRISSEMLQKSARL
                     GAGMVVSRTSPTSASVALAERWGITLIGYARRNRLTVYTHLQRLKGAPVDLPLTSGIA
                     FSPSENPPFE"
     CDS             299028..300590
                     /codon_start=1
                     /locus_tag="ANT_02720"
                     /product="putative signaling protein"
                     /protein_id="BAJ62306.1"
                     /transl_table=11
                     /translation="MSAPIPFLLVLFFSTGLSLYLMGIARRSLHVPGAKEFFFLSMAV
                     AFYTAGYALEISQVRLEDVLWAVRFEYLGIPFIPPLILLTTLRLVRPKPIPLWGIALL
                     FVIPLGTLGLALTIPAHSLFYIEPHMVQNPFYTGLTFERGAWYWVNLIYQLLAGVLAP
                     LILLTAALHASPRRRRSFLLMGVGILIPFVVSMAYALELTPRGVDPIPFALACAVSFF
                     ALAILRTGLFDILPRARELALDGVQEGILVLDSENHVVYVNRALCRLMEGQDWQVEFP
                     LPQASPIGEAVHSLLAEGRGQAEVMFSSEQNGMHEYQIQVYPILDAAGKEEGKTVLIR
                     DITETRRLIRTLNQQATVDALTGVYNRRYLIELGETELEKARQMSLPFTVVLMDLDRF
                     KQINDRFGHAVGDHALQEVARCFKAGVRSSDIVGRYGGDEFALILFGATEEQARQVLE
                     RLQNCMERLGLQEQGEPLHISASFGGVTCNGRCYAPLDELLRRADHALYRAKEQGGKA
                     IEWFAGEEEEQE"
     CDS             300667..300927
                     /codon_start=1
                     /locus_tag="ANT_02730"
                     /product="putative glutaredoxin"
                     /protein_id="BAJ62307.1"
                     /transl_table=11
                     /translation="MPEAGKTFPKVIIFTTPTCTYCNAAKRYLRERGVPFKDVDVSRD
                     AAAARDMVRRSGQSGVPVLDIGGKIVVGFDRPKIDQYLGLRK"
     CDS             300954..301229
                     /codon_start=1
                     /gene="groES"
                     /locus_tag="ANT_02740"
                     /note="protein synonym:groES protein"
                     /note="protein synonym:protein Cpn10"
                     /product="10 kDa chaperonin"
                     /protein_id="BAJ62308.1"
                     /transl_table=11
                     /translation="MSALKIQPLGSRVVIKPLEQESKTPSGLYIPETAKEKPQYGVVV
                     AVGDSEDIKLKVNDKVLFAKYSGTEFKLDGQEYLLMECSDVLAKILE"
     CDS             complement(301304..302113)
                     /codon_start=1
                     /locus_tag="ANT_02750"
                     /product="hypothetical protein"
                     /protein_id="BAJ62309.1"
                     /transl_table=11
                     /translation="MKSKPFTFAQIAVLVMLALLTLGGLGWMLHLLLTPPPAEVRLSM
                     TLQPAQMLTPTLPPASSTAESSPSPTPTPSQASCLPANAASLSARVRHVLDGITLEVE
                     INGETRQVRYLGVELPQQSELADALNRQWTENQTVQLIADPAVPPQSEPALYYVLAGG
                     VFVNQALIREGAALPALYPPGIACIEAFLQEEAQARAEQKGVWKDLLAHLPTPAVSIG
                     LTPPACDCNRRYTCADFATRREAQACFDACGDYRNTTLDPDHNGLACEELP"
     CDS             complement(302166..302960)
                     /codon_start=1
                     /locus_tag="ANT_02760"
                     /product="hypothetical protein"
                     /protein_id="BAJ62310.1"
                     /transl_table=11
                     /translation="MDDLDKPIAYGRTAEIFAWGENQVLKLFHAWVGFDAVEYEYRIA
                     RTMQSCGLPVPQVGEIIEYKGRYGITCQRIKGISMTESLARAPWKILRYARRMAELHA
                     RVHAVTHPTDIPPLNPKMARKILQAQSLPARLREKALTRLEKLPEGHDLCHGDFHPDN
                     ILLTPQGEVILDWMDAGTGNPLADLARTSIILKGSIESGQIRHPLLKRLAHLFHRAYL
                     AQYFSLRPGGESEYALWLPIIAAARLSENISELEGWLVAQAERGLS"
     CDS             complement(302961..303527)
                     /codon_start=1
                     /locus_tag="ANT_02770"
                     /product="hypothetical protein"
                     /protein_id="BAJ62311.1"
                     /transl_table=11
                     /translation="MTHTSQPLSTEQRETLLKTLKERFAKHMHRHPGLDWEAVQARIE
                     TYPEKVWSLYEMERTGGEPDVIGVDETTGEILFCDCSPESPAGRRSLCYDRAAWEARK
                     ENKPAGSVMEMAEAMGIELLTKEQYRALQRLGEFDTKTSSWVKTPTSIRQLGGALFCD
                     RRYNTVFVYHNSADSYYASRGFRGLLRI"
     CDS             303707..304393
                     /codon_start=1
                     /gene="maf"
                     /locus_tag="ANT_02780"
                     /product="Maf-like protein"
                     /protein_id="BAJ62312.1"
                     /transl_table=11
                     /translation="MQKPVLILASNSPRRRQLLGLTGREFLVRPSDVDETPLPGETPD
                     AYVLRLAEDKARATAEHAPAEAWVIASDTTVALEGRILGKPEDAAEARAMLTALRDRM
                     HDVYTAVALFHPASGQMLSEVCHTGVHMRAYTDEEIEAYIATGDPMDKAGAYGIQHAG
                     FSCVDALDGCYASVMGLPLCHLERLMRGVGLAAEVDVPEVCQRFLAYDCPVFSSILQD
                     SASGREAFSS"
     CDS             304390..306585
                     /codon_start=1
                     /locus_tag="ANT_02790"
                     /product="putative penicillin-binding protein"
                     /protein_id="BAJ62313.1"
                     /transl_table=11
                     /translation="MKVARSILLALMMILTACSVFSPAPANHTPAPSATLAPPSVKVT
                     SAPDVRGAVEAFLKAWQAEDYEAMYALLAPATQDAVPQENFIKRYKDVAVNLTLQKLD
                     YEILSTLTNVSSAQAAYRVTFHTAVLGDLSREMSMNLELRSDGWRVLWEDGMIMPELR
                     GGNLLALDYRSPSRGSIFDRNGYPLAINTDAVALGIVPGEIPEGMEGAVLAELSRLTG
                     YPPEWIKALYNDNYVNYYIPVGETTRDAFNLRYDVVKDMPGFAWKEYSARYYSDNGIA
                     PHVTGYTLYIPQEQLDAYLRQGYEMNAKIGWAGLEKWGETTLSGQRGVGLYVLDPQGR
                     VLTRLGTRDPLPARSIYTTLDANLQREAQKAINSFNGAVVVLELNTGRVLAMASSPGF
                     DPNLFEPSNINSRALQDVLNNPSNPLVNRAAQSAYPPGSVFKIVTMATALETGLFKPE
                     DTYECGYYFTDLPGYTLTDWTLEKEIPPSGTLTLPEGLMRSCNPWFYHIGLELSRAGV
                     ADKLAEMARAFGLGVPTGIQQIAEETGNIPDPSSDEIAVQMAIGQSQILVTPLQVASM
                     IAAVGNGGTLYRPQVVEKIVDPDGNAEYTFKPEERGKLPVSEETLALLQDTLRQVVVN
                     NRGTAVRAFSGLGIPVSGKTGTAQTGPGLKPHAWFAAYTSAKRENKPDIAVVVIAENA
                     GEGSEIAAPIARRVIEVYFFGQPQRIYPWEAKLNVTRTPTPEVTETPSP"
     CDS             306582..307502
                     /codon_start=1
                     /EC_number="3.6.1.-"
                     /gene="engC"
                     /locus_tag="ANT_02800"
                     /product="GTPase EngC"
                     /protein_id="BAJ62314.1"
                     /transl_table=11
                     /translation="MSDEASLIPGRVIRLQSGFYTVETPQGTWTCKLRGRFKLEQKDG
                     DVISVGDCVQILPLSDGTGVIEVIEPRHSELVRMDPRPRGEYRQILLANIDQIVAVFA
                     CANPEPRLRMLDRFLVIAEKQGIPAVIIANKVDLVGMERARELFGMYPPLGYPVIYTS
                     VRQGVGLDEVRECLRGKITGLAGPSGVGKSSLLNAIQPHLGLAVREVSEASGKGRHTT
                     VVRQLFRLEMGGYVADLPGLRALALWDTQPEELDGYFPELRDRVAQCQFSDCTHTTEP
                     GCAVLAALERGEIHPARYESYLRMRFGGEE"
     CDS             307663..308016
                     /codon_start=1
                     /locus_tag="ANT_02810"
                     /product="hypothetical protein"
                     /protein_id="BAJ62315.1"
                     /transl_table=11
                     /translation="MTKKMRVAYAVVFALILAALTFAYAAANTVPVTYAGDGSSITSG
                     YTVSNVHYVLDTTNPANISQVTFSLDAPANDVRIQLVNGGAWFSCSTAGTSVTCNVSG
                     VTVLAANTLRVVAVQ"
     CDS             308094..310490
                     /codon_start=1
                     /locus_tag="ANT_02820"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62316.1"
                     /transl_table=11
                     /translation="MRKYLLTRRALLIAALSLSALAFLWVLLAPSRFGGAVEYVIVSG
                     DSMEPLFHKGDLVLLRRAPFYEVGDIVVYRYPGIGAVIHRIVDRRLDRFVLKGDHNTW
                     VDGYEPAPDEILGKYWLWLPGMGTIFLQLRSPWALAILVGVGSLIWGLSSMQSKWTER
                     RKKIKARVDDAIMAARQSAGQFDTAVMGAGKWLSGRQEGFLLVMYIIGILALVLGAFA
                     FTRPVSLTAPDNLLYKQTGAYAYTGEVPAGVYDENRVVSGGAIFPKVSCGIEVAFDYQ
                     LQSQHPAQVSGTYQLMAVVNSTTGWRRTILLNEQPVLFSGKTFSAQAPLDVCEVEKMI
                     AQVQEVTGAQTYQYFLSVYPQVKVSGTLGGMTLEETFNEPLSFTVQTDQIYLNAPAKE
                     DANPLQPVKEGALVRMKTVDNTLSIFSMDVPVRTARTLSAVGLAIAALGIGLVLYLLQ
                     QAEGKDEKMLAKLAVGSRLVEVQDPLARGDARVVHLPALSDLLRLAEQREEVVFFHYA
                     APVATYYVRDGDVLYVHRKLGPAAAEGVDESTRQALVRALEKDEFALYFQPSVSLEDG
                     RVVQLESFLRWRHPERGLLMPVQFLPEVERAGMMMQVDLWVLRRACEYLAQWREAGYP
                     LYPVAINLSLQSLATEGFAAQAQAMVAGLGVSPEWLYLEIPENGLDVSPVGAENLRQL
                     REAGFGIVLNAGERFNPEALEAEPVQQIKLGYPVVQKLSAVSEMQDLASRWISQAHER
                     KIRVAAVGVETSQQLGFFRLHACDQAQGYWISPPVAAEDLPGFLAQKRAWVEVSSKPE
                     "
     CDS             310498..310908
                     /codon_start=1
                     /locus_tag="ANT_02830"
                     /product="hypothetical protein"
                     /protein_id="BAJ62317.1"
                     /transl_table=11
                     /translation="MRRLRVLLGVMFVFILLGAVSAVAGANVVPVTRAGMITRTNTPN
                     DFRPPACTANVTSIISGSGTLNGTPGNDLMLGSAVGDTLYGGAGNDCLMGGGGFDWLF
                     GEDGNDYLNGGPGFDLCFGGLGLNTYDVSCEIQW"
     CDS             310925..311407
                     /codon_start=1
                     /locus_tag="ANT_02840"
                     /product="hypothetical protein"
                     /protein_id="BAJ62318.1"
                     /transl_table=11
                     /translation="MQNMSRKMRWAWMALGFLILVGSISAFAAANIVPFTHLGEILRA
                     NTVNDFKPPECAALNLTNIVVGSGTLTGTNQNDLILASPFNDTVNGRNGSECILGGGG
                     DDYLDGRQGNDVILGGPGDDTLIGGTGNDYLIGGPGYDYCEGGGGTDTFDPSCEIQIQ
                     "
     CDS             complement(311444..312841)
                     /codon_start=1
                     /locus_tag="ANT_02850"
                     /product="hypothetical protein"
                     /protein_id="BAJ62319.1"
                     /transl_table=11
                     /translation="MNIRILGAAQTVTGSQHLLEINGARVLLECGLFQGRRADTYTRN
                     RTFPFNPRRLDAVILSHAHIDHSGNLPNLVKQGFEGPIYATPATAELAEIMVRDSAHI
                     QEADAEYLNKKRLRRGEPPIEPLYTRADAEAVSPLFVPVPYNQPFEPAPGVHARFVDA
                     GHILGSAGVILDLEENGTRRRVWFSGDIGREKLPLLKDPVLPENADYLLMECTYGDKP
                     HRDPEAAYAEFREVALRTFERGGKVIIPAFAVGRTQEIVYSLNRMISDGDLPSVPVYV
                     DSPLAVNASEVFMKHLELFDEETRQFIREHRHPALDFPTLTYIRDVEESKALNGLPGP
                     MVIISASGMAETGRILHHLKNNLEDARNTVMIVSWQAPDTLGRRLADREFKVKIFGET
                     YIRRAEVATIGGLSAHAGQDMLLKYALASRRSLRGITLVHGEELAAAALREKIIEAGF
                     SKVEYPQSGTVLPLD"
     CDS             complement(312838..313980)
                     /codon_start=1
                     /EC_number="3.1.13.5"
                     /locus_tag="ANT_02860"
                     /note="protein synonym:RNase D"
                     /product="putative ribonuclease D"
                     /protein_id="BAJ62320.1"
                     /transl_table=11
                     /translation="MHHQDPTAPIWVATPTALRRMMNHLLACEQIAVDTESNGLHAYQ
                     EQICLIQFSVPGADYLVDPLASVNLSGLNEIFSNPGIEKVFHAAEYDILCLKRDFGFT
                     FTHLFDTMIAARILGRSEVGLAALLEEHFGVTLDKRYQRANWARRPLPPAMLNYARLD
                     THYLIDLRNHLAKELAERGLTALAEEDFLRVCETPAAPAESRPPMWWDVAGTTDLPPQ
                     QASLLQALVEFREQQARFANLPPFRVLSNAVLIQIAEANPMTLEDLAEVQGLSYAHLE
                     RYGLGIMEALRRGRTRPAPQPPGYSRPNHQILKRLEMLKRWRKDAGRRMGVESDVILP
                     RDTMHALAQCDVTTPEDIERLMAHLPWRWQTFGKELIQLLVKEKIS"
     CDS             314067..314471
                     /codon_start=1
                     /locus_tag="ANT_02870"
                     /product="hypothetical protein"
                     /protein_id="BAJ62321.1"
                     /transl_table=11
                     /translation="MKQWLKKFRERAEALEKEACVLVQAYRHPRTPWYARALAVLVLA
                     HTFSPIDLIPDFIPVLGVLDDWIITPLGIALVIRLIPPEVMAEARRQVEENGSASPAL
                     RRLGAALVILLWLVVLVWLGRALGLGMKSGGT"
     CDS             complement(314509..315951)
                     /codon_start=1
                     /locus_tag="ANT_02880"
                     /product="hypothetical protein"
                     /protein_id="BAJ62322.1"
                     /transl_table=11
                     /translation="MKIQVMQGVLNPERMSVQDRDCSCDSPSKIPLKDGDCSCDAPAA
                     RGAFQDPVSFVSYALIHSSQFTDTPTQPQPQKISSEFIPVKSTPAFSPNASHLTLYPV
                     LVPVAGASCWKALSAWFHLTDRCNLRCDYCYLPHRPQDMSVETGRAAVHALFRSAQSH
                     AYTGVKIMYAGGEPLLRFPLILELHGYAQQLAEVQPIYLDEVVLSNGTLLTPEMVQAL
                     KTRGIRLMISLDGLGTGHDAQRHFADGKGSFEKVSQAVELALEHGLPPSISITVTGRN
                     AAGLAELVEWVLERGLIFQLNFYRQSLFSQSHADLQLEEQAILAGIQAALKVIEHHLP
                     RFSLLGILDRTTLAYPHTLPCGAGADYLVFTPQGGIAQCQMLLHHPVTTVHDPDPVSH
                     IRADKYHLINPPVDERGECAECSWRYWCGGGCPLETRRVMHSPYHRSPNCRIYQTIFP
                     ELIRLEGLRLLHYASDPQVVRTQWLELQPA"
     CDS             complement(316094..316822)
                     /codon_start=1
                     /locus_tag="ANT_02890"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62323.1"
                     /transl_table=11
                     /translation="MSVSQNEERSYRYLDLVMALFVTVLIVSNIASSAKIVDWGLSIG
                     NIPLAFDAGTLLFPISYIFGDVLTEVYGFRRSRRVIWTGFAMLALSAFIFWVVRNLPG
                     EATWQEYAGQSAYDAILGGMFSGGIVLASLIAYLAGEFSNSIVLARMKVLTQGRFLWM
                     RTIGSTLVGEGVDTLVFILVASLTGVFPWSLFGTLMLTNYLFKVGVEVVMTPLTYQIV
                     NALKRAEREDYYDVHTRFTPFALS"
     CDS             316954..317883
                     /codon_start=1
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /gene="ribF"
                     /locus_tag="ANT_02900"
                     /note="bifunctional protein"
                     /product="riboflavin kinase/FMN adenylyltransferase"
                     /protein_id="BAJ62324.1"
                     /transl_table=11
                     /translation="MKHIRSLDEFPRGRTYLTVGSFDGVHRGHQGLLSALAQAAHQAG
                     AQSAVVTFFPHPVAVLRGLSQPYYLTSPEERARLMGECGIDVVLTLPFTRELAALSAR
                     EFVTLLREKAGMESLWVGYDFALGRNREGNVPALQRLGEELGFTVHVLPPVALEDIPV
                     SSSLIRAALEQGDVVSAARMLGRPYTIEGAVVHGDARGRTLNIPTINISFWAEQRLPA
                     FGVYACRVEVEGLVLDAVANIGIRPTFANPNGEVRLEAHLLDFSGDLYDRTVRLQFVA
                     FLRPERRFESVEALVAQIQQDIQHAREVLTHAA"
     CDS             317873..319306
                     /codon_start=1
                     /locus_tag="ANT_02910"
                     /product="thymidylate synthase complementing protein ThyX
                     family protein"
                     /protein_id="BAJ62325.1"
                     /transl_table=11
                     /translation="MPLNRQVYLLDSMRLPPETIAVAFAKTSRSPQSFREIAAELTDE
                     KSAEFHEKWVVGYGHASVAEHAVLHIAVENVSRLAVECLESNRLASYTEKSTRYQKWD
                     AQAYCLPPELETHPLRALYEDTIGTLFETYQHLLEPVRQVIEQRLPRQDGESDSAYDR
                     RIRSEYVDVCRFALPAAALANVGVTINARALEHALRKMLSHPLAEVRQMGEEIKQVAL
                     ERLPTLIRYVEPVAYLEQTARDFTRRAETLSPVEDADWCRLLSWDAQGENRILAAALY
                     RFGHMPFAQALQVVENAPAEERAHLTEMLLAGRGRHDIPLRELEYAYFTVDVLLDQGA
                     YFELKRHRMMTQTAQRLSALHGYALPKAIVEAGMAETFRLAMRAAHRAYLRLSADLPE
                     VASYVVPNAYNRRVLLHFNLRTALHWLALRSAPNAHFSMRRVAQRVAQELRNVLPALG
                     RYLLVEEGETWQAIEARYFAATAESPE"
     CDS             319452..319820
                     /codon_start=1
                     /locus_tag="ANT_02920"
                     /product="hypothetical protein"
                     /protein_id="BAJ62326.1"
                     /transl_table=11
                     /translation="MCWCTSTTGREGETITLLYTLKRGAPVTSILLDPNLDVDACNAR
                     WVAMAKERPWERVWSDFQGVHTQLLRRVAEFSDEQLFQAGLHPKLGKTPLWRIIAVCA
                     FEHEREHAEGLRVWQKQIKP"
     CDS             319961..320881
                     /codon_start=1
                     /locus_tag="ANT_02930"
                     /product="hypothetical protein"
                     /protein_id="BAJ62327.1"
                     /transl_table=11
                     /translation="MDLNRITSFKSFRQKMGEMWKSIDFSRESVQDYLYVLAGALVQA
                     FAMRLFLIPAQLVSGGISGAAQLINHYTNWPIGLMVFIGNVPLFILGWQHLGGPRFAL
                     RTALSIVAFSFFTDFLGLFLPAEGVVHDLVLNCLYGGVVLGVGLGLVYRGKGTSGGSD
                     ILGRILNERVGISISQAYLATDSAVILSAGFVFAWENALYALVVTYVSGLTAEMVLEG
                     SNVFRTAMIITNRPKEVAERILYDMERGVTILEGRGGYTGAEREVLYCVVTRSEVSQI
                     KSIVKAVDPNAFMVIGQAHEALGEGFRPLQ"
     CDS             320931..321071
                     /codon_start=1
                     /locus_tag="ANT_02940"
                     /product="hypothetical protein"
                     /protein_id="BAJ62328.1"
                     /transl_table=11
                     /translation="MKNSRVFYILDVFQRRENAGFAIPEAMFEFLPLVWAIQLEMSFS
                     GE"
     CDS             321074..322312
                     /codon_start=1
                     /locus_tag="ANT_02950"
                     /product="amidohydrolase family protein"
                     /protein_id="BAJ62329.1"
                     /transl_table=11
                     /translation="MPEKYDLIIRRAQLRRTPAGQWFDIAIANGVIAAIAPHVDGSAA
                     QELDAAGGLVTESFVNTHLHLCKVYTLQMMDEEALKDYHGADMGKAMTAIELAARVKE
                     KYDERWIIQNVRRALVDAARYGNTHIRAFADVDSKAKLEGVKALIRAREEFRGIVDIQ
                     VVAFAQDGMVREPGARELMRQAMELGADVAGGIPWIEYTDADMLQHVREIFDLAVEFN
                     KDVSMLVDDAGDPGLRSIEMMALETIRRGWFGRSLAHHARAMSMYPTPYFQKLAALLK
                     KAQMGVVSDPHTGPLHARVRELLAEGCLVCLGQDDISDAYYPYGRNNMPEVAFLASHL
                     LWFTTASDMETLYDMVTVNAARAIGLKDFALKVGAPAHLVVMEQQNVLEVLRYHEAPR
                     YVISHGKLVDQQAVRNMAGL"
     CDS             322328..324655
                     /codon_start=1
                     /locus_tag="ANT_02960"
                     /product="carbon monoxide dehydrogenase molybdoprotein
                     family protein"
                     /protein_id="BAJ62330.1"
                     /transl_table=11
                     /translation="MTTFIGVPQPRIDAFEKVTGQADFVADLNFGRMLHARVVRSTQG
                     HARLRRVDATRARAVPGVRAVITGEQCPKRIGFAINDHTVIACRKVRYVGEPVAVVVA
                     VSEEIADQAARLVEVEYEPLPVIVHPRDAVAPGAPLIHEDMEEYAHDPVVHPQPGTNI
                     AHRYRLWRGNVEQAFREAHLVVENEYWIPWIAHVQMEPHGAIAQYDGERLTIYTSSQS
                     PFYVRETVAYLLDMSSANVRVQVPYVGGGFGGKSDVTIEPLLALVAYHVPGLPIRLIL
                     TREEMFFGTVNGRGCWGRMKTAVDRDGKLLAHQSELYFGSGGYADYSIWISQGGGHNA
                     TGPYYIPNLDLRSHAVYTNTPPTGAYRGYGHPEVHWMMESQMDQIARQLGMDAVELRL
                     RNLLRPGLQNAIGQTMKEYNGRADACLLAVRDALGKETTPTVPGRIRAQGIACFMKSP
                     VMKTNAQSGAVIKFNEDGTATLFTGSIEMGQGVNTILTQIAAETLHMPIEQVQYAPVV
                     DTEYSPQEWQTVASHSTWAVGNAVRMAAEDALEQLRHAAALVFDVPPDEVVADDGCLY
                     PQGKPEKALPYSRFAVGYTRPDGSALNPPVIGRGMFVPRGLTFPDPATGQGNMAASWT
                     FGCQGVDLEIDPDTGQIHVLRMASAQDAGRIINPVTARGQVEGAMTMALGAALMEKLK
                     FAPDGRILNAGFVDYRILCAADVPEMEVIFIETPDATGPYGARGLGEHGIVAIPPAVA
                     NAVARALEVEFYELPVTPDQVLAALETRRKGGVSA"
     CDS             324711..325745
                     /codon_start=1
                     /locus_tag="ANT_02970"
                     /product="putative basic membrane lipoprotein"
                     /protein_id="BAJ62331.1"
                     /transl_table=11
                     /translation="MEENMKFNRFVSLLVLVLFVASLLAACAPAATPTAAPKSEKLKV
                     FGAFATPIEEPWDGVIHAALIKAREEGKIDYEYTENIGYSGDMERILREVAEQKKPDI
                     IFGDAFGNEEAVRRVAKDFPQIAFVFGSGLGPSDPNLSVFDNWIHEPAYLCGMLAGGL
                     TKTGTIGVVGGYPVPEVNRLVNAFIRGAKEVNPNVKVLVTFINSWFDPAAAKEAALAQ
                     IDAGADVLYAERFGVIEAAKEKGLWVFGNMSDQNELAPDLVVSSPVWNMTPTVEYVLS
                     QVKAGVYTAQDLKDFSMVAKGGASLAPFHNTESKLPPDLVAKVREREQQIKEGLFRVD
                     IDENQPQAVN"
     CDS             325885..327375
                     /codon_start=1
                     /locus_tag="ANT_02980"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62332.1"
                     /transl_table=11
                     /translation="MQGITKRFGVVEANQNIDFYLKPGEIHALLGENGAGKTTLMRIL
                     YGLYRADEGEIRVAGKVATIHSPKDAIQLGIGMVTQHFTLVPPLSVVENVALGQEGGT
                     TLDLVQMRQRVVDAAKRFGIEVKPDALVRHLSVGERQRVEILKSLYRNARVLILDEPT
                     AVLVPQEVEALFETLNKLRESGMALVFISHKLNEVMELCDRITVLRDGKKIGTVLRGE
                     TNEAELAHMMVGRETFGVVRPAERRGGEVRLRLEKVNALDKKGLPALKNVSLEVRAGE
                     ILGIAGISGNGQSELAQVLSGMLKPVSGTVWVDGRDMTGASPADFAAANIGRVPEDRH
                     SGVVGDLSVAENLVLEHLEEFSRNGMMDYSAVQKFAQQMIEDFQIKARPQDPIRTLSG
                     GNMQKVLLARALAHKPRVLIVAQPTRGLDIGATDYVRGKLLEQREAGTAILMISEDLD
                     EVLALSDRIAVMYEGRIVGVVSGRRATPEVLGMMMSGALEVDYAEA"
     CDS             327362..328414
                     /codon_start=1
                     /locus_tag="ANT_02990"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62333.1"
                     /transl_table=11
                     /translation="MPKLKIERYPAPLWVRPLIPIISIVVTFLLTSLVVLSLNKNPFE
                     AFYYFLIVPLASQSSAIEVLVKSTPLLLTGAAVTFAFSAGYYNIGAEGQLLAGAIAAA
                     GLGMVLQNVPPVLAIPIMIVGGFAAGMAYAAIPALLKTRLDVDEVVTTLLLNTVILFF
                     ISFLLNGVWRSPVSGWPQSPEIAESAIFPRLIPRTRLHLGFLLAWISIGAVWLVFRRT
                     VLGLRMRAVGMGKEAARFAGVKVEQTMLTAALISGGIAGLAGVSEVAGIHYHLIEAIS
                     NNFGYTGIIVAMLGALNPLGVSLAALFLGLLDTGAQTVSRAMGIPIYLGNIVQSALLL
                     ITLAALVLQNYRIRRE"
     CDS             328418..329329
                     /codon_start=1
                     /locus_tag="ANT_03000"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62334.1"
                     /transl_table=11
                     /translation="MEAFLVGLIAATLRVATPLILGTLGELFSERSGILNLGIEGTMF
                     LGAFTGFAVAYTTGSLWLGLLAAVIAGVLAGLLMGLLTVTLGVNQHVSGLGITLLTTG
                     ISLFLYRVIFGERSVQPSIATFTKVSPFGDTPILGPIFEQYLLTYIAIALVPLVWWVL
                     YRTSFGLHLRAVGENPEAADAAGINVFRIRYLALAIGGGLMAAGGAFLSLAQLGSFIF
                     GIIAGRGWVCIALIIFANWLPSRVLWGALLFGGVSALQLRLQSTGAQLPYELFLALPY
                     LVTILALVLAGRSATAPAALLKPYRRE"
     CDS             complement(329443..329958)
                     /codon_start=1
                     /gene="trxA"
                     /locus_tag="ANT_03010"
                     /product="thioredoxin"
                     /protein_id="BAJ62335.1"
                     /transl_table=11
                     /translation="MDRVELLRKIQKHPRPVIVEFWAPWCTPCKVMEPSLKQVAKEFQ
                     GKVDLWRYNADEHPELVRDLRIMGIPTVLGFNAQGEIFRRTGALPLAGVREAFTAALE
                     GKKPEKHLSALERALRAGTGIVLLLVGWSMQMNWVFLTLGGIVLFSAVYDRCPIVQAI
                     KPRLEALFKKG"
     CDS             complement(329969..330175)
                     /codon_start=1
                     /locus_tag="ANT_03020"
                     /product="hypothetical protein"
                     /protein_id="BAJ62336.1"
                     /transl_table=11
                     /translation="MSNWINESGLDRVIRVILGLVLLVLGWGGIVSGTLGVVFKILGF
                     LPLLTGLIGFCPAYALFKFRTNKA"
     CDS             330371..331498
                     /codon_start=1
                     /locus_tag="ANT_03030"
                     /product="dihydroorotate dehydrogenase family protein"
                     /protein_id="BAJ62337.1"
                     /transl_table=11
                     /translation="MVDLSLHLWGHTFRNPVIPAAGPNVGSGRMVRRAAEGGAGGLLT
                     KTISSRAAPVPHPNMVRFGTAGMLNTELWSELPPEVWFQKEYNEALAAAREYGLPLIA
                     SVGYSAEDLAVLAPRLQDKGVDIIEFSVHYLDAERLIETAQLLREVVTLPIIAKLSPH
                     LGDLGAFVRLLDPYVDGYACINSFGPTLSIDIEHGGEPYLGSKFGYGWMSGAPLKPLA
                     VRSVFEAARVTDKPIIGVGGITRGEDVIEFLMAGASMVGVCTAAILRGPDIYGKIAAE
                     TARWLEEHGYSSLQEVKGKFLEKYRNGQRVVTSLEQVAVVDEARCKGCGVCERVCQYD
                     ALRAPQKQVAQVDAELCAACGLCVSVCPHDALSLRLRWEKN"
     CDS             331678..332592
                     /codon_start=1
                     /EC_number="2.1.1.113"
                     /locus_tag="ANT_03040"
                     /product="putative N-4 cytosine-specific
                     methyltransferase"
                     /protein_id="BAJ62338.1"
                     /transl_table=11
                     /translation="MNIIYTHSCERMPELEEGAVSLTVTSPPYWNAIDYDRHAEDDSQ
                     YYRTRQYANGYQDYHEYLDWLVRIFREVYRVTKPGGFCAVVIGTVLLEGKLYPVPFDM
                     TSQFVQIGWEFYQDIIWHKCTAGVKRAGVSIQKPYPGYFYPNIMNEYILIFRKPGPRI
                     YENRSQEEKEQAQYSIDRLFTMDIANNIWHIAPVPPKIIPHPAPFPEEIPFRLIQLYS
                     YPGDLILDPFVGSGQTLKVARHLGRPYVGYEVIEKYVQLAKQRIPEPLDLRQEQLIAV
                     FDKVSIGEPIKGKANGKVHQPSLLKEEK"
     CDS             332595..333773
                     /codon_start=1
                     /locus_tag="ANT_03050"
                     /product="hypothetical protein"
                     /protein_id="BAJ62339.1"
                     /transl_table=11
                     /translation="MELQELVIAIAEVGKEHPSRPLLHEVEIFRHFFVQGEIDWKNLD
                     QRDGSLTRRETLTRFLLLCAVLDQGPDIEGIRRMLIETTNELYRKEIRFLHKPISFFS
                     EIGVAIDEILARHEAIKNIRARVWAEANRSNPARYNLFMDNASQVLGYAIFRWGVPLS
                     LPYLLEKDRQKENLSGENALLDYLESYDSAERMTQQLKDHSRYGLGKAIGDKASHLFG
                     KWLVSSFRLTRQSGDGWDDFSYEVPYDSNAGRVLWRTGFLLHWADEEDFKKQLVLQSG
                     KGKGNTTYLRVTNLRGMKAVKNVGDNLKEPYEEICLRHLKTHKKRPKNFQIQQIQHIY
                     LWQNRGRGLHAAHFDDGLIFIGTHYCFNHDQPDCQQCPINTLCMGYSSERRLIRDFRT
                     "
     CDS             complement(333825..334172)
                     /codon_start=1
                     /locus_tag="ANT_03060"
                     /product="hypothetical protein"
                     /protein_id="BAJ62340.1"
                     /transl_table=11
                     /translation="MNAQIFRTHKLRFFCSLLAFLLLLTFSATFSTQSQPAKAEALSA
                     EPLAGTGYEITWWTVEGGGLTWSQNGGYSLGGTIGQPDAGVLQGNTYTLKGGFWAGAR
                     IQRNVYLPYIRKN"
     CDS             complement(334169..335650)
                     /codon_start=1
                     /locus_tag="ANT_03070"
                     /product="hypothetical protein"
                     /protein_id="BAJ62341.1"
                     /transl_table=11
                     /translation="MGKSNAHPHSMGSTQKNWRCEMKQSFNFLGMLATILALALTAGL
                     TQAQANPAQLQAAIGDGFTYQGMLNKGGNPYSGVCDFQFSLWNASNDGTQIGTTQEKT
                     SVQVTNGIFTISNLDFGAYAFPGDERWLEIAVKCTGDAGFTTLTPRQPLTAVPYALYS
                     KNSWSTSGNKGTVPGTHFLGTTDFQPLELRVNNQRALLIQPKTSSTLNIIAGHAANTI
                     SSNVVGATIAGGGGNDVWKNEIKSSGDFATISGGKINTADGNGATISGGTANTANGQA
                     VVIGGGNINTAVGYAATVSGGGNNQALKDGDTVGGGMNNTANGSNSVISGGAYNTTTA
                     VMAAIPGGYRAKADHFGQMAFASGSFSTTGDAQTSTFVMRNSSTGSSSITLYLDGTSA
                     LLTIADGRTLTFDILIAGRSNTGESAGYHIQGIIENVDKSLSFIGTPTITILGEDDPA
                     WNVRVIADDVNDTLNIQCKGNDEVVRWVATVRTAEVFWGSDTP"
     CDS             335897..336535
                     /codon_start=1
                     /locus_tag="ANT_03080"
                     /product="hypothetical protein"
                     /protein_id="BAJ62342.1"
                     /transl_table=11
                     /translation="MAKFLMYVGVALASSGKRPTAFTALDARGHSLAIGTGTLADALA
                     FAAGAGSALLVLTPPLRARTLRSAEPAPESPSLLPETSEESTPPLAATLQRVGYVNFS
                     AEDESLRQWLETDAESAFERWLGHPPLPGNTLEGRIQRQLLLADLDCDVPDAMEFFEE
                     ITRFKLLRGQLPYEKILSLAELNAYAAAAIARLCDQSPDRVQHIQPRMFLPL"
     CDS             336584..337591
                     /codon_start=1
                     /locus_tag="ANT_03090"
                     /product="putative prenyltransferase"
                     /protein_id="BAJ62343.1"
                     /transl_table=11
                     /translation="MSVNVGMWMKALQVIPRITREEWEKLDVISRWLISTRAAVLIMT
                     FTSATIGGLLAARDGKFNLVLWLLVALGLVLAHALNNLLNDLTDYERGIDENNYFRAQ
                     YGPHPLQQGLMTRKQLLTYAAVTGALALAAGLYLVFLRGWLALVLLALGAFFVFFYTY
                     PLKYIGLGEAAVLLVWGPLMIGGSYFVITGEWSWMAVLAGLPYALGPTTVIYGKHIDK
                     LDADRQKGVRTLPVIIGEKAARASVRVMIVLMYALVAVLVLVGYFTPAMLIVFFALRY
                     LPETWKMLGSPRPSEPPAERKDIWPLWFVAANFYHNRVYGMLFLLGLIADAILRNILL
                     K"
     CDS             complement(337642..338427)
                     /codon_start=1
                     /locus_tag="ANT_03100"
                     /product="hypothetical protein"
                     /protein_id="BAJ62344.1"
                     /transl_table=11
                     /translation="MKIILGTSLFVQISGVGKVVPLTPSQLPVGARHGWHLSIPAGDG
                     RAYRLAQIEQGPFRTRTEFPLIPPVEWTVWARVSAGDLPGTWGFGFWNEPFSAGLGLR
                     GMRRALPVFPNAAWCFYASPPSFLSLRDDQPGRGWMGMVFSSPTTSPLAWLPALPLLA
                     GLLFPATRRGLRRLARRWIHDQAVILPVDVTAWHRYTLRWEHQRVSFEVDGTWSAALP
                     FAPRGKMKALAWIDNQMAYFDLQGNLGSGILPNPAAWLEIAEE"
     CDS             338544..339389
                     /codon_start=1
                     /locus_tag="ANT_03110"
                     /product="hypothetical protein"
                     /protein_id="BAJ62345.1"
                     /transl_table=11
                     /translation="MQEIVPQVYIETAYPGVTLGAINSPHGLILIDAPFRPEDARSWR
                     SALISLGGGVDRLLINLDAHFDRTIGVRNMECTVLAHERMAEVFRNRPMTFKAQGSET
                     GAEWEQYNGLGSVRWSPPEITFSDQLTIHWDDHPIRLEYHPGCSTGAIWAVLTESRVI
                     FLGDAVVLNQPPFLASANLPLWIEQLESLLQGEYQDYLLVSGRGGLVAHQQVRAQIHF
                     LRTVQEKLDALAKQNAPVSETEALVPALLEPFNPLPLYRQRLRYGLTHYYSRHYQSKG
                     EEVEE"
     CDS             339392..340423
                     /codon_start=1
                     /locus_tag="ANT_03120"
                     /product="L-asparaginase II family protein"
                     /protein_id="BAJ62346.1"
                     /transl_table=11
                     /translation="MNPYQPLVELTRGPLVESIHFGALAVVDSTGNLIASVGDPHHVA
                     NLRSSAKPFQALPLVESGVVDAFGITPRELAIICASHSGTEDHVAVLRGLQAKIGVSE
                     DNLLCGTHYPLHEPTAQALRARGEAPTQNRHNCSGKHTGMLAGCQFNRFALEDYLNTE
                     HPWQKRILQTFAQMVSLAPEDVPIGIDGCSAPTFAAPLQNAAHAYALLADPASLPEPR
                     RSALNRIFHAMTTYPDMVAGPERFDTVLMQVTGGKVVAKGGAEGYQGMGVRPGALGPG
                     SPGLGIAIKISDGDTGGRAVTLAAVQVLRLLGVLTAEELAGLTKFDRRPLYNWRKLEI
                     GEIRPCFRW"
     CDS             complement(340583..341740)
                     /codon_start=1
                     /EC_number="2.6.1.1"
                     /locus_tag="ANT_03130"
                     /product="putative aspartate aminotransferase"
                     /protein_id="BAJ62347.1"
                     /transl_table=11
                     /translation="MRETFLNHRIRGLRPSAIRKFFDIAATMQDVISLGIGEPDFDTP
                     APIVQAGIRSLQAGYTHYTSNSGVMELRQALAEHLERLYGVHYDPTEIIITVGGSEAL
                     YLAASATLDPGDEVIIPTPCFVSYQAQVHMAGGVPVEVPCRMENNFEVDPQDVAAAIT
                     PRTKAILLGFPSNPTGAIARRETLLEIARLAEEHDLLVMSDEIYDRLVYDGQHVCFPS
                     LPGMWKRTILLGGFSKDYAMTGWRIGYAAAPHAILQGLLRLHQYTVMCASTTAQMAAI
                     EALRNGEEYVQQMVAEYDRRRRLIVKGLNEIGLPTFEPKGAFYAFPKVSVTGLDDETF
                     ASRLLTEERVAVIPGSGFGAGGEGHVRISYATAYEKLEEALRRMERFVNRL"
     CDS             complement(341757..341975)
                     /codon_start=1
                     /locus_tag="ANT_03140"
                     /product="hypothetical protein"
                     /protein_id="BAJ62348.1"
                     /transl_table=11
                     /translation="MPGVRVECRSEYTYPQRPVALWFDQNRVTVAEAEHESRTPRGKL
                     FRVRLEDGRRFELLYEELTDEWSVREIA"
     CDS             complement(341980..342990)
                     /codon_start=1
                     /locus_tag="ANT_03150"
                     /product="putative nucleotidyl transferase"
                     /protein_id="BAJ62349.1"
                     /transl_table=11
                     /translation="MSKPTLKIAIPMAGLGTRMRPHTWSKPKPLVSLAGKTVLDYVLE
                     QFSTIPPEFEVEYIFIVGPQGDQIREYMEEHHPQKTVHYVLQAEMRGQSHALYLAREY
                     LNGPMLMAFSDTLVETDFSFLKENARDAIAWVKPVPDPRRFGVVELDEQGWVRRLIEK
                     PSDMRNNLVIVGFYYFPSGEELIQAIEEQMHRNVLLKNEYFLADAVNILLERGTRMTT
                     HQVEVWLDAGTPESLLETNRYLLDHGRDNSAEAARPGVTIVPPVFIHPSAHIEASVIG
                     PHVSIGAECTLKRAIVSNSIIDEGSEIEDIAIEGSLLGRHVSLHGTPLHLNLGDQSWA
                     VR"
     CDS             complement(343099..344790)
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /locus_tag="ANT_03160"
                     /product="putative M3 family peptidase"
                     /protein_id="BAJ62350.1"
                     /transl_table=11
                     /translation="MFDQLPTNPAELRNWTWADFAPYYDDLKQRPLTQATLTEWLKDW
                     TSIAERVDELYNRLYVAVTVNTADEESRALYMRFLDETYTQSMEAEQALKEKLLHSGL
                     EPEGFEIPLRNLRAEAELFRPENLPLLAEEQKLTKEYDRIVGAQTVQWDGEEKTLTAL
                     TPYLHDPDRALREKVWRLSAERRLADRQALNDLWVQLLELRQKIAANAGAPDYRAYRW
                     KQMLRFDYTPEDSKRFCAAIEEAVVPAARQLREERRKQMGLPALRPWDVDVDPLGRPG
                     LRPFDSVETFEQGISAIFHHIDPVLGERFDTMRRERLLDLDNRKNKAPGGYCTSFAVA
                     RKPFIFMNAVGTQDDVSTLLHEGGHAFHVFESAALPYIQQLSVPMEFAEVASMSMEYL
                     GLPFLTREHGAFYTPEEAQRARWEQFEKAILFWPYMAVVDSFQHWVYENPRLAADPAE
                     CDKTWSNLWRRFMVGVDESGFEDVVATGWHRKLHIFQVPFYYVEYGLAQLGAAQVWLN
                     SLKDRTGAVQAYRKALSLGGTVTLPQLYQTGGARLAFDAETLRRVVDAMLSAMQV"
     CDS             complement(344817..346307)
                     /codon_start=1
                     /EC_number="6.3.5.-"
                     /gene="gatA"
                     /locus_tag="ANT_03170"
                     /note="protein synonym:Asp/Glu-ADT subunit A"
                     /product="aspartyl/glutamyl-tRNA(Asn/Gln)
                     amidotransferase subunit A"
                     /protein_id="BAJ62351.1"
                     /transl_table=11
                     /translation="MSRIPDLSVSELLAGMRRGDFSAVEVTRAFLEVIERLEPSLHTL
                     ITFTPELALRMAEDADRRYRAWRRADSPAEEALPPLLGIPLMVKDVLCLKGVPCTCGS
                     RILQDFIPPYTATAVQRLLDAGVVVLGKTNTDEFAMGSSTENSAFGATRNPWNPAHVP
                     GGSSGGSASAVAARMTPAALGSDTGGSIRQPAAYCGVTGIKPTYGRVSRYGLVAYGSS
                     LDTVGVFARSAAETALFFSLMAGHDPLDSTSAREAVSPITLPDEPALKGLRIGVPQEY
                     FIPGMSAEVEQAVRAAIAQLEHLGATVQMVRLPHTEYALPVYYLIAPAEASANLARYD
                     GVRFGLRAPAERLWEMFDRTRGSGFGAEVKRRIMLGTYALSAGYYDAYYAQAQKVRTL
                     IRQDFLDAFQQVDVIACPVAPTPAFRLGEHTDDPLAMYLEDIFTLPANLAGVPGLAFP
                     AGFSAAGLPIGIQLMSAPFREEILFQTAHAYQQVTDWHLRRPPTAP"
     CDS             complement(346309..346599)
                     /codon_start=1
                     /EC_number="6.3.5.-"
                     /gene="gatC"
                     /locus_tag="ANT_03180"
                     /note="protein synonym:Asp/Glu-ADT subunit C"
                     /product="aspartyl/glutamyl-tRNA(Asn/Gln)
                     amidotransferase subunit C"
                     /protein_id="BAJ62352.1"
                     /transl_table=11
                     /translation="MSLTLAEVEHIARLAHLELTEEEKNRFREQLSAILEYAARLQEV
                     DTRSISPTAWTFNAQAPLREDVPAQGLSTAEVLSNAPQVQNDQFRVPPVLEG"
     repeat_region   347171..347179
                     /rpt_type=flanking
     repeat_region   347180..348097
                     /note="Similar to IS5 family"
     repeat_region   347180..347202
                     /note="23bp imperfect inverted repeat"
                     /rpt_type=inverted
     CDS             347222..348061
                     /codon_start=1
                     /locus_tag="ANT_03190"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAJ62353.1"
                     /transl_table=11
                     /translation="MTTRESRYVRVARIAYRLAKQALPMYSHAKSPHHFTLPQLGACV
                     LLMFYLNLSYRDMEEWLLASDAVGKELELPRVPDHTTLQRTYAKIRKADWMRMNETLL
                     EEIGRPEEEGVAADSTGFSPGPASSYYQSRSGKAYRHWAKGVYAVGIVSQFILAMQSG
                     WGPGSDAPYLGYLRRKARRFAKRRAWVLLADSGFDGRTVRPQDLIPPVRRGGNLLAPE
                     RRARSELVSAARLDGLYGQRWKTETVNSVIKRKFGQAIRSRKRSLQNREPIIKGLVYN
                     IHR"
     repeat_region   348075..348097
                     /note="23bp imperfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   348098..348106
                     /rpt_type=flanking
     CDS             complement(348229..348453)
                     /codon_start=1
                     /locus_tag="ANT_03200"
                     /product="hypothetical protein"
                     /protein_id="BAJ62354.1"
                     /transl_table=11
                     /translation="MSTMMKPLAEINQQAIQLLYQELGVVNAVRFLRQFTTGFGDYTR
                     ERASLFAGKSLQEIVHEIEQQKGQSLPHKP"
     CDS             complement(348450..348614)
                     /codon_start=1
                     /locus_tag="ANT_03210"
                     /product="hypothetical protein"
                     /protein_id="BAJ62355.1"
                     /transl_table=11
                     /translation="MGLQPLDALHLALAETGKADYFCTCDDRLLRKSKQIELQVKGVS
                     PVELIQEIEK"
     CDS             complement(348476..348886)
                     /codon_start=1
                     /locus_tag="ANT_03220"
                     /product="hypothetical protein"
                     /protein_id="BAJ62356.1"
                     /transl_table=11
                     /translation="MKIYLDVCAIQRPLDTFDQIRIVLEAEAVLGILSLFERGILELF
                     SSDALVFETEQNPFPLRREHARAVLSKAREHLSLSPEAIQRAKQLTIWVSNLWMHCTW
                     HWRKQEKPIISAPAMTGYCENQNKLSYRSKAFHR"
     tRNA            348968..349045
                     /locus_tag="ANT_t0050"
                     /product="tRNA-Val"
     CDS             complement(349092..349673)
                     /codon_start=1
                     /locus_tag="ANT_03230"
                     /product="putative nitroreductase"
                     /protein_id="BAJ62357.1"
                     /transl_table=11
                     /translation="METLEVIRNRCSLKEQISPREIEPGILYTVLDAARYAASSRNHQ
                     PWRFVVVQGQPAVQALVDAAVTGTNAVIRNAPVVIAVCARPQDDSISNGREYYLFDTG
                     MAVANLLLAATDFGLVTHPMAGFDEAALKRHLHIPEDVRVLMITPLAYPASESYDEAA
                     RERLSQRSRKAFEEVVFFNRWGEIQPEMDAIRA"
     CDS             349898..350032
                     /codon_start=1
                     /locus_tag="ANT_03240"
                     /product="hypothetical protein"
                     /protein_id="BAJ62358.1"
                     /transl_table=11
                     /translation="MKVKKMFSSFSLFILFLIAVLVIILENPLPVWAVRMSAGMNEED
                     "
     CDS             350112..351779
                     /codon_start=1
                     /EC_number="4.2.1.9"
                     /gene="ilvD"
                     /locus_tag="ANT_03250"
                     /note="protein synonym:DAD"
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="BAJ62359.1"
                     /transl_table=11
                     /translation="MRSNRIKTALEFAPHRALLKATGVTDADLHKPFIAVVNSYVDIV
                     PGHVHLQAFGKRIKDAIRAAGGVPFEFNTIAVDDGIAMGHEGMKFSLPSRELIADSIE
                     TMLSAHPFDGMVCIPNCDKIVPGMLMAAVRLNLPAIFISGGSMPAGRTPDGEVIDLIS
                     VFEGVGAVQAGRMDRRRLKVLEDYACPSCGSCSGMFTANSMNCLMEALGIALPYNGSA
                     LANTPEREALAERAARLILDLVEKDLRPRDIITQEALDDAFALDMAMGGSTNTILHAL
                     AIAHEAGVDYSLERINHISAQVRHLCKVSPAGKWHMEDVHRAGGIPAILNEIQRATGM
                     LHLERPTVAGVSMGDALRGAVIRDEKVIRPWEKAHSQDGGLAVLFGNLAPRGAVVKTG
                     GVAPAMRRFSGPARIYESQDDALRGILAGEVQPGEVVVIRYEGPKGGPGMQEMLSPTS
                     AIMGMGLGDKVALITDGRFSGGTRGACIGHVSPEAAAGGPIAALQPGDVVEIDLDARR
                     LDVCLPQEEIERRLAALPPFQPRTTSRWLRRYQHFVTSADRGAVLEF"
     CDS             351798..353519
                     /codon_start=1
                     /EC_number="2.2.1.6"
                     /gene="ilvB"
                     /locus_tag="ANT_03260"
                     /note="protein synonym:acetohydroxy acid synthase large
                     subunit"
                     /product="acetolactate synthase, large subunit"
                     /protein_id="BAJ62360.1"
                     /transl_table=11
                     /translation="MMKRTGAQIVWETLMREGVEVVFGYPGGANLPIYDAMLDYPVRH
                     VLVRHEQGAAHMADGYARASGKVGVAMATSGPGATNLVTGIATAMMDSSPVVFLTGQV
                     VSKFIGYDAFQETDVTGITLPITKHNYLVTRVEELGDTLREAFYIARTGRPGPVLVDI
                     AKDAQQNSTDWEYSDRPIQLRGYRPNRHPLSKQVEQALEMLSTARKPLILAGRGVLLS
                     GAMRELREFAERAHVPVAVTLLGIGSFPASHPLSLGMMGMHGEAWVNQAIQESDLLLA
                     FGMRFDDRVTGNLKTYAPNARKIHLDIDPAEINKNVRVDVGIVGDLRESLQTFLEHLP
                     QMDHSDWVEHINTLKGESAVRDIQYLPPDGHLYAAHVIHDLWRYTGGNALVVTDVGQH
                     QMWAAQYYRHDQPFQWITSGGLGTMGFGLPAAIGARIARPDAEVWAIVGDGGFQMTAA
                     ELSTAAQEGVKVNVAIINNGFLGMVRQWQEFFYDRRYAATPMRSPDFVKLAEAHGLTG
                     LRVWRREEVFDAIQRARETDGTVVIDFRVEQEDSVYPMVPAGADLHNMIRRPVRNPLV
                     ETAQDEM"
     CDS             353531..354070
                     /codon_start=1
                     /EC_number="2.2.1.6"
                     /gene="ilvN"
                     /locus_tag="ANT_03270"
                     /note="protein synonym:acetohydroxy acid synthase small
                     subunit"
                     /product="acetolactate synthase, small subunit"
                     /protein_id="BAJ62361.1"
                     /transl_table=11
                     /translation="MRHTLVALVEDKPGVLNRVASLFRRRAFNIESLTVGHTEQPGLS
                     RMTIVVDGDDIAIERLIAYLYKLVNVVHVEDLTHVPAVTRDLAMIKVAAPPETRTQVM
                     QVVDVYRARIVDVTSQSLIIEVTGDEEKIESFVEVLRPLGILEMVRTGLLAMSRGGAP
                     LYPPPNGNGNGHHAAASAD"
     CDS             354109..355161
                     /codon_start=1
                     /EC_number="1.1.1.86"
                     /gene="ilvC"
                     /locus_tag="ANT_03280"
                     /note="protein synonym:acetohydroxy-acid reductoisomerase"
                     /note="protein synonym:alpha-keto-beta-hydroxylacil
                     reductoisomerase"
                     /product="ketol-acid reductoisomerase"
                     /protein_id="BAJ62362.1"
                     /transl_table=11
                     /translation="MAKMDFAGVLEEVVTREEFPLSRAQEVLKDEVVAVLGYGVQGPA
                     QALNMRDNGIKVIVGVTPGGRSWNKALQDGWVPGETLFSMEEAAERGTIVQYLVSDAA
                     QKLTWERIRPCLKEGDALYFSHGFAVVYRDQTGVVPPPYVDVILVAPKGSGTSVRANF
                     LAGSGINSSFAVEQDYTGRARERTLAVGIAIGSGYLFETTFQHEVYSDLTGERGVLMG
                     ALAGIMEAQYQTLRAHGHTPSEAFNETVEELTQSLIRLVAQNGMDWMYANCSTTAQRG
                     ALDWRHEFRDATLPVFERLYQSVASGAETRRVLEANSQPDYKEKLEAELREMRESEMW
                     RAGALVRSLRPENWQK"
     CDS             355241..356866
                     /codon_start=1
                     /EC_number="2.3.3.13"
                     /gene="leuA"
                     /locus_tag="ANT_03290"
                     /note="protein synonym:alpha-IP synthetase"
                     /note="protein synonym:alpha-isopropylmalate synthase"
                     /product="2-isopropylmalate synthase"
                     /protein_id="BAJ62363.1"
                     /transl_table=11
                     /translation="MSQDYVRIFDTTLRDGEQSPGATLTSAEKLEVARGLARLGVDVI
                     EAGFPAASPDDLEAVRRIAVEVGNPADGGHAPIICGLARATRSDIDKAWEAVRPARHP
                     RIHTFLATSEIHMQYKLRMTRQQVLERVEEMVSYARSLCEDVEFSPEDAGRSDPAFLY
                     EVLGVAIRAGATTLNIPDTVGYTTPDEFGALIAGILRHTPGIEHCIVSVHCHNDLGLA
                     TANTLAGLRAGARQAEVTINGIGERAGNTALEEVVMALHTRPNLYGLRTGIDTTQITR
                     LSKLVSNYTGMPVQPNKAIVGANAFAHEAGIHQDGMLKHTLTYEIMRPETVGATQSKL
                     VLGKHSGRHALKTRLASLGYALGEDEMDQVFERFKNLADRKKVITDADLEALVSDELY
                     QPRELYALDGLQVACGTMGMPTATVRLRGPDGQLHVHAAVGTGPVDATYKAIDAIVGV
                     PITLLEFVVHAVTEGIDALGEVTVRIQGEDGLSSVSAQREDDLPRTFGGYGADTDIVV
                     ASAKAYLAALNKLLVAMGTFGPAEKSAEHSLVQ"
     CDS             356896..357108
                     /codon_start=1
                     /locus_tag="ANT_03300"
                     /product="hypothetical protein"
                     /protein_id="BAJ62364.1"
                     /transl_table=11
                     /translation="MNPHKVSFDPMKEGHPDPFSQPNTIPGGWDLTDAVLKTHPHARA
                     ADMNGTAYEQHLRFTAGGYERPQDVV"
     CDS             357083..358510
                     /codon_start=1
                     /EC_number="4.2.1.33"
                     /gene="leuC"
                     /locus_tag="ANT_03310"
                     /note="protein synonym:IPI"
                     /note="protein synonym:alpha-IP isomerase"
                     /note="protein synonym:isopropylmalate isomerase"
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="BAJ62365.1"
                     /transl_table=11
                     /translation="MNAPKTLFEKIWERHVVVEPPDSPAVLYIDLHLVHEVTSPQAFS
                     GLRARGLRVRRPERTVATMDHGVPTLSQGGNGSGRLAFADELSRRQIQQLQDNCREFG
                     IRLMDLESPNQGIVHVIGPDLGLTQPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHV
                     LATQCLLQRRPKTCAVRIEGRLNKGVTAKDVILALIAQIGTAGGTGYVFEYMGEAVRA
                     MSMEERMTLCNMSIEGGARAGMVAPDDTTFEYLAGRPFAPQGEAWERAVAYWRTLPSD
                     EGAVFDRTVTLDASQLEPMVTYGTNPGMGVPISGCIPTPDEMKDASQRAALEKALGYM
                     DLRPGAPIQGQRVDVVFIGSCTNGRLADLRSAARLFKGRRVAPGVRVLVVPGSQQVKR
                     AAEAEGLDRVFKEAGAEWREPGCSMCIAMNGDQLEPGQYAISTSNRNFEGRQGKGGRT
                     FLASPLTAAASALTGVITDPRPLLS"
     CDS             358522..359112
                     /codon_start=1
                     /EC_number="4.2.1.33"
                     /gene="leuD"
                     /locus_tag="ANT_03320"
                     /note="protein synonym:IPI"
                     /note="protein synonym:alpha-IP isomerase"
                     /note="protein synonym:isopropylmalate isomerase"
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="BAJ62366.1"
                     /transl_table=11
                     /translation="MQSFTTLTSHVVVLPVNDVDTDQIIPARFLKTTDKNGLGANLFA
                     DWRYLPDGSPNPKFVLNRPESQGAQILLAGDNFGCGSSREHAPWALLGWGFRAVISTT
                     IADIFRNNALKNGLLPVVVSPQAHARLMALYAAQPSLPLTIDLPSQTLRLADGSQESF
                     PIDSFSKTCLLNGVDELGYLLSLEAEIARYEQSLPR"
     CDS             359122..360723
                     /codon_start=1
                     /locus_tag="ANT_03330"
                     /product="2-isopropylmalate synthase/homocitrate synthase
                     family prtoein"
                     /protein_id="BAJ62367.1"
                     /transl_table=11
                     /translation="MRCAMKIEVYDTTLRDGTQRTDISLSVNDKLNIARRLDMLGVDF
                     IEGGWPGSNPKDAEFFARAAEMEWKHAQIAAFGATCAVEKTPEQDENILALLESRAPV
                     CTVVGKSSVLHVHEVLRTTLENNLRIIEQSLAYLKAQGRRVIYDAEHFFDGYKEDPEY
                     ALQTLAAALRGGAETLVLCDTNGGSLPWEVGEIVRAVRVRFPHARLGIHAHNDGECAV
                     ANSLAAVREGCVQVQGTINGYGERCGNANLCSILPDLELKMGYTCLPQGHLAQLTDLS
                     HYVAEVANLAPDEHLAYVGKAAFAHKGGIHVAAMRRTPRSYQHIDPALVGNTSQVVVS
                     ELSGRGNLLSKAEEYGIPLEEGVDVSGVLREVKALEAQGFSFEAADASVMLMLLRQKP
                     DYQPPFTLVDFTAGVEHRQGRGIFAEATVKVRVGEQVIHTAAEGNGPVAALDAALRKA
                     LLPYYPAISAFHLSDYKVRILDGPNGTSATTRVLIETRNGHRSWGTVGASTNIIEASW
                     RALADSIEYGIWVAEHQVEPAPALP"
     CDS             360752..361816
                     /codon_start=1
                     /EC_number="1.1.1.85"
                     /gene="leuB"
                     /locus_tag="ANT_03340"
                     /note="protein synonym:3-IP-DH"
                     /note="protein synonym:IDH"
                     /note="protein synonym:beta-IP dehydrogenase"
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="BAJ62368.1"
                     /transl_table=11
                     /translation="MHKHIVLLPGDGIGPEVVSAAKRILDAVAGRLNLTLTYEEHLIG
                     GCAMDAQGTALSQDTLHACQRADAVLLGAVGGPKWDDPAAPVRPEQGLLALRKGLGVF
                     ANLRPVRVYPTLVDASPLRAEKLQGVDLLVVRELTGGLYFGQPKGRFEENGRVRAVDT
                     LEYWDYEIERILDLSFQLAQSRRGKLTLVDKANVLESSRLWRQIATDMASRYPQVTLE
                     TVLVDTAAMRLVSQPAAFDVIVTENMFGDILTDEAAVLSGSMGLLPSASLGKATPGLY
                     EPIHGSAPDIAGQGIANPLGTILSVAMMLRYSFQLEQGARAVEQAVERALAEGCRTRD
                     LGGSLTTAEMTDAVLQRLAF"
     CDS             361845..362768
                     /codon_start=1
                     /EC_number="2.6.1.42"
                     /gene="ilvE"
                     /locus_tag="ANT_03350"
                     /note="protein synonym:transaminase B"
                     /product="branched-chain amino acid aminotransferase I"
                     /protein_id="BAJ62369.1"
                     /transl_table=11
                     /translation="MTDSQEYIWLDGELVESEKATLPFMTSALHYGLGVFEGIRCYET
                     PRGPAIFRLAEHMERLIDSARILGFRDLPYTAEQLGEACKTVVRANRLTSCYIRPLIF
                     FDSKVKNLNLDQGWARVGIAAWYWGAYLGEEALEKGARMNISSYTRHHPNVMMTKAKI
                     TGNYANSVLAKTESVRLGFDEAIMLDPQGYVAECTGENLFIVRNGVIYTPGTWAVLEG
                     ITRDALITVARDLGYTVVETQLSRDHLYIADECFVSGTAAEVVPVTEIDFRTIGNGRR
                     GPVTHALQKAFHAVVHGEDPRYAHWLTTVNE"
     CDS             362776..363609
                     /codon_start=1
                     /EC_number="4.2.1.51"
                     /locus_tag="ANT_03360"
                     /product="prephenate dehydratase"
                     /protein_id="BAJ62370.1"
                     /transl_table=11
                     /translation="MKVAFQGEPGAYSEAALLEHFGGQAQSLPCETFEQVFQAVAEGN
                     ARYGFLPIENSLAGSIHRNYDLLLQNDLYVVGEHHLRVSHCLIGLPGARLEEIESVIS
                     HPQALAQCDGTLRRLGVKTEPVYDTAGSVRLVQAEGNPRRAAIASRRAAQLYGMSILA
                     EAIEDNPLNFTRFLIVAAEPVHPRGDAKTSIVFALQNAPGALFKALSVFALREIDLTK
                     IESRPLVGKPWEYLFYIDLAGSTEETRVQNALHNLNEFATFLRVLGAYPRHRFTEPFS
                     S"
     CDS             complement(363667..364950)
                     /codon_start=1
                     /locus_tag="ANT_03370"
                     /product="hypothetical protein"
                     /protein_id="BAJ62371.1"
                     /transl_table=11
                     /translation="METPQTREGLRLRIYLGESDRWRGKLLYNAILDVLRQQKIAGAT
                     VLRGISGFGAHAYLRSTDLEVLSSDLPIIIEVVDTPEKIHNALETISPMVQEGMITLE
                     EVRILKYTQRHLNPLPAERLVREVMTRDVVHLMPEMNVRQAWQKMLESGVKAMPVVDS
                     ERRVVGILTSEDLLERGVIRQRLSVAVRLDEAEIQEELRLLSASPLTVKDVMTQPVIT
                     AREDEHLGNAVRRMIDKGLKRMPVVNAGNQLVGMLSRLDILRQVSGSPTLPSSAAAVR
                     GAVRTVGEVMRTDLPVIRLTERLDTLLEKFAACDSNRLLVVDEQNKPVGVISDSDVVV
                     RVEAAQRKGILQALRRLTSPPPLKVTAEDLYSPGVLTVPTDAPIASAVQTMLAEGRKV
                     LAVVDKQGTLLGIVDRQSLLEALFADFAEIPGNEE"
     CDS             complement(364966..365343)
                     /codon_start=1
                     /gene="crcB"
                     /locus_tag="ANT_03380"
                     /product="protein CrcB homolog"
                     /protein_id="BAJ62372.1"
                     /transl_table=11
                     /translation="MDRILWISIGAVFGANARYWLGVWAAQRWGTTFPWGTLIINLSG
                     SFLLGLFMTLVTGRYPVDPHWRLLVAVGFFGAYTTFSTFTYESINLFLKGQWLAGLLN
                     VVGSAVLGLLAAGIGVYLGKALS"
     CDS             365554..366141
                     /codon_start=1
                     /locus_tag="ANT_03390"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62373.1"
                     /transl_table=11
                     /translation="MLPPVVSIPDLPPQYCQVEYWRITASRKRILQANLLALGLLPLW
                     WLIAVGLMIALGYSKDSLIITIPRVLLASVITVLLHEGVHALAVRAFGGKPQFGVLWK
                     ALAFYTTVKGMAFKRWVFLVFLLAPLVVLSILFPLMAVFLRGEFWLSVAFLAFMINGA
                     SSAGDVFITAVLLRYPPTAYVADEIDGVRIFLPIG"
     CDS             366189..367400
                     /codon_start=1
                     /locus_tag="ANT_03400"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAJ62374.1"
                     /transl_table=11
                     /translation="MLSRLHSHPYPRQFWLMFAGMLISTTGASMIWPFLMIYASEKLS
                     LPLGTVTLLMTLSSFMGLMSSFIAGPIVDRLGRKWAMAVSLLINGGGYLLLSRAETLP
                     AFALAMAVNGTFNPIYRVGADAMLADLIPPQWRTNAYALMRMSNNVGVALGPAIGGFI
                     ASRSYGIAFYCAAAGLATYGLLVLLFARETLPQGAPEPQSEPLGGYGQVLSDRLYRAF
                     LVAFTLNQMVAALIWVLLSAHVKRAYGISESLYGWLPTTNALMVVFFQYGVSKITQRY
                     EPRRMMALGAFLYGLAALGIAFSTTYWAFWTCMVVMTIGELIIVPTSSTFAANLAPAH
                     MRGRYMSLYGLTWGVSAGISPLVGGNLYEWLGARAMWLGGTLVGSLSSLLFLRMRQRI
                     PAEVTETAAGL"
     CDS             complement(367375..368028)
                     /codon_start=1
                     /locus_tag="ANT_03410"
                     /product="hypothetical protein"
                     /protein_id="BAJ62375.1"
                     /transl_table=11
                     /translation="MSLMDEVLPHVDVRVVAFCLLKERLHVLVCSASANGYELPGAPV
                     LLNCSLEETAARRLGELTGIRETYLEQLYTYGEPQRANPRLISVAYFALLPANRLSKT
                     PPHPACWFAVDALPALTGDHAEIIAYALRRLRYKLEYSAVGFQLLPERFTLSELQRTY
                     EMILGEKLDKRNFRRRILRAGIIEPTTECRTGEGRPARLYRYRPDAVAEVKARRLFP"
     CDS             368219..370852
                     /codon_start=1
                     /locus_tag="ANT_03420"
                     /product="hypothetical protein"
                     /protein_id="BAJ62376.1"
                     /transl_table=11
                     /translation="MKRFFCIFLLMTFLLGGCIPSDFNFGLKAEIETSSELGPDTLAR
                     IDAVNQTLATGMEIGPETRQVIRELNETIRQGVKAGFDEATLKRVDSLLRVVEDGVKI
                     GLDEDTLSTLNGMVDTIDRMPGNWENSATEIIRTLERSGGTLAGRMADEIKVVMAEAR
                     LNMQQMTAMAGTEFRCNVDFLGSKAGATLQEFIGHSLVGRLRNILAGGTAAEPIPTPW
                     VCQVIPERIDLVKVGDRMLFEMGILTLTGYNYTDANSPRAYIADEAGNPLPNLTLYPY
                     RTSPYQIQLNLQGLDFSAIPPRSRIVFQWPNEPETSGVAILFPNEGAPVARFTFTPTG
                     GNAPLTVQFTDTSEGSPSQWQWDFGDGSTSNERNPTHTFLESRSYTVQLTVSNPLGSS
                     SVSQVLSVGETLVADFSFSVRQGVAPLIVEFTDRSSGAPTAWEWDFGDGERSTEQNPI
                     HVYMVPRPEGYTVTLRVSKDGQTAAKTGADRILVYEKLQADFVADPTSGKSPLTVAFR
                     DTSTGSNIIAWQWDFGDGSTSDQRNPTHTYSANNLYDVTLTVTNSMGETSTKTRRGYI
                     NAFQIVRLPRPGFILPPLFSILQDIEAYTLNFTLNGGQKLDIQVPYEKYVCGVIGMEA
                     LSGDIQENGTGDILKAYLFRQYSPALGKEGWWLDADFRSHNTNEKWGVDILCLNRKSE
                     GGAFLYKEFRSLEGGEKHNTGIFTADYYFCGIVGQMALNGDIYEYGTHEVLWQARMDG
                     SGPEWQIVVDFITHSEKPEERWDVEVLCLKKGAFLATDNPVFKTDTIEHFSPPAYLTS
                     ISTEDYACGVAGIAFKYGDIDENGTHPIVFTANMRPHPDSSVKVWMVNANFLTHGRDE
                     LITADVLCVNRAYIKGGTPPP"
     CDS             371038..372213
                     /codon_start=1
                     /locus_tag="ANT_03430"
                     /product="hypothetical protein"
                     /protein_id="BAJ62377.1"
                     /transl_table=11
                     /translation="MRCAVLTNATRFRNYGKGAECPKPSPVTGREVSLLTGTTLAMTL
                     PVRLPCPWAIIPSMPRQFWLWLFLFFLALAGCAPQGAVPVVPSASPLLPSMTFPPSDT
                     PSPTLTASPSPTATLTPTFTPTPTPAVLAGAGDISICGQDGDDQTAQLLMNLPGEVFT
                     AGDNSNEQGKPIQYRQCFDASWGRLMSRLHPAPGNHDYGTDEGAPYFAYFGERAGPPG
                     RGYYSYELGAWHILALNSNCEYAGGCGADSEQERWLREDLLSHPNRCTLAYWHHPRWS
                     SGWHGSDARTDAFWRALYDFGAEVVVSGHDHHYERFAPQSPEGERDDLRGIRQFIAGT
                     GGVSLRGYEEIHPLSEVRYNDTFGVLVFILYPDRYEWQFLSVDGARVIDSGSDECHP"
     CDS             complement(372266..373642)
                     /codon_start=1
                     /locus_tag="ANT_03440"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62378.1"
                     /transl_table=11
                     /translation="MHKIRRWLPLMLLFLLGAVMLFSQPVQAQGQKVILYFFWGDGCP
                     HCARMKPFLEELEKRYPDLEVRRFEVWHDDENLKKFQKMIDAYQIQGAGVPTTFIGDR
                     YWVGYNEQIGAEVEEAVKACLQTGCKDAAEGILTPVENPSTEKPAPRPAIDPNNPSVI
                     NLPILGQVDLKSQSLLVSTLLISFVDGFNPCSVWVLTMLLALTLRTGSRKKIVIIGLV
                     FLTVTAGIYALFIAGLFTVFNIISFVGWVQVIVALVAIFFGAVNIKDYFWYKEGISFT
                     IADEKKPGIARGIRRVLDAGDNFWAMVGGTVVLAAGVSLVEFSCTAGFPVLWTNLLTA
                     QKVTALTFVALLLVYMIIYQLDELGIFFAAVFTLKASRLEEKEGRILKLIGGTLMLAL
                     AGVMLINPALMNDLGGAVIVFLIAFAVAGLILLVHRVILPHYGIWIGTEAEGRKRAAA
                     RRARSKRH"
     CDS             374019..377429
                     /codon_start=1
                     /locus_tag="ANT_03450"
                     /product="putative signaling protein"
                     /protein_id="BAJ62379.1"
                     /transl_table=11
                     /translation="MNQPTWHGLLFNATLLLGMSVLYDLILLQGRGASRLRQVISGIV
                     LGGIGIAIILTAFPLIDGVIFDTRSVLISISGLFFGFLPTLIAVGLTAAYRLYLGGGG
                     ALTGVMVIFTSALIGWVWRYLRRRALEKMAWWELYLFGWVVHLNMLLWMYTLPGSLAR
                     PVLAEITLPVLIIYPVATLLVGEILSLNFQRQRASRERERLLAVLESSLNEIYLFHPN
                     TLRFEYVNAAALRNLDYTLEQMRTMTPVNIKPEYNLATFRELIQPLLKGQTPVIVFET
                     RHRRADGSTYPVEVHLQLVKVGNEQVFLAVIQDISERLRSTLRYRTLFENAYDAVFII
                     EGERFIECNPRAVELFGYSREELLGKTPFEVSPPEQPDGMPSDVKARELIHLAVMGQP
                     QLFEWVHLRKDHTPFDAEVSLSALNLEGQTLLQAIVRDITLRKRMEKNEREQRLLAET
                     LRETALSLASTLELDELLDRILENLEKVVPASACNIMLIEDGMVRVARTRGYRERGYM
                     PTEGIAFSLNTTQNLRTIAETGRVLIIPRLEEYPHWVRVPGTEWMRSYAGAPIVVKGE
                     VVGFLNLDGDRPNQFSEEDGERLQLFADQAAIAFANASLYQQTQRLLRRLEAINHVSN
                     VLRPAQTLDELLNLLLTETLHLLETQDGAIWMYDNTRDELRIAIAAGWQTRLRPFALK
                     PGESIAGSVYLRREVYLTHNLQEDPLNAPAIRRLVPENTGGVFVPVQAGTQTLGVFAI
                     TLPSGKTVQPDDVSLVAALGEMGGAAILRMRLHEEMRLHIQRLEMLHRIDTEVLKNTH
                     LTDTLRMALELLRETLKVDSAVIRLYNPDTQLLELAASFGMATVEHAIQPGEYLAGKA
                     ASERRTMRFWRGDPNITPEWEELVRREGLETAFALPLIAHGELVGTLGVAMRNLFHPN
                     REWEDFLDTVAGQLALAIQSNRLIEQLRRSNQELLLAYDTTIEGWSRAMDLRDRETEG
                     HTQRVTQLTLKLAQRMGITGEALTHLRRGALLHDIGKMGIPDHILHKPGPLTDEEWQI
                     MRQHPVYAIEMLSAIEYLKPALEIPGFHHEKWDGSGYPYGLKGEAIPMGARIFAIVDV
                     WDALTSDRPYRKAWTREKTVEYIREQSGKHFDPKVVEAFLKMMEEEPF"
     CDS             complement(377502..379277)
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /locus_tag="ANT_03460"
                     /product="putative M3 family peptidase"
                     /protein_id="BAJ62380.1"
                     /transl_table=11
                     /translation="MTSLPYQQTAWRLSDLSQGTPEEIDALFQQLEAQTQEFEALRPL
                     LTPEIAVETFLDLIHKLERITEDTYRLYGYAGLSFSANTQDQNALTLVGRAEQFLAEL
                     QNRTLFFTLWWKGLDDENAARLMSQAGDYTYWLEEMRHLKPYTLSEAEEKIINLKNVT
                     GASAIERLYETYTNRYTFKLEVDGEVKELTRGELMTYVRGADPDLRARAYQELYRVYG
                     NDGAFLAQMYQNLVRDWYNENITLRGYKSPIAVRNLANDIPDEVVDTLLEVCRKNTSV
                     FQRYFRLKARWLGMDKLRRYDIYAPVARADKAYPFEHAAWLVLDSFRQFDPQFAELAQ
                     RVFEHQHLDSEVRKGKRSGAFCWSVSPRLTPWVLLNYQGRADDVATMAHELGHAIHSM
                     MAQEHSIFTFHASLPLAETASTFGEMMLVDRLLAEESDEAVRRDLLFRQVDDSYATIQ
                     RQAFFALFEKEAHEMVRQNASPDEMAEAYLRNLKDQFGDAVEVSDEFRWEWVSIPHIY
                     GTPFYVYAYAFGQLLVLSLYRQFKQEGESFKPRLKQILAAGGSQSPESILRNAGVDIR
                     QASFWQGGFDVIAQLVNQLEQIPLP"
     CDS             complement(379325..379666)
                     /codon_start=1
                     /locus_tag="ANT_03470"
                     /product="hypothetical protein"
                     /protein_id="BAJ62381.1"
                     /transl_table=11
                     /translation="MVVTGWNNGAHSRHGAGYGFRVQTADRDAFFQKDWTSIQVELEG
                     EEGTVDIALPGEAFWSENGAPLVSPAVGRWLRKNGLAPWARGNPPTFILDPIEGNRFR
                     VRKAPRQRPAF"
     CDS             complement(379682..379960)
                     /codon_start=1
                     /locus_tag="ANT_03480"
                     /product="hypothetical protein"
                     /protein_id="BAJ62382.1"
                     /transl_table=11
                     /translation="MVINLYATFRLLAGTKQIHLNLPENSTVRQALEDALRIVPALRP
                     HWMNESGELHAHVHVLVNGQDVATLPEGLETPLQTSAVLDVFPPVAGG"
     CDS             complement(379963..380787)
                     /codon_start=1
                     /EC_number="2.7.7.41"
                     /gene="cdsA"
                     /locus_tag="ANT_03490"
                     /note="protein synonym:CDP-DAG synthase"
                     /note="protein synonym:CDP-DG synthetase"
                     /note="protein synonym:CDP-diacylglycerol synthase"
                     /note="protein synonym:CDP-diglyceride pyrophosphorylase"
                     /note="protein synonym:CDP-diglyceride synthetase"
                     /note="protein synonym:CDS"
                     /note="protein synonym:CTP:phosphatidate
                     cytidylyltransferase"
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="BAJ62383.1"
                     /transl_table=11
                     /translation="MLASLSPLSQRLLVALLLIPIGIALIWVGGAPFALFVALVLGLA
                     ALEYAHLFEHGGFHPTTWILAGGSALLPLIRLWGGDAFALPALTALIFLTMGWQVFTY
                     RHTHETAVLDLNITLGGLVYLGGLGGYLVSLRQLPDGMWWFLLVLPAIWFADAGAYFV
                     GSRWGRHKMAPHISPSKTWEGYLGGVVSAILLTAGLAALWNLRIPYLTPAHGALLGAV
                     IAVLSPLGDLGESLLKRGFGVKDSSHLLPGHGGVLDRIDSWLWAAPLGYYMIVWFF"
     CDS             complement(380777..381526)
                     /codon_start=1
                     /EC_number="2.5.1.31"
                     /gene="uppS"
                     /locus_tag="ANT_03500"
                     /note="protein synonym:Di-trans,poly-cis-
                     decaprenylcistransferase"
                     /note="protein synonym:UPP synthetase"
                     /note="protein synonym:undecaprenyl diphosphate synthase"
                     /product="undecaprenyl pyrophosphate synthetase"
                     /protein_id="BAJ62384.1"
                     /transl_table=11
                     /translation="MDVSTSTPTLTKVPVHVAMIMDGNGRWAQKRGLPRLAGHRAGTE
                     NLRRIIRASVEFGVKYLTIYAFSTENWGRPQEEVEGLLHILEEVIDRELDELDQQGVQ
                     LRHLGHLDRLPAMLQEKIIRAVERTRDNDRLILSVAFNYGGRDEIVCAIRAMMRDSVK
                     PEEVTPELVSRYLFTADLPDPDLIIRTSGEMRVSNFLIWQSAYSEWYVTPVLWPDFDR
                     EEYLKALIEYSHRERRFGKLTAQDDSTDCAC"
     CDS             complement(381543..382100)
                     /codon_start=1
                     /gene="frr"
                     /locus_tag="ANT_03510"
                     /note="protein synonym:RRF"
                     /note="protein synonym:ribosome releasing factor"
                     /product="ribosome recycling factor"
                     /protein_id="BAJ62385.1"
                     /transl_table=11
                     /translation="MIKETLKEAETRMKGAIQALEENLAGIRTGRASPALVERLQVEY
                     YGVPTPLMQLASISAPEPRVLMIRPFDTSSLRLIEKAIMASDLGLTPNNDGKVIRLNI
                     PPLTEERRRELVKVVHARLEESRIAVRNVRRDMVKDLRDFEKEKLISEDDLKKGEEEL
                     QKLTDRYIQEIDAIGQKKEKEIMEV"
     CDS             382564..382977
                     /codon_start=1
                     /locus_tag="ANT_03520"
                     /product="ArsR family transcriptional regulator"
                     /protein_id="BAJ62386.1"
                     /transl_table=11
                     /translation="MRTKKVKEESIFETQAGVFKLLAHPARLKILALLREGEECVCHM
                     EAMLGYRQAYLSQQLALLREAGVLEMRREGWNVYYRVARPEVYAIIDAAHSVGGSLDD
                     LRRWEEKKKTCECPKCCRARGETPSGEETPLTLAE"
     CDS             383089..385533
                     /codon_start=1
                     /EC_number="5.99.1.3"
                     /gene="gyrA"
                     /locus_tag="ANT_03530"
                     /product="DNA gyrase subunit A"
                     /protein_id="BAJ62387.1"
                     /transl_table=11
                     /translation="MDIGTIQSVDIDEQMRTAYLDYAMSVIVARALPDARDGLKPVHR
                     RILYAMEDMGIRANSAYKKSARIVGEVLGKYHPHGDMAVYDAMARMAQDFSMRYPLID
                     GQGNFGSIDGDAPAAMRYTEARLNPMAEELLADIDKDTVDFTDNFDGTLKEPVVLPAR
                     LPNLLLNGSSGIAVGMATSIPPHNLREVAQAVDYLIENYDQMDDITAEDLMRIIPGPD
                     FPTGGIIVGREGILHGYSTGRSRLTVRGVARIEEQKGGRYNIIITEIPYQVNKAGLIE
                     RIAELVREGKLDEISDLRDESDRHGMSIVIELRRGAQPRQVLNQLYKYTPLQSTFSVN
                     MLALVDNEPRLLPLKRALQVFIQHRQEVLTRRTRFELDKARARAHILEGLLIALANLD
                     AVIAIIRQSPDAETARQRLIERFKLTEVQAQAILDMQLRRLAALERQKIEDEYREVTE
                     RIAYLEDLLANPRKILALIQTDMKELAEKYGDNRRTRIAAEAKEDFSEEDLVADEAVL
                     ITLTARGYIKRVNASAYRTQNRGGKGVIGQEVKEEDEITTILAARTLDTLLFFTDRGK
                     VYAQKAHQIPEAGRTDKGIPAINVLALEANERITVAVAVRSFADARYCLMATVNGKVK
                     RVDLSEFESVRPSGLIAISLENGDQLGWVRLTDGSRHVLLVTEQGYTVRFAESEVRSM
                     GRQASGVTGISLREGDRVASMDIVEEGGGLLLVTTKGFGKRVRLDEFVLKGRAIGGVM
                     ALDHKAIAKTGKLAVARVVQENDEVALFSASGVALRVKVSSIPFKGRVAQGVSIMHLD
                     EGDSVASIARIPQEEA"
     CDS             385629..386117
                     /codon_start=1
                     /locus_tag="ANT_03540"
                     /product="hypothetical protein"
                     /protein_id="BAJ62388.1"
                     /transl_table=11
                     /translation="MELSIVPIEKPEAVNFILGQSHFIKTVEDLHEALVAAVPGIRFG
                     LAFCEASGKCLIRWSGTDEEMIELAKKNAMAVGAGHSFVIFLAEGFYPINVLKTVQAV
                     PEVCRIFCATANPTQVIVAENGEGRGILGVIDGAKPKGIEGEEDIQWRKGFLRKIGYK
                     LG"
     CDS             386217..387434
                     /codon_start=1
                     /locus_tag="ANT_03550"
                     /product="hypothetical protein"
                     /protein_id="BAJ62389.1"
                     /transl_table=11
                     /translation="MMKRRVFGCLLILLILLAFPTANAAQALQPRTPDLPPQTPQEVQ
                     QTESAPQTSALTALNLPPLKAVLIVGPIDGDNGSWTRQEIANMELAAQELEKNGVTVY
                     RFYTPNNNWEQIKAAANGAHFLFYRGHGIYWSDMPYPTVGGFGLKDRMYSSAEIQRDL
                     KLAKNAIVMIYACFSAGSASNDTIPVTQAEARRRVGEYSQPFFALGAGGYFADWFGNA
                     FQQYVRFLFEDKTLGQAYQAFGDYEAGKTVQTTHPAFPSLPMWLGYDEWYEPKPQWNN
                     AFVGDPNQTLESLFPPAMQVSSPAVVAMLESASVSQTASVRITASNGATFNWNATVVG
                     SKPAWLTFTASGSSVQPMQITVQPASGTGTYEVQIQVNPVGMTLSNAPQIITVRLIQV
                     NQIHRVMIPLILR"
     CDS             complement(387517..388884)
                     /codon_start=1
                     /gene="engA"
                     /locus_tag="ANT_03560"
                     /product="GTP-binding protein EngA"
                     /protein_id="BAJ62390.1"
                     /transl_table=11
                     /translation="MARSIVALVGRPNVGKSTLFNRLAGEPLAIVDDIPGTTRDRLFA
                     TAEWSGVEFDIVDTGGIDPSAARAGREPLSIGSAEFIKEIRSQAELAIQDADAILFLV
                     DAISGLTPADREVAQILRRKQQMVDGKPYPPVFLVVNKADSANLRAVASEFYELGMGE
                     PYPISALHGTGTGDLLDDLIASLPKVEEAGEDDSVKIAIVGKPNAGKSSLLNRLVGEE
                     RAIVSPIPGTTRDAVDTRIEYNGVPITLIDTAGIRRRGKIEPGVEKYSVLRSLRAIER
                     SDVALLMIDATTGITAQDTHIAGFILEAWKSAVVLVNKWDAVEKDSHTMAEYTARLRH
                     ELNFMDYVPILFISAKTGQRVDQVLPLALRVQEERLARLNTGTINRLIQEAQERHAPV
                     VRGGRSLHIYYGTQVRSDPPTFLLFCNDPKLAHFSYLRFLENVFRKEYPFTGTPIRFV
                     LKPRH"
     CDS             389046..389867
                     /codon_start=1
                     /EC_number="3.4.11.-"
                     /gene="dppA"
                     /locus_tag="ANT_03570"
                     /product="putative D-aminopeptidase"
                     /protein_id="BAJ62391.1"
                     /transl_table=11
                     /translation="MKLYVVCDLEGVAGVVNHLQQCRWNAEKGWYAPFLEQARRLATL
                     ELNALVEGALSAGAEEVIAWDGHGNFPGGLDYELLHPACKLILDAGDGGPAGLDGSFD
                     ALLQLGLHAMAGTPRTVLAHSFYSHLLEYTVNDEAVGEIWMNAYTAGKAGVPFIFLSG
                     DRAAALEAQRLVPEMEVAVVKEGLSDRPLGLNHPQPALCLSPQAARKTIRKAVAKALW
                     KVGKIAPFTRKPPFTLRARFSEECFAEERASLPGARRVDAFTVELAGAEEPWLLL"
     CDS             390051..391904
                     /codon_start=1
                     /locus_tag="ANT_03580"
                     /product="hypothetical protein"
                     /protein_id="BAJ62392.1"
                     /transl_table=11
                     /translation="MTAEDTIYEEALSALKSGDLPRARDLFTRLLRMNQNKPEYWVYM
                     SATVEIARERAYCLQEALKRDPHNVDARRGLQILGLQPVDEAQVIPLKWQKRNWEVVA
                     PVSEAPAPPLISPRTVFAVVGGLLALAVIVVLVVTGLNRPRQRPIVIPRDLNLPATMT
                     PTPLPTVAAQASPSPTFIGPTPLWMKLQATYTPTPLYVNTPHPISEAYRIAMRAYSRQ
                     DWPGVLNYLQQVVTVQPDAPDLYYHMGEALRFQGNAEQAIAYYSQAISVNPQFAPAYL
                     GRARARLALGKELDKARQDLETALARDPQLGEAYLELAHLELIEKNPEEALQLLAQAD
                     SLLPDSPLVALARGEAYLALGEVDAALEQAQRANTLDLTLLPAYRLLGAVLLEKGEVE
                     QAVEPLETYLLYETNDLEAYILASRAYEGANRLPEALKALDRALALNSRSPEIYIRRG
                     ELYLAQEEFDKAIDDFKAAFRLKKTYTAGMGWAKALLLGGYPGDAYMKFEETKALAES
                     DAQKAELYYWEAQSLEELNEVIAAINTWNKLLALPEDAVKPEWAEYARQRLQVLVTPT
                     RTPLPSATPTVTRTSAASSTATRASGLTATATRTPTLRTTATRTPTPSPTK"
     CDS             391908..394769
                     /codon_start=1
                     /locus_tag="ANT_03590"
                     /product="glycosyl transferase, family 51"
                     /protein_id="BAJ62393.1"
                     /transl_table=11
                     /translation="MRAVPLALLLKKRQRREWMRRKRGFSPFVRFLMGLLVIVLLALG
                     AGTALTAVWMSQITAGLPDVSTLPDLLSPSGEGVFQPTRLYDRTGQHLLYTLENPGLT
                     RRTLSIDPARPDHLSPEVIRVAIPLLDATFWENPGFDASNLLDPYPQTIAERLVLNLL
                     LDREQPDSRRALRMRLLAAQVVSRYGRRQVLEWYLNSAPFGHLTYGIESAARLYLDKS
                     ASELNLAEAALLIPLLNTPALNPLDAPAAAKENQQAALDVLLEKNILTPEEHQRARST
                     PLRLRESFPESHSVAGAFTTLVLDQVAARLGRQRLERGGLRIITTLDLTLQQELQCSV
                     QAHLAQIQGQSYQAILPDGSPCQMSRLLPTRPPVERASEALTASALVMNPQNAQILAF
                     VGDTSRAGEAAYLSVHPAGTLLLPFALVTAFARAYSPATMVWDLPQDLSLPNLDGTFH
                     GPIRLRTALANDYAGALSRVLQPMGGEVLWQLAQALGLEDLNFGSRSGASWESARFSL
                     PQLAQAYALFPNMGTVYGVQMEDYRPLQPVTVLYVEDGQGNILLDLTQPQSRTLVSAP
                     IAYLMHHVLSDESARWQTLGYPNPLEIGRPAGAKIGRASRGKDLWAVGYTRDHLAVVW
                     MGESTPESQLPSLRVTDVAALWHAAMQYVSRDLPPRDWEVPAGVSTVQVCEPSGLLPT
                     PACPQVVSEVFLTGNEPVAYDTLYQVVQINRETGRRATVFTPPSLVDEKVYMNLPPEA
                     LEWAQSQGIEIPPEKYDAIQMPLMPENAQMTHPAPFAMVHGEVIIRGTASGAGFTFYQ
                     LQAGEGLNPQSWIEIASGDQPVKNGVLGKWNTTGLEGLYALRLQVIRADQTVDTAILQ
                     VTVDNTAPYVRILSPLPEQTFTLKPRQIITLLAEAEDTGGIARVEWWLDGQKIGESRV
                     APFSLPWQAGEGQHTLLVRAFDAAGNMGETSLITFRVSR"
     CDS             complement(394776..395291)
                     /codon_start=1
                     /locus_tag="ANT_03600"
                     /product="hypothetical protein"
                     /protein_id="BAJ62394.1"
                     /transl_table=11
                     /translation="MPLILNQPAPDFTLPSVSGEAVTLSALRGKPVLINFWSAECPWA
                     EQADRLLVERWKTFQNQAVWISIASNANETSEQIREVAQARGLPLVLVDAGHRVADVY
                     EAVTTPHCFVLDANGILRYHGALDDTSFRQRVPARFYALEALEAILKGETPAIQHIPS
                     YGCTIVREMPE"
     CDS             complement(395337..396137)
                     /codon_start=1
                     /locus_tag="ANT_03610"
                     /product="hypothetical protein"
                     /protein_id="BAJ62395.1"
                     /transl_table=11
                     /translation="MDLPLPAFLEDYPEITFLLRELLEGMRNILKERLIGVYLEGSLA
                     NGGFDTASDVDFLAVTTEPIDEKTFQALYAMHERLATFPTPWAMELEGSYLPLSFLRD
                     FDPEKRFHPNLERGRQERLKLTDHDWGWWTIHRHILYHRGIVLYGADPRTLYTPPTPE
                     VLKHAMHAVISAWAQGLVENPQKMDSRGYQSYVVLSLCRVLYTLIHGEVVSKFQAMQW
                     ALDTLEPRWHGLIQRAWQGRMSPNGAPDVNELDETVAFIRHAMETVGI"
     CDS             complement(396245..399148)
                     /codon_start=1
                     /locus_tag="ANT_03620"
                     /product="putative signaling protein"
                     /protein_id="BAJ62396.1"
                     /transl_table=11
                     /translation="MKPPIPSQLAKILKRMLISRLFVPLFIAMVLVNLAAWGVVWQAL
                     ISREYTYARLMAQELDAGLQDALEAMQATQTLDWSHSPQAHSAALEAMRRTVSELDRL
                     IAINDQGDVLALAPFEKDVLRWNLSNQPYFSSLRPEMPPLFFTPQYSPFSGLEVVMAA
                     IPLTPSMYLMGEINVERLKARGNMGMLFDNRFTRWSIYDDKGNALLQAGNDLENGFVQ
                     PPARVQGFNWISGSSQPLRLATRVNMPTPGWTLVVERAVLTGMGWYVAGTLATLLLVP
                     WLASVLVTQMEKRLNRIVVRPLEILNERVKQLTSGDYSEWISFSTIAISSREIAELAS
                     SIQRMQHAILKRQQALAESEARYRQLADLLPDMVFEVNAEGKLTYANRAALSNTTSAD
                     FSALQNTEFISMIPLPEVPAFQNLCHSLQPGKVSRPLVVRFLKQDGSTFPGEVVIAAL
                     GNGEVRGYRIVARDITERLSFEEALRRSYQMFIQGPVIVFRARTSGDHPVEYVSPNIT
                     RFGYTPAKFTTLKDFYDILIHPHDRDRVIEQTQAHLMARSSTFEREYRVRCADGSVRW
                     VYDFNTVSYESNGSVRHFAWYLLDITERKQAELRLDQQIQRLAALQLIDASITANADL
                     TFTLQILLSQLMTLLRVDAAAILRYDVQEHALTGITGDGFLYAEPEKFRLAFGESYAG
                     RIVETRQKIVINNLPEELMQHLVMPGMKQEGFVSFIGLPLIAKGEVKGVLEIFQRQPL
                     TLERDWMDYLETLAGQAAIAIYNADLLENLQRSNEELRRAYEATIQGFSIALERRDKE
                     TEGHSRRVAEWTVRLARRAGIPEEELERIRIGAILHDIGKMAIPDSILLKEGNLTDEE
                     WEIMRKHPEHAARMLSAIEYLRPAMVIPQYHHEKWDGTGYPYGLKGEEIPLAARVFAV
                     IDVWDALSFDRPYRPAWKPEQVRQYLIDQAGKHFDPRLVPLFLEMLEEESPFE"
     CDS             399438..400358
                     /codon_start=1
                     /locus_tag="ANT_03630"
                     /product="hypothetical protein"
                     /protein_id="BAJ62397.1"
                     /transl_table=11
                     /translation="MKRAVSISIGSSKRNKTVEIELLGERVRLERIGTDGDMDKAAQL
                     YRELDGKVDAFGVGGTDLGLRVADRWYPLHSVSRLVRDVRQTPVVDGTGLKATLEKRV
                     AGVLEQLAPSLPEKTALVTTAVDRWGLAEAALNAGFRVTFGDLIYSLGIPIPLHSPRS
                     IRLMAALLLPVLSRLPFEWLYPVGEKQGQRNPKHTRFFQQAAVVLGDCHYIYRYMPDD
                     MRGKVIVTNTTTPEDVQTFRASGVRWLITTTPVLEGRSFGTNMMEAAILAAAGRREPV
                     NYAQADGYYRWLDGVLDELKLSPQVQELNA"
     CDS             400355..401122
                     /codon_start=1
                     /locus_tag="ANT_03640"
                     /product="hypothetical protein"
                     /protein_id="BAJ62398.1"
                     /transl_table=11
                     /translation="MKAILAAGGEASIQDPLYPYTQGKPKALLEMAGKPMVQWVIDAL
                     NASSVVDSIVVVGLPPHTPLESRLPLRILPDHHGMLENFQAGARAIYEEERRDQMVLA
                     VSADIPLIRGEMVDWVAQNTQDIEADVYYHIIERHVMETRFPQSKRTYLRIEGREYCG
                     GDLNALRLKAVLEADSLWNAMVQARKNPLKQAQLIGWDILLLLLLGRLTIPEAERRFS
                     RRLGLRARAISCPYAELGMDVDKPVQYELALRELSAR"
     CDS             401127..401681
                     /codon_start=1
                     /locus_tag="ANT_03650"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62399.1"
                     /transl_table=11
                     /translation="MASSIWNWVQRWDDRWTPRFTLKPGGGWIWRSAAVLAHSGDSWF
                     WVGALALVWLFTTGDWHRRAALLAAAVGVQALAVFALKQFIRRPRPEGEWGAIYRNVD
                     PHSFPSGHAARAALLAVMGLGLGPQWFAVLLLIWAPLVSLARVATGVHYLSDVLAGIL
                     LGSLMGAGMLALSDWLMRLFPFFF"
     CDS             complement(401741..402781)
                     /codon_start=1
                     /EC_number="3.2.1.4"
                     /locus_tag="ANT_03660"
                     /product="endoglucanase C"
                     /protein_id="BAJ62400.1"
                     /transl_table=11
                     /translation="METLSGFQAGVNLGGWISQYGSFDYQHFETFIQEEDIARIASWG
                     MDHIRLPMDYPIFESDDNPFSYNERGFGYVDRTIEWCEKYNLNLILDLHRAPGFSFNT
                     LEENRLFQNVDLQERFLALWETFARRYRKVERPTLIFELMNEVVLPTSAPWNELAQRA
                     VRRIRSVDAERWIMIGGNHYNSAWTLKDLVRVDDPHIVYTFHFYEPMPFTHQKAYWVD
                     FLKAFDTTTPYPGEIPHLEEFLAQHPEYAEQFAAYRGKVMNLDMLRYFIQPAVDFLEQ
                     THLPLYCGEYGAIDHAPLESRLNWHRDIVGLLRQHGIGRAVWSYKEMDFRLVNWKGEV
                     ESQELVEIVSQR"
     CDS             402915..403139
                     /codon_start=1
                     /locus_tag="ANT_03670"
                     /product="hypothetical protein"
                     /protein_id="BAJ62401.1"
                     /transl_table=11
                     /translation="MIKLKAWLESLAIFVLTLVLIAGASQSSLDRWERGVSARPFVEY
                     AVMVAVSCLFLLALRRNPGEYGISLRNLRE"
     CDS             403306..403710
                     /codon_start=1
                     /locus_tag="ANT_03680"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62402.1"
                     /transl_table=11
                     /translation="MGSQGGMALSLMSWAGKALVALVFYCFFLGLGEELLFRGYLQSR
                     LNQAFGKPFLFFGVAWGWGVVLSAALFGGMHLLNLGSLVSGHWQPAPWWGLWTFFAGL
                     VMGFVREKSGGILAPVLLHGLPQALAEAVLGR"
     CDS             403764..404978
                     /codon_start=1
                     /locus_tag="ANT_03690"
                     /product="hypothetical protein"
                     /protein_id="BAJ62403.1"
                     /transl_table=11
                     /translation="MNIEDARRYLKMLCEDIPDRSVGSEGNRRAVAFFTELVSSFGWQ
                     TETMALPVIDWQERGADLRIGEQSFDVRVSPYSLGCAVEAPLISAETLKELERLEVEG
                     RVLLLHGELTREKLMPKNFPFYNPEEHQRILALLGQKQPAALICATGRNAAVAGGVYP
                     FPLIEDGDFDIPSVFTTEEAGQVLLSCVGKTVWLESRSNRIPAFADQVIARKGNNPDR
                     RVVVSAHIDAKKGSPGTIDNAIGVVVLLFLAELLKEYHGDPGIELVPFNGEDYYAATG
                     QMEYLRKNQGRFHTIWLNINLDGVGYKDGKTALSFFNLPESVKMHMDEILARYEGLVE
                     GFPWVQGDHSIFIQQGCPAVAVISQWLLEHLDSQEITHTSKDAPSIVDPHKLVEIAVA
                     LKDFLNSLSELN"
     CDS             405157..406071
                     /codon_start=1
                     /locus_tag="ANT_03700"
                     /product="hypothetical protein"
                     /protein_id="BAJ62404.1"
                     /transl_table=11
                     /translation="MKRMHQTMLFPDALREFTFAKSYEQIVQLLQDYPELDEYVIPIL
                     SLMSTLGLMLEVEKAFGETSETQERVIEIVDPATIEILQQKPTARETAQTINLLISIG
                     RRNPAVFTEEACTMLKILAEGDIPANLKPKLLRYHAALRASRDSGFDLEWALKKKREA
                     EWVDEDWEKADQQSEQMKAFLLAPNVESARAVVHQSHWLEPYLEEGGLSFSGEDLSLR
                     HGLAHALWEKSWCRVRRTVREYAELTTPRAWEVLDQFAETAKKHQKKQTVHEVLAIKF
                     EYFSVLLKKCAEQGVDRVFLEYANHFVA"
     CDS             406136..406783
                     /codon_start=1
                     /locus_tag="ANT_03710"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62405.1"
                     /transl_table=11
                     /translation="MDIPSGFWLTLLACAGYGAIHSALASHTVKGWAERRFGQFARRT
                     YRLFFVLMASLTTLALLAVPLLLPDRPLYVIPFPWIILTLAVQAFAVWGLLAALSQTD
                     ALAFLGLRQLSAPEPLRRRAKSGELVTRGFYGRVRHPLYLFSLILLWLFPVVTWNILA
                     LMIGLTVYLYIGTLLEERKLLDEFGEAYAEYRRTTPMIFPRLLPGRVTRPRQEGE"
     CDS             complement(406755..408053)
                     /codon_start=1
                     /locus_tag="ANT_03720"
                     /product="hypothetical protein"
                     /protein_id="BAJ62406.1"
                     /transl_table=11
                     /translation="MKNAVAEGLSEIERLQRQVFPSGSEWFFPHYAGYSLVNLPASIF
                     QWLGADAPAALRPPLAHPAFQQWNTRFDTVILILVDGIGLDWMQNTLERASRDEDLRF
                     WAHLPAESVLAPLTSVVPSTTATALVSLWTGALPAEHGVIGYELFLKEYGILTNMITF
                     QPAVFGEGNATLRLAGFNPETFLPVPSIGRALNEQGVGVQVLLHRSIARSSLSQMLYA
                     GAEIFPVGSPGDLFVTLEQVVTQRTPYPRYIHAYWGAVDEAMHRFSPGNPRVWREWLM
                     FTQQFALFFREMQKHSRGRTLLLFTADHGHIPTPRRAEFEVRRHPRLMDCLTMVPSGE
                     ARLPFAFVRAGKERAFQDAVAELWNGRFEVLPATEFVQTGWLGKTTPAPCLWERIGDF
                     VILPREDYYWYFGLKENTLLGRHGGLSRAEMLTPLLGVVL"
     CDS             complement(408068..408808)
                     /codon_start=1
                     /locus_tag="ANT_03730"
                     /product="ABC transporter permease protein"
                     /protein_id="BAJ62407.1"
                     /transl_table=11
                     /translation="MKRRDYLLALLALLALWQILAWLVNQPILPDPWRVLRALVQETL
                     SGDLPKHFLASLWRVVASTLLSILLAAPAGLVLGQSRRLNRLFTPMIYLLYPIPKVVF
                     VPVLLLFFGIGDLSKILVIFLILFFQILVLVRDQAAALRPELILSVRSLGAGRRALFR
                     FVYLPASLPGILTALRQSIGTAVAVLYVAELFATRVGLGYYIYFQGSTLLNYPAMYAG
                     ILAMSFLGLGLYFLVDGLERRLCRWQIR"
     CDS             complement(408805..409566)
                     /codon_start=1
                     /locus_tag="ANT_03740"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAJ62408.1"
                     /transl_table=11
                     /translation="MLEFQRVTFHYRHGTPIFLDFNWRVEKGDAWAVLGPSGCGKSTL
                     LALAAGLLFPTQGQVLVEGQPLTRPRPHTGLIIQDYGLLPWATVRENAALGLRVRNFY
                     GADGIHAPKDYVPRTDVTPWLERLGLLEVANQFPSQISGGQRQRTAIARTLALEPDLL
                     LMDEPFSSLDAPTREGLQMLVMELWADQRLTLVLVTHAIEEAAMVGKRILVLGNPPNT
                     QALVVDNPGAGEPNYRTTPEYQAICQFLREVLNRP"
     CDS             complement(409643..410611)
                     /codon_start=1
                     /locus_tag="ANT_03750"
                     /product="ABC transporter substrate binding protein
                     precursor"
                     /protein_id="BAJ62409.1"
                     /transl_table=11
                     /translation="MKKTLVFLFVLALMLSLLGCTPQATPTSQPATLKVVALPILDTM
                     PILVAQQQGLFSKYNLTVEFIPAGSAPERDQLVAAGQADGMLNEVLSALYFNKESARV
                     QVVRYARAATKDAALFTLVANPNSGVKSVADLKGKSVGISEGTIIQYVTERLLMAEGV
                     DPKEVKLTSVPKIDARLALVKSGELDAAVLPEPLASVAVKEGSIAIISDAAYPQYSFS
                     TWTFRKEVLKNNPDAVKRFLLALEDAVALINADPAKAEWKQLLVDNKILPAPLAENFV
                     VPPFVTAGVPTEEQFMDTLTWAKEKGFLQADQAYQDVITASFLPQK"
     CDS             410824..411174
                     /codon_start=1
                     /locus_tag="ANT_03760"
                     /product="roadblock/LC7 family protein"
                     /protein_id="BAJ62410.1"
                     /transl_table=11
                     /translation="MMVDRLRELQASSPDIEASAVVSVDGLTIASALPQGVEEDRVSA
                     MSAAMLSLGERIANELGRGSLEQVYIKGEKGYVVLMSVGEEAVLTALAREQAKLGLIF
                     LDMRRAAEDLTKLI"
     CDS             411191..411823
                     /codon_start=1
                     /locus_tag="ANT_03770"
                     /product="hypothetical protein"
                     /protein_id="BAJ62411.1"
                     /transl_table=11
                     /translation="MEPIPKSGLYYSNKMARLALLALEEVMGKNGLNAILNLANLSHL
                     IDNLPPDNLNREFDFADFSMLNGALEEMYGPRGGRGLAKRAGRAVFMEGLRNFGALAG
                     AGDLAFKILPLSTKLRIGIPAMAKIFSTTSDQYTTVEEKEDHFVYTIHKCPVCYGRHT
                     DKPCCHIATGVILEGLRWVSGGHEFKVEEVRCIACGDPTCDFIIYKEPES"
     CDS             411854..412759
                     /codon_start=1
                     /locus_tag="ANT_03780"
                     /product="response regulator receiver protein"
                     /protein_id="BAJ62412.1"
                     /transl_table=11
                     /translation="MWEIALVSPIFLVCAGEPVNEKKPTLLIVEDDLDIADMLNAYFR
                     VQGYEVQTVNWGEDGVRAAQSGMPDLIILDIRLPDIDGFEVARRLRTNRRTRDIPIIF
                     LTEKRGRDDRLKGLELQADDYITKPFDIAELRLRVRNALQRASQGTLVNPVTGMPEGK
                     PVDEALESSLHQPDAALLVVQLRNLERFRDVYGFVAGDDLLRAVSLMMRDTVIQLGGE
                     EDFFGHLTPSTFVIVTRDHNVHAISERIRRRLEQSFDYFYSDQHRERGLFADRPLSLE
                     IHTLKPSTLQTQLEGLKTALQQFYH"
     CDS             412772..413500
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_03790"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62413.1"
                     /transl_table=11
                     /translation="MKITFVIPTYNEAENLPRLVSALFSLPVPGLHLLIVDDNSPDGT
                     GQIADELASQSEGRLSVLHRSGKLGLGTAYIQGFQRALEEGADAVGQMDADFSHPIEK
                     ITALVNTLETCDWVIGSRYVPGGQLDERWPLWRKFLSWFGNFYARTILNIRVKDVTGG
                     FKLWRAETLRAMPLERIRSNGYVFQVEMNYVASLLGFKFKEIPIYFADRRWGKSKMDF
                     RIQLEAAVRTWQLLWMYRDLRRRS"
     CDS             complement(413505..414422)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /gene="ksgA"
                     /locus_tag="ANT_03800"
                     /note="protein synonym:16S rRNA dimethylase"
                     /note="protein synonym:S-adenosylmethionine-6-N',
                     N'-adenosyl(rRNA) dimethyltransferase"
                     /note="protein synonym:high level kasugamycin resistance
                     protein ksgA"
                     /note="protein synonym:kasugamycin dimethyltransferase"
                     /product="dimethyladenosine transferase"
                     /protein_id="BAJ62414.1"
                     /transl_table=11
                     /translation="MVSKRGDVLPDPGTSQPSGDSPLNLPPLPVAALLRSHGLAPRKS
                     LGQNFLTDPAILRRIVESAELPPQAEVLEIGPGLGSLTRVLAQVARRVVAVELDSTLI
                     PLLDEVVSPYGNVEVLHGDILQFDPARLMSSAGYFVVANIPYYITSAVMRHLLEASIR
                     PQRVVLTIQREVAERICAVPGEMSLLALSVQVYGAPRVTLRIPAGAFYPPPKVDSAVV
                     RVDLSPQPRIPAEQLEIFFRLIRAGFSQKRKTLRNALSSGLGWKGERAESLLRQAGID
                     PNRRAESLALEEWALLVDAYVKAEEKQAG"
     CDS             complement(414353..415729)
                     /codon_start=1
                     /locus_tag="ANT_03810"
                     /product="hypothetical protein"
                     /protein_id="BAJ62415.1"
                     /transl_table=11
                     /translation="MRNLFRWLPALLVFAGITLLGVYFAQPVYIRVDGQTLTTHPLAL
                     TVKGTLRQTGVEISTEDLVIPPDNHLIPANGIIEVHRAVPVHLLVDGQPFSFLSVARA
                     PAALAHQAGFLLFPGDVVLHNGAPVNPIQPIGGDAPIYLQIKRARPVRLVEDGGEKTL
                     FAIGNTLRQALWQAGVPLLPGDVLSPSPDTPLSTASKAALRRARPITIEVDGKDIQTF
                     SAAPTVGAALAEAGLSLQGLDRAEPDENSPLPADGRIRVVRVREEIVLQQKTLPFSST
                     LQPDSSLPLDERRVIQPGKYGVRVSRERVRYEDGVEIARFTEGEWTAAEPVNQVVGYG
                     TQVRVQTAQTPDGTIEYYRKVTVYATSYSPCQQGLGRCSWSTSSGMRLQKGVVAVTLS
                     WYRLFKGARVYIPGYGFGVIGDVGGGIPGTYWVDLGYSEEDYVRWSQNVEMYFLTPAP
                     PNPPAILP"
     CDS             complement(415741..416829)
                     /codon_start=1
                     /locus_tag="ANT_03820"
                     /product="hypothetical protein"
                     /protein_id="BAJ62416.1"
                     /transl_table=11
                     /translation="MKSKVAVLRTRPETVLDDYRHLCALAGLREALDPGATTILKDNI
                     SWHLMYPSSNTTPWQLEGTILALHDAGFHDLVDVHNKTVVTIADLGDRYNKFGPVLEK
                     YGIPKKYNFRDEDMRWVEIKPKAQMAVLHKIFPHGIYIPDFFIGKNIVHLPTVKTHSY
                     TVTTGAMKNAFGGLLNVNRHYTHTWIHDTLVDLLAIQREIHTGIFATMDGTTAGSGPG
                     PRTLIPHQKDVILASADQVAIDAVAAQMMGFDPMKIEYIAHATERGLGQGNPREIEIV
                     GMPEVAEERWNFKVGVNLGTGTGRLLWHSPLKVFQKLFFHTPLVNIFIFASEYYHDHF
                     WYPLYGKPVVERWKRESPWGQLFEQYPG"
     tRNA            complement(416907..416982)
                     /locus_tag="ANT_t0060"
                     /product="tRNA-Phe"
     repeat_region   417051..417058
                     /rpt_type=flanking
     repeat_region   417059..418258
                     /note="Similar to IS6 family"
     repeat_region   417059..417085
                     /note="27bp imperfect inverted repeat"
                     /rpt_type=inverted
     CDS             417144..418172
                     /codon_start=1
                     /locus_tag="ANT_03830"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAJ62417.1"
                     /transl_table=11
                     /translation="MKIILQLPQVKRKKPARPKRCPYCQGETFQRWGVEKRRIEDVKV
                     RHVEVVRYRCTRCRRTFRDYPEGVGNGRHSERLKKLSVILWSLGLSYRRVAGVLRIFG
                     LRLSHMSGWRHVQAEGEKLMGELKWKSVRVVGVDGAWVGGKGVMVAVDLGDGSLLEVA
                     EVDEKDSRALFTWLKRLKEMHDIGAIVSDDLAIYKQLTDELEIGHQVCQFHVRRWVKH
                     ALKGLQAELDPAWQGVLEKVEEILRDLPLHGDRLLHRLWKSLPGRSTPPEGKRTPLEK
                     LRDLILRLSRDWQRYVAFYADVGIPWTNNRTEQMIGRLKSRAQQARRYKTTAGLLRGS
                     TVACQFWA"
     repeat_region   418232..418258
                     /note="27bp imperfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   418259..418266
                     /rpt_type=flanking
     tRNA            418319..418391
                     /locus_tag="ANT_t0070"
                     /product="tRNA-Lys"
     CDS             418677..419177
                     /codon_start=1
                     /gene="rplI"
                     /locus_tag="ANT_03840"
                     /product="50S ribosomal protein L9"
                     /protein_id="BAJ62418.1"
                     /transl_table=11
                     /translation="MKVLLIKDVYKLGRAGDVKKVADGYGRNYLIPQGLAVLATPGAL
                     KMAESIRARAAKQREALNQEMSGLAQRIQGQYLTFAARAGETGKLYGSITPTMIAEAL
                     SRKLGVTIDRHQIEAQSIRNLGEFKAHVRLTVDLVPEINIIVHREGETPNVPVEETQT
                     GEGEIA"
     CDS             419298..420650
                     /codon_start=1
                     /locus_tag="ANT_03850"
                     /product="Xre family DNA-binding protein"
                     /protein_id="BAJ62419.1"
                     /transl_table=11
                     /translation="MTLSVGERLKQTRLEKHLTLEQVSQATRVRVHYLDALERGDLEA
                     LPSRVQGKGFLRLYADYLGLPVDEILAQWEGKPLPSPVQPSPQPEEVQESHRMPVEPA
                     APPPAEVEVFVPATEVPVTPPAGASSSLILLKEIGQELRRKREALGFSLADVEEFTHI
                     RTRYLQALENGQLEQLPSPVQGRGMLQNYADFLRLDTEDLLNRFAEALQQRRIEQTIR
                     IESPTAPRAKPITRIRRWVTPDLLIGGGLILALFLFVAWTAGRITAERTRMAQATLPS
                     ISDVLLTTPSPTPGEQSAPSTPAPQQTPLEGEGNPAPTEIPPTEGTPVSTVAPISNAP
                     VQVYLIARQRAFLRVIVDGKIAFNGRTIPGNAYPFSAEKSIEIISGNAAALQVYYNQQ
                     DLGVLGEMGKPLRLTFTQQGVLTPTPLPTATPTATPPVTPTPTPTPLLATPTITPFIP
                     "
     CDS             420667..422001
                     /codon_start=1
                     /locus_tag="ANT_03860"
                     /product="hypothetical protein"
                     /protein_id="BAJ62420.1"
                     /transl_table=11
                     /translation="MSKRFYLVSLGCAKNTVDSQSMASLLQEAGFEPTDRQKEADVLI
                     VNTCGFIGPARQESLDTLRDLARHKKKHQLLVAAGCLTERYRQQVAQEVPGIDGILGT
                     RRWMDIVDLVQQLRPGRKYPEPLYHLPETPTVGKDEKGVLRAAIQGASAYLKIADGCR
                     RPCAFCAIPLIKGTAVSRPPEVILQEARILQDEGVKELLLIAQDTTDYGHDLGMKDGL
                     ATLLEGILREAPEIPWIRILYAYPGYVTDRLIEVMANHPQIVPYLDMPLQHAHPQTLR
                     RMRRPSNMEWVYQTLAKMRAAIPNLALRTTFIVGYPGETEEEFQTLLDFVQEIQFDHV
                     GIFTFSFEKGTASEPLGDPIPAEVKQERLARLAEVQERVSLARNQSYVGQIQPVLIEG
                     FDRGIAIGRAPHDAPEIDGLVFVEGEAPVGEIVPVRITGAMTHDLTGVLVRP"
     CDS             422014..423552
                     /codon_start=1
                     /locus_tag="ANT_03870"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62421.1"
                     /transl_table=11
                     /translation="MNASPLRRERLWDGFALLLALVGFLASAQVTFRIFEAIPHIEDE
                     MAYTWQARLIARGFTLTIPTPPCPNCFLVPFVVDAHGQRSSKYPPAWSVVLALGERLG
                     ARAWVNPFLAGLSVWLIYRLGKRLLNAPTGALAALFTVISPFFLMNSGSLLNHPWALF
                     LTLAFTLAWLDAFFPSRIPAWLSLPTAGLSMGLLALTRPLTAVGVALPFAVHALIILW
                     RGDARRRWRLLLFGGIAGAVSLLYFVWQYAVTGDPFLNPYLLWWEYDKIGFGPGVGVR
                     EGGHTLVQAWFHTRFSVGVGSHDLMGWVYLSYLFFPFGLIALRRRPQAFLPVGVMLAL
                     VAVYNLYWTPAWLYGPRYYYEGLPGAMLLNAAGVCWLAGWVTGKGRAVRWGWENRLGL
                     AGLAFTVMFLCAANVSLYLPIRLSMLVGLYDVRASDLALFLSPEAQKMPPTLVIVYPQ
                     RKWIEYGRLLDLSSPLFDSQFVFTIDRGEILNQEVIQFFPGRLVWHYTPGVTRLTPVS
                     DDAP"
     CDS             complement(423553..424068)
                     /codon_start=1
                     /locus_tag="ANT_03880"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62422.1"
                     /transl_table=11
                     /translation="MQASSLALALTYWLHMLATVLWLGSLSALAVLVLPAARRRLDAS
                     AYAALLEDLQERLQPLAWLSLAVLAATGMFQMSAHPRYSGFLAIENAWAVAILIKHLF
                     VGGMVLLSAYNTWGLLPQLRRMAILRASGKPLDETQLAQIQRRERLLLTLLLISSVLV
                     LAFTALARAVS"
     CDS             complement(424085..425296)
                     /codon_start=1
                     /locus_tag="ANT_03890"
                     /product="hypothetical protein"
                     /protein_id="BAJ62423.1"
                     /transl_table=11
                     /translation="MSDSCGIMYPMSDMDLENTQPSRPREDMEDTQPHTPVSRGVSPV
                     PPEQRAAENEPHTQPRRRSLRGWVIAGGIVLILLLGGLGAFLGYRAAQAARSQMSREQ
                     IVTLATEQMMLAQQDLEQGRFQIARKRLEYVIQLDPNFPGVQEKLAEVMIQEAFSLTP
                     TATIALATSTPTPTPDFRGEEEIFNNARQLLAQKEWFAVLDMLDALRNKNLTYRAVEV
                     DGMYYIALRNRGLAKINNGNLEGGLYDLALVERFGPLDVDAQGVRNWARLYLTGAAYW
                     GVRWDQVIFYFSQIVPAYPGLRDVNGVTALERYRVALIKYGDQLAAEGKYCDALKQYE
                     AAQQVAPDGMLEPTMTAVYNQCYVQPSETPTLPLTLTPTPTSTGVIVPPTETPTPPAA
                     PSETPTETPTP"
     CDS             complement(425423..425989)
                     /codon_start=1
                     /locus_tag="ANT_03900"
                     /product="hypothetical protein"
                     /protein_id="BAJ62424.1"
                     /transl_table=11
                     /translation="MNIFPFTARVGVRLGWVIGLGIAALILVPVLLFAWVANLPEVYP
                     YTLLKSEAGTLGLAVFSLLVVGILFILLWGWFSTGKIVVNSSGMKWEIEGEKGFIRWD
                     QPFSLHRWRSVYESGGTSYDQPSMTLPVIVYRVAQGDSCLTFWYGESWKKIQDLPDGP
                     LAGVMLFHHARKLAKTIDEMYQQSLKTI"
     CDS             complement(425993..426373)
                     /codon_start=1
                     /locus_tag="ANT_03910"
                     /product="hypothetical protein"
                     /protein_id="BAJ62425.1"
                     /transl_table=11
                     /translation="MWMKLGKVEAPVRLALAFYEACNRQAIEEMLTLLSADCLFESPA
                     APCGSPLRGRDAIAAFWREFFAAHPGARFEVQDVFGAGFRSVARWTCTWKSPDGTAHS
                     FCGVDVFRITGESIAEQVSFGKGE"
     CDS             426739..427677
                     /codon_start=1
                     /EC_number="2.5.1.47"
                     /locus_tag="ANT_03920"
                     /note="protein synonym:CSase"
                     /note="protein synonym:O-acetylserine (Thiol)-lyase"
                     /note="protein synonym:O-acetylserine sulfhydrylase"
                     /product="cysteine synthase"
                     /protein_id="BAJ62426.1"
                     /transl_table=11
                     /translation="MRIANDATELIGNTPLVRLNRIAQEAGAAATVVAKLEYYNPAKS
                     VKDRIGVAMINAAEQAGLIKPDTIIIEPTSGNTGIALAFVCAARGYRCVLVMPETMSK
                     ERRMLLRAYGAELILTPGSEGMAGAIRKAEEIAASDPRYFMPQQFKNPANPEIHRKTT
                     AEEIWRDTDGQVDMVVAGVGTGGTITGVGEVLKARKPSVRMIAVEPDASPVLSGGQKG
                     PHPIQGIGAGFIPDVLNTQIYDEIVRVKAEDAFATARKMARMEGLLVGISSGAATWAA
                     LQVAARPENAGKLIVVIIPSFGERYLSTALFADLAD"
     CDS             427698..428528
                     /codon_start=1
                     /EC_number="2.3.1.30"
                     /gene="cysE"
                     /locus_tag="ANT_03930"
                     /note="protein synonym:serine O-acetyltransferase"
                     /product="serine acetyltransferase"
                     /protein_id="BAJ62427.1"
                     /transl_table=11
                     /translation="MVKKFFQMMREDIASVFERDPAARSVFEILVAYPGLHAVWGHRI
                     AHWLWGRGFKTLARWLSHVMRFLTGIEIHPGATIGRRFFIDHGMGVVIGETAEIGNDV
                     TLYHGVTLGGTSLEKGKRHPTLEDRVVVGAGAKILGAITVGAGSRIGANAVVVKSVPP
                     NSVVVGVPGQVVVRNRPQTTAPDLNHNVLPDTIGTTVAALIERVESLEQRLEEARQQV
                     QPALIGSSDRLERLEAVLRSHVLEHPHLVPGNGKEHHRHGPLPHPDASGVWHAEDFTI
                     "
     CDS             complement(428614..429894)
                     /codon_start=1
                     /EC_number="1.1.1.42"
                     /locus_tag="ANT_03940"
                     /note="protein synonym:IDH"
                     /note="protein synonym:oxalosuccinate decarboxylase"
                     /product="isocitrate dehydrogenase [NADP]"
                     /protein_id="BAJ62428.1"
                     /transl_table=11
                     /translation="MSESGERITMQNGRLHVPSHPIIPFIIGDGTGPDIWRAAVRVFD
                     AAVEKAYRGERRIIWKEVLAGEKAFNTLGTWLPEETLQAFREYLVGIKGPLTTPIGGG
                     IRSLNVALRKELDLYVCLRPVRYFPGVPSPVRHPELVDMVIFRENTEDIYTGIEYEYG
                     TEENARFKQLLKEHFPKDYAKIRFPETAGIGIKPVSKEGTARLVRAAIRYALENKRRN
                     VTLVHKGNIMKYTEGAFRNWGYEVAETEFGEQTYTWAQWERTKAEKGEDSANAEQEAA
                     LKSGKLLVKDVIADIVFQQTLLRPREFDVLATMNLNGDYLSDALAAQVGGIGIAPGGN
                     INYTTGHAVFEATHGTAPKYADKDMVNPGSVILSGEMMLRYMGWTEAADLIIRGMEGA
                     IAAKTVTYDFHRLMEGATLLKCSEFGDAVIRHMD"
     CDS             complement(430004..430333)
                     /codon_start=1
                     /locus_tag="ANT_03950"
                     /product="hypothetical protein"
                     /protein_id="BAJ62429.1"
                     /transl_table=11
                     /translation="MDRSMVTTTFGFEGYRIVRYLGVVRGITVRSRSIAGNFVGALET
                     MVGGKITTYTELCEHARQEAFDLLIQHAEQIGANAIIGMHYDATELMESVTEVLAYGT
                     AVVVEKI"
     CDS             complement(430400..431251)
                     /codon_start=1
                     /locus_tag="ANT_03960"
                     /product="hypothetical protein"
                     /protein_id="BAJ62430.1"
                     /transl_table=11
                     /translation="MFSPVFMLPRRGFYLILAVILLLLLTGCPPKFPCDEKIKDPEPY
                     QQMVLQHPLIQALSETLTIEEVRIGACFVKGKANAAVMFRTPSDFSSLGMLYRGSFDF
                     IFTKDGTLSIPEDGFWEIRDWEISSWDGKSIDLIVGAIRKKIDELESNPRVHEVLTRT
                     QADPLNAANHLNTGQIFRKNARLTYAFRAHQVREYLLPSDIEWETFPEIHQAHEIIQT
                     RLLTGELSNCTIGTGELHNYTGAQIDELGGWYMTVALQCNEKWKDAFLHLLSDGSFER
                     LSIQTEY"
     CDS             complement(431394..432683)
                     /codon_start=1
                     /EC_number="2.7.1.144"
                     /locus_tag="ANT_03970"
                     /product="putative tagatose-6-phosphate kinase"
                     /protein_id="BAJ62431.1"
                     /transl_table=11
                     /translation="MMFGSPAPLLDMVTAQKQGMARGIPSICSAHPVVLSAACHLARR
                     SGAPLLIETTCNQVNHQGGYSGMTPADFVRFLREILEREGIPPQQVILGGDHLGPYPW
                     RKEPAETAIAQALEMVRAYVQAGYTKIHLDASMPCADDDPERPLPLERIARRAAQLCA
                     AAEAAAGAVQPVYVIGSEVPPPGGAQGQEARLHVTTPQEAQAALDAFREAFLQAGLTP
                     VWERVIALVVQPGVEFGVDSIHAYQREAARPLKTFIEGVPGMVYEAHSTDYQTRASLR
                     ALVEDHFSILKVGPALTFAYREAVFALEHIEREILGRQDMPLSRLSEVLDEVMLNDPR
                     HWQGYFAGAPAEQALARRYSFSDRIRYYWHHPAAQEAVRRLLANLIETPPPLSLLSQY
                     LPREYEMVRAGEISSHPQDLIRAHIQHTLEDYAAACG"
     CDS             complement(432684..433634)
                     /codon_start=1
                     /locus_tag="ANT_03980"
                     /product="putative carbohydrate kinase"
                     /protein_id="BAJ62432.1"
                     /transl_table=11
                     /translation="MSETFAPSSRPFDLLVAGEINPDLILNGDVEPAFGQVEKCVDSA
                     TLTIGSSSVIFACGAARLGLRVAFIGKCGDDLFGRYMLEAMQERGIDTRAVIQIPDGH
                     TGMSVILNRGSDRAILTYPGLIAALSADDIPDDLLGQARHLHIASYFLQTALQPGLPD
                     LFRRARRLGLTTSLDPNYDPGASWQGIRDLLALTDVFLPNQTEACALTGTDDPAKAAR
                     TLGKQTGTVAVKMGTQGALGVQGEVMAHAPALTVPVVDTVGAGDSFDAGFLYGYLQGW
                     TLERCLRLGAVCGSLSTRTAGGTAAQPTLAEALGFLEREK"
     CDS             complement(433639..434586)
                     /codon_start=1
                     /EC_number="4.1.2.40"
                     /gene="lacD"
                     /locus_tag="ANT_03990"
                     /note="protein synonym:D-tagatose-1,6-bisphosphate
                     aldolase"
                     /note="protein synonym:tagatose-bisphosphate aldolase"
                     /product="putative tagatose 1,6-diphosphate aldolase"
                     /protein_id="BAJ62433.1"
                     /transl_table=11
                     /translation="MKALSIAKFRSFQTCASAHGTFTFLALDHRQNLRRANPRFEDNH
                     ELSRFKLEVTAELAPFATGVLLDPEVSAAQAIASGALPGTKGLVVALEATGYTGEPAA
                     RRSQILPGWSVEKAKRMGASMVKLLVYYHPESPTAQEIEAFVAQTAVECQRYDLALML
                     EPLSYPLKGERLSGEEKRRVVIETARRLTAIPGVDLLKAELPQATDDLDMGKLADACA
                     ELHEASQAPWILLSAAASFETYLQQTAVACRAGASGIAVGRAVWQEAVALDGSDRLDF
                     LRRIARPRLERLSALCLALARPFTEVYSAEAPFDWYRQY"
     CDS             complement(434609..435466)
                     /codon_start=1
                     /locus_tag="ANT_04000"
                     /product="hypothetical protein"
                     /protein_id="BAJ62434.1"
                     /transl_table=11
                     /translation="MRLRFAHLVLILSIALAGCAPALPPAPSFVRFTETAEMSSENSP
                     HPAADWWRPTVGLTWQWQIGNNEIDTRVDVDVYDIDLYVDQAVIDELHAQGRRVICYI
                     SVGSWEDWRPDKDRFPAEVLGKDYEGWQGEKWLDIRQIDKLAPIMLARLDLCQAKGFD
                     AVEPDNMEIYTNDTGFPLTYKDQLKYALWLAEEAHKRGLAIGQKNAADMVADLVNVFD
                     FAITEDYFYYGEAESMLPYIQAGKPVFAAEYTDLPGDFEEFCRQSRKLGFSTILKNRE
                     LDAWVKFCP"
     CDS             complement(435470..436801)
                     /codon_start=1
                     /EC_number="3.2.1.22"
                     /locus_tag="ANT_04010"
                     /product="putative alpha-galactosidase"
                     /protein_id="BAJ62435.1"
                     /transl_table=11
                     /translation="MTKITFIGAGSLGFTSELVRDILTFPLLEDAHIALMDIHPERLE
                     WAKRQVEKLIAAGKRPATVSATLDRAEALKGADVVLTTILAGSTEVWRHDIEIPKKYG
                     VDINVGDTRGPSGIFRFLRTINPMMDIVRDMEKYYPNAVLLNYTNPMAMLVSAIQKQS
                     FITVTGLCHSVQGTAMMLARWIGAPYEEIDYVCAGINHQAWYLEYKWNGQDAYPLIRK
                     AVTERPEVYNEEIVRNEMFLALGYYVTESSGHNSEYNWWFRKRPDLIEKYCTHGTGWN
                     PGEYAYILKEYQRNEATWKDQVRERLEAPLTPEDLQRGEEYAAYIINALKGGEPFKFN
                     GNVRNTHLITNLPEGACVEVPVYVDRAGFHPTHVGALPPECALLTQLSSGIEEMAVQA
                     SIAGDPTMVYRAICHDPLTASVLSLAEIRQMTNELFAVHKDYLPQFKVHRV"
     CDS             complement(436829..437671)
                     /codon_start=1
                     /locus_tag="ANT_04020"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62436.1"
                     /transl_table=11
                     /translation="MGKRVQTRLLDALTYLILLIGAVGMVTPFLWMVSTSFKLPADQF
                     TKTLIPPTFTLRNFQALFAYGDISFPLLFLNSAVISLLTTIGQLLTCSMAAFCFAVVR
                     FKGRDFLFTLLLLTLLIPFHVTLIPNFVIFSWLGLVGTSVPLWLPAFWGGAFGTFLLR
                     QYFLTIPRDLVDAARVDGATLPQIYWKVYLPLAKPALAALAIFSFQGAWNDLLRPLVY
                     MPAAPNTTLTVGLALFQTQMTRGGNFTVLMAGALISILPLLIVFFFAQRFFIEGIALS
                     GVKR"
     CDS             complement(437685..438572)
                     /codon_start=1
                     /locus_tag="ANT_04030"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62437.1"
                     /transl_table=11
                     /translation="MEAGLKPLGREKFWLWAMLAPTLFGLFFSAFGSLLATLALSFTR
                     WDLLTPPQWAGFANYIALFKDPKNLTSLLNTVRFTAMYVPGVVIVSLLVAVLMNRGLK
                     GISFFRTAYYLPAVTSAVATALVWQMIYGKDTGILNYLLESLGLQPVCWLCTDMALYS
                     VVIVNIWGAIGEGMIIFLAGLTTIPREYYEAAEMDGAKGLQKFFRITLPLITPSIFFQ
                     TLISTINAFQAYDYIYMLTRRGQGDSSVPVVVFSIYRNAWHFSNYGGASAQAIELTLI
                     VAALMGLYLWLEKRFVVYE"
     CDS             complement(438643..439923)
                     /codon_start=1
                     /locus_tag="ANT_04040"
                     /product="putative ABC transporter substrate binding
                     protein"
                     /protein_id="BAJ62438.1"
                     /transl_table=11
                     /translation="MKRTLFSLILVLTIVLTACAQAGGTPAPSGGAAEIRFMAWGDPA
                     ELEVWKQIVADFEKENPNVKVNVEVSDWDSYWTKLKTLLAANTPPDIFAIDAPLYKDY
                     QSRGVLLNLKPYLDANPGLLDGLYPVTLKAYETPEGYFGLPRDFQTIVVFYNKDMFNA
                     AGIPYPQQGWTYDDLREIARKLTKDTNGDGKVDQYGFYADLWDMELIWGEGIWAHGGD
                     VISADYTKTLIGTPEARKAWQLFHDMIFVDGSWPDANTAAQYGGDPFLAGVAAMTTIG
                     HWAIPGYAEASFKWDVAPMPAGPAGQATSVNSAGFVVAKATKYPQESFNFIKFVLSEK
                     GQTRLAELGFACPVLKSVAESPAFLEQEVKVNHQVFLDSLAFARMKPSFKGYEEWSSV
                     IGDGMSVVWTGEAELDATLDEVVKQADEVLAKNR"
     CDS             complement(439948..440997)
                     /codon_start=1
                     /locus_tag="ANT_04050"
                     /product="hypothetical protein"
                     /protein_id="BAJ62439.1"
                     /transl_table=11
                     /translation="MENGTFTLQEILSQPQAWASALDVLKASQADIRRFQPGEYAQIL
                     FTGCGSTYYLALSAAALTQELTGAPARAFPASELWLNPDIVYTGGKTLLVAVSRSGET
                     SETLHACRAFLDQKRGDLITLSCYPQTPLAGMGTLNLVLPSGQEQSVAQTRAFSTLYL
                     GTMALACEWSGRADLLDALTRLPEAGAQVLENSAGLAGELGQDASLDRFYWLGSGTRY
                     GLACELSLKMKEMSLSHSEPFHFLEFRHGPKSMITDSAVVIGLRSARNGQAEGAVLDD
                     MLALGGRVVDLAFADAPLFPEKATYRLTLPAPLSEAIRNILYLPVGQRIAFERALSKG
                     LNPDRPTHLDTVVKL"
     CDS             complement(441002..442039)
                     /codon_start=1
                     /locus_tag="ANT_04060"
                     /product="amidohydrolase 2 family protein"
                     /protein_id="BAJ62440.1"
                     /transl_table=11
                     /translation="MLLEHYKPRSKLVTRQSVVEKPRFPVIDAHNHLAPPFGGDWEEK
                     PINELLDRMDAAGVIHYVDLDGGWGEDILNRHLDLFKARAPERFTIFGGVDWNQWEYL
                     GNRFPEWAAERLRIQKARGAEGLKIWKHFGLHVRDHTGARVAVDDARLDPVWQTAGEL
                     GMPVLIHIADPVAFFDPIDETNERWEELGAHPDWSFPSPPFPPFLEIVNALHRLVKRH
                     PQTTFIGAHVGCYAENLAWVGSVLDDCPNFFVDIAARIGELGRQPYTARRFFLKYADR
                     ILFGTDVGPDLETYRIYYRFLETDDEYFNYNPGEIPLQGRWYIYGIFLPDEVLEKVYA
                     GNARRILRIQG"
     CDS             complement(442063..442839)
                     /codon_start=1
                     /locus_tag="ANT_04070"
                     /product="DeoR family transcriptional regulator"
                     /protein_id="BAJ62441.1"
                     /transl_table=11
                     /translation="MDIPSLSNIERQQAILALLQRQQRVKIAQICEEFAVSEATARRD
                     LEALASQGLIQRVHGGAIPLQPAAPEPPLLERSHEQADEKARIGRLAATLVQDGETVF
                     LGSGTTVLEIAKHLRERKGLTIITNSLPVVNLFAGMEHIQVVCLGGILRDSELSFIGH
                     ITEQALSEVRADKVFLGVRAVDLEHGLTNDYLPETMTDRAILKIGREVIVVADHTKCC
                     RVSTAFLAPLTSMHTFITTQEADESFISALQELGVRVLLA"
     CDS             complement(442995..444791)
                     /codon_start=1
                     /EC_number="6.1.1.10"
                     /gene="metG"
                     /locus_tag="ANT_04080"
                     /product="methionyl-tRNA synthetase"
                     /protein_id="BAJ62442.1"
                     /transl_table=11
                     /translation="MSTPVLIAVAWPYANAEIHVGNITGAYLPADIVARYHRLKGNRV
                     LMVSGTDSHGTPVTLRADAEGKPVEEVYKRFHQSFLDLFQKAGLTYDLFTTTHTENHF
                     KVAQSVFLALLKNGYLYTEVRPQWYSPSLRRFLPDRYIEGTCYICGDEHARSDQCDKC
                     GNVLEPEKLINPRSKVDGSTPELRETVHYYLDLSKLEPEVARFLRERQHYWRETVCNQ
                     TLGQIESEGLKSRPITRDLDWGIPVPVEGWEGKCLYVWFEAVIGYLSAPIEWARLHGL
                     GDAWKDWWVNPESRTIYFIGKDNIFFHAAWWPAQLLGMGETFMEIFAGEKGQKLVLPY
                     DVPANQFMNLEGDKISGSRNWAVWGHDFLSRYDPDPLRYYLTVNMPEMRDTDWDWEDF
                     YKRNNDELVATWGNLANRVLSFAVKHFEGKVPEPGALTELDEEILRKVESGFESVGAE
                     LEAVHLRSALGSAMALATEVNRYLDQTAPWKEIKTDRQAAARAIYTALRCIDNLSVLL
                     SPFLPFSSEKLHQYFGYEKPLFGKQATRTVQDGLGEHTVLLYDPDDAAGKWQPSALQP
                     GQPLQAPQPLFKKLDASIVEEERARLRAQRKS"
     CDS             complement(445028..445630)
                     /codon_start=1
                     /locus_tag="ANT_04090"
                     /product="hypothetical protein"
                     /protein_id="BAJ62443.1"
                     /transl_table=11
                     /translation="MSELYLASMYLEQGDRENAARELERILSMDMDNIHAWRLLAHAL
                     TNPDEIRECWDNVLRLNPRDPEAIAALKALENRSAYMEGTPPPFPEEDMQALEKGMMP
                     ALEEEDAPSLEYRIATEATRPVTPRTGDEFAYLERNTQPRAEEKPEKGFFENDFIFYT
                     LIFLVLLFIAIIAILVFFGPQAFDPLFQWLKSLGIPLGAP"
     CDS             complement(445674..446864)
                     /codon_start=1
                     /locus_tag="ANT_04100"
                     /product="RNA polymerase sigma factor"
                     /protein_id="BAJ62444.1"
                     /transl_table=11
                     /translation="MASPGSNKRGTEILKMLLEKADVQGYLTTEDLMEAYPNVGEDHE
                     RFEAILLALRRHGVDIYDTEENEYPFPDEDIDGAFIEEDPVQTFDLNRISSDDTVGLY
                     LKEMSRVPLLSSEEEVELAKRIERGRAAKKELTRNSARLSPQRRGELEAQIQDGESAR
                     EHLIKANTRLVVSIAKRYIGRGVPFLDLIQEGNLGLMKAVEKYEYQRGFRFSTYATWW
                     IRQTITRSIADQGRTIRVPVHMVDRIRRLYRTTHEMEQKLGRTPTNEELADAIGIKAS
                     KVDWMMRVSWLPLSLESPINEDEEDSELGQFIEDQVTPSPMQTTYSNLLREKIQEVLD
                     TLPAREARILRLRFGLENGRTYTLEEVGQKFGLTRERIRQIENKALRRLRHPRRARQL
                     KDYL"
     CDS             complement(446975..447454)
                     /codon_start=1
                     /locus_tag="ANT_04110"
                     /product="hypothetical protein"
                     /protein_id="BAJ62445.1"
                     /transl_table=11
                     /translation="MNLPRHPLRVNVGFLLNAPVGYSRDIHFEFPLVQLEGDFLVSEF
                     NGLLRVSRTPQGILSQCDFQGYTEVECVRCLSPFPQFVHTVFSELYAFNRRSLTESNL
                     LFPENGYLELESLVREYLILEIPISPVCRPDCKGLCPVCGENLNLRLCEHSILPSQV"
     CDS             447559..448161
                     /codon_start=1
                     /locus_tag="ANT_04120"
                     /product="HAM1 protein homolog"
                     /protein_id="BAJ62446.1"
                     /transl_table=11
                     /translation="MTKLLIASTNRGKLREFQAILAGEPYELFLPADLGIALTVEETG
                     ETYRENAGMKARAYAQASGLITLSDDSGLEVQALNGAPGLHSARYAPQKGATDADRRA
                     YLLENLRDKPRPWLARFVCTVAIATPQGEVFFTEGECPGEIIPEERGTHGFGYDPIFL
                     FPERGLTMAELPPEEKNRISHRARAVLAAIPILRQLLAEG"
     CDS             complement(448158..449921)
                     /codon_start=1
                     /locus_tag="ANT_04130"
                     /product="putative two-component sensor histidine kinase"
                     /protein_id="BAJ62447.1"
                     /transl_table=11
                     /translation="MKRADFPYLADWFAITFRWMAIVALAFSLILYMDGQWLPLALLA
                     GSLVWNLTMTVLAVFNQRLPAHRTLNTLVDLAISMTLFGLTGSATTPIQWVGVLAIAP
                     SAMYFELRGALLIAVMATALETGILYFLFPAQFNLLVVEYLGGLNLAIGLVFGGLSLP
                     LMKRVRTTYHELVRKQHESETAIQRRERERLQAFFDMIETFSSTFNYKRVLEVGIQAG
                     IKAMGLSEAEGARLLAAFFLFEDHTLRYVVGQGFPQRDQNLPLAAQEGILRKALQSGE
                     PQIHHGACDDPELSELVALHTCQSLLIIPLLRGMNVYGILLFAHPDQNFFPPERVEYL
                     MIVGHQAVIAIQNARLFADLQEEKERIVQTQEEAQRKLARDLHDGPTQSVSSIAMRLN
                     IARRLLHQNPTAAEEELAKIEELARRTTQEIRHMLFTLRPLVLESEGLEAALKAMAEK
                     MRDLYQQNVVLDVDPTAVSALDSTQQTVVFYLCEEAVNNARKHAEASQITVRLKYVTN
                     YTDIIGLEISDNGKGFNVNEVMGSYERRGSLGMINLRERADLVNGLLRVDSAPGKGTR
                     IRVFIPLTEEAMDRLHGRVRA"
     CDS             complement(450044..452500)
                     /codon_start=1
                     /locus_tag="ANT_04140"
                     /product="ATP-dependent Clp protease ATP-binding subunit"
                     /protein_id="BAJ62448.1"
                     /transl_table=11
                     /translation="MMRFDRFTERAQEAAQRAAEIIQRYGHNQIDTEHILLAMIEQPQ
                     GAVPQLLEMLKVDTNALAERLDYILRTSPKASIFGGGAGQIFITPRVKRIIDIANEEA
                     NRMKDEYISTEHIFLAILSERSTPAARLLESAGVTRERVYDAIQVLRGGQRVSDPQAE
                     TRYRTLEKYSRDLTQQAREGKLDPVIGRDKEILRVMQILSRRTKNNPVLIGEAGVGKT
                     AIVEGLAQKIANNDVPEILAGKRVIALDLGAMIAGSRFRGEFEERLKAAIEEVQRSEG
                     EIILFIDELHTVVGAGAAQGAMDASNMLKPSLARGELQCIGATTLDEYQKYIEKDAAL
                     ERRFAPVFVDEPSVEDTIQMLRGLRDRYEAHHKVKISDEAIVAAARLSSQYVPDRHLP
                     DKAIDLIDEAAAKLRVALYSLPPDLKQMKSELDRLKAEEEQAGQERDYERAAIKKAER
                     LRLESQYNELRIRWETEHQLDGQVDENDIAEVIAQWTGIPVSQMMESEAEKLLKMEER
                     LHERIIGQDEAVHAIADAIRRARSGLKDPRRPIGSFIFIGPSGVGKTELARALAEFLF
                     GDEDALVRLDMSEYREQHTVSRLFGAPPGYVGYEEGGQLTEAVRRRPYRVILFDEIEK
                     AHPEVWNALLQILDDGRLTDGQGHVVDFRNTVLIMTSNLGTEFVRRGGTLGFLPSENS
                     EDRQAHDKIEKALKSTFRPEFLNRIDEIIIFSPLSMEHMLQIVDLQMQEIRARLQEHG
                     LDVELSTEARNWLAKVGYDPNFGARPLRRALQKYVESPLSVSLLSGEFKPGDRVLVEI
                     QDERPVFRKLEEPAGEPSTP"
     CDS             452643..453698
                     /codon_start=1
                     /locus_tag="ANT_04150"
                     /product="hypothetical protein"
                     /protein_id="BAJ62449.1"
                     /transl_table=11
                     /translation="MLQHVQKTCPFFSALLCLCTTIKPVKVFIPVKTSSIRPLDVNRD
                     MLAVAALIEECFASTLDPDGREYLYHIRRAVEDPALIRWVWTTDEEVSSPLFGYVWEE
                     DGRIVGNLTLIPARKGKEWVYIIANVAVHPDYRRRGIARQLTLRALDHLRQHHIRSAW
                     LQVREDNPAAHHLYLSVGFAERSRRALWLSSLPGVRPPHVPGVRVTGRRWRDWKCQRE
                     WLQRTYPSDVRWNLSLSISRFNANPFYQFVQWMMGSNQRHWVARGVGADRKPWGFLSW
                     EHLTSYIQMLWAATNPAHEEEALMALLPRAQQELAHLHLPLGVNYPASKAEAAFQACG
                     FHLHSVLIWMEYRLEGE"
     CDS             453791..454192
                     /codon_start=1
                     /locus_tag="ANT_04160"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62450.1"
                     /transl_table=11
                     /translation="MQKLLIRLGINAVALYTAIYLLSGRGITHQFENWWEILWLALIF
                     GLVNALVRPVVIAMSCPLLILTLGLGTLLINTLMFVIAGWIGTQFGVGFEVDGFMPAF
                     LGALIVSVVSALLSLFFHDEPRKHRPRPRRD"
     CDS             complement(454217..454690)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ANT_04170"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ62451.1"
                     /transl_table=11
                     /translation="MEITIRPATHEDAPLLADWHVRMFIELLEEEGQAINPQEMLVLN
                     AVTQQYLATRLAQDKAAAWLLLENQQPVACAAVSILPCVPAPGRLDMEYPLLHSVFTL
                     PEHRRKGYARRLVEQALEWCRQRGFSSVDLHASRAGEPLYRALGFHPTHEMRLAL"
     CDS             complement(454761..455489)
                     /codon_start=1
                     /locus_tag="ANT_04180"
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="BAJ62452.1"
                     /transl_table=11
                     /translation="MEPIIHIENVHKYFGRVHALRGVSLDVQKGEVVVIIGPSGSGKS
                     TLLRCINRLEEFDKGRIVVDGIPLDSAENINAVRTEVGMVFQQFNLFPHLSVLENITL
                     AQKIVRKRSDSEAVKIAMDLLEKVGIPEKAHAYPAQLSGGQQQRVAIARALAMNPKIM
                     LFDEPTSALDPEMIQEVLDVMLQLAREGMTMVVVSHEMGFSRNAADRVIFMDGGVIIE
                     EGPPSVIFSNPTQERTKLFLSKVL"
     CDS             complement(455492..456316)
                     /codon_start=1
                     /locus_tag="ANT_04190"
                     /product="amino acid ABC transporter permease protein"
                     /protein_id="BAJ62453.1"
                     /transl_table=11
                     /translation="MSTSTPAEVDPHLPTIRGNENVFRWDAGWLLVLAASALLAILVL
                     VVGNPFDRIFRFVLDGLRVTVMVTLVTFGLVLVVGIIGALGRLTHIAPLRGLATLYVE
                     VVRGIPLLVQLYFWYYAFPSIVRDLGTQWNVESMKNFVANPYVMAIAGLTLCYGAYMT
                     EVYRAGIQSIPKGQMEAARSLGMTYFQAMRYIILPQAIRVILPPVGNEFITLLKDSSL
                     VSAVAVADLTRRGREFQAITPLPLHIYLMIGLMYLIMTLLSARVVAMIEARMSKER"
     CDS             complement(456413..457168)
                     /codon_start=1
                     /locus_tag="ANT_04200"
                     /product="amino acid ABC transporter substrate binding
                     protein precursor"
                     /protein_id="BAJ62454.1"
                     /transl_table=11
                     /translation="MKRFSVILWAMLIMALVFSACTPAQPSEKTKVRVATDATFPPFE
                     MVDENTKQLTGFDVELMNAIAQKAGFEVEWINVGFDPMLAGIAECQYDMAIAAITITE
                     ERKASMDFSDPYINAGQIVTVRKETTDISGKNDLKGKKIGAQLGTTGAIEAEKIEGAE
                     VKTYDSYDQAFLDLANGQIDAVIADYPTTLAFLATNPDKLKTVGEVFTDENYGVAFCK
                     KKADLIPQVNAAIKALKEDGTIKKLEEKWLAGK"
     CDS             457298..458260
                     /codon_start=1
                     /EC_number="1.5.99.8"
                     /locus_tag="ANT_04210"
                     /product="putative proline dehydrogenase"
                     /protein_id="BAJ62455.1"
                     /transl_table=11
                     /translation="MFRAFFVSLSRATWAQKWITRLPVARQAAARFVAGETQAEALQA
                     VRQLNQRGILATLDHLGESTTRASDAQQATAEILSLLDAIQQAGVQANVSIKLSQIGL
                     AVDPALCEANLWKILEKARDLGNFVRIDMEDSSLTQRTLDLYLKALVSGFADHVGIVL
                     QAYLYRTEADLTRVLTAGGRVRLCKGAYKEPSTLAFSRKADVNLNYDQLALQMLRHTL
                     RHGTPQVSADGRTPPIPALATHDPQRIRFARQAVEELYLPKRAVEFQMLYGIRRDLQE
                     SLAAEGFPVRVYVPYGTHWYPYFMRRLGERPANLWFFVKNFFQR"
     CDS             458260..459159
                     /codon_start=1
                     /locus_tag="ANT_04220"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62456.1"
                     /transl_table=11
                     /translation="MEPAETSTLSQHVLRIARPWALGFSLLTYALGGGVAHYLGVTIE
                     WGRFLGGQLLVFILLLCGFFLFETFELPLESAVPAPGEKPRRLSRIQALRISVILLTG
                     GAALTALWIAQGVLNTVAFLVLGISVLVMLALSVPPLRLANSAYRDLLWGILFVYLIP
                     AFAFALQSGELHTLLGFITLPLIFLYLASSLALSLEHYASDLKQGRRNMLNRLGWERA
                     VGVHHYLVLVGFLLFPLGSLMGIPRSLLFPGLLGLPVGLFQIWQLMRIAGGAPPRWRL
                     LMITAAATLVVTLYDLNLALWTD"
     CDS             459163..460398
                     /codon_start=1
                     /gene="moeA"
                     /locus_tag="ANT_04230"
                     /product="molybdopterin biosynthesis protein MoeA"
                     /protein_id="BAJ62457.1"
                     /transl_table=11
                     /translation="MPEFLELLPPAQAWEVFRNALPSAVLPAERLAVVQARGRVTAEP
                     VVSPENLPAFSRSTVDGYAVQARDTFGASESLPAYLKLIGEVPMGAAPSFSIRRGECA
                     LIHTGGMLPEGADAVVMLEHTQSSRPDEVEILRAVPSGENVLLAGEDVRIGEVVLPAG
                     VRLEDAQIGGLTALGILEVNVVRQPRVGILSSGDEVIPPERQPQPGQVRDINSYSLSA
                     LVERHGGLAVRYGIVPDRPEVLRETLRHALSECDAVVITAGSSASTRDFTAAVINEMG
                     APGVLVHGVNVKPGKPTILGVCNGKPVIGLPGNPVSALVIARLFVVPVLRSLLGLSGE
                     VWQSAVRAVLTVNLASQAGREDYFPVQLIRKGETLFAEPIFYKSNLIFTLARADGLVK
                     IPASATGLGVGEEVDVQLL"
     CDS             460406..461338
                     /codon_start=1
                     /locus_tag="ANT_04240"
                     /product="hypothetical protein"
                     /protein_id="BAJ62458.1"
                     /transl_table=11
                     /translation="MRRILLGLLVMALAGAVGCATTGYAAPLDEAGQTQVAQKVETML
                     ATANSFPANTPSPGSSATLPPTFTASPTMTLTPTLTPSPTWKNVFAGEVYAPILLYHR
                     VVEGQENNRYAVSPTAFEEQMRFLAENGYTTITPAYLARVILVGGQLPERPVLITFDD
                     GYADTYTNAFPIMEKYGLKGALYVVTSTVGVGEFITIEQLRDLAAHGWEIGSHTVRHV
                     DLVKNPDQVEKELEDSRQTLQDWLGMPVLTMAYPYGKANEYVQTKTRLAGFRAGLRIG
                     IFNRHTPDSLFELSRREVRAEYTLEQFIELLSVP"
     CDS             461328..463328
                     /codon_start=1
                     /locus_tag="ANT_04250"
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="BAJ62459.1"
                     /transl_table=11
                     /translation="MCHNPEWGGKTMSVYLHDIPLPEAQQRLIQALEEVGLESVLGVE
                     EIPLDERALGRVLAEPVWARLSSPHYHASAMDGFALRAEATAGASPTRPVILQVGEQA
                     VYVDTGDPLPDWANAVVPIENVEALDEQDIPAADARHPLKIRLREALPPWTHVRPMGE
                     DIVATELVLPAGHTLRAVDLGAIAASGHTHVRVSRPPRVAILPTGTELVPVGQPVKRG
                     DIIEYNSLVLAAQVRSWGGEAVRFPITPDDFEQICQRVQQAADMTDLVLLNAGSSAGS
                     EDFSARAVERLGTLLVHGVAVRPGHPVIMGLIRRSQGGWTPIIGVPGYPVSAALTGEI
                     FVEPLLARWLGRRPAEPLEIEAQITRKVTSPAGDDDYMRVVVGKVGNRVLAAPLSRGA
                     GVITSLVRADGIVILPRGVQGLEAGAPVRVRLYRSPAEVEQTIFAIGSHDLTLDLLAQ
                     ALSAHQRRLVSANVGSLGGLVALRRGEAHLAGAHLLDPQTGEFNIPYIRQYLPDTPVT
                     LVEWVGRIQGLLVCKGNPLNIRGLEDLVRAGVRFINRQRGAGTRILLDYHLERLGIDP
                     AKIQGYDQEEYTHLAVAAAVASGRADCGLGVMAAAQALDLDFIPLFTERYQLVIPTVY
                     YESDLLAPLRVLMQDENFRRSVQGLPGYTVENMGQVVAQLPQ"
     CDS             463350..463829
                     /codon_start=1
                     /EC_number="1.11.1.15"
                     /gene="bcp"
                     /locus_tag="ANT_04260"
                     /note="protein synonym:bacterioferritin comigratory
                     protein"
                     /note="protein synonym:thioredoxin reductase"
                     /product="putative peroxiredoxin"
                     /protein_id="BAJ62460.1"
                     /transl_table=11
                     /translation="MVLSANQPAPDFTLADETGAMRSLSEFRGKPVVLYFYPKDDTPG
                     CTTEACNFRDDYHVYAENGVVILGVSPDSPKSHAKFKAKYNLPFTLLADEEHRVCEMY
                     GVWGRKKFMGREYDGVFRTTFLIDPQGMIVKVWEGVKPEGHSQEVLEALRDWQGASA"
     CDS             complement(463927..464367)
                     /codon_start=1
                     /locus_tag="ANT_04270"
                     /product="putative Rrf2 family DNA binding protein"
                     /protein_id="BAJ62461.1"
                     /transl_table=11
                     /translation="MFRVSRRIDYGVQLMIALAQTEAERPVPTAVLAEKLHIPLPFLH
                     QIGRSLIQSGYIRATPGPRGGLRLKQSPENISLLQIIEALEGPMRIVPESNGNGMMTR
                     EVWAELQEKVVAALASIRLSELAKKAPQGALLSVESINMAERNN"
     CDS             464394..464585
                     /codon_start=1
                     /locus_tag="ANT_04280"
                     /product="hypothetical protein"
                     /protein_id="BAJ62462.1"
                     /transl_table=11
                     /translation="MIDQNNNQLKTFSKVTFFTFWLDNHHNHNQFSPELSSRNSLQTV
                     NNLAGGMGKITGKETLYHP"
     CDS             464686..465117
                     /codon_start=1
                     /locus_tag="ANT_04290"
                     /product="cytochrome c family protein"
                     /protein_id="BAJ62463.1"
                     /transl_table=11
                     /translation="MKKSFWILLAVVVMSALVLAACGGGGGQATVERKAPPPEYAGKT
                     NPYAGDAAAIAEGKELYNVNCATCHGETGAGDGPAGASLDPKPANLITAAKEASEDYE
                     FWIVSEGGAAAGRSASMAAYKGVLTEDEIWKILAYTRTFGK"
     CDS             465193..466878
                     /codon_start=1
                     /locus_tag="ANT_04300"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAJ62464.1"
                     /transl_table=11
                     /translation="MLTNAGNVLGWIVLWLAVLAGIGILFWLFRREHSRRVQFQTRIR
                     QLEQQLNAVLELNRALAESEDEKSLIETALAQINRLVGGMGASFVPFDAWGEPLPAFT
                     AGDLPEPVLKGWAEHLVSEQVRGACRTCEMLQSLSGKTCPLRWGPMGAMEIYCFPLAL
                     GERRLGMVNLYLPSGCSLDSALHDFLQGILNELALAVETARLHRQEVLTLRQIQALRL
                     PRRDLQSTLSALLQRVRDHLGFGTLIIQVRPLQDERLSGLRIVVGDVQAYPAGWLEIL
                     LEQALVCKEARQRREEYGWVRMYPLQLPDGLSMGCLVLLEPVMEDLLPAQQALLQTAA
                     AQAALMIENERSLLALEYTLILQERTRLAREIHDGLAQTLAFLKMQVAQMQTALQQGD
                     LTRLARLLSENKQALEEVYQETRQTIDHLRTQPEEDLTVWLEGLASSFQRHTGIPVEV
                     RWLTQPPTLAPEVQVQMVRILQEALNNVRKHAHASQVSITLREWGRDVVMEIHDNGRG
                     FDPEDVPEVAQYGLRGMRERAEMIGAELQIISAPHLGTTVRVALPYRQEENVE"
     CDS             466875..467519
                     /codon_start=1
                     /locus_tag="ANT_04310"
                     /product="NarL family two-component response regulator"
                     /protein_id="BAJ62465.1"
                     /transl_table=11
                     /translation="MSGKYRLVVVDDHALFRRGLISLLEEMPEFDVVGEASDGEEALK
                     VIAQRHPDIALVDVNMPRMDGIALVQALRRQKSALKVLMLTISQEDQDLIGAIRAGAN
                     GYILKNTEPEDLRKALLNIAEGKGVLSPEVVPPVLGVMQRGTLDSSPQLLSDRELEVL
                     QCLAEGLTTQQIASRLFISENTVKTHIRHILDKLEASNRTEAVGKATQLGILRR"
     CDS             467596..468453
                     /codon_start=1
                     /locus_tag="ANT_04320"
                     /product="hypothetical protein"
                     /protein_id="BAJ62466.1"
                     /transl_table=11
                     /translation="MQRERISENVYWFQSEIYAQVTAGAVTGPYWAVVIDTLALPEET
                     LAMRAFIEEELGVPVRYVINTHYHADHCWGNGFFPGATVLGHALTRKLMLEKGAASLE
                     SAKRQNPAFKQVKLIPPHITLEEGTLVLRVGKKSLTLFPTPGHSVDGISVLVEEDRVL
                     FAGDAFLPLPYIVDGDAEVLSDTIRKIGKMGLENIVQGHGDIILRGEIDEAVKENLAY
                     LSTIRKQVRAALRKRNPVDALLAIDIESCGKSRVFLGGLAEELHRRNLRFLFRQMQNE
                     EERVEASER"
     CDS             complement(468538..469230)
                     /codon_start=1
                     /locus_tag="ANT_04330"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62467.1"
                     /transl_table=11
                     /translation="MIMQVIQVLGVLVVSYLLGSIPFGWIIVKLSTGRDIREVESGRM
                     GGTNAMRAAGFLAGLLTAIGDIAKAYVTHWLVVWFIPADWGIRIWLEVAAPLMAILGH
                     NYSIYLLTRHSDGTVKLRGGAGGAPCFGGTLGILPWSAYIILPIGVLVYVFVGYASVT
                     TLSIAISATALFTYLTLTQGYPWQYILYGVFSFFILAWALRPNLKRLAEGTERAVGLR
                     AYLQKRRQAQSK"
     CDS             complement(469267..469674)
                     /codon_start=1
                     /locus_tag="ANT_04340"
                     /product="hypothetical protein"
                     /protein_id="BAJ62468.1"
                     /transl_table=11
                     /translation="MRFPEDMVEQILNHMQGNLQEERCGLIGGVNGEAHLFLPITNIL
                     HSPTRFRMDASEQWQAFQTFEAQGLELMAIVHSHPNGPSVPSPTDLAEFAYPGVLYLI
                     AAPTAEGWQLRGFWLDEGQIREEGLEISRNASS"
     CDS             complement(469678..470496)
                     /codon_start=1
                     /locus_tag="ANT_04350"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62469.1"
                     /transl_table=11
                     /translation="MEAHEHLPDRNRMSVVIAAVMLAYAVTPFVQIAPLILQTQLPGL
                     FLSFTIDFSTLSSLLAAALAATGSWWLLLDHPLYPTWQNRGRHWLLPALTAWVIGVPL
                     NTLEVGPEWWALFGLGGVFLVIVLLAEYIALDPEDVRHAPAVVGLTALSFALFLLLTV
                     SLKATGLRLFLTFPAITLAVGLAALRTLYLRLGGVWHWKGALFITLIVGQIASALHYF
                     PLLPLQYGLLLTGLAYALTSIVSAYEEGRTGTALWLEPAIMLGVLSLLAVLIRG"
     CDS             470636..471625
                     /codon_start=1
                     /locus_tag="ANT_04360"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62470.1"
                     /transl_table=11
                     /translation="MASSTRTEIAPPRLMASIHAGFNLVANRAYLLAFPILLDLFFWL
                     GPRYRVKALFSPFIEDWLSMTQAMGGAQVSDMIDTVRKFWEMQLDRFNLFSALSTFPI
                     GIPSLMAGLMPEKTPLGMPSIMEIQSFGQFVSGFLLFSLLGLVLGCVYFSLLAREVRL
                     FEEEHGTLRLLIWEVGQVFLLVVSLILLALVISVPLLGMAAILEMISLQFLQIFTLVV
                     MVALLWIIVPLVFTPHGIFVARRNFLTSALLSVRTWRWLFPSIGLFLLSLLLISQGLG
                     YLWRIPPEDSWLMLAGILGNAVVSTALLGASFVYYRDALLWAEALRRATQVLR"
     CDS             471665..473584
                     /codon_start=1
                     /EC_number="5.99.1.3"
                     /gene="gyrB"
                     /locus_tag="ANT_04370"
                     /product="DNA gyrase subunit B"
                     /protein_id="BAJ62471.1"
                     /transl_table=11
                     /translation="MATPVNTSYGAKDIQVLEGLEAVRRRPGMYVGGTDLKALHHLVY
                     EVVDNSIDEALAGACDHIQVTIHPDSSVTVEDNGRGIPVDIHPEKQKSALEVVMTVLH
                     AGGKFGSGSYKVSGGLHGVGVSAVNALSEWCEVEVRRDGKVHFQRYERGVPVEPVKVI
                     GKCKPNETGTKTTFRFDPTIFKGDLDYKFDTLVQRFREMAFVTRKVTIRLIDERASRE
                     MSFYFEGGITSFVRYLNRNREVLHPVVYAEKEVEGVGIEAAIQYTDAYAESVYSFANT
                     INTIDGGTHLTGLRAAITRVINDYARRNNFLKDGDPNFSGDDTREGLTAIVSVKHPDP
                     QFESQTKVKLMNPEVQTYVQQVVGEAFSTFLEENPQAAKAIIQKCLTSARARDAARKA
                     RDLVIRKSTLESLTLPGKLADCSERDPSKTELYIVEGDSAGGSAKQGRDRHFQAVLPL
                     RGKILNTERARLDKILSNNEVKALISALGTGIGDSFDLSGLRYGRVIIMTDADVDGSH
                     IRTLLLTFFFRYMLPLIEDGHLFIAQPPLYRIAYKNQVRYAYTDADRDRILKELGITP
                     EKASIQRYKGLGEMNPTQLWETTMNPENRTLLMVTVEDAAAADRTFDMLMGAAVPPRT
                     KFIQTHARDVRNLDI"
     CDS             473777..474487
                     /codon_start=1
                     /locus_tag="ANT_04380"
                     /product="Crp family transcriptional regulator"
                     /protein_id="BAJ62472.1"
                     /transl_table=11
                     /translation="MGLRELTSGLESVRLFRGLTPQQLEWVAARAYSRTFPPGVELIV
                     AGTPGETVYFILSGTVKIYVPQVDGTEVIVNILGPGDTVGELGVIDGGERSASVVTLE
                     RTETIWMTGEMFQEALRTIPQMNENLLRILSARVRLTTENVQAYASLDIPGRIARQLL
                     SLAHTYGREQGGGVFIPLRLTQGDIAELVGSSRKRVNQVMVTLRREGVLTFDTEGHIT
                     LFRLKDLERMVEGRVGHY"
     CDS             complement(474560..475816)
                     /codon_start=1
                     /locus_tag="ANT_04390"
                     /product="major facilitator superfamily transporter"
                     /protein_id="BAJ62473.1"
                     /transl_table=11
                     /translation="MNAKKTLLNETLIWFLIAMILANIAGSMYMDLLPLYLQELNASV
                     AQVGLFFTLSAIIPLALQILGGWISDSLGRLRSIALGSLAGVLSYVGLVLAPSWEWLL
                     LAQGLGAVTSALVAPSYGAFIAESSSEENRARVFGVVETLYSVVGIVGPPLGAWLVEL
                     RGFKPMLFVAGILYLSATIIRVRMARNARRQNPAPASALTLDSLRGNLRSLLILLVSG
                     GLLTWLFLTDGVRDIFFRMSFTFFPVYLKSVGGLTIQQIGWLSASLSTAIMATNLLGG
                     WLADRKGEHVAISLGFLLDGISMLIFLRASTFPLFLLSWVLAGVGIGMMSPAYSSLMS
                     KALPERLRGTGFGLLHSSLGVFSLPAPSIGAYLYEKFSPRAPFMLTTVISFLTILPAW
                     FKFRPQKATPAPLAVEGQTAPVSEQG"
     CDS             complement(475788..476831)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ANT_04400"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ62474.1"
                     /transl_table=11
                     /translation="METKIFLPSSFTSRPATLTDAEAVANLLNLCFVEWTGSPETSTQ
                     DLHSFWTNPMMNLERDTLLILDTHQQVVAYGEMYDAPPHVRLYLYGRVHPQSRGKGLG
                     TALVQWGLARASLSLEKAPADARVVLHQFLPAQAVEGARLLESLGFRHIRNSYQMRIE
                     LSTPPQAASFPAHIQVRTVHLENELEALVRAHRQAFHDHWGYVETPMEEALKDWRHWV
                     ETDPRCDPTLWFLAMDGDEIAGYCLCSPGTEEDPQLGWVNLLGVRREWRKQGLGLALL
                     LHGFDALYQRGFHRIGLGVDASSLTGATRLYQRAGMHVHREYHLFEYEVRPGKDYLRQ
                     SLEDHEREKDTAE"
     CDS             477201..479564
                     /codon_start=1
                     /locus_tag="ANT_04410"
                     /product="hypothetical protein"
                     /protein_id="BAJ62475.1"
                     /transl_table=11
                     /translation="MRSWKLNGDSPLFLTLAANARVTSTTYSNDIIWALQLGGGEPPA
                     LAVTTTLGLRAAQMRLFPIFRFGQQTVHDPAEFHRSPQVTQILPGYLSISLSPFEGVD
                     VQLEYRVDSSQTLAGRVRVLNRSVLAQEGCVDWAGLLEPLGYGVGLGILPMGLNTVLQ
                     GNTSDLAVVVFVSGGIQPGKGVYPSLCLPINLYPGGSVAFHWAVSVAAETEQAFEQAR
                     EATLQAWDAVTARIELQSTADLMEVSTPNPEWDALFWQAQVAGVSLLQTRTDALPEDS
                     FVLTRRPDQGYSPRGDGSDYPYLWSGQTAFDSLYLLEVLPGIPDLGSRLLRNFAGTVD
                     EQGTPIWKPGLGGQRSTRLALPLLTQLCDLEALSAEEAETLFAMGFRLVQAWLDYEHD
                     RDQDALPEYQHPLQTMLENHPLFDLWHPLSQGVSIEWVESPTLGAMLFREVRSLLKLA
                     RRLERGEEEAWLEAKAALLFAAVQSCWDHRSGVFRYRDMQSHRAPAARELLSFSGSGT
                     FKPKRQPLKPQRLVVQLFAPESHTLSAIVRLRGINAVNEVVQEEFSPREISWQNGVGR
                     FTSRNLFASVEEISVSGVPGRDHGKVLAAGLDVVDISLFLPLWAGVVKDKQAKTLVQK
                     TLFRHMLHRFGFPMLAGRQQDALPEWQAVSLPWNTWIAHSLLDLGMRREASDLFLRFI
                     QPVLGALKSRHNFYQYYHAETGAPLGEAGHLWGMPPLKLFLRIAGIEKITSHLVEVRE
                     FNAFPFPVTVKYQRISVTREGNTTTVRFPGHPAYTVTGSEARRIALT"
     CDS             479598..479945
                     /codon_start=1
                     /locus_tag="ANT_04420"
                     /product="hypothetical protein"
                     /protein_id="BAJ62476.1"
                     /transl_table=11
                     /translation="MSAEFPTQPIRLWIAVVQAQDAEIAREAVEKLGLHVERLPSVGG
                     FLGRRNATLIIGVPPEKQEQVEQSLHENCRQRVEFIAIPLESAPLPMPTPTPITVGGA
                     TVFTLEVDHYEEI"
     CDS             479948..480214
                     /codon_start=1
                     /locus_tag="ANT_04430"
                     /product="hypothetical protein"
                     /protein_id="BAJ62477.1"
                     /transl_table=11
                     /translation="MKLILAILRDIDHDAVSQALTSAGYRVTMIASTGGFWRRGNTTL
                     MVGCEDEQVEPALQIIRNNCQTPAEPGTRHATIFVIKVDQYVHF"
     CDS             480241..480894
                     /codon_start=1
                     /locus_tag="ANT_04440"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62478.1"
                     /transl_table=11
                     /translation="MDFAKPFTFVFEDQNWLSKIALVAVISLIPVVGVLVLLGWGLEI
                     TRRVIRDELPILPEVDFGKHLGDGFKGFVIGLVYSVPMLVLVILMSVFSAALSNSYNT
                     DFANAVLILLVVCLALFILLYGLVLNLLAPAAYARFAATGSMSAAFQFGEVWRTVTAN
                     LGGYVLVVLATILAGFIAGLGSIACVIGVIFTGTYAAAVLYHFYGQAYKQARLNRSL"
     CDS             complement(480952..481527)
                     /codon_start=1
                     /locus_tag="ANT_04450"
                     /product="hypothetical protein"
                     /protein_id="BAJ62479.1"
                     /transl_table=11
                     /translation="MSREPLSEEERRLLLQLARRSIEAAVNGKPLPEIRAEDYPARLF
                     EPGVCFVTLTDARGELRGCVGALEAYQPLVEDVREHAVAAALEDYRFPPVRPHEVDHL
                     KIEISRLTPPRPLPYENPEDLPRLLRPHVDGVILRDGIRRATFLPQVWEKIPNPEEFL
                     SHLCQKMGAPASLWRKKKLDVYTYEVEEFHE"
     CDS             complement(481560..482063)
                     /codon_start=1
                     /locus_tag="ANT_04460"
                     /product="flavin reductase"
                     /protein_id="BAJ62480.1"
                     /transl_table=11
                     /translation="MTELTLSPRGEDLRRAMRRWVTGVSIVTAAHEGKRHGMTVNSFV
                     SVSLDPPLVTVTLANTTRTHKLVSASGRFGVTILDIHQQNLSDRFAGRIPEDGDRFHD
                     VQIFSLSGEIPLLSDGLAALECRVVHCYEMPHSTLFIGEVEQVWIREDGEPLVYVNRA
                     YRCLKEC"
     CDS             482246..483382
                     /codon_start=1
                     /locus_tag="ANT_04470"
                     /product="putative thermolysin family peptidase"
                     /protein_id="BAJ62481.1"
                     /transl_table=11
                     /translation="MSHRHPLFCVIPPYMLERIAEKGTEVQQERARQALALSEQMREQ
                     RQKVAVRAEALRTAGPAVRQRSVHSAQYLSNLPGVLVRAEGAAPSGDPAVDEAYDGSG
                     ATYDLFWDIYQRNSIDGAGMPLVSTVHYQQGYDNAFWNGYQMVYGDGDEDLPEEDRLF
                     NRFTISLDVIGHELTHGVTQYTANLTYANQSGALNESFSDVFGSLVRQYQLRQTAAEA
                     DWIIGKGLFTANVNGVGLRSMKEPGTAYNDPILGKDPQPGHMRDYVTTTRDNGGVHIN
                     SGIPNHAFYYAAIEMGGYAWEKAGRIWYVTLRDRLRAGSTFQDAANLTFAVAGDLFGV
                     NSLEQQAVKRAWSLVGIEVTGDGGGNGNQNPGCLDAFIRLLRGV"
     CDS             483379..483699
                     /codon_start=1
                     /locus_tag="ANT_04480"
                     /product="hypothetical protein"
                     /protein_id="BAJ62482.1"
                     /transl_table=11
                     /translation="MIIQVERTGGFAGLTMQAIIDTEHLDPEEREELEELVEKSEFFR
                     LPPRLKVQTMAVNQFEYVITIEDEFQRHTLEAHEEALDPRLNELVQRVLRLARRKQRE
                     KKDD"
     CDS             483931..484176
                     /codon_start=1
                     /EC_number="1.2.7.3"
                     /locus_tag="ANT_04490"
                     /product="putative 2-oxoglutarate ferredoxin
                     oxidoreductase delta subunit"
                     /protein_id="BAJ62483.1"
                     /transl_table=11
                     /translation="MPVQGRIVVSDLYCKGCELCVAACPQHVLRLSPDRLTAKGYHPA
                     ELAGPGCTGCGICAVVCPEAAITVYRQKAPARKTAEA"
     CDS             484188..485303
                     /codon_start=1
                     /EC_number="1.2.7.3"
                     /locus_tag="ANT_04500"
                     /product="putative 2-oxoglutarate ferredoxin
                     oxidoreductase alpha subunit"
                     /protein_id="BAJ62484.1"
                     /transl_table=11
                     /translation="MARELLKGNEAIAEAAIRAGLQAYFGYPITPQTELLEWMSKRMP
                     ELGRAFVQAESELAAINMVYGAACTGARVMTSSSSPGISLMMEGISYIIGTEVPAVLV
                     DVMRGGPGLGNIAPAQSDYNQIVHGGGHGDYHLIVLAPASVQEAVDLTVLAFDLAEKY
                     RTVAVVLLDGSLGQMMEPAELPPMRPVKTVYPEWAATGMMGKREKNILTSIYLNPPDE
                     EQTNLRLLRRWQEVEANEIRFKEYFMDDARYVVVGFGSAGRVALSAVRAARAEGIPVG
                     LLRPITLSPFPYAHIRKLAERVEGFLVVEMNAGQMLEDVRLAVSGQKPVEFYGRLGGV
                     MPFPDEILAEIQRIASGGLTLEGHPRERWLQRMNGKN"
     CDS             485316..486098
                     /codon_start=1
                     /EC_number="1.2.7.3"
                     /locus_tag="ANT_04510"
                     /product="putative 2-oxoglutarate ferredoxin
                     oxidoreductase beta subunit"
                     /protein_id="BAJ62485.1"
                     /transl_table=11
                     /translation="MVMEQILPEEIVYQRPEALADVNTHYCPGCTHGVAHRLIAEVID
                     EMGIRDRMVGVASVGCSVFAYNYFDFDWVQAPHGRAPAMATGIKRVLPDRFVVTYQGD
                     GDMASIGMAEVVHAAARGENITVFFINNANYGMTGGQMAPTTLPGQRTTSSPSGRDVE
                     TAGYPIRAAELLATLEGASYVVRRSLHDPKNIRLAKKAIRTALEVQAQGLGFSMVEFL
                     STCPTNWGMTPVDALHWLEEHMIEYYPLGDFKVAPTVAQIRI"
     CDS             486113..486658
                     /codon_start=1
                     /EC_number="1.2.7.3"
                     /locus_tag="ANT_04520"
                     /product="putative 2-oxoglutarate ferredoxin
                     oxidoreductase gamma subunit"
                     /protein_id="BAJ62486.1"
                     /transl_table=11
                     /translation="MQTEIIVSGFGGQGVLFAGQLLSYAAMDAGKEVTWIPSYGPEMR
                     GGTANCTVVISDEEIGSPLVKHPQAVIAMNLPSLDKYEPLVKSGGVLIVNASMVNRQP
                     ARTDIHWVMVPGNEIAEELGDRRMTNMVMLGALLANLPILSLEALVRTLEAHMPARHQ
                     RLLPLNIEAIKRGAEYLAVKA"
     CDS             complement(486731..489250)
                     /codon_start=1
                     /locus_tag="ANT_04530"
                     /product="putative ATP-dependent Clp protease ATP-binding
                     subunit ClpC"
                     /protein_id="BAJ62487.1"
                     /transl_table=11
                     /translation="MSGMERFTQRARRVLSLAHQEAERLRQDTINTEHLLLGLIEEDG
                     GIAGRVLRELGLEPDRVREMVERLGGIGTYRGGKIDLAPGTQQVLEYAIEEARRMGHH
                     YIGTEHLLLGLVRSTDGLGMEVLRKLGVTAEQIRRQTRRILQESSSAPTGAPAGTAPA
                     SGRPASARQEKERPKTPLVDQLAVDLTAKAEEGKLDPVIGRQMEIERVIQILARRSKN
                     NPALIGEPGVGKTAIVEGLAQRIVEGDVPPLLLGKRVLQLDVGSLVAGTMYRGQFEER
                     LKRVIDELKSSGAILFIDEVHMLVGAGAAGSSVDAANILKPALSRGELQVIGATTLDE
                     YRKHIESDAALERRFQPIIVNEPSIEETIEILKGIKTAYEEHHRLTITDEALEAAAKL
                     SARYVTDRFLPDKAIDLVDEAASRVRMYKSSAAATAREIMKKLREVRQNHALAVEDGR
                     MDDAQEFLEREAELEEQLERLRTGWDRAASPKVTADDIAEVVSMWTGVPVMQMATEES
                     ERLLHMEEELRKHIVGQDEAIDAIAKAVRRARAGLKDPRRPIGSFIFLGPTGVGKTEL
                     TKALARFMFGSEEALIQLDMSEFMERHTVSRLVGAPPGYVGYEEAGQLTEAIRRRPYS
                     IVVFDEIEKAHPEAHNMLLQIMEEGHLSDAKGHKVDFRNAIIIMTSNIGADMIKRQTS
                     LGFPLAKDQTKEEQEAYEDMRKKLLDSLRRVFRPEFINRLDSVIVFRALNREHIRQIV
                     NLELNKVAERLKENGITLRATEAALDKLAEEGYDPEMGARPLRRVIQNKVEDRLSDLV
                     LAKEFNPGDEVLVDLDPETNDIILCRSEESPQEPEQALNVG"
     CDS             489594..489941
                     /codon_start=1
                     /gene="rplS"
                     /locus_tag="ANT_04540"
                     /product="50S ribosomal protein L19"
                     /protein_id="BAJ62488.1"
                     /transl_table=11
                     /translation="MSEQILKAIEPQPNPNVPPLRPGDVVSVHVKIKEGNRERVQEFK
                     GTVLFTKNAGAGSTFTVRRVASNGIGVERTFLTYSPRIEKVVVERHSKVRRARLFYLR
                     NRTGKSARLKQRF"
     CDS             490031..490771
                     /codon_start=1
                     /locus_tag="ANT_04550"
                     /product="peptidase C26 family protein"
                     /protein_id="BAJ62489.1"
                     /transl_table=11
                     /translation="MEEEMTLPLIGITSIRKEGEPGQTHWYSTPFSYIHAVQRAGGMP
                     VLIPPVYPAEKLPALLQRLDGVLLIGGGDIDPNLYGGEPHPRVYDIQAERDSLEITLV
                     HLALETSTPLLGICRGAQVMNVALGGTLYSDIADQKPGALKHDYYPDFPRNTLAHAVE
                     IEAQSRLAQMLGGTHFEVNSLHHQGISKVAPSLRVTAHAPDGLVEAVEVEGHPFAIGV
                     QWHPEWLQEHAPQRALFSAFIRAASQRK"
     CDS             490787..491608
                     /codon_start=1
                     /EC_number="5.1.1.3"
                     /gene="murI"
                     /locus_tag="ANT_04560"
                     /product="glutamate racemase"
                     /protein_id="BAJ62490.1"
                     /transl_table=11
                     /translation="MIGVFDSGVGGLSVLRAIRALMPAEPVIYLADQAHVPYGPRPLE
                     EVRGFSQSIARFLIAQGARVIVVACNTASAAALFHLRQTFPETPFVGMEPAVKPAAET
                     TQSGVVGVLATPATFQGALYASVVERFAQGVTLLQDTCAGLVQQIEAGNLAGEETRRI
                     LENALLPMLARGMDTVVMGCTHYPFVIPLIQQIVGEQVRVIDPAPAVARQTRRVLEAH
                     GWLVEGNQPAPVRFLTTGDGEAFRRMIRQLLGELFPDPQVEVIQWDEQIQPELVY"
     CDS             491626..492177
                     /codon_start=1
                     /locus_tag="ANT_04570"
                     /product="hypothetical protein"
                     /protein_id="BAJ62491.1"
                     /transl_table=11
                     /translation="MPRFELDLNPVDHITTDAIGQPGKRVFYIQGVKDDQVVTLIVEK
                     IQIQTLALGVEEFLQEIANRFPHLSAPAAEYDESKMHITPPVDPLFRVGELALAYDSD
                     NDRVILIARELVAEEEMGEDPASMEERAGVVRFWCTRSQIRAMARWGLEVAARGRPLC
                     PYCGEPMDPEGHFCPKRNGHKKH"
     CDS             complement(492243..493109)
                     /codon_start=1
                     /locus_tag="ANT_04580"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62492.1"
                     /transl_table=11
                     /translation="MSALSSAVSQNRVPSLGWLKSGGKYTLLTLFALLWLLPVIAAVV
                     TSFRTMDDITTHGFWSIPQTVTTQNFVKAWVNARVNKYLLNSFIITIPSLFGMLFLSS
                     MGAYALARFKFKANLPLYFMFVAGTMLPFQILMLPVFRLTNALGLYDSYGALILIHTA
                     FQLGFCTFVLRNFMRTVPGDILDAARVDGCSEFRIYWQIVLPLTLPALAALATLEFTW
                     VFNDYLWAIILLRADTLRPVTAGLATLRGQYNTDWPVITAGALLATIPTLVVFVFLQR
                     YFIQGLTLGSSK"
     CDS             complement(493122..494459)
                     /codon_start=1
                     /locus_tag="ANT_04590"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62493.1"
                     /transl_table=11
                     /translation="MPSSRAMRDYSTANLFTLVLGTLLLITFIFLPWFGTAPAQNGAR
                     IFSDNLYQVPGAIPAPLIWLIPIATLGILGFGLWGILTPERDRLAALLAAFCAFLGLL
                     YFARIFVEPSLLGGKATPGVGFWISLFSLLLTLFNLPITGPEVARLFQPRKGSRRGID
                     PRFIPYLFLIPSLTLYLVWIIGPTFYTFYLSLTNWDGVSTPGFIGFANFQRLFTRDRN
                     FTEALVNNIRWLLIFISVPTTLGLLMAMIFNQEMWGSRFYKVSLYLPLVLSLPVIGLI
                     WSWVYNPRLGLINSLLSLLGATDLPGWLGDRKLAIWCVIAAAVWRQVGYVMVLYLAGL
                     KNVDPMLIDAAHVDGADRWQLFRHVIFPLLAPVTTIVVVISVIDSLRAFDLVAIMTRG
                     GQSTQVLANFMYIEAFNNYRMGYAAAIAVVLFFLSMVFIGFYLSIVIRDELEY"
     CDS             complement(494544..495893)
                     /codon_start=1
                     /locus_tag="ANT_04600"
                     /product="putative ABC transporter substrate binding
                     protein"
                     /protein_id="BAJ62494.1"
                     /transl_table=11
                     /translation="MKIRFFTLFSMLMLVVMVFSACAPAATPTPEKVVETVVVEKEKV
                     VEKTVEVQKVVTANVITYNSYNGDPKPRAFDESVVKMWNEAHPEMPVEHSIIAHEDFK
                     QAIRAYLTADPAPDVLTWFAGNRARFFIDKGLILDQTKMWEDAKLNEVYAPGFQALAT
                     YNDKKYFLPTSYYWWAIYYRKSLFAEAGIEKEPETWQDLLDACDKLNAKGITPITIGA
                     RFKWPAAAWFDYLNMRVNGPQFHIDLTDLKVPYTDPKVRKVFDYWKELIDHKCFIEDP
                     AAYDWQEAIDPMVQGKAAMYLMGAFITDSYPDEAEADLDFFRFPIIDPNLPVGEDAPT
                     DGYFASATARNPEGALAFMAFLGSKEVQQKAFEELGRLPTRTDVDISKATPATQKGIK
                     LIQSADYIAQFYDRDTTPPMAEAGMDGFMRFWDDPTQIDQILADLEAERQRILSEGQ"
     CDS             complement(495974..496984)
                     /codon_start=1
                     /locus_tag="ANT_04610"
                     /product="LacI family transcriptional regulator"
                     /protein_id="BAJ62495.1"
                     /transl_table=11
                     /translation="MKRSRPNIRDVAALAGVSHQTVSRVINGDERVTEETRQKVEAAI
                     LQLGYRPSSLARSMAYGRTFTLAFVALNFTDYTFSSMLDAAESEARQHNYFTLAISAG
                     ENSNYAELVNQLFGHQRVDGMIVVGPSLVEHHAELAHEAPVVCITPRRISDLPHTVDS
                     DNRQGGWLATRHLLELGHRNIGMITGPQNQVSVQERMEGYCKALQERGVTSPVEWIVE
                     GDWSATSGYHAFEALYPQGVSAIFAQNDRMAIGCIRAARDHGVNIPEDLSIIGFDDIP
                     LASYFDPPLTTIRQDTAELGRQAARLLLELLKNPQLPPRHTVIPTQLIVRKSTCAFQE
                     RR"
     CDS             497132..497524
                     /codon_start=1
                     /locus_tag="ANT_04620"
                     /product="hypothetical protein"
                     /protein_id="BAJ62496.1"
                     /transl_table=11
                     /translation="MHQRRGGVAWWLAFPLMGLLAGLFALLLLERRKRVHQQGPAVSP
                     PAPSIVLPPEEDAPLPADDLTVIRGIGPKTAVVLAQAGIRTFAHLVQSSPDSLREVLS
                     QSALRLPNASPEDWIAQAKARLERQTAP"
     CDS             497603..497710
                     /codon_start=1
                     /locus_tag="ANT_04630"
                     /product="hypothetical protein"
                     /protein_id="BAJ62497.1"
                     /transl_table=11
                     /translation="MNAGNDILGLVAVLAGIVLLLVFAWWQSRTPLQKK"
     CDS             complement(497774..498328)
                     /codon_start=1
                     /locus_tag="ANT_04640"
                     /product="hypothetical protein"
                     /protein_id="BAJ62498.1"
                     /transl_table=11
                     /translation="MPPAETDLILVAYLPAPRDWEIARVLGWYRIPLRHAPKVIEVDY
                     LAFYQGAAFGEEHRWRIEYIAPVRGHELTTRAALLRDEPHHPRAHEEYYKVQLGAPER
                     LPAPIPAGHWKRITFLYTTGERLLSARSLADLTVRDEEERQVLWRSLRDRAIQGGSYR
                     AEDLPEVPLDPALLALLGGMDLQP"
     CDS             complement(498382..499848)
                     /codon_start=1
                     /locus_tag="ANT_04650"
                     /product="pyridoxal-phosphate dependent enzyme"
                     /protein_id="BAJ62499.1"
                     /transl_table=11
                     /translation="MATIDLTVHPDRLERAVQRARERGIIIPTFAQMKDPTRIPEKIR
                     EQLKQTGLWDVTPVNLFRITWKNEPKPFGGLFGGVNYIEFPSSLTGVPARIIALVGKW
                     FPTGAHKVGAAFGCLVPRLVTGQFDPTSQKAVWPSTGNYCRGGAYDSALLGCQSIAIL
                     PEGMSRERFEWLSRIAGEVIATPGSESNVKEIFDKCWELRRSGEDLMIFNQFEEFGNY
                     LWHYEVTGHAMEEVLRSALGSNDAYRGVALTTGSAGTIASGDYLKQVYPTSKIIASEA
                     LQCPTLLQNGFGAHRIEGIGDKHVPWIHNIKNTDIVVAIDDNDVVKIMRLFNEPVGQE
                     YLQRKGVPVETIEKLNLLGFSGIANVLSAIKFAKYYELTGNDVVLTVLTDSMELYGTR
                     IEEYREQFGEFTPSDAAEAFAGALHGVRTDALIELSYAERKRIHNLKYYTWVEQQGKT
                     YEEIQAQWYDPNYWTDIQRQVGEIDAKIEAFNRMVGLL"
     CDS             complement(499861..500811)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_04660"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62500.1"
                     /transl_table=11
                     /translation="MKPVFSIIAPIFNEHDSLPELHRRVSAVMDGLGEPWELILVDDG
                     SSDGSTDLIRQLAEQDERVRPVIFARNFGHQIAVTAGLDYARGDAVVIIDADLQDPPE
                     VIPDLVARWREGYEVVYAVRTEREGESWFKLFTASLFYRIIFRITDVKIPMDTGDFRL
                     LDRKVVNVLKTMRERHRFLRGMAAWVGFRQIGVPYKRAARFAGSTKYPFKKMLRLALT
                     AITGFSYFPLQVATYLGFISAGLALIFIPIVVIERLVGNQAFFGQATTLVSVLFLGGV
                     QLISLGILGEYIGRIYDEVKGRPLYIVREAPENDSSHPQS"
     CDS             complement(500929..502188)
                     /codon_start=1
                     /EC_number="4.2.3.1"
                     /gene="thrC"
                     /locus_tag="ANT_04670"
                     /product="threonine synthase"
                     /protein_id="BAJ62501.1"
                     /transl_table=11
                     /translation="MTRATFQGYRCSLCGAEFAPQDWLYTCPHDGGNLDVVLDTPAIR
                     QQTSPRQISAQTEPSLWRYLPLLPVDDPGGQGTPLRTAGWTPLYSPPALKAQTSLHAL
                     WVKDEGKNPTASFKDRASAVVVARARQIGAEVVVTASTGNAGAALAGMAAAVGHRAVI
                     FAPRTAPPAKIAQLLVFGAQVILVDGNYDNAFDLTVQAAQEFGWYCRNTGYNAFTAEG
                     KKTAALEIFEQVILPNRLDRPLCVFVSVGDGNIISGIHKGFKDLYALGWLETMPRLFG
                     VQSTGSAAVANAFFAGTEEITPVQAATLADSISVDLPRDGVRAVRAARQTGGAYVLVS
                     DDAILQAIAALGKAGIFAEPAGATAYAGLLEALKSGQIQPDDPVVVINTGSGLKDVKS
                     AMRAVTEAPVIEPNLNALKRLLEKNLR"
     CDS             complement(502210..502611)
                     /codon_start=1
                     /locus_tag="ANT_04680"
                     /product="hypothetical protein"
                     /protein_id="BAJ62502.1"
                     /transl_table=11
                     /translation="MESKIPPAFADLVSREKKALAYLALVRRDGSPQVTPVWFDFDGT
                     YFIFNTARGRVKDRILRRHPKVAFVIQDPDNPYRYLQVSGRVVDEDENNAVEQIRDLC
                     EKYHGHRYFKIAEGETRVTYRVLPERVQGMG"
     CDS             complement(502636..503604)
                     /codon_start=1
                     /locus_tag="ANT_04690"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62503.1"
                     /transl_table=11
                     /translation="MDLIIVLQAGVATGTILLFATLGEIFAERSGVMNLGVEGMMLLG
                     AMSAFSIATRTGNPWLGLLVAMLAAGLISQIHAFISITLQADQVVSGLSLGFLATGLS
                     LVLGEGLSKAGTITLIPSWTVPVLSQIPILGPIFFTDHKLLVYAGYIIIPLAWYYINH
                     TRPGLHLRAVGEYPAAADSLGVNVYALRYLYVLVGGVFAGLAGATISLAIAPGWFSEL
                     TTAGQGWIAIGLVIFAQWDPLRAAFGAYAFGALRRLVLDIQAPMMLFGFRNPFYYNPY
                     WGFFLEMLPYAFTIIVLVIGSREAIRRRLGAPTALGIPYIRGERGL"
     CDS             complement(503608..504738)
                     /codon_start=1
                     /locus_tag="ANT_04700"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ62504.1"
                     /transl_table=11
                     /translation="MNKSALTRSKANWLPFTVELEPRLTPPPGWFSWVLTIGMVIFAL
                     LIGALVIAFAGGNPWAAYSHIARSSFGSIGVLSDTLVKAIPLMIVGLACTIAFRMRIW
                     NIGAEGQFFLGAFGASAVVLTPILPADSPQWLFILTMLIFGMAAGAIWGFIPGYLKAK
                     FKVNEVISTLMLNYIAVSWNNYWIYAVWTEGGFQMSKMFPRNAWLPRLTDFADRVPAF
                     GGLTVHFGLILALIAAVVVWLILYRSQWGYEIRVVGDNPPTANYAGIPIARNTVLVMM
                     LSGALAGLAGMSEISGVVHRLQGAISPGYGYTGIIVAWLAKLNPFAVIPVAIFFGALI
                     LAGREIQPSGIPKMIQGIILVCLIASDFLMRYEIRIRRKGEA"
     CDS             complement(504731..506296)
                     /codon_start=1
                     /locus_tag="ANT_04710"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62505.1"
                     /transl_table=11
                     /translation="MEAVEKSQEKPIAVQMSGVVKHFPGVLANDHVDFTLFKGEIHAL
                     LGENGAGKSTLMNILAGLYRPDAGTIVVSGKTCTFNSPRDAIHAGIGMIHQHFMLVPS
                     MTVTENILLGLEEPRFRLRLSHYDEQIRALGERFGMRVDPKARIWQLSVGEQQRVEIL
                     KMLYRGAEILIMDEPTAVLAPAEVEELFHTLRRMREEGKSIIFISHKLNEVTAIADRV
                     TVLRRGKVTAAGLPLAGVSRAELARLMVGREVVFNLQKKPVQPGEVVLKVENLHALND
                     RGLPALRGVSFEVRRGEIVGLAGVAGNGQRELAEVITCLRKAEKGHIWVGGEEITNCN
                     VSKGIRKGIAHIPEDRTHVGTAPNLSVTDNVILKKYKEPPIANGWMLNQVAATGYAED
                     LKKGFEILVPTVETPVRLLSGGNLQRVILAREISAQPQLLIAVQPTRGLDVGAIEGVH
                     RLLLAQREAGAAILLISEELEELIDLSDRILGIYEGQIMGEVTDGNLEAIGLMMTGTR
                     LENAPAVPEVRHE"
     CDS             complement(506404..507615)
                     /codon_start=1
                     /locus_tag="ANT_04720"
                     /product="putative basic membrane lipoprotein"
                     /protein_id="BAJ62506.1"
                     /transl_table=11
                     /translation="MKNRVLLRAVALLVFVAILLGACQPSAATPEKVGEFQIPEIQKG
                     KFNVAMVLIGPHDDGGWSQAHYEGLLYVEKNVPNVHVAYIENVPEGADSEQVFRALSR
                     KGFNLIFGTSFGFMDPMETVASEFPNITYIHISGYKSNEKNFGNLFGAMETMKYLAGM
                     LAGARAKMDGNPKLGYMATFPIPEELRLGNAIALGMRKTCPECTMDVRWINTWHDPVK
                     EKEAAASLFDAGAQVVFTGADTPAVADVATEKGKWGVTYDWVGSCKAERCLTAPYWNW
                     GPVYAKITQGVIDKTYKPGWDYFDADSGGLGLFGFMEGQTYPKGVAELPPEVINEVKD
                     LVAKSLKGEFTRFDVFKGPIKDNTGKVIVPEGESLQQIDLDQFPEMGLGCKYCMKWWA
                     EGITAELPQTQ"
     CDS             complement(507920..508447)
                     /codon_start=1
                     /locus_tag="ANT_04730"
                     /product="hypothetical protein"
                     /protein_id="BAJ62507.1"
                     /transl_table=11
                     /translation="MNITPQTRIGELLREYPALEEDLIRIAPAFKNLRNPVLRRTIGQ
                     LATLEKVAQIGNVTVLELVNTLRRAVGQPEMATLHDVPRNLKVSRLEEDPDWIQGEPQ
                     LVINGTELLQRGEVPLVQVNAVLPSLENGRYLLLISDFEPAPLLDALQKQGCRVHHRV
                     NPEDTRQHWTFISRL"
     CDS             complement(508460..509710)
                     /codon_start=1
                     /locus_tag="ANT_04740"
                     /product="hypothetical protein"
                     /protein_id="BAJ62508.1"
                     /transl_table=11
                     /translation="MSELINNRQQRIEIMKSLIRQLHHGSSEEQVKHQLETMLAEADY
                     SDVFLMEMQLIQEGIPAESIQQLCDTHTHVLKKFLDLQETPETIPGHPVHTFIQENRE
                     LTRTTARVRLLIRMLDKMRDEDDASSLMMQIHQALNDLMDVDKHYKRKEYLLFPIFER
                     NNLPGPPTVMWGKHDEVRQALRTTLEGLHEVSQIIASEARAFCTFAVEPLLQAIDEMI
                     YKEEKILFPTALNLLTEQEWYDIYLQSDEYGYCLYAPEFEWIPEGGVQQPEERPAAHN
                     GRIQMPTGSLSLNELIGLFTTLPFDVTFVDRDDVVRYFSPGKERIFSRSRAVLGRKVQ
                     YCHPPKSVHIVNQILKDFKAGKQDVARFWINLHGKMVYICYYAVRDKEGQYLGTLEVT
                     QDITEIQQLSGERRLLMYDTPHSN"
     CDS             509983..510519
                     /codon_start=1
                     /locus_tag="ANT_04750"
                     /product="hypothetical protein"
                     /protein_id="BAJ62509.1"
                     /transl_table=11
                     /translation="MKPPIKTMLLIALLMITLIFSWNAAQAQKGETPPSPQSETLDGN
                     TRSLDSVSPQALTGFIITSNPYCYQPDVSRNECIINFRYTQANDDGTNAPLLKYLKYS
                     IDGKMRYYSGKFFENSITYAYSMVPQGFKVPCGLPNESGLGNDFGKSYAIVIQAIGNT
                     DTQLGANFFSVACPAYVP"
     CDS             510516..511001
                     /codon_start=1
                     /locus_tag="ANT_04760"
                     /product="hypothetical protein"
                     /protein_id="BAJ62510.1"
                     /transl_table=11
                     /translation="MKTGGAMHALRLALLGLALLALLVLPPSQSSAQSSSISLQIQNP
                     VCMQSSLDSGTCYIRMRSISAVGSGSSFSRLQVFVNGKLRANTGGFFENSGYVVGNMF
                     GSGFVVSCGGKNASGDPDFGQSYTIQVVASLADSTTTTGSIAVFCPYYEGKSFLPFLL
                     R"
     CDS             511153..514380
                     /codon_start=1
                     /locus_tag="ANT_04770"
                     /product="hypothetical protein"
                     /protein_id="BAJ62511.1"
                     /transl_table=11
                     /translation="MEQHFPITATKIFVPRRREEILSRPRLLDLLKQWSDLRLIIVAA
                     PAGYGKTSLLVDYATQSRMPVCWLGLDLLDQTLPRLVAHLIASIRQNFPAFGIASLAA
                     LQGWSAGSLQDEALVSMIANDLYEHTPEHFFLILDDYHLIEESRAVVQFLNDLIQRVD
                     ENCHFIISSRTLLNLPDMPLLVARSQVGGLSFEELAFQPAEIQQLWLRNFQIPLSEQE
                     AAQLARDTEGWITGILLSHQAPGGRREERLRGARVAGVGLYEYLAQQVLERQPPQMQE
                     FLLHTSLLEEFDAELCQEVLGEPPEGMSWQAWMEQALRANLFIQPVGTDRIFLRYHHL
                     FRDFLQARIARLYPERTQQILLTLAEVWAKRGEWERAYAVYRRLGQEEWIAYLVERAA
                     TDLIARGNIQTLGEWLEALPETYRNRPAILSSLGTVYVTRGNTPQGIQLLDRAIVAYQ
                     NSEDKPGLARTLVRRATALRLQGNYLAAMEDTRQALEVMSGSEGEASLRGDALNELGL
                     ANFYLGHPQDALNVLEQAADLFRKNRDAESAAKNAMHRGMVARAMGCFGDAERFYHEA
                     LQHYQKNQNLIWQANVLNNLGVLKQYRGDYEGAALAFEKVVQYAHLAGYNRLEAYGLA
                     GIAELYRDLNATAEARQACQRARAVASQIDDRFLLFYLNLLEASLSILEQNWTQARRE
                     LELARSLMGEGASPYQQQLFTLAQAHLALHHHPSETVLAELRRARKVLEDASRRTDSL
                     HATCLVAGMAYLLKDTYTACRELSTLHEALQDADLNHTATLCALQIRHVLAAMRESEC
                     SGMVLELQEAISAFERRIPLLKQALRRHLQTVPLGPPKLSIQTLGKVQIRLNGRLVPN
                     SAWVTKTSRELFLLLVASPEGLSKEQIGEILWPDSEPEDLNYRFKNAIYRLRRAVGKE
                     AILWEGDIYRFNRALDYEEDAEIFLKEIELAETSDDLEKTIAHYQQAIRLYRGAYLPD
                     VEGSWAHLRRQKLRGKYLQGLLQLANLEFRHKHYEEALNAVQKLLEEDACMEEAHRLA
                     MLIYAAMGNRTAVMRQYEACQAALKREFNALPSEETRQLFKMLTR"
     CDS             complement(514357..514899)
                     /codon_start=1
                     /EC_number="3.6.1.13"
                     /locus_tag="ANT_04780"
                     /note="protein synonym:ADP-ribose diphosphatase"
                     /note="protein synonym:ADP-ribose phosphohydrolase"
                     /note="protein synonym:ADPR-PPase"
                     /note="protein synonym:ASPPase"
                     /note="protein synonym:adenosine diphosphoribose
                     pyrophosphatase"
                     /product="putative ADP-ribose pyrophosphatase"
                     /protein_id="BAJ62512.1"
                     /transl_table=11
                     /translation="MAFERLNRTILHTGRVFTVAQHTLRLPNGKSQTYDLVEHEGAVT
                     ILPLDEAGNIWFVRQYRLGAERSLLELPAGVLHAGEDPLEGAAREVREEIGMAARTLK
                     RLGGFFMAPGYSTEYMHVFLATGLTPAPLPQDEDEFIERVSLPFQEALAMAQRGELED
                     GKTLVALFLALPELTGEHFE"
     CDS             complement(514977..515612)
                     /codon_start=1
                     /locus_tag="ANT_04790"
                     /product="hypothetical protein"
                     /protein_id="BAJ62513.1"
                     /transl_table=11
                     /translation="MNKSLRFFWMMVLLVVLILSTACTLRASTPPAPTQEQGVLFPTP
                     TSVANAVQTQTAQAQPQIATATPQVEAPTPVPQQAEQPQPTAQAPQPQPIPTLERPST
                     YTLQKGEWPICIARRYDLDLNALFSLNGLNMNSRPAVGTVLKIPSSGNWNEAAYGPRA
                     LRKHTDYKVAAGDTVYTIACYFGDVSPEAILAANGLNSPNDVKPGMTLKIP"
     CDS             515977..516870
                     /codon_start=1
                     /EC_number="4.1.3.30"
                     /gene="prpB"
                     /locus_tag="ANT_04800"
                     /note="protein synonym:2-methylisocitrate lyase"
                     /product="methylisocitrate lyase"
                     /protein_id="BAJ62514.1"
                     /transl_table=11
                     /translation="MAEQSSAGRRLRQALEEEKPLQVVGAINAYAALLAERAGFRALY
                     LSGGGVAAASLGVPDLGITTLDDVLTDVRRITDATSLPLLVDADTGFGSAFNIARTVR
                     SLIKAGAAGMHIEDQVQAKRCGHRPGKQLVSADEMVDRIKAAVDARTDRDFVLMARTD
                     ALANEGLEAALERARRYVEAGADMIFAEAVTELPQYAAFVQACGVPVLANLTEFGKTP
                     LYTLDELRAAGVSLALYPLSAFRAMAAAALEVYRTIRAEGTQGRVVPLMQTRAELYEV
                     LNYYAYEQKLDELFGKEKGDG"
     CDS             516863..518020
                     /codon_start=1
                     /EC_number="2.3.3.5"
                     /gene="prpC"
                     /locus_tag="ANT_04810"
                     /note="protein synonym:citrate synthase 2"
                     /note="protein synonym:methylcitrate synthase"
                     /product="2-methylcitrate synthase"
                     /protein_id="BAJ62515.1"
                     /transl_table=11
                     /translation="MAEMSVVQETPRKKSVALSGVPAGNTAICRVGFEGNDLRYRGYD
                     INDLAEHSTFEEVAFLLVHGKLPLASELERYRLKLKRLRGLPAPVKAALELIPAAAHP
                     MDVLRTGVSMLGATLPEREDHNAEGARHIADHLLAIMPSILLYWYQYAHHGRRIEVET
                     DDDSIAGHFLHLLHGRRASDLHQRALDITLILYAEHEFNASTFTTRVIAGTGSDIYSA
                     ITGGIGALKGFKHGGANEGAMEIIERYRTPDEAERDVRRIIKEKGIILGFGHPVYTIS
                     DPRAKILKELSCTLCKDFGDESMCDIAERIEAVMWEEKNLFPNLDWYAAVTYHMMGIP
                     TFMFTPLFVMARTAGWAAHIIEQREDGKIIRPSANYIGPEPRAYVPIMKRG"
     CDS             518027..519475
                     /codon_start=1
                     /EC_number="4.2.1.79"
                     /gene="prpD"
                     /locus_tag="ANT_04820"
                     /product="2-methylcitrate dehydratase"
                     /protein_id="BAJ62516.1"
                     /transl_table=11
                     /translation="MKMSGGHGQERGTFDPLMVEIADYVTRAQIDSSEAYHTARLCLM
                     DSLGCALEALSYPACTKLLGPVVPGISVLNGAKVPGTPYQLDPVTAAFNLGAMIRWLD
                     FNDTWLAAEWGHPSDNLGGILMSADWFSRQAVAAGKRPLMVRDVLTAMIKAHEIQGVL
                     ALENAFNRVGLDHVLLVRVASAAVVTGLLGGTHEDVLNAVSNAWVDGGSLRVYRHGAN
                     TGSRKSWAAGDATARGVRLALMALKGEMGYPGALTAPTWGFQDVFFKGQPIRLGRALG
                     SYVMENVLFKVSFPAEFHAQTAVEAAFQLHPLVKDRLDEIEKVVITTHESALRIIDKK
                     GPLRNPADRDHCIQYMTAIGLIFGRLTAEDYEDERAADPHIDALREKMVCVENPQYSR
                     DYLDPDKRSIANAVQVFFRDGTATPQVAVEYPLGHRRRRAEALPLLEAKFRASLQRHL
                     SPRQGAAIQALFANPGRLESVPVHEFVDLFAL"
     CDS             complement(519686..520396)
                     /codon_start=1
                     /EC_number="3.1.21.4"
                     /locus_tag="ANT_04830"
                     /note="protein synonym:endonuclease DdeI"
                     /product="putative type II restriction enzyme"
                     /protein_id="BAJ62517.1"
                     /transl_table=11
                     /translation="MSHKIAEIQNAYNILVGSIDERAHADNEEGNRAYGGAVRSAKGI
                     LVEGIAQNLVKIAWEELGEDPNRLSFIRENIKIPLKPEYLRRVRPAEVAEYIKAHIEQ
                     YFYGHKTDVHVSIDGQFVMGIECKAYTENAMLKRILVDFTLLKEVVPNLKCVLIQLES
                     QLGGDYSQPLNKIIYGSTSTHTLLSYFDVDLNIITLLEGERKVDEPIHKQPYFKEMTE
                     PALRKAVETLKALLSDFQ"
     CDS             complement(520406..521581)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="ANT_04840"
                     /product="methyltransferase"
                     /protein_id="BAJ62518.1"
                     /transl_table=11
                     /translation="MADYKSIQLTNFEVDKKVLDIVNNCLSQQPDPRPFVEINSIGYV
                     FYFHTLDIKLLQRNIEMLTAHDLFSANNPSSSRKAGELLQKIYEEVSKIGSYGIRSGK
                     RQYVNFDIERKVRNRKAKEQNRSQYYYAQDNNFSKISNQLPPEMTNQIFCGDSLEVLK
                     KIPDNSIDLIFTSPPYNFGLEYERQDDAHKWDLYFEKLFAIFDECIRVLKFGGRIAVN
                     IQPLFSDYIPSHHLISNFFISRRMIWKGEILWEKNNYNCKYTAWGSWKSPSNPYLKYT
                     WEFIEIFAKGTLKKSGDPKNADITSDEFKEWVVAKWSIAPERKMKEFGHPAMFPEKLA
                     ERVIKLFSFVGDIVLDPFNGVGTTTAVAQKLGRKFIGIDISQEYCDIAQKRLKNTLL"
     CDS             complement(521869..522120)
                     /codon_start=1
                     /locus_tag="ANT_04850"
                     /product="hypothetical protein"
                     /protein_id="BAJ62519.1"
                     /transl_table=11
                     /translation="MLILRMFLVGWIVLAGAILLNLLAGALHLATWYTFLQSVSAQGL
                     TSALRALRWQDAVFLFLVYPLGLGGLAWAGGWLARQMAG"
     CDS             complement(522132..522587)
                     /codon_start=1
                     /EC_number="4.2.3.3"
                     /gene="mgsA"
                     /locus_tag="ANT_04860"
                     /product="methylglyoxal synthase"
                     /protein_id="BAJ62520.1"
                     /transl_table=11
                     /translation="MHERKLVSQAKKHIALIAHDGMKQELLEWVDFNKGTLARHFLYA
                     TASTGKLIMENTGLPVSVLASGPLGGDLQIGSGIVEGKIDFLIFFWDPLEPQPHDPDV
                     KALLRVAVLYNIPTASNRATADYLISSPLMESPYTRILPDFSHKIHREV"
     CDS             522863..523750
                     /codon_start=1
                     /locus_tag="ANT_04870"
                     /product="hypothetical protein"
                     /protein_id="BAJ62521.1"
                     /transl_table=11
                     /translation="MSDKRYFWIGTLLLFGVLVFLVQQEIVRASALEKDQARDFVQYT
                     LVEHIIPDDVDLSVDWTRESPTVDRQELAKALERIEAIPSFHGPGWVHRVYVGYQVPP
                     DPPHPLHPKDGYHVLEEWLYVNKVGVVEKILQTSADLQGNLLQEIACAEEICGNLSKA
                     GLVEFKDEPLTQPFQPYRFNQNEAPALLQELYASNKETWGWMEEREMGKTLFVASYGK
                     NTAEQISQIPGFEGTLIQYGILVDSGVLAHFSLYEKRDGAFVLNSTDDLVLFETLPSN
                     PEIERRIASAVKILKEIAE"
     CDS             524323..524463
                     /codon_start=1
                     /locus_tag="ANT_04880"
                     /product="hypothetical protein"
                     /protein_id="BAJ62522.1"
                     /transl_table=11
                     /translation="MEQAMACINHLVLGILPGKLKFRYLPHARRYFAAHPAEALDFIT
                     RI"
     CDS             524564..524785
                     /codon_start=1
                     /locus_tag="ANT_04890"
                     /product="hypothetical protein"
                     /protein_id="BAJ62523.1"
                     /transl_table=11
                     /translation="MPLYEYHCDECQEDFEKLVSLSECDVNPRCPACGSLRTRRQIST
                     FATRGSSPTWSLSSPSASSGCSSKGSLFS"
     CDS             524845..525126
                     /codon_start=1
                     /locus_tag="ANT_04900"
                     /product="hypothetical protein"
                     /protein_id="BAJ62524.1"
                     /transl_table=11
                     /translation="MKLRDPQLQETLIQRLRRIEGQIRGVEGMLENQRDCREILQQVS
                     AVQAALRSFSRSLLEEYAVTCLLDEEARTDPRLAEKNLRELIELITRAQ"
     CDS             525140..525550
                     /codon_start=1
                     /locus_tag="ANT_04910"
                     /product="hypothetical protein"
                     /protein_id="BAJ62525.1"
                     /transl_table=11
                     /translation="MASARIKWTGQKEFIGVDSTNHSVVISTPAEGTGMKPSELLLVA
                     LASCTAVDVVEILTKKKLTLTGLEIFATAEQEADPPWTFRKIHLNYVFRGKDLTEKAV
                     EQAIALSEEKYCSVAATIRGKAEITTSYEIHLEA"
     CDS             525681..526781
                     /codon_start=1
                     /EC_number="4.2.3.1"
                     /gene="thrC"
                     /locus_tag="ANT_04920"
                     /product="threonine synthase"
                     /protein_id="BAJ62526.1"
                     /transl_table=11
                     /translation="MRGFLNTPDSSLYSGVLARYGAWMDLPAHTRPVTLLEGNTPLIP
                     MPRLAQELGGGFELFVKFEGMNPTGSFKDRGMTAAISEAFGRGVHTVICASTGNTAAS
                     AAAYAARAQMRAIVIIPEGKVAAGKLAGAVAYGAQVIQIQGSFDDALSLVVEISERHP
                     IALVNSLNPYRLEGQKTAAFEIVDALGSAPDWLCLPVGNAGNITSYWMGFRQDHARRS
                     SGLPRILGVQAEGAAPLVLGHPVEHPETVATAIRIGKPARGEQALEAAEQSGGRIIAV
                     SDAEILAMQRRLAGEGVWVEPASAAGLAGLARQLREGKMRLSELRGRRVVAVCTGHGL
                     KDPEIIAHNMPAPLRLPARMDALEEAILGVSR"
     CDS             526778..527677
                     /codon_start=1
                     /EC_number="2.7.1.39"
                     /gene="thrB"
                     /locus_tag="ANT_04930"
                     /note="protein synonym:HK"
                     /note="protein synonym:HSK"
                     /product="homoserine kinase"
                     /protein_id="BAJ62527.1"
                     /transl_table=11
                     /translation="MNFTVRVPATTANLGPGFDCLGLALDLWNEAEFCFEGEGICVEI
                     HGEGAEALSKKPDNLILTAFFRLLHQLGAPKPRGVRLRVQNHVPVGSGLGSSASAVVA
                     GLLAARAWSGRDIPAERLLDVAVSLEGHADNASAALFGGLTVSVNTPQGWLVERFEPA
                     PMQMVVVLPQFSLSTRSARLALPALLEHGDAVFNLGRTALVVEALRRGDLELLGRVMD
                     DRLHQPYRLPLIPGAQDALRAAKEAGAAAVALSGAGPSLIAFPYQDPEPVAHSMQTAF
                     QKQGVPARAFYLHSTPLGAQILG"
     CDS             527834..528727
                     /codon_start=1
                     /locus_tag="ANT_04940"
                     /product="putative prenyltransferase"
                     /protein_id="BAJ62528.1"
                     /transl_table=11
                     /translation="MKPFPFLFGPMRVPFLLLTPACVAVGVATAYRQTGHLSLLDILI
                     VLIGALAAHISVNVFNEYYDFKSGLDSRTQRTPFSGGSGSLQAHPEMARATLILAWAS
                     FAVTALVGLYFVWKQGWGLLPLGILGLVILVTYTLWFVYQPVLCLIVPGLGFGILMVM
                     GTHYALTGTYTWTAFIASLVPTFLVSNLLLLNQFPDVEADQSVGRRHYPIVLGRRASS
                     VVYGLFLLGAYLAVGVGVALRLLPWTSLLALLTLVLSWKAFRGAFENAENIPALIPSM
                     GMNVIINLATPVLLALGLFLA"
     CDS             528823..530058
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ANT_04950"
                     /product="putative beta-ketoadipyl CoA thiolase"
                     /protein_id="BAJ62529.1"
                     /transl_table=11
                     /translation="MYNQSMVEEAVIIEAVRTPIGALGGSLARVRPDDLAAHVLQALL
                     ERTQIDPALVEEVMLGCANQAGEDNRNVARMALLLAGFPVEVAGVTVNRLCASGLSAV
                     NMAARAIRLGEGDVFIAGGVESMSRAPYSLPKAETGFPFGNLTAYDTALGWRYPNPRM
                     QALYGTESMGETAENIAEMTGITRQEQDAFALASHQRAIAAIDSGKFAEEIVPVPVPQ
                     KKGDPLMVDTDERPRRDTTLESLAKLKPAFRPNGTVTAGNSSGLNDGAAALLLMSASR
                     AAQLGLKPLARIVSSAVAGVPPRIMGMGPVPAARKALARAGLTLEQIVLVEINEAFAV
                     QTLAVMRELGLPHDKVNVNGGAIALGHPLGCSGARILTTLIHEMRRRAPYMPRPFYGL
                     ATLCVGVGQGEATIVEWLA"
     CDS             530055..531026
                     /codon_start=1
                     /locus_tag="ANT_04960"
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="BAJ62530.1"
                     /transl_table=11
                     /translation="MNVLVTGASGFIGGNLCRVLVQAGHRVRAFHRASSVLTLLEGLD
                     VEHAVGDLTQPETVARAMEGIEVVFHAAAWMGSSDPGKLYAVTVEGTRTVLRCAREAG
                     VRRVVHTSSVAALGVPEYRSPFPINENHTWNYRPERYPYGYAKYLAELEVQRAVAQGL
                     DAVIVNPALVFGAGDVYRQSRSLLRQVAARRFPFSVEGGLNVVHLDDVIEGHLAALER
                     GRTGERYILGGENLSLHAMLSLAASVVGVPPPTLVLPAGIVRAAAIPLNAFQRFLNLP
                     VPVETLHLAGYYFYFDTTKARRELGIALERSARQAFADAWEWMRFPR"
     CDS             531047..531871
                     /codon_start=1
                     /locus_tag="ANT_04970"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62531.1"
                     /transl_table=11
                     /translation="MNNGLTDWIKRHSLITFYLLAFLFSWLGWIPQLLTARGVWTVDH
                     PLLSLLGGGGPTLAAVLVVWWTQGRQAVGGLFARLVQARAGWRWLGAVFAFWILVGAL
                     AWSLMMLFTPHRANLQGFSWGVLVPVFLTMLLSNVWEEIGWRGFALPRFQERFSDWHT
                     ALIMAGLWSVWHLPLLLNPKNPMSGLPWSAELLFSLALTVVYIWLYRQTGGSLFYVTV
                     FHALSNTLAYAFLAWGVFLESYGFVVGLTALAAVVILKVYGTQQFAYPQGVDKILD"
     CDS             531881..532243
                     /codon_start=1
                     /locus_tag="ANT_04980"
                     /product="hypothetical protein"
                     /protein_id="BAJ62532.1"
                     /transl_table=11
                     /translation="MPTCPKCQQTERQNKAGRTESGAQRYKCMRCGHKYTPEPKPRGY
                     PEEMRKQALQMYVDGMNLRRIARHLGVHHRTVSLWIQAYAARISEVPLPEEVKEVEMD
                     ELFTFIGHKKTGSTSSPL"
     CDS             532276..532629
                     /codon_start=1
                     /locus_tag="ANT_04990"
                     /product="hypothetical protein"
                     /protein_id="BAJ62533.1"
                     /transl_table=11
                     /translation="MVWERTDSAIQEMVDEAPKAKQYFSDAFDAYNRLWYHGGRYAVS
                     EGKRETYSVEGDNAELRHYLARLARSSRCFSRCRFALECALRLFAYCFNSRQLYRQRY
                     PAYPAHVMEFIPPVF"
     tRNA            532692..532763
                     /locus_tag="ANT_t0080"
                     /product="tRNA-Gly"
     CDS             533069..533479
                     /codon_start=1
                     /locus_tag="ANT_05000"
                     /product="hypothetical protein"
                     /protein_id="BAJ62534.1"
                     /transl_table=11
                     /translation="MPEFHQWLEQKFRQWEKEQGKAQSYYAFARYLGVSQSDLALWMI
                     GDGLPGADDLSLIAEKLGDEVYTIMEKPRADPFLQKMVDAFPVLPVGLRERLASAAWD
                     TRQYIQSRGLDPESVEAKKALVEIFQRYGIRFGG"
     CDS             complement(533487..534407)
                     /codon_start=1
                     /EC_number="3.1.26.11"
                     /gene="rnz"
                     /locus_tag="ANT_05010"
                     /note="protein synonym:RNase Z"
                     /note="protein synonym:tRNA 3 endonuclease"
                     /note="protein synonym:tRNase Z"
                     /product="ribonuclease Z"
                     /protein_id="BAJ62535.1"
                     /transl_table=11
                     /translation="MFEITFLGTSASAPSVKRGLSAQLVKHNEYRFLIDCGEGTQRQI
                     LQAGLGFKRLNHILITHGHLDHILGLAGLLSTFMRWETIDHLEIYGPRSALERIDDLL
                     TRVVLRGARPPMPLTLIPITPGVFFEGDDFRVSAFPVHHRGSESLGYLFEERSRRPFL
                     PEKADALGVPAGPLRRDLVEGRAVHLPDGRTITPDMVLGEERPGTRLVHVGDCGETES
                     LLGVVSGADGLVIEATYLEEEREMAHQFSHLTARMAAELAQRAGVKALYLTHLSRRYR
                     EKDVLAEAQSVFPNTIVVRDFDTFIIKRNE"
     CDS             complement(534409..534537)
                     /codon_start=1
                     /locus_tag="ANT_05020"
                     /product="hypothetical protein"
                     /protein_id="BAJ62536.1"
                     /transl_table=11
                     /translation="MLNCSVLRRDFDHAEEVIRKADSEAFITAEEVRAVHRGFWRL"
     CDS             complement(534540..534923)
                     /codon_start=1
                     /locus_tag="ANT_05030"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62537.1"
                     /transl_table=11
                     /translation="MESVLSLEVILTALMIFVMRVVDMSMDTLRILFVVRGKKLITWV
                     LGFLQSLIFIVAVARVLGGDVHPLSVLAYAAGFATGNIVGMFIEDKMAIGHVRITIIS
                     TAAGSQIAQALRESGYAVTEIKMAL"
     CDS             complement(534936..537134)
                     /codon_start=1
                     /EC_number="2.4.1.1"
                     /gene="glgP"
                     /locus_tag="ANT_05040"
                     /product="glycogen phosphorylase"
                     /protein_id="BAJ62538.1"
                     /transl_table=11
                     /translation="MDMSSFVRETPNHFSLPRRIARLGDLAYNLWWAWNPEALRLFAR
                     IDRTLWEQVYHNPVAFLRRVERRHLNAATNDRYFLESYDAVIYAFDQYMNEENTWFKR
                     NYPQLTNQQIAYFSFEFGLHESLPVYAGGLGVLAGDHLKEASDLGLPLAGVGFYYTQG
                     YFSQRITEDGWQETRNLYLNYEELPVVPLVHPEGGPLMVSVTLAGRKVFARILQIQVG
                     RVPLFLLDTDVESNTLADRSLTARLYTSDQEVRISQEILLGIGGLRALRLLGYSPTVW
                     HMNEGHSAFLTIQRLREYVAQGFSLEEAKERIRKTNIFTTHTPVPAGNDEFPLWMMDK
                     YFSHVYNELKMDRDLFIDLGRNMQEWGETFSMPVLALRLSEKCNAVSELHGRVSRRMW
                     HKLWADKKENDIPIFHITNGVHVGTWMARRWRLLFERYLGMDWMDNLDDPEMWMMIDS
                     IPDAEIWAVRRHLKNKLVHYAIERARRHWVTGEAHPVQVVAGGVLLEPYSLTIGFARR
                     FATYKRANLIMRDVDRLIRIITNADMPVQIIFAGKAHPADEPGKLLIQQVYRAVKDSR
                     AGGRLVFLEDYDMNLARLLVQGVDVWMNTPRRPNEASGTSGMKAAMNGVLNFSVLDGW
                     WREGFNGKNGWAIGEEKDYTDPNEQDERDAQSLYATLENEIIPLYYGSRAGDDIPHAW
                     IERIKESMRTLIPQFSTRRMLKEYLQQAYLPAMEAAVQMEALPGEGKRSN"
     CDS             complement(537283..538353)
                     /codon_start=1
                     /locus_tag="ANT_05050"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62539.1"
                     /transl_table=11
                     /translation="MKFPCNNCLITNCNASAHMRIENLYIMILYLQRGEFTRRQGTGT
                     TPHNRMSLNSNQGPFSYAYSTGGRRRVSPARPSSSPSSPNSSGNGHFYPPDDRSESSP
                     PSSPPSSPPPPPDFFFQNAAWWNRFSDQFHNDPFFIWRILGLCIGLFVFFFPATVGAA
                     IHLFDIFWGGVDPNLVSDSSFLWLFINDFVVREVVIGIILCAGLLFIMLATHDEPLLY
                     PIFLLIGLLFVGVSSIFSVVVSSRCILDLSCDPSAYILSVALILVLGIAGSALPFAYR
                     IGSTILFSGVFLISFAYSSAVWLVKLAGTPPYIIATPEILRATLLLFLNFVLVFLPAG
                     LSWRPLMEQMSLNRRNPQREAE"
     CDS             538508..539674
                     /codon_start=1
                     /EC_number="5.3.1.5"
                     /gene="xylA"
                     /locus_tag="ANT_05060"
                     /product="xylose isomerase"
                     /protein_id="BAJ62540.1"
                     /transl_table=11
                     /translation="MSDYTPKPEHKFTFGLWTVGSTGRDPFGAPTRDALSPVELVHLL
                     AEVGAYGVNFHDNDLVPIDATPAERDRIVRDFKNALKETGLVVPMATTNLFSDPVFKD
                     GAFTSNDPKVRAYALQKTMQAIDLGVELGAKVYVFWGGREGTESDATKNPVDAIKRTR
                     EALNFLCEYVLDQGYDLKFALEAKPNEPRGDIYNPTTGHMLAFIETLDHPEMVGVNPE
                     VAHEHMAGLNFLHGVAQAWEAGKLFHIDLNDQYPGRYDQDFRFGSRDLKAAFFLVKFL
                     EDVGYSGSRHFDAHAYRTEDYEGVKDFARGCMRTYLILKEKAARFNADPEIQALLAEI
                     NATEPSLESVFGAYSREKANRLKGMTFDRVSLGKRGLKYERLDQLTIDLLLGVR"
     CDS             539812..540303
                     /codon_start=1
                     /locus_tag="ANT_05070"
                     /product="MarR family transcriptional protein"
                     /protein_id="BAJ62541.1"
                     /transl_table=11
                     /translation="MPTHYQGDPQIKLALDTFIKFTRASSALESYLFHDGILEGLTPS
                     QFGVLETLYHLGPLCQGEISHKLLKSTGNITLVLDNLEKRGLIERQRSREDRRMVTIV
                     LTEAGRELIERVFPRQAALIAEAFSPLSSEEQRTLGELCKKLGLALQQKNSPHLTHIH
                     STP"
     CDS             540317..540856
                     /codon_start=1
                     /locus_tag="ANT_05080"
                     /product="hypothetical protein"
                     /protein_id="BAJ62542.1"
                     /transl_table=11
                     /translation="MSWQIDTAHTQIQFTVRHLMISKVRGWFEKFSGTVNLDESNPEN
                     TSVDVVIDAASINTREPQRDAHLRSADFLDAEHYPHLTFKSTRVERTGERTARLYGDL
                     TIRGVTKPVVLDVTFNGMLTNPWGMTSAGFSATTTINRKDWGLEWNVALEAGGWLVGD
                     EVEIAIEAELIKVVAEQPA"
     CDS             540874..543897
                     /codon_start=1
                     /locus_tag="ANT_05090"
                     /product="putative M16C family peptidase"
                     /protein_id="BAJ62543.1"
                     /transl_table=11
                     /translation="MLSLPWEYTAGGFYVASFQIAVDCIMSSNSHTLREFCMSSSVHG
                     FELLRDERIPEINSRARLYRHIRTGAELLSLENDDENKVFGITFRTLPMDDTGLPHIM
                     EHSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTYPDKTCYPVASQNLQDFYNLVDVYL
                     DAVFNPLLSPYTLKQEGWHYALENPEDEMTFKGVVFNEMKGSYSSPDSLIYDQVIRQL
                     FPDTPYGLDSGGDPEKIPNLTYEQFLYYHRTFYHPSNARIFFYGDDAPEKRLQMIDAY
                     LQNFEYKQVPSVIPLQARASQPRRVRLPYEVGTEEEAPRHFIALSWMLPEVPDAHEAL
                     TLSLLEHVLIGTPASPLRKALIESGLGEDLTAANLTLDLRQPVFSVGLKGVASENLER
                     VEALILETLQQLADSGVDAETLWASLNTLEFRLREQNTGSYPRGLFVMLQALALWLYD
                     KDPIEALRFEAPLRNLRQRLTQGERLLEERIRRLLLENPHRVTVILDPDPALAERRAT
                     AERDRLEQARAAMSPEQLQQVVEETRELKRRQETPDSPEALATIPTLKLSDLEREIRR
                     IPSEEHTLAGIPTLYHDLFTNGIVYLDLAFNLRVIPQEWLGLLPLFGRALTEMGTARQ
                     SYVQLIQSIGQKTGGIWTQLFLSAAPERKDAEAWLVLRAKAMLEQTPDLMALLQEILT
                     SVRLDDAERFRQMVLEEKASLETRLIYSGHRMAATRLRAGLDEAGWLSEQTGGVSYLF
                     FLRQLAREVEQNWAEVQARLEGIRDRLLQRQGLRANVTVHREGWQTVQPALSDFLAAL
                     PQRAVLPSQWTVQAPPAQEGLIIPSQVNYVGKGGNLFEAGYTLHGSMYAITQYLNATY
                     FWERVRVQGGAYGGFCSFDPYSGAFLMLSYRDPNLLKTLEAYDQLAQYLRTLHIEESE
                     RVKAIIGAIGELDAYQLPDAKGYTAFVRALLGITDERRQRLRDELLNTQPEDFRRLAD
                     AVENLAHHGRIAVLGTEPALQEAAQVRGLNLQRIL"
     CDS             543902..544747
                     /codon_start=1
                     /locus_tag="ANT_05100"
                     /product="putative polyphosphate kinase 2"
                     /protein_id="BAJ62544.1"
                     /transl_table=11
                     /translation="MGEAMERYFIKPGEKVRLKDWSPDPPKDFEGDKESTRAAVAELN
                     RKLEVLQERLYAERKHKVLVILQGMDTSGKDGVIRSVFEGVNPQGVKVANFKVPTQEE
                     LDHDYLWRVHKVVPGKGEIVIFNRSHYEDVLVVRVHNLVPPEVWKKRYEQINQFERLL
                     HETGTTILKFFLFISREEQKQRLLERLADPAKHWKFNPGDLKERALWEEYEKAYEDVL
                     SRTSTEYAPWILVPADKKWYRDWVISRVLVETLEGLEIQLPPPLADAETYRRQLLEED
                     APESR"
     CDS             544774..545535
                     /codon_start=1
                     /locus_tag="ANT_05110"
                     /product="hypothetical protein"
                     /protein_id="BAJ62545.1"
                     /transl_table=11
                     /translation="MSQIQVTLLGTNGWFDTHTGNTPSVLVQAPDFDVILDAGYGFAK
                     LDRFIRGDRPAFCFLSHFHLDHLIGLHTLAKYQFQHGLTIIGQPGTKWALDSLLSPVY
                     SVPLTGLRYPVHIVETQPGWIEGLPFEAQALPLIHSQPCFGYRLQIAGKTLAYCTDTG
                     YCENAVKLARQADLLLTECSQAPGTPHNDEWPHLSPTEAARIAREAEARQLVLIHFDP
                     TQYPSLEDRIHAETEARKVFSSVTAGRDEMQFTLA"
     CDS             545532..548522
                     /codon_start=1
                     /locus_tag="ANT_05120"
                     /product="hypothetical protein"
                     /protein_id="BAJ62546.1"
                     /transl_table=11
                     /translation="MSALGIENGVVAGQSAAWSLIQKLGEGDAGEVYLVEGLVTHEPA
                     ILKRPRRSVFLGEIRRQAEQIRTEGRILQALEHILKPLQGRVSTPRLLDVSKPGTEFS
                     ENQFIVIARANGFDLTTLTRVAQMGFSPAEMLGYTPAEQTFLRELAKQGAVPERVLLA
                     ALAAVLDVFALIHTTEWEWNNQVIQGILWNDVKPDHLFWNPYQTSVTLIDWGNGRLIE
                     KIEGGREARYSPVEDLRQFWEEMSRFLWQVHPALLERLEWSTALPDLREIRSSVEVLR
                     QRIERLRLDAERQARQLREEEARLLSPTLGEGLLREALEDVQARLIALGEIPDYENAL
                     RMAGNISTNLAAVGDMESIRAVCRWAESLPGSQSAMWQVIARLAEYARRADPAHKEAI
                     LQAVQRAAAGQWEEVLWYMLVFLENAPEPDNWQDLVEQVRALALPEDALNVRPLPVLK
                     RILFTLQTTLQRLEDQTGESEGEEAFALRALVEQLQDVTYNWVQVDPLPPHTTIAYQD
                     SETLITDIEHFLPGAGNDLRRALTPLRWQVQDVLESWGRREFILARQGLRRLLALDPD
                     RRRLLRAESALEKAPHWLQQLHGGPQAHEHLSECITRWEYEGREMRNQVGSAGWLDGI
                     LEGLKAIRRGTWPGDLLLYQPELVADLPWLTEFERAEEVQKRLYPHMTLRLPLTLQGI
                     QEARFGPEQALSFLEPVDAWTPEARGSSARVYRATYLAGNGEQQEAALKIMRMDKAEY
                     ALPLFREEARILSILQGVPGVNPMLECGFLWVGEGFDFPPDHNLGAIQALRGDAVRMG
                     VERVDTFLEQLDQRVREGWAPYLLVQTRRREDNLLLMCDASVTQGRLLPVPQLLLMSI
                     QICEILEEAHRRNIVYRDHKILHYYWEAPQNGIYIIDWNVARYYPEGLTPVEIHMDLV
                     QLGARGLHHILTGRPAPGALPLGPTRPEEIEQAAQQYRAQWTFDDQRLSAQVLTILEQ
                     LLSGSYTSVSDLKDDLKRAYLDLR"
     CDS             548562..550295
                     /codon_start=1
                     /locus_tag="ANT_05130"
                     /product="hypothetical protein"
                     /protein_id="BAJ62547.1"
                     /transl_table=11
                     /translation="MDLSLLDRIEQQLADASTPLNELRRLSIELDDAMHESDFATLPE
                     SERTRAQRLFQELRGRLRGGEVKPVPETPLRGAAATEASAHPSPTRPRGEERQHNPYA
                     QETMEEAERLFYGGRYADAIRLYDQVLAIEPDWERARQHRNEAEGYLRTGYIPAVALP
                     AEAASAFGKAQSAARLGRYQDALALLQRAQNILQQYGIQRWQEGTEFEQKLQQNIDAE
                     NVFNEGLQLFAQGQLEEGIDRVETAAQATGLPRYHERLQTLLREREQIQSSAEALNAT
                     VLDPRAVTQAKTNIETLVLKYGENPTLQKLRAQLETAIPRLASSLMEQARQLRAQAVR
                     AQTLETARSRIRQARQLLDQLTGLGYQSDEFSELQREVEKTFQEISRYEDTLEQTRAV
                     LETNPNWPSAAARMSADLRARFPNDPNIIELNKALSVYTSTLLGLKIAGAALALALVV
                     FLIWLGVGQVRGYILSLTPTATATPTATATPTRTATPTATVTPTPRPTETPTITPTPL
                     TATLARRVWARNGCYEEFTGIAQIPEGAVVRLLPAERRFDTLSRECLLVEYVGETRTI
                     IGWILIADLAR"
     CDS             complement(550357..551166)
                     /codon_start=1
                     /locus_tag="ANT_05140"
                     /product="hypothetical protein"
                     /protein_id="BAJ62548.1"
                     /transl_table=11
                     /translation="MSEYTNTAGQRLDLPEPVVSLSGRTMGGADYQIIGTVMQALTLR
                     MKPGMGFYTEVGSLSWMSQGVRMDTNLGKGGLMGALGRMFTGESLFVVNYTAEIDGAM
                     ATFSCDFPGKIVPVNLAQGQAMIAQKDTLLVAEQSVSLSIAFQKRLGAGLFGGEGFIL
                     QKFEGPGTFFASFDGEIVEYTLQPGQKMLVDTGHLAMFEPTVTYDVQMVKGVKNLLFG
                     GEGLFLVSLTGPGRIWLQTMPMSKLAGAIHKFMPSAEGKSQGPGLNINLGG"
     CDS             complement(551226..552380)
                     /codon_start=1
                     /locus_tag="ANT_05150"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62549.1"
                     /transl_table=11
                     /translation="MRPKSLPWLVFLCVRVPLLLALSFDGLRGYGDFFHFYRLAQFPG
                     LPFVNYWVEFPPLFPFLIEGLARLAPRENAFTYLLVLLLTLADLGNVLLFQRLSQRLN
                     LPDDSTRTILYAALIAGLAYTWWYFDSVCVFFTLLGLDAMLTGRSAGKTGLAIGLGML
                     TKWFPALLLPALWRILPPKRAVLATLTAFGLVLVVYAGLWTASPAFTNASLRSQSAKG
                     SWETVWALLDGNWGTGNFGELSQRSDPQAAAQTMGNPARIPAWLSLLALGGLGLFLYW
                     RYKVTSPQDALPLIGLTWGLFFLWSPGWSPQWVLYLIPLILLSLPLRQALLMGGALML
                     VNLLEWPLLLSRGWFHLLPLSVILRTFLLILLVMVWAQNPLKLLQPDFRN"
     CDS             complement(552391..553053)
                     /codon_start=1
                     /locus_tag="ANT_05160"
                     /product="hypothetical protein"
                     /protein_id="BAJ62550.1"
                     /transl_table=11
                     /translation="MEEILSLPIRGMDGAPLTNTFFRQKEEASELAVFFPGRGYTCAM
                     PVLYYPTRLMVQRGADALTIEYNATREAGFDQLDMEERLRRLGNDARNAVEVALTQRK
                     YQRVVLFGKSLGSLVLAWLLVHEPELLHATYVWLTPLVRVPFLREAVRRAKPQSLFIA
                     GDADPLFDSDAMQDLMKQGDFHLLVLSGANHSLEIEGDLEATLKGMSLMLRTLDEFLQ
                     KG"
     CDS             553190..554650
                     /codon_start=1
                     /locus_tag="ANT_05170"
                     /product="putative M20 family peptidase"
                     /protein_id="BAJ62551.1"
                     /transl_table=11
                     /translation="MGILVLVLVLFFLAFLLIRTVLFGKVPPPVEQAELPEVDGNIVA
                     EHLAAVLRHRTISESEGKPADPQTFYALHRELERLYPRVHATLRVDVVNRLSLLYTWK
                     GRDEFLEPVLLAGHLDVVPVDPETRDAWKFPAFDGHIEDGAVWGRGALDTKNSVVAIL
                     EAVETLLKQGYQPKRTILLAFGHDEEIGGFQGAAQIAGRIQAYNARLAAVLDEGGAIL
                     SGGVVPGVSLPVALIGIAEKGYATLQLTVESSGGHSAMPPKHTGIGVLARAITRLENA
                     PLPERLHMVHRMFEHLAPFLPFGLRLAFANLWLFRPLIARVLSANPRTNALIRTTTAV
                     TMVQGGVKDNVLPARATAVVNFRLMPGDRVADVVAYARRVIADDAVQISLPQGGSWEA
                     SGVSPTDSPAYLGILQALGQVYPEAVSAPYLVAGATDARHYQAVCDQIYRLSPMLITP
                     EELKTIHSENEHISIETLARMVQFYIQLIKIWGENG"
     CDS             554664..555020
                     /codon_start=1
                     /locus_tag="ANT_05180"
                     /product="hypothetical protein"
                     /protein_id="BAJ62552.1"
                     /transl_table=11
                     /translation="MPITVNQLKNVNELVEYLNDLEAKIRVLEDENTALRSAMEEVSN
                     SNRNVLNLLRQEWPRTGLVSRSFWIRALTVYGHFFVIQLIVTAFLFVGYLIFIAPVIT
                     RFINEVLPTLLPGMTP"
     CDS             complement(555091..555264)
                     /codon_start=1
                     /locus_tag="ANT_05190"
                     /product="hypothetical protein"
                     /protein_id="BAJ62553.1"
                     /transl_table=11
                     /translation="MSDCACGGSCGCGHHTEESTVYLTREEYIARLEQYLLDLKAEIA
                     AVEAELAELRQTA"
     CDS             555389..557092
                     /codon_start=1
                     /locus_tag="ANT_05200"
                     /product="hypothetical protein"
                     /protein_id="BAJ62554.1"
                     /transl_table=11
                     /translation="MERTVPSATSEEIKLYRATLYSLLRSTAEVSIRTLEEAHAGMNS
                     LLHPHARDSQPDLSAFIYAMLRLPDCMPEVRSVILGQSQEVFQRHGYGNIETWQEVSA
                     RARRRRCFFDGQGTLACYIASRSDIEDILPALTAYQIEWNKMRLLLSSLPEGLSLEEA
                     AVDPQRFLRLADALRLTVEDLGRLRTLWGSQFAAMLERIRAQKMNLGVRLLSGSLSAY
                     QRATHLWWEHLESVCSQLGERPLYFISSNTHSLANLLSGYALRHEDEIARFIEQSSPE
                     LKNEWRDIQQGQVRSSRENFLYYALKKYQQSMAGAHSLHEQLEEEQSLGILRIPSERS
                     FDLEAQVIDLSRLDPSRFDPRLQTGLDLTALRQSNALILNIDYPLGLAAYHLLSKIAE
                     QAIQILGVYIMGKAATLNARRGDVMIPSVVQDEHSHNTYLFRNCFTAADVTPYLVYGS
                     VLDNQKAVCVLGTFLQNARIMDVFYREGYADIEMEAGPYLSAVYEMSRPKRHPVDELV
                     NLSDLPFDLGILHYASDTPLSKGQNLGAGTLSYYGMDSTYATTIAIARRIFQQEILRL
                     G"
     CDS             complement(557094..559163)
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /gene="glgX"
                     /locus_tag="ANT_05210"
                     /note="protein synonym:Glycogen operon protein glgX"
                     /product="glycogen debranching enzyme"
                     /protein_id="BAJ62555.1"
                     /transl_table=11
                     /translation="MLAILPGRSFPLGATVFPKGVNFSLYSRGSTRVELLLFNSADDA
                     KPADVIPLDPHKNHTFHYWHVFVPGLKAGQIYAYRVDGPYKPEKGLRFDPTKILLDPY
                     GKAVVFPRHYDRKAACQPGDNTPYALKNVVVDTSAYDWNGDYPLHRPFARSVIYEMHL
                     AGFTRHPNSGVTEEKRGTFAGLIEKIPYLVELGITAVELLPVYAFDPLDAPPGLSNYW
                     GYSPISFFALHPFYSSRKDPQGVMDEFRDMVKMLHRAGIEVILDVVYNHTTENGAEGP
                     TLSFRGLANDVYYMLDPKDRSRYVNYTGTGNTLNTNHPVVRRMILDSLRYWVSEMHVD
                     GFRFDLASILSRDEHGNPVPNPPVLLDIENDPYLAGTKLIAEAWDAAGLYQVGNFVGD
                     RWREWNGKFRDDIRRWVRGDIGSIYAFPNRMLASPDLYGHEEKEPDQSINFITCHDGF
                     TLNDLVTYEQKHNEANGEGNRDGHNENLSCNHGVEGPSKDPEIEALRERQIKNFFAYA
                     LLALGAPMIQMGDEVRRTQRGNNNAYCQDNEISWFDWSLVEKHADLLRFVRELIRFRL
                     HFASDPEDDFKSLSQILQEARITLHGTHLNQPDWSPHSHSLAMTVSNGGGKRFIHMIF
                     NAYHDPLTFELPALANGGRWRRVLDTSQPSPDDLIPPFRAPRVHSTHYRAEGRSVVVL
                     VADLDEN"
     CDS             559310..560950
                     /codon_start=1
                     /EC_number="2.3.2.2"
                     /locus_tag="ANT_05220"
                     /note="protein synonym:gamma-glutamyltransferase"
                     /product="putative gamma-glutamyltranspeptidase"
                     /protein_id="BAJ62556.1"
                     /transl_table=11
                     /translation="MESNLFEFTSRRSPVISRYGIVAASQPLAVAAGLKVLSMGGNAA
                     DAAVATAAALAVTEPGSTGLGGDAFCLYYEASTRKVYALNGSGRAPAALTLERLEAEG
                     FGQTLPRFHPYTITVPGACAAWCDTVERFGRLPLLKVLGPAVELAHEGFPVAPQTAYL
                     WQRAATSQLASAVNGLELTLNGRGPRAGEIFRNPGLAQALTMIAIEGKDAFYRGAIAH
                     AIVEVVREAGGCLTLEDLAAHESTWEEPISVTYHGVHFWECPPNGQGIAALLALNLLE
                     TYDLHRLDALSPERLHLLIEAMRLAFADARHYVADPVFARIPLEELLSKEYAGERRKL
                     IDPARANPAVRHGVPFASSDTVYLAVVDAQGNACSFINSNYMGFGTGIVPRGWGFSLQ
                     NRGHNFSLIPGHPNQVAPFKRPYHTIIPAMATREEDNSLFACYGVMGGFMQPQGHLQV
                     AVALVDDQLDPQAALDRPRFCIEPDESGSVVALEEGIPVKTMAALADRGHHVRPVSGV
                     GRTLFGRGQVIYRDPEQGVLWAGSDPRADGCAMTLGSS"
     CDS             560955..562817
                     /codon_start=1
                     /gene="uvrC"
                     /locus_tag="ANT_05230"
                     /note="protein synonym:excinuclease ABC subunit C"
                     /note="protein synonym:protein uvrC"
                     /product="uvrABC system protein C"
                     /protein_id="BAJ62557.1"
                     /transl_table=11
                     /translation="MKPISEHLQQILDNLPTRPGCYIYKNEAGEVIYVGKAVNLRNRV
                     RSYFNESPKDFKTRQLVRHIAHIDWIVVESELEALILEMNLIKKYRPRYNIRLKDDKR
                     YPYIKVHWAAPFPKVTVTRQMVQDGSRYFGPYTSVWAVHQTLDVLRRIFPYLTCDREI
                     TGKDARACLYYDIKLCAAPCIGAIGQAEYRRMIEDLCDFLQGRTEPIVTRLQKEMEDA
                     AEALQFERAAAIRDQIFAIEKIVEKQRVISSKQMDSDVIAIARANGEACVQIFFIRSG
                     KLIGREYFILEGTHEEQEAEIVSQFIKQFYSEAATLPDQVLLPHEVEEAQIIEQWLKS
                     RRGGEKVQLVVPGHGEERELVEMATENAIETLAALRAQWEADTNKQQQALAEIQQALN
                     LPAPPNKIECFDISNTQGTATVASMVVFEQGVPSKKNYRHFNIRSVQGPDDFASMEEA
                     LTRRFKRWQAAQEGQFEPGAKLDPAFTILPDLLIVDGGKGQLSRAVKVLESFGLLGKV
                     PVVGLAKQNEELFLPERSESILLPRHSQGLYLLQRIRDEAHRFAITAHRKQRTKQGMA
                     SVLDSIPGIGPARRRWLLQHFGSLEAIRQASLEELTAAPGITKELAQKIKEHLE"
     CDS             complement(562864..564660)
                     /codon_start=1
                     /EC_number="2.5.1.-"
                     /gene="ctaB"
                     /locus_tag="ANT_05240"
                     /note="protein synonym:haeme O synthase"
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="BAJ62558.1"
                     /transl_table=11
                     /translation="MFANNSLNPVKRFRLLIGLALILTLALMTAGTILRLNNGAQACP
                     DYPTCYGSFALPADPTQAASMIHRGLAGASFLSLLGALGIASRHLRHQRALWLSTLAA
                     TVLFLIQIPLGAVLVFGIWGRLISALHFLLSMLALAALTSALALTWLPSAESPLRLRF
                     ASPFARLTLWSTAAGLVLLISGALVSALDAGQACPTFPVCLPAEPLGWLALAHRSVML
                     ITGVLLSLQFRRAWRSQRSQTLTLPAVTAGFVLFFGQGLMGALMVLRGFPVELAGVHA
                     LAAAGWVAANTLAVLGVGLAGRTTEEETAEAQETLPLRQRLGDFYRLNKPVIVLLLLV
                     TTYAGMVVGGKRLPSLELTFWTMLGGALAAGGASALNQYIDREVDKAMQRTAKRPIPS
                     GRMKPAEGLAYGIAACLTAFFLLAGFVNLLAALLSLAGMVYYVVLYSLWLKHATVQNI
                     VIGGGAGAIPPLVGWAAATGSLNIPSLFLFAIIFFWTPPHFWALALVRRNDYARGGVP
                     MLPVVRGEMETRKQVFVYTLELVGLTLLVPLFNLAGSIYLISALVLGLWLIGVAWRVL
                     KQGGNKIAWTMYRTSSMYLAFLFLAMVIDVLV"
     CDS             complement(564629..565414)
                     /codon_start=1
                     /locus_tag="ANT_05250"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62559.1"
                     /transl_table=11
                     /translation="MKTTVMPASTPKTHAFFSLRWLGTTLLVLMAVAVMVRLGVWQLD
                     RLGQRRAQNALILQNASAPVLDLNRALIQGKTDWKSQAFRLAEASGVYLHEEEILLLN
                     QVWEGQPGYHLVTPLRISGTDAVILVDRGWIPLNQADEAARAVYHLNGEVRLQGRLMP
                     SQAEPRWGGGGDPQIPEGGRLPAWKWLNVERISQQVSGNVLPVYLLELSENATLTLPY
                     RADTSIEVSEGSHLSYALQWFSFALILLIGYPFYVRKQLSQPR"
     CDS             complement(565411..565920)
                     /codon_start=1
                     /locus_tag="ANT_05260"
                     /product="hypothetical protein"
                     /protein_id="BAJ62560.1"
                     /transl_table=11
                     /translation="MSMWKAVTLRLIFSLILGMLAGWAVSEISYQLLKDPNARDQARR
                     IELVIPPGTAERVAAGEPVLSLPEKMTFVEGDLLVVKNLDSVSHQLGPVWVPPQSSGV
                     LEVGKASTYQYTCTFQTSRLFGIEVKPNLTVETRIQGVLLMGLPSAAMLGLYSFLIFP
                     IRAKEGTSA"
     CDS             complement(565917..566498)
                     /codon_start=1
                     /locus_tag="ANT_05270"
                     /product="electron transport protein SCO1/SenC family
                     protein"
                     /protein_id="BAJ62561.1"
                     /transl_table=11
                     /translation="MRKYAFWLGLGVFIALLAVAGLALAQPYRLRGSIIDPPQPAPAI
                     ALNGFDLSAQRGKVALLFFGYTTCPDVCPATLGEMKQVLQRLGTQAQNVQVVFVTVDP
                     QRDTPEKIQKYTTAFDPRIVGVTGTEEDLQPIWQAYGVYREIRQGGTAAGYLVDHSAR
                     VYLIDPEGFLRATYPFGTPVEDLLSDVRFLLKP"
     CDS             complement(566495..567073)
                     /codon_start=1
                     /EC_number="1.9.3.1"
                     /locus_tag="ANT_05280"
                     /product="cytochrome c oxidase, subunit III"
                     /protein_id="BAJ62562.1"
                     /transl_table=11
                     /translation="MATQTTALEQAHSHAYKLRTARIGLWLFILSDSFVFAGLLVTRF
                     YLLGGHRPELEQLVGVIVTSVLLISSFFMNRAEVQISRGNRKGFITSTAITMALGIAF
                     LIGVVGVEWQIAPFGPADGAQGAVFYMMTGMHAFHVLTGVIFLGIILRNGLRGHYSPE
                     RHWAVEAAANYWHFVDVVWIFYYPALYLIGTL"
     CDS             complement(567074..567289)
                     /codon_start=1
                     /locus_tag="ANT_05290"
                     /product="hypothetical protein"
                     /protein_id="BAJ62563.1"
                     /transl_table=11
                     /translation="METSTDTQKKMELRRGVIVFAALAVLTVIEYFLGTHAAPTIFLW
                     LIALLKAGLVIWFYMHIQRAFREEGGH"
     CDS             complement(567306..569162)
                     /codon_start=1
                     /EC_number="1.9.3.1"
                     /locus_tag="ANT_05300"
                     /product="cytochrome c oxidase, subunit I"
                     /protein_id="BAJ62564.1"
                     /transl_table=11
                     /translation="MKKIFQIGLLRGIFGQILGMALGYGLVTALQLLSGARLRAEPAW
                     VVGGAFSALGFLIALGAFTDWFRMAKGEEVPEPEDIEEPQDGRRYWGLSYDHKVIGVQ
                     YGFLSLFLLVLGGLFGLIFRTELLAPQLQFLSFNLFNTLIGLHGMVLIASILMGIAAV
                     SNYVIPLLIGARDMAFPRLNAFSFWVAVPGALILLWSLALGGFETGWTGYPPLSIRGP
                     MGVQMFFLGVWFVGWSSILGALNLIATILRMRAPGMSMFRMPILAWSVLATSIIALTA
                     TQLIGLSFQLVLFERLLGMGFFEPSNGGNPILFQHLFWFYSHPAVYIFVLPGLGIISE
                     LLPVFVRKPLFGYKWVAMSSLGIALVGFLVWAHHMFAAGMEEYLRVPFMYSTLLVAVP
                     TGVKFFSWTATIWQGNIRLRVPMLFVLGGIIIFLLGGITGPLLGTVSTNLHLTDTYYV
                     VGHFHATMFGGYVFPFFAALYYWFPKITGRQMSEKLGKWHFWLLFIGFMVMSLGQMRI
                     GMLGMRRRIADYDPAMGFQLPNIIITLAGFMVALSVLILFINLYRSARFGQVATGNVW
                     QSRSPEWQIPSPTPAHNYPAPLRIVGEPYDYAGESQRYVEVDGAVPAAHAAD"
     CDS             complement(569182..570582)
                     /codon_start=1
                     /EC_number="1.9.3.1"
                     /locus_tag="ANT_05310"
                     /product="cytochrome c oxidase, subunit II"
                     /protein_id="BAJ62565.1"
                     /transl_table=11
                     /translation="MRNTHPVRKVLIASANPLFGKGLQQIYRQRFEAVEFLLTSTMDE
                     TLIQLERWQPDLVIVDYDDKTIHREEFLSHFITGQRSMQVMLVSLRESGAVVVYDRKT
                     LTPAQADEWLSDFQSHPPSKRSQTMKGNARHLFIAGGLVIVATALAYFALLGINPLPA
                     QASTQAQAIDRLFNAHFFMIALLFSLITVFIGYSLFAFRSKPGMEDQPGANMKGNNTL
                     EIIWTLIPLATVLVFSFFGARNLAETRMVDSQAMEVKVIARQWDWVFEYPAYGIKSNE
                     LYLPVNRQVLLKLTSLDVIHSFWVPEFRVKQDALPGENLVKELRITPIKEGRYTVMCA
                     ELCGGAHANMNRPVVVVSKQEFDAWVSSKVNAATADPVERGKRWAELSGCLSCHSVDG
                     SKLVGPTWKGAYGHEVELADGSKVLADETYLYASIVDPASQLVKGYPNSMPANYADQL
                     SDEQIRDIIEYIKSLK"
     CDS             complement(570754..571569)
                     /codon_start=1
                     /locus_tag="ANT_05320"
                     /product="hypothetical protein"
                     /protein_id="BAJ62566.1"
                     /transl_table=11
                     /translation="MKFLSAFLLLILTGLSACRTVLQPMPSPTQTSLTVTPTFPSVPE
                     PSATSPSESVTCDMLKDASSGLKGVLECSQQDGMIWVSLNVPYSDALGDFYRWSEGEG
                     WKPVEGAVEGSVFQKGNTLLAVYNPEPSLEDPQRKTELPTGTRGRMALGVFSALPESA
                     GRSLFPGPPDCQNLPPLFFPPESILKCRQQAHAVFLYTPYESRAILLILYALLKQADW
                     QVSTWDWALQRTVWKKGESNLFLEALFPNATAVQGDTFPPLARSRLEWRVTTP"
     CDS             571579..572112
                     /codon_start=1
                     /locus_tag="ANT_05330"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAJ62567.1"
                     /transl_table=11
                     /translation="MGMKSAEINLNFLGDGIALDFFSNSVIIIEQKFYKEIIGMTRIL
                     FLPDPHTLLWLEEEQPAEAILQALQRGEWLPPAPFHELPCADLRALQIEDMVLITRTA
                     PRAVVQPYLPHLSRRQMEVLKGLAEGLTTRQIAYRLRISTRTVYLYVSDLKRRFDAGT
                     RAELVRRAMIVLSSLRR"
     CDS             572189..574723
                     /codon_start=1
                     /locus_tag="ANT_05340"
                     /product="hypothetical protein"
                     /protein_id="BAJ62568.1"
                     /transl_table=11
                     /translation="MSGWQKLFRVLLSLSILSGWLLTFTVPVRAAAVTTRYVVDRLDD
                     VLPPDTETGDPGWLFACTEAAEDCSLRSAIMLVNYNAYELAASDPDNTYQFEIVFDEG
                     LACSSDNPCIVRMSPVLAGAGEDLNATGDFDIGARIPNTGEAYPLTLSLLGNPADPTA
                     VVIDGLLDEPNPRDRVLDVHPLANVTLSDLTIQNGKAGEHLDGGGGIRNRGTLTLRNV
                     MLIDNATSDAVSQVPGGFGGGIYNTGILFLQNTIVSGNKTGKGSGSANQGGDGGGIYN
                     ARGATVTVQGGEISNNSTGTGGDGYTSGAGGGLYNDGTAILSNVNFMGNSTGNGAPPG
                     GSAGLGGAIFNNAQSVLRLENVLFSQNKTGNGAASIDGNGGNGGAGGAIANAGYLEKM
                     DNVTFYKNQTGNGGQSVNFNGGSGGNGGALFNAGTAVVGNEDASPLYVIFKENKTGDG
                     GVAGVGYGGKGGDGGAIYNEGSIISPLVELNPDFPVFEANATGNGGGGGIYGDGGNGG
                     NGGALANTGTLQIPDAPTVSVMLNVTFLGNYTGYGVKCDGESMGGSGGNGGAIFNSGG
                     IGILANVTFEANKTGPGASDTSGNCGGGNGGSGGAIANTGTVQEVRFASFVRNETRAG
                     GSSVNPGRGGHGGAIFNSGEGRIVVIHSTLDSNKTGAGGTKVDGGLAGAGGSGGAVYA
                     ENKSNVSLKNATVTANQVGGTGKGGGIYNASGLQTRVFVQGSALGYNKLSTQALNDCQ
                     DDSSGNLRSLGYNVVQTVGNCSEFAAPLDRINTDPQLGALTGIKPFYRLPLTETAPVV
                     DFVPISACAYPYQDQRGMIRPRGWGCDAGAVEYESNYRIALPFIRK"
     CDS             complement(574727..575488)
                     /codon_start=1
                     /locus_tag="ANT_05350"
                     /product="hypothetical protein"
                     /protein_id="BAJ62569.1"
                     /transl_table=11
                     /translation="MPPGMDTKAIEVLREINRTFYLQYGESFARTRRRVQNGVKQVLE
                     RLPDEGVWLDIGCGSGALAVEWLQRGRKSRYIGMDFSEVLLEEARRAVSALHAGEQVT
                     FLHGDLTAPNWHLAVQDIPLQGILAFAVLHHIPSHDLRLALLRTVHSLLPPGGWFVHS
                     EWQFHHSPKLMSRRLPWSVVGVNEENLEAGDTLLDWRETLPAGEEQGGLRYVHLFSPE
                     ELQQLAEQAGFSIEETFSSDGLGNRLSLYQIWKRL"
     CDS             575539..577137
                     /codon_start=1
                     /locus_tag="ANT_05360"
                     /product="hypothetical protein"
                     /protein_id="BAJ62570.1"
                     /transl_table=11
                     /translation="MDFEVWQETHEPTPERQEIARRVLEDVRRGMDVVRALRRHPLPE
                     GGYLPKSILVQTYQRLVEQGEWQEDAHFLAAIRMKPVRTLSGVTTVTVLTKPYPCPGK
                     CIFCPTDVRMPKSYLPDEPGAMRGLQNEFDPYRQVASRLESLAATGHPTDKIELLILG
                     GTFTAYRRDYQEWFIRRCFDALNEVDSARLEEAHRRNETAPHRNVGLVIETRPDEITP
                     QELAWLRRLGVTKVQMGVQSLDDRILALNQRGHTAAEALQATALLRAAGFKIVLHWMP
                     NLLGATPQSDREDFARLWTQGYAPDEIKIYPCQLLQNADLYAYWERGEYQPYTTEELI
                     DLIADLKPTVPEYCRINRIIRDIPSTNVVAGNRRTSLRQDVLAEVARRGQRCHCIRCR
                     EVRNERVDPNTLVLRDLTYTAAYAEEHFLQFVTPQDRIAGYLRLSLPLPDAPDVTSAL
                     PDLEGAALIREVHVYGQSLPVGFELPGAAQHIGLGTQLLNRAADLARARGFRRLAVIA
                     AIGTRLYYESRGFQRGGLYLIRDL"
     CDS             complement(577199..578527)
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /locus_tag="ANT_05370"
                     /product="glycosidase"
                     /protein_id="BAJ62571.1"
                     /transl_table=11
                     /translation="MPKADYVFPNGFLWGTATSSHQVEGNNTNNDWWAWEQQEGRILH
                     GHRSGLACDWWDGRWREDFDRAAETGQNAHRFSIEWSRVQPAPDRWDEDAIDHYRDML
                     RGLRDRALLPLVTFHHFSLPLWLAERGGWENEETPALFARYVRKCMEAFREYTNFWIT
                     INEPNVYAYEGYIAGLFPPGKKDLTAAMRVMANLVRGHALAYREIHAVQREARVGLAL
                     AIRPLLPAGPLKFLDGIPAKIAGQFFNEAFPGALKDGKLRLITRTVPIPEAQGTQDFV
                     GVNYYTVDMVRFDLLRPQEMFGHRFYPADAPLSDTGFIAHFPEGMFLTLKWAKSFNLP
                     IIVTENGVEDADDHLRPRYLAEHIHQVWRAANFNWQIKGYFHWTLVDNFEWERGWTQR
                     FGLWGLDVDTQRRIRRPSVDLYASICQKNALTYDAVAQYAPEALPRLFPE"
     CDS             578686..579783
                     /codon_start=1
                     /locus_tag="ANT_05380"
                     /product="putative magnesium-chelatase"
                     /protein_id="BAJ62572.1"
                     /transl_table=11
                     /translation="MPPIYPFTAIVGQERMKRALVLNAVDPRIGGVLIRGERGTAKST
                     AARALAALLPKVKVVSDCRFGCDPDAPATWCTECRERAERGESLPVSLRQIPFINLPV
                     SATEDRVVGTLDIEAAIQRGERHFEPGVLAAANRGLLYIDEVNLLDDHVVDVLLDAAA
                     MGMNIVEREGISFTHPARFILVGTMNPEEGDLRPQLLDRFALSVEIYGIRDARERVMI
                     MERNLAFEKDPLAFVAHWQPKEQELSQQIEQARKLLDQVTYTSRDLLSIASLTASLQV
                     DGHRPDLVILKTARAHAAFEGRTSITARDIALAAELALPHRLKRTPFQQASATMEELA
                     ERIEQLQGGATSGEPREHPGGMEEESGQKKT"
     CDS             579894..580769
                     /codon_start=1
                     /locus_tag="ANT_05390"
                     /note="fragment"
                     /product="putative magnesium-chelatase"
                     /protein_id="BAJ62573.1"
                     /transl_table=11
                     /translation="MNTGETFEARRLDTPLDKMMRRHAGRRSRTYTDRKRGRYILARP
                     AGRRRDDLAFDATLRTAAPFQRQREELKKRNRVAFAVRPSDYMRKVRVRRAANLVLFL
                     VDASWSMAVAERMQATKGAILSLLNDAYQRRDRVGLITFQRDRATLILPPTNSVQLAE
                     QALRDIPVGGKTPLSAGLDMAYGILKREKMLHPDVLPLLIVLTDGAGNVSMGHLPPLE
                     EAHYLAERIAEEHIHAVVINMEHAAFDQGLAQELANHLKAPCYNLTDLRAESLYYTVR
                     QEMQSTALKGLEDKR"
     CDS             581206..582363
                     /codon_start=1
                     /locus_tag="ANT_05400"
                     /product="hypothetical protein"
                     /protein_id="BAJ62574.1"
                     /transl_table=11
                     /translation="MKSILRFLSVFALGLSFLLSACAGIAPTPTPTPLPTETATPQPT
                     PTPEPTSTPAPTPTPTVDPCATQPERWTFSLPVDPISKQPYPNFWMNLSPACALKNLE
                     PWIAFSMMIQNGYSIQEAAQTLGLEDNPYLAPLKEGKPQKYVMNFYIKKQKVDDFNLP
                     ERYYWWLPYMYHPADMRNYLFDPDTDRYEARLVLWGCARNVTAEVADGVSPELPKVTF
                     QAVCAVRKYYPGVQSYWWEMDFPEGTAGGLTRKFIPGKRAFEPKYKQYGEGVHGAKPD
                     QPAYAGMLYYAYIGNGQWYYIGEDNAFDLVGFDSVEEMEAALQRNLELVPGSQVWDLE
                     WLKQTYGVDARPVPQEYKTGFDRYQSDSAFKALVDRALEKQKESLDRYSQK"
     CDS             583000..584001
                     /codon_start=1
                     /locus_tag="ANT_05410"
                     /product="LacI family transcriptional regulator"
                     /protein_id="BAJ62575.1"
                     /transl_table=11
                     /translation="MPTIHQVAERAGVSSTTVSHVINNTRYVSPETRERVLRAMEELN
                     YRPNVLARSLRRGETRTLGLILPDSANPFFAEVARALEFAAFRAGYNVIFGNSENDLE
                     KEQVYVDVLVTKQVDGLIFMATGDRSQSLETLVRGGLPVVVVDRQLSALEVDTVLTDN
                     LQGGLLATRYLIAGGHRRIGCITGPSHLTPSAQRVIGYRQALQEAGLEVDEALMVRGD
                     FHPRSGYEAARRLLELRPLPTALFACNDMMAIGALRALAEAGLRVPEDFSIVGYDDIE
                     LASYAAPPLTTIRQDKVAIAESALRLALERIAQPELPARCETLPVELVERQSTRRMA"
     CDS             583998..584909
                     /codon_start=1
                     /EC_number="2.7.1.15"
                     /gene="rbsK"
                     /locus_tag="ANT_05420"
                     /product="ribokinase"
                     /protein_id="BAJ62576.1"
                     /transl_table=11
                     /translation="MSGTLVIVGSLNMDLVVRAPRHPQPGETLIGSSFQTFPGGKGAN
                     QAVAAARLGAKVRMIGRVGQDAFGDALLATVQRDGVDTTFIRRDPQAPTGVALITLDA
                     KGQNTIVVASGANGNVSAEDVRQSAQAFEGADVLLVQLECPLEAVQTAVQLAHQAGII
                     VVLNPAPAQPLPAELLQMVDYLIPNQHELTLLAGGISDREQAIRHLQAQGVRYLVVTL
                     GEEGALLALGEDRLILPAYPVEVVDTVAAGDAFAGAFALALAEGKTPLDAACWGNAAG
                     AIAVTRPGAQPSLPTRQEVEQFLKERT"
     CDS             584913..585308
                     /codon_start=1
                     /gene="rbsD"
                     /locus_tag="ANT_05430"
                     /product="putative high affinity ribose transport protein
                     RbsD"
                     /protein_id="BAJ62577.1"
                     /transl_table=11
                     /translation="MKKTALLNSALSEVIATLGHGDMLVIGDAGLPIPAETYRIDLAL
                     TRNMPPFLDTVRAVLSEMQVEKVIVAKETGEVSPQVLAELKRLLPDTPFIEVSHEELK
                     RLTRDARAVVRTGEFTPYANVILVSGVVF"
     CDS             585327..586292
                     /codon_start=1
                     /gene="rbsC"
                     /locus_tag="ANT_05440"
                     /product="ribose ABC transporter permease protein"
                     /protein_id="BAJ62578.1"
                     /transl_table=11
                     /translation="MSQVASRPVAFDRRAFFQRFGLVFSFLLLMIALSLLSERFLTPA
                     NLMNVLRQATINGIVSVGMTIVILTGGIDLSVGSVLALSVTVGASLMKQGTPVGLAVA
                     SALGIGTLLGVINGLMITRAKIPPFIATLGMLTVARGLTLLYTQGQPITGLPATFRWI
                     GTGVVAGIPMPVILSLAVFALGWVFLSRTKYGAQIYLLGDNPTAARLAGVPVDRMTVL
                     VYAISGFCAALAGLVLVARLDSAQPIIGQGYEFNAIAAVVVGGTSFSGGEGGLAGTLL
                     GALLIETLNNGLNLLNVSPLWEQVVKGVVIALALLLYKVFSPPSK"
     CDS             586410..587342
                     /codon_start=1
                     /gene="rbsB"
                     /locus_tag="ANT_05450"
                     /product="ribose ABC transporter substrate binding
                     protein precursor"
                     /protein_id="BAJ62579.1"
                     /transl_table=11
                     /translation="MKRSIVYLLLAFVLVLAACTPAAQTATQAPQQGGEITLGLVLST
                     LNNPFFVTLRDGAQKAADAAGVKLIVVDAQDDSAKMTAGIEDLINKKVSALLINPTDS
                     DAVVPAIQKANEAGIPVFTVDRGSNGGTVVSHIASDNVAGGKMAAEFLCKAIGGKGNV
                     VELQGIAGTSAARDRGQGFNEYMSTSCKDAVIVAQQTADFNRDKGLKVFENILQAQPE
                     IAGVFAHNDEMILGAIQAAEAAGRTGIVFVGFDAIDDAVQAVKDGKLAATVAQQPAVM
                     GQMAVETAVKYLKGEKVDASIPVPLNLVTKDTVK"
     CDS             587408..588907
                     /codon_start=1
                     /gene="rbsA"
                     /locus_tag="ANT_05460"
                     /product="ribose ABC transporter ATP-binding protein"
                     /protein_id="BAJ62580.1"
                     /transl_table=11
                     /translation="MTDTAIPRLKLEHVYKSFPGVQAVSDVSLDVYGHQILALVGENG
                     AGKSTLMNIINGVVPLDSGKIVLDGQPVSITSPHRALELGITMIHQELALIPELTVGQ
                     NIFLGREPRRWGIGVDWKRLYAQAQRELDRLGIEVSAQATIADLSIAQRQLVEIAKAL
                     SYNARLIALDEPTSSLTSRETETLFRLVRSLREEGVALIYISHRLEEVFELADRIAVM
                     RDGHLVAVGNAAEFTPAEVVRLMVGRELTEFFPKVPAQRGEPVLKAVNLKAGREVRGV
                     SLELHRGEIVGLAGLVGSGRTNVARLLFGADRLEAGEIWFEGRKVQLRSPQDAIRLGI
                     GLVPEDRKAQGLFAGQSVRYNAAAGLIQRLSRWGFIRFQAVNRIVRELVERLRVRTPH
                     LNQKVRNLSGGNQQKVIISRWLSLNPKVLILDEPTRGVDVGAKAEIHALMSELAAQGM
                     AILMISSELPEVLGVSDRILVMREGRIVAELTREEATQDRIMQAATGQL"
     CDS             588922..589905
                     /codon_start=1
                     /gene="rbsC"
                     /locus_tag="ANT_05470"
                     /product="ribose ABC transporter permease protein"
                     /protein_id="BAJ62581.1"
                     /transl_table=11
                     /translation="MLNGNHSFSFIAFLRRTSTYLILLVILVWFALLSPEFLTVGNLL
                     TVALQTSLIALVAIGMTLTIITGGIDLSVGSVAALSGALAAGLATRGGLGTYPGLLIG
                     LLTGLGIGFLNGAMIVWGRIPPFVATLASMAVARGLTLVYTQGRPIAGLDKAFTFWGG
                     QGALGIPVPVWVLTVVAVLAYFLLKHTPLGLHIYAVGGGEETTRLAGVNVGLVKFSVY
                     LLSGLCAALSGLILTARLWSAQPNVGVGLELDAIAAAVLGGTSLAGGVGGIPGTLAGA
                     FIIGVLSNGLNLLEMPSYNQQVVKGLVFILAVMLDYFIKQRQVKPKGNPTG"
     CDS             complement(589912..590796)
                     /codon_start=1
                     /locus_tag="ANT_05480"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ62582.1"
                     /transl_table=11
                     /translation="MIEIENLTKVYPNGKRALNSLSLNIHEGMFGLIGPNGAGKTTLM
                     RILATLLTPTAGRVLIFGKDLQTPEGKVSTRKSLGYLPQEIGFHLKLTVEQELDYFAI
                     LKNITDPKDRNRQIDNVLEQIGLRSARKERIHTLSGGMKRRLGIGIALLGSPKLLIVD
                     EPTASLDPAERVHFRNLLFQLAGKRIVILSTHIIEDVNQVCSDLAVITNGNLLFHGAP
                     EILLSQVKGKVRIVPESELNAEKNLRLISSKTTPSGTEHRVLSSEKPSHTSENIEPTL
                     EDAYLWLIQQTSEESENV"
     CDS             complement(590793..592355)
                     /codon_start=1
                     /locus_tag="ANT_05490"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62583.1"
                     /transl_table=11
                     /translation="MMKRALSQLSFSFAIYGYSTFCYSCISFTSASLLAFTDTQTGDG
                     IIAFVKYLAILSAFLSPFLFSSALKPEDTPSLELHSTMACPNWQVTISRIIVHWLTLI
                     FSSAVISWVSAFITENLSQGVLLALGVINVASNSLFFGGIAFWGTMIGRDSRKGRLWG
                     LMAFLFSILIPFPNFLNPVIYPYRVIDGLDYPVLWGVSRSIYCLLGGLAFAHGLYLTN
                     DTDRLLSGESSLAHQSANHKNVFFEKIIRAFSEPLPIPSNQSLGLICYEAWLILAEGT
                     IPIMVTSISLLFTFLLPLLDALRLGFDTLPLSLIQSHTALVFFLFPFLPIFLVQRIPQ
                     DRKQLLDQSILANISPQRYLFGKVAGACVITGGIYLLSLLPSFFLLTITALFSSLTLF
                     SHYFGILLLGVVPSLMYFCSLSILIGGMSGKQPPVFLGGLITIIFLVLTVITENNILG
                     NILFPTGRMTIETFLNQMSLQMGLLYMPAASSPPVVPFYYLPLPVFSGALQTWAIWNI
                     AMKVFEKDVFSA"
     CDS             complement(592833..593414)
                     /codon_start=1
                     /locus_tag="ANT_05500"
                     /product="hypothetical protein"
                     /protein_id="BAJ62584.1"
                     /transl_table=11
                     /translation="MTEKSKIFTSMLMGTIFLLFIAIAGLFIRVNQLQNQILVLMEYF
                     PVDAGQNSGLSIDTNAPDFTLPNTDGKYFSLHDFLGQKILLGFSSIDCPYCKKMYPEL
                     RSFSKKSSNLQIVLISRGTLKENQELVQEQQFNFPILTLEQGNSEIGKNFQVPGTPFF
                     YVIDEVGKICSKGFANTEEHLEELIRKCNQNSN"
     CDS             593659..594069
                     /codon_start=1
                     /locus_tag="ANT_05510"
                     /product="hypothetical protein"
                     /protein_id="BAJ62585.1"
                     /transl_table=11
                     /translation="MTEHENHLDQQRAEIRKVLIVIIVVAFACYCVGLSILQFNAWIN
                     RPTATPTVTPTITETPAVTVTPPQASPTLITLTATGTGTPTMTPSFTPTFFTFTPTVT
                     ATSTPTPPPPTATNTPVPPSPTETETPVAPTTSP"
     CDS             594082..595146
                     /codon_start=1
                     /EC_number="3.4.11.-"
                     /locus_tag="ANT_05520"
                     /product="putative aminopeptidase"
                     /protein_id="BAJ62586.1"
                     /transl_table=11
                     /translation="MTDIKDFLKELISLPGLSGYEAPAREVISREWQTLVDELSVSPL
                     GSLHALKRGSSPEPRPRILLAAHMDAIGMMVTRITPEGFLGFTEVGGLDPRILPAQPV
                     RVYGKEPLRGVIVQPSDRLLPPSQKGKPVEMKHLLIDTGLPAEEVRRLVKVGDPIAFD
                     TEPLELPEDLICGHTLDNRASVAALTVCLQTLQRAAHDWDVYAVATAQEEETLGGGFT
                     SPFEIRPTLAIAIDVTFAKGPGVNDYRGKTLGGGVVLGWGPQSHPRVFDDLKALAERL
                     DIPFEIEVYPRASGTDAYAMQIVAEGIPTMVVSIPLRYMHTPVEVVSLSDIRRVGRLL
                     AEYILRLTPEDVKKIQWEEA"
     CDS             595149..596219
                     /codon_start=1
                     /EC_number="3.4.11.-"
                     /locus_tag="ANT_05530"
                     /product="putative aminopeptidase"
                     /protein_id="BAJ62587.1"
                     /transl_table=11
                     /translation="MSPATPAPQIGAEQIALLEKLSNACAVSGDEAQVRKIVLEEIKP
                     FADDLRVDALGNVLAVRKARTPNALRVMVDAHMDEVGFMIVEDDKDGLFRFVAVGGLD
                     ERTLPGKKVLVGAENVPGIIGAKPIHLTEEGETERKIPIESLRIDVGLKGGKKVKVGD
                     RATFATRFWQSGNALFGKALDDRLGVATLIELFKNPPENIELLAAFTVQEEIGLRGAR
                     PAAYAFNPQLAIALDSTPANDLPMWDGSENIFYNTRLGAGPALYIADSATLSDPRLVR
                     HFAQTGEQMGIPFQFRQPGGGGTNAGAIHRVREGVPSLSVSVPGRFAHTAIMLARLDD
                     WQNTLALVYYALSRLDAGILQR"
     CDS             596270..597268
                     /codon_start=1
                     /EC_number="3.4.11.-"
                     /locus_tag="ANT_05540"
                     /product="putative aminopeptidase"
                     /protein_id="BAJ62588.1"
                     /transl_table=11
                     /translation="MKALIQKLVETVGPSGYEEKVREVVRAEIEGLADEIKVDALGNL
                     IARKGSRSEGGMRIAISAHMDEIGVIATHVDENGFVRFTTIGGVSPRTCIGGRVQFLN
                     GTRGVIYMESLESATALPTLDQLYIDVGASSRETCPVKVGDIAAFDRPFMELGDRLVS
                     KAMDDRISVAVMIQALKELSSTPHELYFIFSTQEEVGLRGATTAAYGVDPELALAVDV
                     TRTGDTPKGVKMEVALGKGPAIKVRDSGMLSDPRVIRWMVETAEKAGIPYQLEVLEGG
                     TTDARAMQLTRAGVPAGCLSIPTRYIHSPSEMVDYQDVLQSVRLLVALLSAPVTLK"
     CDS             597265..598614
                     /codon_start=1
                     /locus_tag="ANT_05550"
                     /product="hypothetical protein"
                     /protein_id="BAJ62589.1"
                     /transl_table=11
                     /translation="MSAGLSYKRSSSQPHRLKPFRRAVVLLLSALLFLSGCLPPWLAS
                     PTPTASPPLPTATPPVSPTPSTEALATPTVSEPLVLWLPPQFDPESGSRAGNLLKERL
                     AAFEQENGIQIRVRLKAVNGPAGLLDSLTLASAAAPAALPSAVLLPRRDLEDAALKGI
                     IYPLDGLSTAIDTSDWYDYARELALVQGSVYGLPMAGDSLGLVYRSEWLAHSPNSWQE
                     ILEQRYTFTFPAQENQSLVTLALYLSAGGDTQDTQRRPLLEETPLQTVFTWYRSAAER
                     AVIPIWTAQVETYSQAWQAYQDQRTTMVVAWVSTYLSDFPPDSLFAPLPSLGDAPASL
                     ATGWVLAVAEPDPQRRVLAARLCEWLTQSDFLGAWSEAAGVLPVRPSAFPLWKNQSFV
                     PVFQRMAETARPIPSNEVITVLGPVLRESTLEVLQLKTLPASATQDAVKKVANPGVK"
     CDS             598611..598907
                     /codon_start=1
                     /locus_tag="ANT_05560"
                     /product="hypothetical protein"
                     /protein_id="BAJ62590.1"
                     /transl_table=11
                     /translation="MNEKTSSVIQYADLRVLAMLGVLLFFLFLSMGSGMMQSSPVEAT
                     PTSEGEMLAPTVTPLPPEYLGNYAQTTGIILATSVIVLIVVGGVLYGLLSNKKQ"
     CDS             598969..600027
                     /codon_start=1
                     /EC_number="3.5.4.4"
                     /gene="add"
                     /locus_tag="ANT_05570"
                     /note="protein synonym:adenosine aminohydrolase"
                     /product="adenosine deaminase"
                     /protein_id="BAJ62591.1"
                     /transl_table=11
                     /translation="MGWYPRIPTGELSLYRAIPKVDLHRHLEGSLRLETLLDIARQHG
                     LTIPQTHFHSLVQMQQDEPLTFTNFLSKFQTLRMFYRSPEVIRRITREAIADAAAENV
                     RYLELRFTPVALSRLQGFSYDEVMDWVIQSAEEASREYNIKTRLIVSVNRHEPVDLAE
                     QIVEYAIQRRERGIVGFDLAGNEVEFSALPFEGVFREAKKHGLQLTVHAGEWGGAENI
                     LEAIEFLGAERIGHGVKVLQTPRVLQAARERGIAFEVCITSNHQTGVVGAVRQHPLPQ
                     MVREGLKVTINTDDPGISRITLTDEYRVALEELGMPVAVFKDVVLNAARASFLPPEER
                     QSLVETLEPELNRTLQFL"
     CDS             600041..600814
                     /codon_start=1
                     /EC_number="3.1.3.5"
                     /gene="surE"
                     /locus_tag="ANT_05580"
                     /note="protein synonym:nucleoside 5'-monophosphate
                     phosphohydrolase"
                     /product="5'-nucleotidase SurE"
                     /protein_id="BAJ62592.1"
                     /transl_table=11
                     /translation="MPHVLITNDDGVHAPGILALAQALQTLGKVTVFAPDRNWSASGH
                     DKTMDRPLRVRETHLADGTPALTSDGSPADCVALALLGVIQEPVDVVVSGINAGENLG
                     QDMTYSGTVTAAMEGALAGLPAVAVSMKLPANGSKPDFSAAAQIARRVVERVLRFGLP
                     PRVVLNVNVPPLPLDQIKGIRITRLGERIYRDALVTRYDPRHKPYYWIGGEPPDGVPE
                     EGTDIGALAEGYASITPLHLDLTLYSLMESLRQWNWEEE"
     CDS             600874..602865
                     /codon_start=1
                     /locus_tag="ANT_05590"
                     /product="hypothetical protein"
                     /protein_id="BAJ62593.1"
                     /transl_table=11
                     /translation="MMLFTACSAPPTPALSTPSPSPSPTLTATVTPSPTATFTPTPTP
                     TPTPTPTPVRAGTPFALNPEGILEIHLPQVVELARWGYGSSRDLALSSDGEWLAVATR
                     LGVVLYRANPLTFHTLLNVWEPVQVTFSPDSTRLYVAGEEIEEWNLASLEWVRAFPSQ
                     GASTAVEMLVARDGQTLGVLYPDPGGKNALLLERWNALAGTLDSTQRLPSPGSAVREA
                     ALSPNLSFVALHGGGLVQLVDARTGEALTLLPASQSAPGRMTFSPDESLLAVAYPDQR
                     ADFQNTNRVEIFTVPHGVRHSTLSLSGGEGRDQPIINLAYSPAGDALAVGFANRVVRL
                     WRESGAPRMVLQGESEPAQMLFSPDGARLFSSGVDVWKLADGERLASSGEHFAPLNDF
                     VLSPDGSWVALAGFGRVELRQIQDGQILRTITEGLSGEVRDVDVFPGGQTMATTGNEG
                     MAHLYRVSDGRFLSRLGETGPRLWAVAFSPDSRWLAWSGENGYLYIYDLERDFLAKRI
                     EEPYLATRILFSPTSQQMAVLTSAGVNLRQVNGTLVRTIGGAGLEDLAFSPDGGTLFV
                     GGNQVLRAVVTGDGSDLWKSDYDPQQSPTALAVSPDGAFLAVGWQDGHIELRWAGSGE
                     VLRILYGHHGAVTRLGFAPQSRLLLSLGQDGTVRLWGVP"
     CDS             602939..604444
                     /codon_start=1
                     /locus_tag="ANT_05600"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62594.1"
                     /transl_table=11
                     /translation="MKRWLAGLTLFLTLSALFAIAPYGAGVARDSVEYLATGMHVAQG
                     RGFITFDGTPFRLWPPLYPLLLAGLSVFPLDPFLTGGWVNALLLGASVYLSGLLFMEI
                     FPRRRWLGIWGAGLFGISRSMFPLSIHLLSDLLFMVLVLAFLWVVSSMSRTRGVLLAG
                     VLAGLAWLDRYIGALLLPLGAGWVVFFSRVSWRKRLERMGLFLLVSALPMSFWMVRNL
                     RLFGHPFGAPPPARLTLIENVEAGLAEMRLWLFPEGFLPAWGMLGGFLLFLGVLAFLV
                     RWRRGDLAGRAGILAGWFILWGVAYFAFLLISSTQADITRLDARLMAPIYPAFLMFIL
                     AGLEGLARVLKRWRLASLLVPLIVGLFWGIPSVSQWADILQQTRTYGAPLYNYLNTPE
                     FRQSGVTAYLQSEGVPEGLPLYSNYRTAVFLYTRHTCSGSPWSRHPHYAIEYPLEQYL
                     PDFPAGETGVLIWYESGVHTHYYAPEDLARLYVLDVLYKGEDGGVYLIRRR"
     CDS             complement(604503..606995)
                     /codon_start=1
                     /EC_number="3.2.1.25"
                     /locus_tag="ANT_05610"
                     /product="beta-mannosidase"
                     /protein_id="BAJ62595.1"
                     /transl_table=11
                     /translation="MLTQSLTSSKGAVWTFRQAGEEEWLPATVPGGVHTDLLALGRIP
                     DPFVADNELKVQWVAESEWEYRGVFTVSPELAQAPHLFLVADGVDTLADVRLNGKVLG
                     KTENAFRQYRWDVAGLVKAGENEIRVFFHSAVKFCRQRNQEKPLTPKVGMSLEGSVFV
                     RKAPCQFGWDWGPKLPPIGVWRDLRLEGYTQARLDDVHFRQRVEGKKAYISADVRAEV
                     WGKTPLTAHLRVTAPNGKKTFETSAPLVEGTAALQVAISNPQLWWPNGYGDQPLYRVE
                     VWLESSEGVEDQKAVQMGLRTIELRREPDEWGESFTFIVNGVPVFMKGADWIPADSFP
                     TRLTEAHYEHLIRSAAETHQNMLRVWGGGFYEDERFYDLCDRYGILLWHDFMFACYIY
                     PHDEAEFIENLRYEVEDNVRRLRHRTCIALWCGNNEMEQGWADWGWTNPTNPLMVTER
                     EAYERFFYHTLPAWVEKLDPDRPYWPSSASSNEPFVNPNSQDRGDMHYWDVWHGRKPF
                     TAYRTVYPRFMSEFGFQSLPPLETIRTYADPEDWNMTSYIMEHHQRSASGNGLMITQM
                     TESFRMPKDFPSLVYLSMVLQAEGIRYGVEHWRRNRDRVSGTLYWQLNDCWPVASWSS
                     IDYFGRWKALHYAAKRFYAPVLLSIEDQGTKMKVHLTSDLTTAWEGRVRWALVSVDGQ
                     IVLSGEVPVNLAPLSSQAVFSQDFAGVVFGEEDRSRELVFLAELYRENECISRSLATF
                     VPNKHLKLSDPGLEYSIHREGNRAVIVVQARKLARFVELKLEGADVIFSDNYFDVPAG
                     FSVTVTCPIPKGWTLKRMSKALRVTSLYESFA"
     CDS             complement(607093..609036)
                     /codon_start=1
                     /locus_tag="ANT_05620"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62596.1"
                     /transl_table=11
                     /translation="MLPAFLSPLLLIGTAFSLGAVLRIRSRLLWAQTVALMAFALLVL
                     TFHIANLLHALNRLDVILFIQSLLFGASIAVWWRQQKPPLFPNLLLPFEKPAWNDLPY
                     LVILLGVMLSVGFAAVLAYTVPPNNNDALSIHLARVGMWRQLGTYFPWETAVVWQLTF
                     PVNAQLATLWTILLSGSDHFVAFIPWLAGLTGALGVMALARELGFCRIAALTAGLVWL
                     SLPVVQLHLSSVRHDLVSTALLISGVLYFYRWGKEPHQRVWMILSALAIGLVIGTNFS
                     VIFYLPALTGLFLLAWIFSRTHSLKMLIQWTGTALLFFLLLSSPIYWSNWAHFGSPLG
                     SRAEAMTGQTVLKQVSLPQYLALNTTRWLYQMVDTAGLPQPLWGYGIKAKAWLAHTLA
                     GSWNDVIEGTTATYSGHVFSWRRVYLLQEDEAWFGPLGALLMLPGSVWAFWKGWKQRQ
                     LLLLAPFLFLLSALVFGTLFRPGWTPYDGRYFMPVSALALALLPFVLENSPGRALWRW
                     LVAAVVLSSLWMCATQNPTREVLGERTLWNTSRTFQLTRQAYLTLPMLDLADRSIPLN
                     AVVGIATQKGFYFEYGLFGEHFTRRLIPVYPPERIGDEPWLRDQGIQYLLIEVSETYP
                     TAIAPSYRYLDSRGDWVVYRYQP"
     CDS             complement(609048..609332)
                     /codon_start=1
                     /locus_tag="ANT_05630"
                     /product="hypothetical protein"
                     /protein_id="BAJ62597.1"
                     /transl_table=11
                     /translation="MKVTVELTGAARAHAGVKTLSLDLPDTATYRDIVRELAKHFPQL
                     VGWLIAPDGESFLSSNMLVINGDLATPVMVLDENPADGEHLILMSVITGG"
     repeat_region   609733..609741
                     /rpt_type=flanking
     repeat_region   609742..610659
                     /note="Similar to IS5 family"
     repeat_region   609742..609764
                     /note="23bp imperfect inverted repeat"
                     /rpt_type=inverted
     CDS             609784..610623
                     /codon_start=1
                     /locus_tag="ANT_05640"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAJ62598.1"
                     /transl_table=11
                     /translation="MTTRESRYVRVARIAYRLAKQALPMYSHAKSPHHFTLPQLGACV
                     LLMFYLNLSYRDMEEWLLASDAVGKELELPRVPDHTTLQRTYAKIRKADWMRMNETLL
                     EEIGRPEEEGVAADSTGFSPGPASSYYQSRSGKAYRHWAKGVYAVGIVSQFILAMQSG
                     WGPGSDAPYLGYLRRKARRFAKRRAWVLLADSGFDGRTVRPQDLIPPVRRGGNLLAPE
                     RRARSELVSAARLDGLYGQRWKTETVNSVIKRKFGQAIRSRKRSLQNREPIIKGLVYN
                     IHR"
     CDS             610624..611172
                     /codon_start=1
                     /locus_tag="ANT_05650"
                     /product="hypothetical protein"
                     /protein_id="BAJ62599.1"
                     /transl_table=11
                     /translation="MYLFLTYLCNRATKDFYDIVGVRVYGEILGWVRKRIKDPFTLVG
                     LIDGEWVGFANGRVMNPDIAISLHTMTFTRRGRVGWAMYYAKTYYALEILKCKEWWST
                     FESYNGWRMAGVEMAQPTKPWPEYQHELGGARVYYLTQDMWNAGVKNFAVEMIGSDLS
                     FNVTDEVRKANEHFHAPAEVNL"
     repeat_region   610637..610659
                     /note="23bp imperfect inverted repeat"
                     /rpt_type=inverted
     repeat_region   610660..610668
                     /rpt_type=flanking
     CDS             611557..613281
                     /codon_start=1
                     /locus_tag="ANT_05660"
                     /product="bacterial FdrA family protein"
                     /protein_id="BAJ62600.1"
                     /transl_table=11
                     /translation="MAAIKVEIRSGVYYDSAVLMQLQRSLASLPGIEDAGVVMGTESN
                     KELLAHIDLTTPEVEKAQPNDLVIVVRGVDEKAATEALGKVDELLTRKKGGAEQAYRP
                     RSIEGANDMLPEASWVLVSVAGRYAAGVAREAMRLGKHVFLFSDNVSVEEEIALKQEA
                     AEKGLLVMGPDCGTALIGGYGLGFANKVRRGNIGVVAAAGTGLQHVTSRIHQLGGGIT
                     HGIGTGGRDLSEKVGAVTFRQGIELLSRDPETKVIVLVSKPPSPKVAEEVLKLARKAG
                     KPVVVNFIARPLSLPQMDNLYFARGLDHAAELAVELSRNLPALETDVDLGLERFAAGQ
                     KYLRGLFSGGTLAYEAQHILASYLPKVYANAPINKELKLPNSYVSQEHCIVDLGEDEF
                     TQGRLHPMMDNELRIRRLMEEAADPSVAIILLDVVIGYGSHPDPASELGPAVARAKAL
                     AKEAGRYLEVIAVVCGTDEDPQKLDAQVQQMKDGGAWVSTSNEEAMRYAGRLARALSQ
                     EAGGEFTMKPVDLSTLQRPLAAINVGLESFAENLAAQGAPVIHVDWRPPAGGNERLMA
                     ILERMKQR"
     CDS             613321..614565
                     /codon_start=1
                     /locus_tag="ANT_05670"
                     /product="hypothetical protein"
                     /protein_id="BAJ62601.1"
                     /transl_table=11
                     /translation="MVDIEKANQQAVERMMDARPVVVGVAPAIDVIPGMHKDLLLHAG
                     PPVTWERMAGPMKGAMVGALIWEGRAKNWDEAEALLSSGKIKFEPCHEHSAVGPMAGV
                     ISPSMMVYIVENKTHGNRAYSGLNEGRGKVLRMGAYSEDVLARLTWMNEVLGPVSHKA
                     LEAMGGLDLRTLLGKALHMGDDGHNRLDAASILYTTQMAPWIAKVAKDSDTAAEVIRF
                     LGENALSILNQVMAGCKTMADAAHGIEGSTIVTVMARNGTDFGIRVSGLGDRWFTGPA
                     GKVKALYFPGFTEKDANPDIGDSTITETAGIGGFAMAAAPAIVTFISGTPQDAIKTTL
                     DMYEITYTEHKHFTIPYLNFRGTPTGIDIRKVIEKNVLPRVNTGVAHKDPGIGQVGAG
                     VVTPPQNIFEDALVAFAEKYGF"
     CDS             614644..616317
                     /codon_start=1
                     /locus_tag="ANT_05680"
                     /product="hypothetical protein"
                     /protein_id="BAJ62602.1"
                     /transl_table=11
                     /translation="MDRERFIKMMAEAKMYDLTQDCSIFTPPFPGDKALEVHFFKRVT
                     GAYGGGQGANGQILNWSNTVGTHLVGETAFHSGGRRISDIPLTDLCGPGVIVDISDMV
                     SDYSIYTPEMIMKKADVRPGDILIINTGYHRYSWDQPDVVNPEAQGGVESKEFGFYVR
                     HPGPSMDFYKWALDMKLKVIGVDCGSAEHPMNTTIRYMHDNHFRRAEEKLMREHGKKW
                     EEMFPPDEYYQLTHITMPKNHLVFVEAIVGEIDKLKNQRAWITIMPIPFMEVETAWAR
                     VAAYQPPDWMSEAEFYEAMSKAEMLDMTVPFSVQTPQWLNYVPLSVTYHRRVGGQYFG
                     MSRNSSICNASIHLATHMDGEKHFYPSGRTIGQVPLSEWVGPGVIADISHLVSDASVY
                     TPQMIESVVDIRKGDILVIKTGWHRYGWLSPDSDEFRYMVKHPGPSPDFSEWAAKLEL
                     KWIGVDAVSADHPMNTIMRIWHPKTFAEANEKLKRDFGKTWDEMYPLDKYYQDMHLNL
                     FPKRIVHAENLGGDIARASSGRYYIGCYLQKAMEAESMWGRFVAFKEGE"
     CDS             616397..617272
                     /codon_start=1
                     /EC_number="1.2.99.2"
                     /locus_tag="ANT_05690"
                     /note="protein synonym:CO dehydrogenase subunit"
                     /note="protein synonym:CO-DH"
                     /product="carbon monoxide dehydrogenase medium chain"
                     /protein_id="BAJ62603.1"
                     /transl_table=11
                     /translation="MKPIPFEYFAPTTVEEALEHLSNLGYGGKVLAGGQSLIPAMNFR
                     MARPGALVDLNGIPELAYIKPTADGGLAIGTMTRDSKVEHSPEVAKRFPLLPEVMPNI
                     AHPQIRNRGTFGGSIAHADPAGQLPAISIVLNANLKVLKKGSERWVKAEEFFLGPFMT
                     VLEPEEMLAEVVLPALPPRTGSSYQQVSRQKGGYSMAAVASVVTLDEAGKCTNARMVM
                     ISVGDVPILSAAALRILVGQKPTPEAIAEVAEIAASQEIDPGTDIHATAEYRRHLIRV
                     LVRRSLTTAFERAAK"
     CDS             617283..617762
                     /codon_start=1
                     /EC_number="1.2.99.2"
                     /locus_tag="ANT_05700"
                     /note="protein synonym:CO dehydrogenase subunit S"
                     /note="protein synonym:CO-DH S"
                     /product="carbon monoxide dehydrogenase small chain"
                     /protein_id="BAJ62604.1"
                     /transl_table=11
                     /translation="MTTHTIKVKVNGVEYVREVEPRLLLSDFLRHDLGLTGTHVGCEH
                     GICGACTILFDGEPMRSCLIFAVQANGHEVTTVEALGTPEKMHPLQEAFQEKHALQCG
                     YCTPGFLMTLKPFLETHPNPTDEEIREAIDGNLCRCTGYEHIIEAVKLAAQKMATRS"
     CDS             617780..620128
                     /codon_start=1
                     /EC_number="1.2.99.2"
                     /locus_tag="ANT_05710"
                     /product="putative carbon monoxide dehydrogenase large
                     chain"
                     /protein_id="BAJ62605.1"
                     /transl_table=11
                     /translation="MAGRVFGQSIPRNEDPYLLTGQAKFIDDIELPGMLHAAFYRSDY
                     AHARIKKIDVSEARKLPGVVAVYTAEDFGEFVRPGPLQVPPPTAIKGSVFHARPLMPI
                     AKDKVRYSGEPLAVIIAESRYIAEDAMDYIVADLEPLPAVTDLEKALEPGAPLVHEDL
                     ESNLAALVKQERGNYEEAAAKADVVIKKRIVVDRGAGAAMENRGLVVNWDDRAREMTI
                     WATTQAPIPLRNSIAGRLGLFEEQVRVITPFIGGGFGPKIMTSQPDDVLLPIIAMWLK
                     RPIKWIEDRRENFLGTTSERDQIHYAEIALTKDGIILGVKDVFYHNTGAYDPYGMTVP
                     LNTQTHTVSCYEVPNFYTEIRMVFTNEYVVTPVRGAGRPEGVFVMERLMDYAAQELGM
                     DPAEIRRRNLLRKERFPYPTGIIGQDFVEGVLDSGDYPETLRRVMEVIEYEKFRKEIQ
                     PQLRAQGKHKGIGIVCFTEGTAVGPYEGARVTVGANGKVTVATGISTQGQGHFTVFAQ
                     IAAEQLGVDVKDVKVVTGDTGHFHWGAGTFASRGMGVAGTAVYNAAVKVRKKALEFGA
                     RFLGVSEDEVELCDGKVCVKGDPSRSMPLGEIALKANPTRGTIPPGVEPGLEATAYFG
                     PPYGATGAGAVAMIVDVDPETMAVNIEKFAIVHDCGTVVNPLLLEGQVMGGVHMGIGN
                     AFYEKIKYDENGQLLTASLMDYLIPQATDMPKEMVVEHLETPSPLNPLGMKGVGEAGA
                     IPTPACFMQALEDALYEYRLQIDETPLNPSLLWEMVQKAPKK"
     CDS             620195..620818
                     /codon_start=1
                     /locus_tag="ANT_05720"
                     /product="hypothetical protein"
                     /protein_id="BAJ62606.1"
                     /transl_table=11
                     /translation="MQLEGEHVFKGPREEVYAMFRDPEVLASALPGTQSLNKIDDQHY
                     EGAMNIRIGPVSGSFSGKLEVADEVAPEKCTLIVEGRGAPGFAKGVGRVEFIDQGDGT
                     TLMKYSGDVQIGGTLASVGQRMIDSVAKSMIKTAFETLDKALEARLAAKAGSAPVEFK
                     APTEAEFAAAVTKDMASGLKEVAEVRMLFYVIPLILVLVVIAYLLSH"
     CDS             620963..622465
                     /codon_start=1
                     /locus_tag="ANT_05730"
                     /product="putative permease"
                     /protein_id="BAJ62607.1"
                     /transl_table=11
                     /translation="MGWQTHNVLNCSFIQNHLLKTYSSEEGSHMATTAKKPAVMGYLP
                     NDVPPFGQMVLLGFQHVLTMFPATVLCAILMKFPVSTVLTITGLGTVVALLGSKFAMG
                     KYIPLYYGSSFSYIAAVTAIMQAKGVEGPVAPPEVISVVTAGFIATGTINIIVGLIIR
                     LSGGKEAIDKILPPIVTGPVACTIGIGLGAAALNMASGACCGVTDPVMQLKWWAAATV
                     TLLAAFIFSVYLQGKGFIGMLPILLAAIFGYIVAIPLGLVDFSQFGKEALIRAPTITF
                     PVFNDPLTATVIVGVGIMAIATIPESTAHLYQISLYVDHLAEEQGREKYGLARYIGLN
                     LMLDGLNDLVNGLFGSTAGTNYGENNSLMVISRNYSGPSLLAAGVIAILLGFIGPLAE
                     AVASIPTAVSGGLAIYLFGVIGMQGIALMMAEKVNLYDPKSLAIGAAILIIGIGGNIG
                     FNGGFLPIPLLQGVFPYGWPAIATGAVVGIVLNLITMAWKPPMERAAVEH"
     CDS             622581..623444
                     /codon_start=1
                     /locus_tag="ANT_05740"
                     /product="NmrA-like family protein"
                     /protein_id="BAJ62608.1"
                     /transl_table=11
                     /translation="MILVSGAAGKTGLAVTRALSTRGKRVRAWVRCEAYRQRALGQGA
                     AEVVVGDLRNPQDWQNALHGVEAVYHICPNMSPDEESIAAAMLEELCRLEGVQLVYHS
                     VLHPQVEAMPHHWAKMRVEERIFASGVPFTILQPSAYFQNLLAFRQSILEQGCLSIPY
                     SVQARLSMVDLQDVAEAAAQVLCEDGHAGAIYELAGPQPVSHEQVAQSLSRLLRRPIQ
                     AQTIPLEDWVKQAQRAGMSAYAVETLAKMFAYYDAHGLIGNARVLTCLLGRAPVSLEE
                     FLSREFSSQGE"
     CDS             623445..623933
                     /codon_start=1
                     /locus_tag="ANT_05750"
                     /product="hypothetical protein"
                     /protein_id="BAJ62609.1"
                     /transl_table=11
                     /translation="MDSNRSQHYNFVYEAIPVMFHSQTNQFMKYLERDGTKFLEFWWD
                     HVGERLPEERLSDFKDVACEITPIDQQTKMAIIRLPVPTADREAYYIGLISRPERRFA
                     WVRLPNTSVVCLIRREGDAFPNGTELVELTPSARVVSVGAGPLPEWEAFKQVLLKMVK
                     KG"
     CDS             623947..624297
                     /codon_start=1
                     /locus_tag="ANT_05760"
                     /product="hypothetical protein"
                     /protein_id="BAJ62610.1"
                     /transl_table=11
                     /translation="MKIDWGTVVVGLAILVVYGRMALIRGRKRRLERQALLEQKREAK
                     KQKNRPHTPVAQPQPGIKITYEVVSWWLVGGGLLVTLAGIAMRYSALFPPAVQPYWWV
                     VTAAGILLFAFSFR"
     CDS             624623..625522
                     /codon_start=1
                     /locus_tag="ANT_05770"
                     /product="oxidoreductase FAD-binding subunit"
                     /protein_id="BAJ62611.1"
                     /transl_table=11
                     /translation="MQNPHPGLPEIEYIKPASLEEASKFLAAHAGEARPFLGGTDTFV
                     RMRDGVWKDKYLVDVKGLDGTAQVSFDPEKGLTIGAGVPMNRVEAMPEVREHYPLLAE
                     AIRTVASYQLRNRATIVGNICNASPAGDTIGACMLYGGVLKVFGADGVREEPLATFFK
                     GPGKTNLKPGDIALSLHLPLPPKGHVGRYIKVARNKLGDLAIVGVSVLGYPDATVASG
                     FRFLIALASVAPVPLRVPVAEKVLAEKKIDEATIAEAAQIAMDSCSPIDDVRGSAQYR
                     KHMVRNMTRRAVTEVWQKLTQAA"
     CDS             625556..626023
                     /codon_start=1
                     /locus_tag="ANT_05780"
                     /product="oxidoreductase iron-sulfur subunit"
                     /protein_id="BAJ62612.1"
                     /transl_table=11
                     /translation="MGYHRITLTVNGVMELVDVPSNMTLLQMLREKLGLTGTKNGCAS
                     GECGACTVMLNGEPVNSCMVLAVECDGADVVTVEGLAKNGQLDPLQEAIIETGGVQCG
                     FCTPGILISSRALLNRNPKPTEFEIREAISGNLCRCTGYNRIVEAVKKVAGTE"
     CDS             626042..628390
                     /codon_start=1
                     /locus_tag="ANT_05790"
                     /product="oxidoreductase molybdopterin binding subunit"
                     /protein_id="BAJ62613.1"
                     /transl_table=11
                     /translation="MAVAEKQQTVIGASVPRLDVREKVTGAAVYADDIQFGPGLLHCR
                     VKRSPIPHGIIKRIDTSKAEKLPGVKVVVTGADFPDRIGLYLKDRHIFARDRVRFIGE
                     PVAAVAAVTEEIAEKALELIDVEYEELPGVFDPVYGASPEAPLLHPELGTYEYPNFIF
                     PKPGTNIANHFKIRKGDTEAAWPQCAAIVEHTFRIPHVQHVPIEPHVAVAKAEENGQV
                     TLWASTQSPFAQRALIAKALHIPESKLRVIAPFVGGGFGCKAGVTMEAIPVAVALKLP
                     GYPIKLRLTREEEFYTNFVRQGLVIKIKVGCDKDGNLLALENTMYWDGGAYTEYGVNV
                     TRAGGYSSTGPYDIPNVKTDSMCVYTNHPVGGAYRGFGMAELHTGIDQAMDMLAEKIG
                     MDRVEFFKKNCIRGGDVLATGMVIHDVGIEDCIDAVAKDLNWGVKEKPSGPNKVRGKG
                     IALAWKAPAMPPNAGSSAIVKLNADGTVDVSVGGQEIGQGTFTVMAQIAAETLGVPYE
                     NVRVTGPIDTRYSPYEWQTVASRLTWSMGNAVRNAALDARQKVLNVVAEAWQQDPKEL
                     DIKNGYVISYRTEDTMPLKDVVVYGIPKPNDQGWIGGPIVGTGSFMPTYVTGLDPETG
                     QGDRAVVHYTTGAQGVDLEVDLETGQITILKAVSAFDVGKAINPELVKQQMEGGMVQG
                     LSSAIFEECKLEKGVMRNPSFVDYRIATAIDVPPIMDTFIIEHAQDDGPFGARGIGEH
                     PLVPSIAAVASALRDALGIRITNPPFSAEKVYLALVEAGLAK"
     CDS             628555..630159
                     /codon_start=1
                     /EC_number="4.1.1.41"
                     /gene="mmdA"
                     /locus_tag="ANT_05800"
                     /product="putative methylmalonyl-CoA decarboxylase
                     alpha-subunit"
                     /protein_id="BAJ62614.1"
                     /transl_table=11
                     /translation="MTESNVNAQPTSGEAEQRDERQHLYKKLQEYREKLLEAGGKDRI
                     EAQHAKGKLTARERIEKLLDEGTFQEIDAFMVHRHSDFGMDKSRFLGDGVVAGFGKID
                     GRRVCVFSQDFTVLGGSFGEVAGQKVCKILDMAMDAGVPVIGLNDSGGARIQEGVHSL
                     SAYGEVFYRNTLASGVIPQISVMLGPCAGGAVYSPALMDFIIMTKGISNMFITGPEVI
                     KTVTAEVVDAETLGGAMAHSTISGVAHFATENEEESFATVRRLLSYLPLNNSEPAPAI
                     EPYDDPNRMDEGLNAIVPANPNEPYDMKQIIEKVFDLGSFFEVHANFAPNAIVGFARL
                     HGQSVGVVAQQPMMMAGAIDINAADKIARFVRFCDAFNIPLITFSDSPGFMPGVAQEH
                     GGIIRHGAKIVYAYSEATVPKLTVVTRKGYGGAYIVMGSKHIHADLVFAWPMAEIAVM
                     GAEGAVNILYRKEISNHPDPAAERARLVAEFREKFANPYRAAASGYVDDVIMPSETRP
                     RLIAALELLRDKQVSQPSKKHGSIPL"
     CDS             630184..630531
                     /codon_start=1
                     /EC_number="4.1.1.41"
                     /gene="mmdD"
                     /locus_tag="ANT_05810"
                     /product="putative methylmalonyl-CoA decarboxylase
                     delta-subunit"
                     /protein_id="BAJ62615.1"
                     /transl_table=11
                     /translation="MNGDFLQGLTVSVLGILITFIALGVFILIMIVLQRLFPYREEEE
                     EQAEVAQIETSQPAEETAMSQEGEIVAAIAAAVAYLRLRANPQLGNAFQEGRGRWWFS
                     RRLEAIEGKTRKR"
     CDS             630541..630993
                     /codon_start=1
                     /EC_number="4.1.1.41"
                     /gene="mmdC"
                     /locus_tag="ANT_05820"
                     /product="putative methylmalonyl-CoA decarboxylase
                     gamma-subunit"
                     /protein_id="BAJ62616.1"
                     /transl_table=11
                     /translation="MKKIKVIVNEKPYEVEVGDMSISPFTVVVNGQSYQVTLEGEQVQ
                     EVRPVASAPAAPAPRPVAPAPVPAPAPKPAAAPAASGDVLTAPMPGVILDIAVKPGDK
                     VTVGQQLCALEAMKMKNAIRSPREGTIASVEVQDGQRVNYGEVLFRFS"
     CDS             631003..632127
                     /codon_start=1
                     /EC_number="4.1.1.41"
                     /gene="mmdB"
                     /locus_tag="ANT_05830"
                     /product="putative methylmalonyl-CoA decarboxylase
                     beta-subunit"
                     /protein_id="BAJ62617.1"
                     /transl_table=11
                     /translation="MDLSNLSILLQAFRELGWQNIVMLGVGGFLIFLAVKYEFEPNLL
                     LPIGFGAILGNLPLTGVTEQGGFLKIIYDFGISTELFPLFIFIAIGAMTDFGPLLENP
                     RMALLGAAGQLGIFTTLLLALAIGFPLKEAASIGIIGAIDGPTAIYVSSKLAPHLLPA
                     ITVTAYSYMSLVPIIQPPVMRLLTTKAERRVRMPYTIKPVSRVVRVLFPIVVTILVSL
                     IAPKASPLISSLMFGNLIRESGVVERLSKGAQNELANLVTLFLGLVIGSTMEGKAFIQ
                     PQTLAILGLGLLAFVLDTVGGVLFGKLMYVLSGKKFNPCIGAAGISAFPMSARIVQRF
                     VSEEDFQNFVLMHAMGANAAGQLGSVVAGGVVLAVLAGVL"
     CDS             632203..633084
                     /codon_start=1
                     /locus_tag="ANT_05840"
                     /product="hypothetical protein"
                     /protein_id="BAJ62618.1"
                     /transl_table=11
                     /translation="MKLIDLTIPLGIGTPAWPTYEPLQVKYFKRLAPNGANGQLLTHS
                     NHLGTHLDGEIHFYTPGKDMASLTMDYLVHEAAIVDLSDVCGDYDVYTSKMIEERVEV
                     KEGDILVIHTGYHHFGWDMPTADEVRYMVKHPGPDREFAEWAKKKKLRWIAVDCGSAD
                     HPMNTIIRTWMPRQAKEAEYVFKKKYGMSLEEFFSDDKYQLMHIEMFPHEIIHAECFG
                     GEIDLLLNQRVTVGFFPWRFVDGEASIGRAVAFVDDAKYEELMKKRESMPKTRFGDAY
                     DPTHVERLNAISRANLS"
     CDS             633487..633885
                     /codon_start=1
                     /locus_tag="ANT_05850"
                     /product="hypothetical protein"
                     /protein_id="BAJ62619.1"
                     /transl_table=11
                     /translation="MGWLRQWASDERGHQHQSAHHGAGSRWAHRRRHVLRHYYGFEIL
                     GNKEWWATYESYNGWMRWGLGMAQPSYPWPEYQHELGGARVYYITKKYWDQLVKDYIR
                     QMVGADLDFNVPDEVRKANEVMRVPDDILV"
     CDS             complement(633964..634893)
                     /codon_start=1
                     /locus_tag="ANT_05860"
                     /product="hypothetical protein"
                     /protein_id="BAJ62620.1"
                     /transl_table=11
                     /translation="MEHSPSAYVRMYRCQSIGYAALKGLSFPTTGRVTGSTSKGVFVL
                     VPPQRVFFLSYESYRGPLTLNLSPRPAEPLPVYIGQEVHLEADEISLPTLNTHISLSD
                     ENLWLPPVPPARIRSGEELWASIQRLSESALYVHRGVGFVPLLAFIMDDPHPPTIPAI
                     LQPSIASILILKNLFTQPLEVSMPALTGLMGSGRGLTPSGDDLIVGLMLLLSRMPGMD
                     SLHETLEALHRQIMEIAFEKTTALSANLIACACEGSADERLIQAVDGFLTGSLSESAV
                     LATLQEYGSSSGVDALTGMALALRALKVANYLI"
     CDS             635046..635675
                     /codon_start=1
                     /locus_tag="ANT_05870"
                     /product="response regulator receiver protein"
                     /protein_id="BAJ62621.1"
                     /transl_table=11
                     /translation="MSVPLGPILVVEDVPHVRELLEVTLRFKGYPVVSACDGLEALEF
                     IARERPALIVADILMPRMDGFAMAHEIRKNPQTRSIPIIFVSATYVTPEDKKFALSFG
                     GVRFIEKPIDTEDFLLTVAEVLTSDSPNVPAPMNERDFYQGYRERLEQKLRHKNTQIS
                     RTERLLATLPDEQKPAFETLLKQALADRDEIQRELDQLYKILDEMKGLS"
     CDS             635753..636550
                     /codon_start=1
                     /EC_number="3.1.3.25"
                     /gene="suhB"
                     /locus_tag="ANT_05880"
                     /product="inositol-1-monophosphatase"
                     /protein_id="BAJ62622.1"
                     /transl_table=11
                     /translation="MLPELEDLKQFAREAGAVLLEGFGRKMAVEYKARINPVTEYDRR
                     SEDLLIRLIRSRFPHHAILGEENGHQDGQKEHLWIIDPLDGTTNFAHGMPIFAVSIAY
                     AYKGQVQLGVVYDPNQDDLFCAERGQGAWLGDRRLQVEGAGDLLHSLLITGFAYENWV
                     IETNLQFFAHFHRRCEGVRRLGAAALDLCYVAANRADGYWEVSVNPWDLAAGGLVAEE
                     AGARVTRMDGAPDYLRPPCNVLCANPVLHEIMLKEIQSVAVPLYPAR"
     CDS             complement(636504..637331)
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /gene="trpA"
                     /locus_tag="ANT_05890"
                     /product="tryptophan synthase alpha chain"
                     /protein_id="BAJ62623.1"
                     /transl_table=11
                     /translation="MSGIKRIAQIFEKARNQQRAALILYYPAGYPDYATSLEVLKGLA
                     QSGADLLEVGMPFSDPLADGPTIQHATQMALSQRMNTRHCLALVRELRQQGVETPVVL
                     MGYLNPVMAYGMERFVRDARQTGADGIILPDFPPEESADFRALCDAYELALISLVSPA
                     TPPERARQIAETTRGFLYLISLTGVTGARESLPPELEAFVARTRAVARVPLAVGFGIS
                     TPQQARRVSQIADGVIIGSALIARTGEAANPVQAAVEFIQQMFTALGKEELPRFESL"
     CDS             complement(637328..638548)
                     /codon_start=1
                     /EC_number="4.2.1.20"
                     /gene="trpB"
                     /locus_tag="ANT_05900"
                     /product="tryptophan synthase beta chain"
                     /protein_id="BAJ62624.1"
                     /transl_table=11
                     /translation="METLSLIPTQQKDGRFGIFGGQYIPEVLMPAVQELEETYRQTRN
                     DAEFHEIYTHLLKTYVGRPTPLTFAKRLTEELGGARIYLKREDLTHTGAHKINNALGQ
                     ALLAKRMGKTRLVAETGAGQHGVATATVAALLDMECVVYMGSVDIARQQPNVQRMKLL
                     GAEVRAVESGTRTLKDAVNEAIRDWVTNVRTTHYLLGSALGPHPYPTIVRDFQAVIGR
                     EAHAQILEAEGRLPDACIACVGGGSNAIGLFSAFVDDEEVALIGVEAGGEGIASGKHA
                     ARFADPARGKPGVLHGTFTYLLQDEDGQVLPTHSISAGLDYPAVGPEHAYLREIGRAE
                     YTSVTDAEALQAFQTLARTEGILPALESSHALAEAIRRAPSLPRESILLVNLSGRGDK
                     DLETVLKALKGRGA"
     CDS             complement(638571..639218)
                     /codon_start=1
                     /EC_number="5.3.1.24"
                     /gene="trpF"
                     /locus_tag="ANT_05910"
                     /product="N-(5'-phosphoribosyl)anthranilate isomerase"
                     /protein_id="BAJ62625.1"
                     /transl_table=11
                     /translation="MNIKICGLTTKEDALIAAEAGANFLGFVFYERSPRFIHPEGCAR
                     IVETLKGYPVQCVGVFVNHAVEKVQDILRTCGLALAQLSGDEPPAHLEQLAGKAFKAL
                     RPATPDELDENLHIYPPHHPAPAYLLDAHQPGAYGGTGLSANLEIARPLAMRMPILLA
                     GGLTPENVAERVLRVRPWGVDVSSGVESAPGKKDPERIRAFIRAVRACEHALIHS"
     CDS             complement(639215..640009)
                     /codon_start=1
                     /EC_number="4.1.1.48"
                     /gene="trpC"
                     /locus_tag="ANT_05920"
                     /note="protein synonym:IGPS"
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="BAJ62626.1"
                     /transl_table=11
                     /translation="MNRLETILAHKQREIEERLQTVSPEQLERDIQETLPPPDFREAL
                     RRPPGAPVRLIAEIKRASPSRGQMAPIANPIELAHCYQQNGAAAISVLTDARFFSGSL
                     EDLRAIAALPHHPPLLRKDFILHPIQILEARAAGASAVLLIAACLSPASLRHLMAYAA
                     ELGMSALVEVHNEAELEQVLTCQPEIIGINNRNLRTFEVDPYTALRLLPLIPSPMIKV
                     AESGIHTPEDAHRFADAGFDALLVGEALVTAANPGEKMKELIGVVE"
     CDS             complement(640006..641022)
                     /codon_start=1
                     /EC_number="2.4.2.18"
                     /gene="trpD"
                     /locus_tag="ANT_05930"
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="BAJ62627.1"
                     /transl_table=11
                     /translation="MLKPYIAKVMNFQSLSAQEAEEAMNIIMNGEATPAQIGGYLVAL
                     RMKGETVEEITGSARAMRAHASRVKVQSTPLIDTAGTGGDGAHTFNISTAAAFVIAGT
                     GRKVAKHGNRAASSRCGSADVLDALGVRINLTPEQVARCIEEVGIGFLFAPSFHPAMK
                     HAVAPRRELGQRTLFNLLGPLTNPAGATHQLIGVYDGKLTSMLAEVLGELGVQGAFVV
                     HGHGGLDELSTSGPNRISRLHDGRVENEELDARDLGLRQATPEDLRGGEPAENASILR
                     AILENRDDSPRRDVVLLNSAAAIAAECGDLTRALAEAEHSLSSGAALQKLEALVTYSQ
                     QVAV"
     CDS             complement(641041..641625)
                     /codon_start=1
                     /EC_number="4.1.3.27"
                     /gene="trpG"
                     /locus_tag="ANT_05940"
                     /product="anthranilate synthase component II"
                     /protein_id="BAJ62628.1"
                     /transl_table=11
                     /translation="MLLILDNYDSFTYNLAQIFGELGEEIAVYRNNEISLEQIRALQP
                     ERIVISPGPGGPEDAGVSIEVIRELGMHIPLLGVCLGHQCIAAAFGGNVTRAPRLMHG
                     KTSPIYHYGEDLFTGIPSPFEATRYHSLIVAEPLPQELKATAFTSAGELMGLRHRQYP
                     IFGVQFHPESILTPYGKQLLRNFLDVRVPAAQPL"
     CDS             complement(641606..643117)
                     /codon_start=1
                     /EC_number="4.1.3.27"
                     /gene="trpE"
                     /locus_tag="ANT_05950"
                     /product="anthranilate synthase component I"
                     /protein_id="BAJ62629.1"
                     /transl_table=11
                     /translation="MTQPLTHVSLPVSAKSVPAPLVRTLPADLETPVSIYLKLANGSP
                     SFLLESVTGGEQVARYSFIGVRPRRIYRIEGDRLIVSDLQGREEYYSGEPFKQLERLF
                     SAKKRPVLPGLPRFSGGLVGYLGYEMVRYFEAGIGTLPAQYEYPDALLLEVDTLAAFD
                     HAFGKIILIAHPEPALPRNEAQQEAEQRLDELQASLRKPLELPLSYPSHAEMTTMKSN
                     MSREQFLSAVEQAKEAIRAGEIFQVVLSQRFSRTTSAHPFEIYRALRRLNPSPYMFYF
                     DFANSTAGEPLRLIGASPEMHVRLSGNTATIRPIAGTRPRGTTPEADLQLEKDLLADP
                     KERAEHVMLVDLARNDLGRVCTYGSVQVREQMTIERYSHVMHIVSQVEGTLRPELNAF
                     DLMRATFPAGTVSGAPKVRAMQIIRDLEPTPRGVYAGAVGYFAFDGSMDTCIAIRTLV
                     MQGKRISVQAGAGIVADSEPEREYQETLNKARALAQAIEIAEKPEEHHVAYSG"
     CDS             complement(643542..644405)
                     /codon_start=1
                     /locus_tag="ANT_05960"
                     /product="hypothetical protein"
                     /protein_id="BAJ62630.1"
                     /transl_table=11
                     /translation="MRNMASRITGITLIGMAILGVLFSIAAIILTNRFLDEARSAIIA
                     TGDLTERALLNTAKGLYTARTSLEEAQTTLSAIHQTLDGVTATVEGFSPALEAFHTLL
                     GESLPAAIRTTQVTLQAAQTAAQTLDIFLYGLSQVPILSNFVKPPEVALHTAIGEVNS
                     SLDNIPAALQDAQQGVQTASSENAKMESGLETISGQMSGIEEVVLEMKNVVDEYLLLV
                     EDLQMKLLNFEKRLLTWVSIFRVLMTFILAWLALAQISLFLQGWDLLVHGFPGQGTAP
                     ETRGHSETPKT"
     CDS             complement(644452..644868)
                     /codon_start=1
                     /gene="mrpG"
                     /locus_tag="ANT_05970"
                     /product="Na(+)/H(+) antiporter subunit G"
                     /protein_id="BAJ62631.1"
                     /transl_table=11
                     /translation="MNIVIVGLAFLGAFFIFLASIGILRMPDLFLRMSATAKAGTLGV
                     GTLLFATILHFQDFVITSRALATIIFLILTAPVAAHMIARAAYFDGTPLWEGTVRDDL
                     KNHYQLTTHALDSQVHPAEDTPSIETAEGDDFTEEG"
     CDS             complement(644880..645143)
                     /codon_start=1
                     /gene="mrpF"
                     /locus_tag="ANT_05980"
                     /product="Na(+)/H(+) antiporter subunit F"
                     /protein_id="BAJ62632.1"
                     /transl_table=11
                     /translation="MIMDWMWTLVIGLIGLAFIFTVIRLIRGPRLPDRVVALDLITAE
                     IIGVIAVASVRANQPAFLDVAIILALISFLGTVAFAYYIEQRV"
     CDS             complement(645140..645613)
                     /codon_start=1
                     /gene="mrpE"
                     /locus_tag="ANT_05990"
                     /product="Na(+)/H(+) antiporter subunit E"
                     /protein_id="BAJ62633.1"
                     /transl_table=11
                     /translation="MRLFLLNVLLAIAWGALTGNFEPENLIGGFALAYLILWLAFSRR
                     PQTRYFRRFPRAVEFILFMAWEIFLANLRVAVTVLSPRPRLRPAVVGVPLSLKSPAEI
                     SLLMNLLTLTPGTLSLDVSSDRTLLFVHTLWLESPEEFIQKIKQDYERRIMELFE"
     CDS             complement(645610..647091)
                     /codon_start=1
                     /gene="mrpD"
                     /locus_tag="ANT_06000"
                     /product="Na(+)/H(+) antiporter subunit D"
                     /protein_id="BAJ62634.1"
                     /transl_table=11
                     /translation="MNGLSIAPIVLALVWGILGLIFWQRTRVLRWLGVAGSTSFVALS
                     IVLLLLVQKEQFLVIQVGAWRAPFGITITIDLLSALMVTMTSVLAWFIALFSLTEVDE
                     AQARYGFYPLFFLLLMGVFGAFTTGDLFNLYVWFEVMLMASFVLMALGGHRAQLEGAT
                     KYVLLNLIGSTFFLIAAGLTYSMTGTLNMADLAVQIREVEHSTLPLVLSAIFLVAFGI
                     KAAIFPLFFWLPASYHTPPIAVTALFSGLLTKVGVYAMLRVFTLIFPMNGTILQSILL
                     ILAGFTMVTGVLGAAAQWDLRRLLSFHIISQIGYLIMGLGLFTPLALAGTIFFTLHVV
                     IAKAALFLVSGMIQRLTGTFNLKPLGNLAQTQPAMALLFAFPALSLAGLPPFSGFFAK
                     LALVRAGLEVQQGAIVAVSLAVSLLTLFSMSKIWQEAFWKPAKREEKGALPANLWGAV
                     SGIVLVSVLLGLLANPIMTLSLQAAHQLLQPSLYVQAVLGGLP"
     CDS             complement(647088..647465)
                     /codon_start=1
                     /gene="mrpC"
                     /locus_tag="ANT_06010"
                     /product="Na(+)/H(+) antiporter subunit C"
                     /protein_id="BAJ62635.1"
                     /transl_table=11
                     /translation="MNVLLAITAGVLFGGGLFMMLRRSLVRVLIGLLMISNAVNLIIF
                     TAGRLVPAHPPLISPGNNALTPPYADPVPQALILTAIVISFGVAAFAIVLMQQTYRAL
                     GNADMNDMRSTDTPVEDEEEATP"
     CDS             complement(647462..647881)
                     /codon_start=1
                     /gene="mrpB"
                     /locus_tag="ANT_06020"
                     /product="Na(+)/H(+) antiporter subunit B"
                     /protein_id="BAJ62636.1"
                     /transl_table=11
                     /translation="MKARSMLLQVAVSYLMPLLLIFSIFLLIRGHNEVGGGFVGGLVA
                     AASFILYAIAESPNAARALLPLSPDKLIALGLSIAVLSGLPAVFMGMPFMTGLWIKQP
                     LPVIGKLGTPFIFDIGVYLVVIGVCLHILLNLAEEER"
     CDS             complement(647878..650205)
                     /codon_start=1
                     /gene="mrpA"
                     /locus_tag="ANT_06030"
                     /product="Na(+)/H(+) antiporter subunit A"
                     /protein_id="BAJ62637.1"
                     /transl_table=11
                     /translation="MEFALLLLTGFLLTFTAPWMRRFLREWSLPFFLAYPLAALALLW
                     NASELIQKQSAVEVSIPWVSSLGVNLSLRIDGLGWLFGMLISGIGALVVLYAHGYLHH
                     HPQENRFYGFLFLFMTAMLGVVWSEDIFLLFIFWELTSISSFLLIGLEHHEEKARKAA
                     LQALLVTAGGGLALLAGLVGLALITGSNRLSVINSQGNWIVQSRLSLPVLLLILAGAF
                     TKSAQFPFHFWLPGAMAAPTPVSAYLHSATMVKAGVYLLARLTPALGGTPAWHTLLTL
                     FGLATLLAGAMLALAQTDLKRLLAYTTVASLGTMMFLIGLGDSLAIKSAMALILAHAL
                     YKGALFFVAGGIDHSTHTRDINRLNALAGKMPLTALAAALAGISMLGIPPALGFISKE
                     LIYEASLESASGGNTLIVLIALAELTAVGLWVAFLPFWTKSGEKTAEAHGEDVFLWLP
                     PLILALISLTLGLLPSVASKALVQPAVEAALLKSTPVKLSLWHGWTPMLALSALTLGI
                     GAVLGFSRTRYQHAVQTILQALSPISPERGYERGLAGLKRFATVQTNFLQNGYFRRYL
                     LTTILFGMVLVGAILIQSLPLPWASFTPPRFYEIILVGLILTGVFAVTRTSSRMAAAA
                     LLGMIGFTIALIYLLYSAPDLAMVQFTIETLSVILFVLVIYRLPQFTRTRGGRTAVLD
                     VLVSVAAGVLVTVLVLSISAVPHDSLVTPFYAENSLKLAQGKNVVNVILVDFRGFDTL
                     GEITVLALAGIGVFALLKLSGKSEAIRTPEKEEAE"
     CDS             650363..650818
                     /codon_start=1
                     /locus_tag="ANT_06040"
                     /product="Fur family transcriptional regulator"
                     /protein_id="BAJ62638.1"
                     /transl_table=11
                     /translation="MKDPEQRFQELMQKLRSREYRLTPQRVALIRLLASSEGHPDAAE
                     LYRRLLEQFPTTSLATVYKTLNLLKEMGEVLEIEIDGIGGEGSRFDGNDPTPHPHLIC
                     VRCHRILDGQVSLTEEILQAVQGQSGYRVISHRLDFYGICPECQAQGAN"
     CDS             650907..651344
                     /codon_start=1
                     /gene="bfr"
                     /locus_tag="ANT_06050"
                     /product="bacterioferritin"
                     /protein_id="BAJ62639.1"
                     /transl_table=11
                     /translation="MEDTMDKETLIAHLNEDLAGELGAIIQYITYAAKASGPFRPQLA
                     QFFLAEVPDEQLHAQFLANKIVALGGEPTTTPRPVPPARNNREMLEAVLEAERKARAD
                     YTRRAEEAEAFGDKGLAVQLENMVLDESNHAEETERILREWHL"
     CDS             651495..651938
                     /codon_start=1
                     /gene="mscL"
                     /locus_tag="ANT_06060"
                     /product="large-conductance mechanosensitive channel"
                     /protein_id="BAJ62640.1"
                     /transl_table=11
                     /translation="MWKEFKEFALRGNVIDLAVGIIIGGAFGKVVSSLVNDIIMPPIG
                     LLLGKINFSDLFLDLSGTHPASLSAARDAGVPVLAYGSFIQSLVDFLIVAFAIFLLVR
                     AVNRLRVLKPEPAAPPAEPTTKECPYCLSTIPIKATRCPHCTSQL"
     CDS             complement(652007..653209)
                     /codon_start=1
                     /EC_number="6.3.2.4"
                     /locus_tag="ANT_06070"
                     /note="protein synonym:D-Ala-D-Ala ligase"
                     /note="protein synonym:D-alanylalanine synthetase"
                     /product="putative D-alanine--D-alanine ligase"
                     /protein_id="BAJ62641.1"
                     /transl_table=11
                     /translation="MDTTIFIQEELDPDPEKPPSSRPRPARPWRVAVIANVKGETALP
                     IQAPPDAGAEFDRKETIEAIQSAIESDGHTTRFLSADHTLLDSLREYQPDICFNIAEG
                     IIGDAREAQVPALLEMLGIPYTASRVLANALGLDKTMTKRIWRNLGIPTASFQEFITG
                     DEPLEADLSFPLFVKPAREGTGMGMDEGSIVYNENQLRRRVKWVIEAYHQPALVETYL
                     PGREFTVGVLGRADARRWSPKPHLYRADGFHRFPILEVDNSNTVTPGVYGYAAKTLHP
                     GEEGVPGFICPAQVEPDLAEKLWTLAIRAHNAIGALDVSRVDVRLDAHGNPRLLEINT
                     LPGLTPGFSDLCVIAQAEGLSYRDLILEILYLGASRWGLLEEAPQAIHVPLQAHHHTF
                     QPAPMIFK"
     CDS             653331..654215
                     /codon_start=1
                     /locus_tag="ANT_06080"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62642.1"
                     /transl_table=11
                     /translation="MHFGVILPNYGAGSGRLAVLDTALLAEALGFPSVWTTDHLALPV
                     GDAERFTPLLEALTTLAYLAGSTARVKLGVSALVLPQRNPLEVAREVATLDVLSGGRV
                     VLAAGIGWSQGEYANLGYSFTNRGKRMEEALQVLRTCWRGNRVVSYQGRYYRFEKVDF
                     APAPIQAGGPPLWVAGNSPAALRRALRLADGWHPVGLSPDVLAGQLAKVRPLLANRPF
                     TVAVRLSVAWGHETAEGGALAGSPEQILEMLRLYQSSGATAFLLHFLAENQSERERVM
                     RAFAREILPHFPRDVEMG"
     CDS             654212..655261
                     /codon_start=1
                     /locus_tag="ANT_06090"
                     /product="hypothetical protein"
                     /protein_id="BAJ62643.1"
                     /transl_table=11
                     /translation="MKKTLFLLALLGALFLSACASSVELGSLFTPTFTLTPSLTPSVT
                     QTPTPTETLTPSPTDTETPTLSPTFTTSFTPTSTDTVTPGPSPTDTRTPTVTRTPTRT
                     RIPTRTRIPTRTPTITLTPTITNTPTPPPPQTAILRPGLLSRVVSPIQAEINVTPGED
                     GMVRIELIGEDGRIIVRQVLDYRNYRGRSITIYPQIPFEIQAMAETARLQVVTQDRFG
                     RTISLMSVDLVLLSLGRAEIYPPLVTQEPYIVRFPQEGQVVSGGVLWISGLARPVNSS
                     PILIELVGESGAVLSTKLLTVEPPSGELSHTPFEVEIPYQVNASTPVRLTFRQEGGRI
                     PGTVALSSRVIVLEP"
     CDS             655287..655745
                     /codon_start=1
                     /locus_tag="ANT_06100"
                     /product="hypothetical protein"
                     /protein_id="BAJ62644.1"
                     /transl_table=11
                     /translation="MEKNRLQPGFWRIVDNDYIATFSIYTIGTLWAVYLIFKVFALEF
                     RDESFYLILSAVLTVLGGAVLAWRYWRIRAFFAKGERTRGKLVKTDFFRSTGWLEYDY
                     TLKGKRYHRKETVHRNPRTRALKEGDLVWVVFDPQRPERAMLADIYEEKG"
     CDS             655792..656181
                     /codon_start=1
                     /locus_tag="ANT_06110"
                     /product="hypothetical protein"
                     /protein_id="BAJ62645.1"
                     /transl_table=11
                     /translation="MANRAGDWLRQAERDLEQARDSQRAGRHEWACFAAHQAAEKALK
                     SLHLHFGQEAWGHVVARLFSDLPAQVQIPENLVEKGRVLDNFYVPTRYPNGHPEGAPF
                     EHYGILQSEQAITYAGEILAFVRSQMA"
     CDS             656192..656503
                     /codon_start=1
                     /locus_tag="ANT_06120"
                     /product="hypothetical protein"
                     /protein_id="BAJ62646.1"
                     /transl_table=11
                     /translation="MDAAVRAWAAQLASAHPEVLKVGYWGSYARGDWGVGSDVDLVLI
                     LSRSDLPFDQRGRTLDATSLPVPADLLVYTLEEWLNLPEEGRFKKTLASEIVWVFERN
                     P"
     CDS             complement(656550..657704)
                     /codon_start=1
                     /locus_tag="ANT_06130"
                     /product="hypothetical protein"
                     /protein_id="BAJ62647.1"
                     /transl_table=11
                     /translation="MRKGLAVFFLAMLFWLAGTLSTVKAQSQSEPFTGDALCLPDAYP
                     TGADCLVLGPAAKLTEWSAYGLTYPPRPLPARKPPAELTQSPVSIAKINLPANEPAPL
                     YSTLEDAVNGSNPVRSIDAGKLRYVSIINVQRVNDKPYVQLKTGEWMRASPAAYSSFQ
                     GLQFYRTPANSFGWIVDHTRARTAPTYTAPEVDPILYRETAVQIYQIVNRDGTDWYQI
                     GFDRWVERRYIRQVRINTTPPQGVTGNRWIEVNLYDQTLSVYENNQLIFATMVASGGE
                     PFYTRPGLFQIYKKKPLETMQGAFEADRSDFYYLEDVPWTMYFDQARALHGAYWRAWY
                     GFPGTHGCVNLSIGDSAWLFQWAKEGDWVYVWDPSGQTPTDPALYTQGGA"
     CDS             complement(657747..659909)
                     /codon_start=1
                     /locus_tag="ANT_06140"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62648.1"
                     /transl_table=11
                     /translation="MRMPFKADKRALLERGLLLGGSWASLTLTLYLFLLQPFHTISRI
                     RLGLSAVLAGMIILLLFLWSERDEALPPRVSKGWLVLFALWGTLLVYFAKPQPSMALF
                     ALPETLEVTFVPLEANTAAVQILWLNDGVADISFRQIDWAGNAQIQPDGVRLSLTKDQ
                     PGGFRWQGKGWQSFTLTLKSNSPLKAYLRTQRANYEEIIEPTEDAEYTLHLPIGNPGI
                     SGVFLALIWGNVFLSFFLFLLMSVAFPHRNISLRLSLRWQDLLPWFILALFALLGWGA
                     GMVIAQYNRLYADDYCYLNILHENGWLKANMHAYLHITGRFAGHFLDFIAYHLGESIA
                     PLGIYVLFAAGGGGLYLLMRTLYPQSKVWHTASLAAALPLFALITTANPVQSVFWTLH
                     ALSVCAGLGFLLLTFRQVFRWMDTPPALKNRLGLFLLAVFTGGFHETLSIFGILFLSL
                     LAWLDWRSQRHQGKQKEFPVSAVAVLGLLMGFLIVIIAPGNTSRMAEIGITFDLKEIF
                     RQTPNLILSSFRWMLGGPYQNGFTLLVLLAVFLLGLQWGLRHAIPSYGFLPLHPLEKL
                     AFFFLPFVSILLMLLPSAVLRGFFPLRSLFIPQTVLILGMFGHGIWAGTWLREQNLKL
                     LAPVAIVATALILWMGWLIFPAVSRFHQEMKLHAAEWDTRAAFITQAHTAGQNTVLVP
                     PYRYIAEVDLQPDPENWLNRCIQTYYGITVQLESIEQP"
     CDS             complement(659948..661921)
                     /codon_start=1
                     /locus_tag="ANT_06150"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62649.1"
                     /transl_table=11
                     /translation="MTFRRTVLGLTFLATGIALLELGIPALQDGRIPASSKWMLVFIL
                     GGLFFSGTGVLWGLSLTPRWQTFEAFFQRGLLALRRIRWVGIPILGLVGIGWLELIYL
                     PYPALFERNDLFLSPALRLSLLWVLGVLTVPFWLALFPRLRGVEALAGALLFLGLLHR
                     GGEYFFAVRDYPFSLGWSEASRFYYGSLFHSQAIYGESTPLPFLHPSRYLLLSIPHLI
                     GNLPLWAHRLWQALLWFGMPLLNAFLLARRLSLASRSIRWLFIGWSALFLMQGPVYYH
                     LLVASGIVLAGFDSRRFWRSFFVIVLASLWAGISRVNWFPVPAMLAIMLYLLEQPYPG
                     NFWRWVKNPVIWGISGVVSAFLAQAMYIALSRQPDISSFGSSFFSSLLWYRLLPSPTY
                     PPGILPLTVILSLPILFLIALNGKRQILHPLRLLGLSGMVFILFAGGLVVSTKIGGGA
                     NLHNLDAYWMTLWIWGSALFSGQVTGEQHPGVPFRKPAILIALAFILPFYPAVMEGRP
                     IPVLDKARAEFELSLLKSYLKPAVENQQPVLFIWQRQLLTFHQIEGLRLIFPYETIDL
                     MEYAMSDNRAYLQQFYDDLCHQRFAVIVSAQQNIVFKSPQDTFPEENNVWVTRVTIPI
                     LSYYKPLDTLDQSGTQILIPKENPPTCLRIAVP"
     CDS             complement(661918..662814)
                     /codon_start=1
                     /locus_tag="ANT_06160"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62650.1"
                     /transl_table=11
                     /translation="MKAPRSKATWIRWAGTLLTLLLLGYLAAQQDWDTLRASFRQIEV
                     WRWLAALGLTLLSRLAVALRWHVLLASAQPRLRLSQSMRLTFAGLFAANFLPTTIGGD
                     VVRLAGAVQLRMDAALSTASLVADRLIGMAGMTLALPWGLARALDAGMPVLQSAFLSL
                     PGLFQKIRAFAQNLLEHFRFWARKPAPLLISLGFTLVHMACLFSSIAILLEGQGQSIP
                     WLTIAGIWSLVYFITLLPVSINGLGLQEVSSTLLYAHLGGISMEASLTLAVLLRALQM
                     LASLPGALFVPDILAAREGKTQ"
     CDS             complement(662811..663764)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_06170"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62651.1"
                     /transl_table=11
                     /translation="MDLSIVVPVYNEEENLPLLYQAVVAAVVPLNLEWELILVDDGSR
                     DSSPQVLQTLAEQDPQHVRVVLLRRNFGQTAAIAAGIDHSSGEIVVLMDADLQNDPAD
                     IPMMLEKIHEGYDVVSGWRKNRQDDLTRTLPSRLANGLISRVTGVHLHDYGCTLKAYR
                     REVLTGFRLYGEMHRFIPVYAHSVGARILEVEVHHHPRRFGKAKYGLERTAKVILDLF
                     TVKFLSSYSNKPIYLFGGVGIILIGMAFLVLFYLFVRRVFFGISVLGSPLFQMSTMVA
                     IFGFQSILMGLIAELLVRTYHESQGKPTYTVRTTINFPPEV"
     CDS             complement(663877..665340)
                     /codon_start=1
                     /locus_tag="ANT_06180"
                     /product="LytR family transcriptional protein"
                     /protein_id="BAJ62652.1"
                     /transl_table=11
                     /translation="MQSMARVSSRYRQSQPSLDRTTLILLGVFVVLALATAVVAYLWA
                     RNLFSSWTMTGMGNAPAASSPAQSGEQNQGNSNVPLPEGPLQNNGAGPEPKPWDGKTR
                     VTLLVMGLDYRDCEDNFAECDQNGASRTDSMMLLTVDPVSKTAGMLSIPRDLWVQIPG
                     FDYGKINTAYFLGEVYKLPDGGPGLAMRTVEQLLGVPIQYYALVDFNAFVRIIDELGG
                     VKIRPKERIKLDPIGPNNTIWLDPGVYVVDGATALAYARNRYTEGGDFDRAARQQEVL
                     ISIRDRVLQFNMLPTLIAKAPRLYAEVQSGVRTNLTLEQIVQLAWLSQQIDKENIKRG
                     IIGPPNYVTFSTSPDGQAIEIPVTDQIRVLRDEIFATGGPVGPAAVTDDPEELVKQEA
                     ARILVKNGTTTGGLAGRTAEYLRSKGLNVTGEGNADQVYSFNTLIDYSGKPYTMTLLL
                     DMLGKDNTRVISRYDPNAQVDIEIILGTPFAQSNPLP"
     CDS             complement(665420..665647)
                     /codon_start=1
                     /locus_tag="ANT_06190"
                     /product="hypothetical protein"
                     /protein_id="BAJ62653.1"
                     /transl_table=11
                     /translation="MVHPDLMEILRCPVCVREEGKTGLLTLSRDYWLVCQDCQRKYPI
                     VDEIPVMLIDEGDKWIQTAVEDLPVPPPAPK"
     CDS             complement(665797..667017)
                     /codon_start=1
                     /locus_tag="ANT_06200"
                     /product="hypothetical protein"
                     /protein_id="BAJ62654.1"
                     /transl_table=11
                     /translation="MREHMKRIFLFLSLILWVFIAIAQTPLPEEVIGEPVMLDTPSQP
                     GLLFTGCTRVNVAPMNDAYEHRVVELSNIERDKLGIPPLKRNTDLDYAGRFHSKDMMD
                     EDYFDHNSYDGETQVCLWYTRVGNFYTGYSSLAENIAAGHSTPEAVVEAWMNSPGHKA
                     NILDSNYREIGVGYTYGGGTYYRYWTQDFGTRSSVYPIVINLEAAQTASPDVNLYIYG
                     KGKWSEMRLRNDSGTWTAWMPFQERVNGWSLPWIAGTRTVSVELRSGTTTTSASDTIT
                     LTTSGNRLGNLPDSITFLYDKSTGTLYPSASLALQPTNSLNSTPLTWSAAVNPTSNFL
                     QLSRTSGTTPNDTLLVMPHASTLQNVGTTLGTLTIAITNPVYPPEGSSKTIPVRVSVV
                     NSLNARVYLPAVLR"
     CDS             complement(667087..668946)
                     /codon_start=1
                     /locus_tag="ANT_06210"
                     /product="hypothetical protein"
                     /protein_id="BAJ62655.1"
                     /transl_table=11
                     /translation="MSTISYPVRRPTPQPRAITLEQVLLAGMLGVVLFVVVLVIFFLG
                     FQIVYAGRIFPGVSVAGIDVSGMTPREAAQEIQRRITYPQTGKLVLKDGERFWIVTPA
                     ELGLALDASASARAAFQIGRSGDPFTRLWEQSLTLASGKDVPPVLLLDQRVTFAYLNN
                     LATQIDVPAKDATLQVEGTEVKVTPGQIGRKLDLNASLILVSVQMQTLKDAILNLYVQ
                     EEKPAILDASTAAEQARRILSTPLTLTLPATDNSGDGPWTIPPEQLAQMLVIRRAEAD
                     GNTRYQVGLNETYLLTYLSDLAPKLRRSPVNARFIFKDDTRQLEVIQNAVIGRELDVS
                     ASANFIQEKLAQGEHEIALQINYTNPPVTDEMTGEQLGITELVQATTTYFRGSSAARV
                     QNIKAAASKFHGLLVAPGETFSMAQALGDITLDNGYAEALIIIGGQTIKGVGGGVCQV
                     STTLFRNAFFAGFPIVERHAHAYRVGYYEQTASGHSDRLAGLDATVFVPLVDFKFVND
                     TPYWLLMETYINGYSLTWKFYSTKDGRTVEWDTTGPTNVVDPPETVYRENPDLKQGEI
                     KQVEWAAKGADVTVTRRVYKNGALYFSDQFVTHYEPWGEVFEYGPGTELPPKE"
     rRNA            669333..670830
                     /locus_tag="ANT_r0040"
                     /product="16S rRNA"
     rRNA            671143..674099
                     /locus_tag="ANT_r0050"
                     /product="23S rRNA"
     rRNA            674172..674288
                     /locus_tag="ANT_r0060"
                     /product="5S rRNA"
     CDS             674459..674881
                     /codon_start=1
                     /gene="ssb"
                     /locus_tag="ANT_06220"
                     /note="protein synonym:helix-destabilizing protein"
                     /product="single-stranded DNA-binding protein"
                     /protein_id="BAJ62656.1"
                     /transl_table=11
                     /translation="MTFHTIIIVGNVGREPEMRYTPAGQPVTSFSVASNRSYTNQQGE
                     KVDETIWFRVSAFGKLAETCNQFLHKGSRVLVEGRLVPDKNGSPRIWTRQDGTAGASY
                     EVTATTVRFLSARGEGGAEAGGDLTIPDVGDMGEDIPF"
     CDS             674904..675569
                     /codon_start=1
                     /locus_tag="ANT_06230"
                     /product="translin family protein"
                     /protein_id="BAJ62657.1"
                     /transl_table=11
                     /translation="MKTLPEIAERIHQALEARTRARDQVLTQARVLTRHAAHAIRAAH
                     REEWSIAAEQLEQARLLVRQLQQDLAPYPELYFAGYTQDAIKEFAEASIACALIQNLS
                     LPTPEELGVEDVTYLNGLAEAAGELRRRCLDILRQGYSQEAERLLSCMDDIYDVLVTM
                     DYPDAVTNGLRRQTDVARSLLERTRGDITLSQREQHLEQVIRDAVKRLESPSHDSPDN
                     PRF"
     CDS             675541..675786
                     /codon_start=1
                     /locus_tag="ANT_06240"
                     /product="hypothetical protein"
                     /protein_id="BAJ62658.1"
                     /transl_table=11
                     /translation="MTRRTIRASEIGAFLYCRRAWWYRLQGVEPQNREVLGEGTAYHL
                     RHGKEVWLASLIRLAGWLFLSGALILLVVGLTLYVLR"
     CDS             675802..676317
                     /codon_start=1
                     /locus_tag="ANT_06250"
                     /product="hypothetical protein"
                     /protein_id="BAJ62659.1"
                     /transl_table=11
                     /translation="MMWIGVGLFLFLLAVLMLIWAQHRLQAVGLPLGRIVSTDTSRWR
                     ALEKPLYDPETGLTGKPDYVVKVGGVLVPVEVKSAWAPAEPYDSHVYQLAAYCLLLAR
                     TSGKRPPYGFIHYRNRTFAVDFTPALEQALLGVIDEMHAEQRRSTVNRSHEESSRCAR
                     CGFRAVCDQRL"
     CDS             676334..677521
                     /codon_start=1
                     /locus_tag="ANT_06260"
                     /product="putative LytR family transcriptional protein"
                     /protein_id="BAJ62660.1"
                     /transl_table=11
                     /translation="MLKAVTPLYRLLVGLLLCALALSACGAEQDITARGTVFPSYAVQ
                     MPPTLSPTPSLTPLPPRSTVYPTPRFTSVTPIPSPAEPLTLPDEVMVYLLAGQDRSQP
                     FVGRTDAIHLVFLHPRFAKAALISLAPDLFVYLPGYSMQRLSAAYPLGGARLLRETLA
                     YNFGVRVDEWAVMRMDDFAFLVDELGGINVPVLEAIPGVCGDRIYPGQVFMNGELALC
                     YARLRQQEQETARGLRQQALLEQMLLRLAQGGNLVRLPGIFETIAPRLDTSLSREDVV
                     GRAALALRLSDTRRLGYFQIGENAARVWPILDNPRTIVFLPDGQAVRRVLEQAMAFIS
                     RPEAFSERIATLEFELTISPTPTPLPTDTPIPPDTPTPLPTFTRTPAPQTLTPTFTPT
                     LAP"
     CDS             677762..679048
                     /codon_start=1
                     /EC_number="1.4.1.-"
                     /locus_tag="ANT_06270"
                     /product="glutamate dehydrogenase"
                     /protein_id="BAJ62661.1"
                     /transl_table=11
                     /translation="MSGMINEFEMAQRQFDHVASLMHLDPQVAEFLRWPMREYHFRIP
                     VRMDDGTIRTFQGFRVQHNDARGPNKGGIRFHPAETIDTVRALAFWMTWKCAVADLPL
                     GGGKGGVVIDPATLSTAEKERLCRGYVDIMWRNLGPRTDVPAPDVGTTPQMMGWMMDE
                     YSKLVGQYTPGVITGKPLGGGGSAGRTEATGYGVIYTVREAMKMLGIDSRGTVAAIQG
                     FGNVAQYAAIGFVEMLGGKVACVSYWDREDRCAYTVSKEGGIDPHFLMSITDQYGTID
                     KNKAVAAGYKIEDGEAWITKEADVLIPAALSGTINAETVKGVHERVKIVAEGANGPTT
                     PEADELFKARNIFVIPDFLCNAGGVTVSYFESVQNDMNYYWTKEEVLSRLDTKITTAF
                     HGVVEMAQKQGVFMRDAAYMVAIDKVVKAMQLRGWI"
     CDS             679194..679697
                     /codon_start=1
                     /locus_tag="ANT_06280"
                     /product="putative DNA-binding protein"
                     /protein_id="BAJ62662.1"
                     /transl_table=11
                     /translation="MTLQPEAERDLIILEHIEQNPDATQATLAAQLGVAVGTINWHLK
                     RLIEKGYIKVRRAERRKLRYIITPEGIALRARLTMDYIQTSFRLYRLVRQRTIEALTQ
                     VQEHGIRMVRVVGDGDVAEVCRLTCLERGMQVVEDEHAPALTIQGLKIVLMGDGFDHK
                     EEENHAS"
     CDS             679687..680649
                     /codon_start=1
                     /EC_number="1.1.1.271"
                     /gene="fcl"
                     /locus_tag="ANT_06290"
                     /note="protein synonym:GDP-4-keto-6-deoxy-D-mannose-3,5-
                     epimerase-4-reductase"
                     /product="GDP-L-fucose synthase"
                     /protein_id="BAJ62663.1"
                     /transl_table=11
                     /translation="MQVESFWHGKRVCVTGGAGFLGQFVQKKLRERGVSQEQIFVPHY
                     PEYDLVKPEDVRRVLDDSRPDVIIHLAAHVGGIGANREHPAEFFYDNLMMGVQLMHEA
                     WKKGVGKFVAIGTVCAYPKFTPVPFKEDDLWNGYPEETNAPYGLAKKMLLVMAQAYRQ
                     QYGFNAIFLLPVNLYGPGDNFDLQSSHVIPAMIRKFIEAEEAGKDEVVLWGDGSPTRE
                     FLYVEDAAEGIVRATEAYEGSDPVNLGSGYEIRIRDLAELIARLTGYSGKIVWDTTKP
                     NGQPRRALDTTRAEKYFGFRARTNFEEGLQKTIEWYRQNRHKIA"
     CDS             680689..681546
                     /codon_start=1
                     /locus_tag="ANT_06300"
                     /product="putative polysaccharide ABC transporter
                     permease protein"
                     /protein_id="BAJ62664.1"
                     /transl_table=11
                     /translation="MTTVKNHSYPITYLRPASGWMPLDLAALWEYRELIYFLTWRDIR
                     VRYKQALLGIGWAILQPVFHMVLFTVIFGRLAGLKPDAGIPEQLYPIFSFAALLPMQL
                     FQQALQRSSISLVQNANLLTKVYFPRLIIPLSAAGAALVDFFFAMLVLGGLMVAYQVP
                     VTARLLWLIPLTLLAVLAALAIGLWLSALNVQYRDVQHMIPFLIQAWMYASPVAYSID
                     VIPESGIWRWVYALNPMAGVIQGYRWALLDATPPAGFLWVSVAVVVVLLISGLYYFRA
                     MERTFADTV"
     CDS             681548..682804
                     /codon_start=1
                     /locus_tag="ANT_06310"
                     /product="putative polysaccharide ABC transporter
                     ATP-binding protein"
                     /protein_id="BAJ62665.1"
                     /transl_table=11
                     /translation="MSDWAIRVEKIGKQYRIGTLNSQRYQTLRDAITGLFDRSARNVV
                     SGRIWALKDVSFEVRQGQVLGIIGRNGAGKSTLLKILSRVTQPTEGFGEIRGRVGSLL
                     EVGTGFHPELTGRENIYLNGAILGMKRREIERKFDEIVEFAEVGAFIDTPVKRYSSGM
                     YLRLAFAVAAHLEPEILVVDEVLAVGDAEFQRKCLGKMSDVAQEGRTVLFVSHNMSAI
                     LRLTQETLVIEKGRLKMRAPTPEAVDYYLSQGYSQEGQRTWDADEIPPEAAPFRPCAV
                     RIVNAEGKVTETVRSTEPFHIEVEYALDAPITGLRVGVYLMSMRGEYIFTSFDTDDPQ
                     RFERYPVRQTGVYVSRCTVPADLLNEGRYAVGINASSFRVRRYFQDDQALSFTVDATG
                     APGTHWTEARLGPLRPRLDWKIEVKA"
     CDS             682801..684417
                     /codon_start=1
                     /locus_tag="ANT_06320"
                     /product="capsule polysaccharide biosynthesis family
                     protein"
                     /protein_id="BAJ62666.1"
                     /transl_table=11
                     /translation="MKAAGKQVIKQFLGQIPFTAELYWLLRQNGKPIRTRFSLKHLQS
                     ELPEMVRQAEAMRRVVETSKNVFIFATLHYWIEHTALLGMALAAQGHRVTLGFLPYAE
                     WQEPINLFDLRRQNAYARKVLSTAEPWLHPVSFLNNRPTVVRLPDEVMDAVRLVSNYD
                     AQYTLQVEDVDLESGIYKLRLERNTEAARTLYPYLKANRPDVVIVPNGTIQELGVAYR
                     IARILNIPVVTYEFGDQRQRIWLAQNAEVMRQETDALWEAHQGASLTPEQLERMRALF
                     MARQRGALWENFARQWQGTPAQGGNTIREQLRLDERPLALLATNVLGDSLTLGRQVFS
                     QSMAEWIERTVQYFAGRPDVQLVIRIHPGEVLTHGQSMMDVVKRVLPRLPEHIRLIGP
                     KEKINTYDLVEVADVGLVYTTTVGMEMAICGLPVIVSGQTHYRGRGFTFDPDSWVSYY
                     KLLGQILSKPSAYRLSRQQVESAWEYAYRFFFDYPRPFPWHLVRAWEDYKARPLQSVL
                     SDEGLAQYGDTFRYLVGDPIDWKRILQENP"
     CDS             684414..685271
                     /codon_start=1
                     /locus_tag="ANT_06330"
                     /product="hypothetical protein"
                     /protein_id="BAJ62667.1"
                     /transl_table=11
                     /translation="MSGEPVRQQVRSFYDQIGWQKEADGLYQNARYEDLRPVSAEYIH
                     RCHLRVKRHLAPEGRYLLDAGSGPVQYPEYLTYSEGYQYRVCADLSIVALQEARRRLG
                     EHALCVVADVAHLPFAPEAFDGVVSLHTLHHLPLEEQPNAYNELFRVLKSGKKGVVVN
                     GWTDSPLMRRWAPLVALAERLGTWVARLRSRAVAAEKKTSVSQPTGTFVRKLDAAWLR
                     EHLQGKIPYEIYVWRSVSVRWLRALVHSITGGKVWLKLLYWLEERNPRWYGENGQYPL
                     IVISKERRS"
     CDS             685276..686283
                     /codon_start=1
                     /locus_tag="ANT_06340"
                     /product="UDP-N-acetylglucosamine dehydratase/epimerase"
                     /protein_id="BAJ62668.1"
                     /transl_table=11
                     /translation="MNWSEKVVLITGGTGSFGKKFVEIMLNEYHPAKLIIYSRDELKQ
                     HEMRQSGFDHPSLRYFLGDVRDKDRLRRAFEGVDIVVHAAALKQVPACEYNPMEAIKT
                     NILGSSNVVDAALDTGVEKVLALSTDKAVNPVNLYGATKLAAEKLIIQSNAYAGGKVT
                     RLACVRYGNVVGSRGSVVPVFLKQRENGKVTVTDERMTRFWLTLEQGVRFVIRSIEQM
                     RGGEVFVPKIPSMSIMDLARAVAPENDIEIIGIRPGEKLHEVLVSEDEARHTVELDDM
                     FVVMPAEAIWFGLDWHDKGNPLPDGFRYASNNNSQWLTIEQIREMIRPIEEAHRKGVL
                     E"
     CDS             686292..687227
                     /codon_start=1
                     /EC_number="1.1.1.133"
                     /gene="rmlD"
                     /locus_tag="ANT_06350"
                     /note="protein synonym:dTDP-4-keto-L-rhamnose reductase"
                     /note="protein synonym:dTDP-6-deoxy-L-mannose
                     dehydrogenase"
                     /note="protein synonym:dTDP-L-rhamnose synthetase"
                     /product="putative dTDP-4-dehydrorhamnose reductase"
                     /protein_id="BAJ62669.1"
                     /transl_table=11
                     /translation="MGERRKRLLVTGASGLLGISLCLDAVGDFEVIGVVNSRRLAGAP
                     FSQVQADFTQTGSAAKLIEEVRPDWVVHCAALADLDACEKNSALSARLNANLPGEVAE
                     ACYRSGARLVYISTDAVFDGERGGYREDDQPNPQSVYARDKWLGEQAVWQANPQAIVA
                     RVNFYGWSLLGQRSLAEKFYYTLAAGKGMMGFTDVYFCPLVNQHLGRILLEMLEKGLE
                     GLYHVFSAECQSKYAFGVALAKRFGLDAGLIRPVSVQEAGLAARRSPNLTMRVEKLEA
                     ALGHAMPGQEEELEAFHRLYLEGYPQRLRAMVAVA"
     CDS             687264..688331
                     /codon_start=1
                     /locus_tag="ANT_06360"
                     /product="putative N-acetylneuraminate synthase"
                     /protein_id="BAJ62670.1"
                     /transl_table=11
                     /translation="MDIQIGNRLVGLNHPTYFIADIAANHDGSLERAKQLIRLAKEAG
                     ADAAKFQNFRAPKIVSDYGFKALGGQKSHQATWRKSVFEVYQDASIPFEWTYELKAVC
                     DEVGIDYFSSPYDFEATDFLVPYMPAIKIGSGEITWHEALEHIARKGLPVILATGASD
                     IGEVAAAVRLILSINKQLVLMQCNTNYTASLENFNHVHLNVLKTYGLMFPDVVLGLSD
                     HTPGHAAVLGAVALGARVIEKHFTDDNNREGPDHKFAMNPDTWAQMVENTRQLERALG
                     SADKFVAENEQETVVLQRRCLRAARDLPAGTVITREHLDVLRPAPRDAIMPYDIPRVL
                     GKRLIVDKVAGQELRWTDLGE"
     CDS             688332..689474
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_06370"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62671.1"
                     /transl_table=11
                     /translation="MRVLYFTRAYTPHDHRFLSALAESGQEVFYLPLENDGKALEDRP
                     LPPQVERLHWQGGSGRFRWRDVPARVLELRRILRQVNPDVIHAGPVQTCAFVAALAGA
                     SPLVTMSWGSDLLKDAFSSGWMKWVTRFTLRASHVLVGDCLAVRDAAAGLGFPAEHVV
                     LFPWGVNLERFHPVRESSPLRERLGWQDAFVVLSLRSWEPIYGVETVVDAFAQAFEEE
                     PRLRLILLGQGSLAGRIQQRLHQRQLHEVVYLGGQVNQDDLPRFYQAADLYVSASHSD
                     GSSVSLMEALASGLPVLVSDIPGNREWVTPGEAGWLFPVEDAHALAQGILRAVREPET
                     LKDMRIRARRLAEERADWRKNFPKLLEAYRMALRRTGKLVEEKQPL"
     CDS             689471..690232
                     /codon_start=1
                     /locus_tag="ANT_06380"
                     /product="acylneuraminate cytidylyltransferase family
                     protein"
                     /protein_id="BAJ62672.1"
                     /transl_table=11
                     /translation="MTNTVILIQARMTSSRLPGKVLLDLGGQPALAWCVERCKQARSA
                     QRVVVATTTNASDDPVAALCHQRGWEVFRGSEFDVLDRFVQAARWAQADVVVRVTADC
                     PLIDPAEIDRVVEAFFATGADFAANRLPPPWKRTTPIGLDTEVCRMAALERAWREAAQ
                     KFEREHVMPYLYDEPGRFRVHIADWEQDLSHHRWTLDTPEDYQFLREVVKRLGNRMDV
                     RWQDVLALLEAEPQLMQINAGVRHKSGLEHDPRMK"
     CDS             690240..691148
                     /codon_start=1
                     /locus_tag="ANT_06390"
                     /product="hypothetical protein"
                     /protein_id="BAJ62673.1"
                     /transl_table=11
                     /translation="MSLITLFTAPKPFTDPHIALIQHNAIRSWLALGDEVEVILLGEE
                     EGLAEAAALYGVKHLPQVARTASGTPLVSSMFALAREHSTSPLLCCVNADILLTPDLL
                     TVGRAMLEKHSRFLVVGQRWDLDVHEPLEFTAGWAGRLRRRAQQEGKLHKATGSDYFL
                     FPRGCFSDMPAFAIGRAGWDNWMIYSGRAQHFPVVDATHDLFIVHQNHDYRHLPGGQP
                     HYKHPETLENIRLAGGRRAIFELPDVSHRLVKGKLVRPPLTWQRFWREVEIFPLVTLH
                     SYPLALAMYFLLHPRKAYREYREGRL"
     CDS             691152..692108
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ANT_06400"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ62674.1"
                     /transl_table=11
                     /translation="MRVGQNPAKFVKEVARPERITVAVLNYIPFLSGFYAEALDVLKV
                     CLESARTEAGLPFDLLVFDNASCEEVRQYLLDEHQAGRIQYLFLSEKNLGKGGAWNII
                     LSGAPGEIISYADSDVLFSPGWLKRSVEILETYPNVGMVTARPFRTREEYMTATLDWA
                     RRTSEVQVEQGQLIPWETFLEFDLSLGQSEEEIRQRYESTRDVRLTYQGVPAFVGASH
                     WQFTAWKSTLQNFLPFNMDRPMGQVKQLDERMNAAGFLRLMTAEPLAMNMSNTLRGVR
                     QTVTAPAPQPGRKKTSPLLEFPPVKKVLLSLYDSIFRWYYDR"
     CDS             692098..693543
                     /codon_start=1
                     /locus_tag="ANT_06410"
                     /product="hypothetical protein"
                     /protein_id="BAJ62675.1"
                     /transl_table=11
                     /translation="MTDKTIFISADHGLSIVYFLQTDVLPTLLESGARVVVLTDDGIR
                     DQIAAKFSQPNLIIEGLRFRQCREYFEKNDHSLQYWMHFLRWMGGSNRINTNAMDGHL
                     RQMAHEASPRGKRLMPLIRGLTYVLRRSRLARQALVNFQRRYTPNIYGDLFEKYQPSL
                     VVASTPGWRWDRYLLREAAARGIPTAAVIVGWDNPSSYRLPGAPVDWITCWSEIQKQE
                     LVLGSDWKPERVHVGGIPSYDGYFRGTWKMSREEYFRLHGLDPNRKLLSYACSFVTFS
                     PNFANIRALAELVHQDALAEPTQLLIRLHPNHFQPGSLYEQEANRVRELIRGMPHVHL
                     VEPVPLGGELGYYSGEDMPEKASMMAYSDVFLTVYSTMVVETAIHDRPIVSVCIDEPG
                     GWNTPGKFSLSLQEIGEWPTHLRFRAAGAGRVAYNAEQLKDILNLYLRAPETDSAQRR
                     KFIQDECTFTDGSAGWRTGTFLRSLLERGEA"
     CDS             693540..694511
                     /codon_start=1
                     /locus_tag="ANT_06420"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62676.1"
                     /transl_table=11
                     /translation="MKFLIAGFGSIGRRHLRNLRALGEEDILLLRSHRSTLPDDEIAG
                     LPVETDIHAALAHRPDAVIIANPTALHLQVAIPAAEQGCSILMEKPIADSTEDIPALR
                     RALEKGGGQLLVGFQFRFHPTLQQAAKLLSEGVIGRVVSVRSHWGEYLPNWHPWEDYR
                     QSYAARPDLGGGVILTLCHPFDYLRWLLGEYAIGWAGGGTLGDLELQVEDCAEIGLKF
                     RNGAVGTLHLDYLQQPPRHTLEVIGTAGTLQWDNADATLRVFRAGESDWQVFSAPEGF
                     ERNWMFLEEMRHFLAVARREVQPACTLEDGVRALQLALAAREALKAI"
     CDS             694539..695276
                     /codon_start=1
                     /locus_tag="ANT_06430"
                     /product="hypothetical protein"
                     /protein_id="BAJ62677.1"
                     /transl_table=11
                     /translation="MKRLQFHGWMGLLVLTMLVVSACTPPAPAATPTPVSTDTPQPSA
                     TATPTATLTLTPTVTATPTQTPTSTLTPTLAPSFEQAKVIELRYQTVGGYQITMVVPA
                     VNAPYNVILGGINFKCSFDEKYPDRLFCFGLAKPPMDQSITLAFLHPDTGKVIYQGKI
                     VLDSRALPTPVPSGYSQYDCPDRGKNVTCEIECRIAPDGVPCMVATCFDACGPYYSVH
                     TCPEDVSQWNMCNDELLREMKSRYNIP"
     CDS             695290..696018
                     /codon_start=1
                     /locus_tag="ANT_06440"
                     /product="hypothetical protein"
                     /protein_id="BAJ62678.1"
                     /transl_table=11
                     /translation="MKKGWMVVVFLVVFLQACQPQMVSSLQLPTNTSVVIPTDTAVPS
                     ATATQTPTMTQTPTMTPTVTQSPAATPMARFNELKLLLLENKLGGWTMQWVLPGVQIP
                     LKLLLDNREYTCTVDVKYPDRLFCQGLAQPALERPITLVFVNPENGKEIYRTEFIIPV
                     ALLKPPTPVGYAQTNCPDRGKNVSCETECRIAPDGTPCIVATCVDACGPYFSVHSCPD
                     DMPLPSHSCTAEQWVAMKKKYQIP"
     CDS             696029..696853
                     /codon_start=1
                     /locus_tag="ANT_06450"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62679.1"
                     /transl_table=11
                     /translation="MSDIFEKFSLKGRAAIVTGGAGLLGMEFCRTLGQAGASVLVADL
                     NAEAAYRTAESLRAEGLTALHAVVDVTQPESVQAMVEACVDEFGSLDVIVNSAAMDPK
                     FDASQAGKHTNAFEDYPLEMWKQALDVNLTGVFLCCQAAARQMVAQGGRGSIINICST
                     YGLVPPDQRIYEKPGQPKQFKPAFYTATKAGVLGLTKYIAAYYAGTQIRANCLTPGGV
                     YNNHDETFVRNYSYRTIMGRMAQRDEMNGALLFLASDASSYMTGGNIIVDGGWTVW"
     CDS             696847..698082
                     /codon_start=1
                     /EC_number="2.7.7.43"
                     /locus_tag="ANT_06460"
                     /note="protein synonym:CP-N-acetylneuraminic acid
                     synthetase"
                     /note="protein synonym:CP-NeuNAc synthetase"
                     /product="putative N-acylneuraminate cytidylyltransferase"
                     /protein_id="BAJ62680.1"
                     /transl_table=11
                     /translation="MVDAKPEVLAIIPARGGSKGIPRKNIKSFAGHPLIAYSIAAGVQ
                     AESVTRVIVSTDDEEIATVAREYGAEVPFLRPEELAQDQTLDLPVFQHALRWLEEHEG
                     YRPEVVVQLRPTSPVRPPHLVDEAVRILLEHPEADSVRGVVPAGQNPHKMWRIDPQSG
                     MMKNLLDVPGVDEPYNAPRQILPPVYWQTGHIDAIRPRVIHGGSMSGRIILPVMVDPA
                     YTVDIDTPKDWARSEWLVWYSDLEIVYPGRRRRPLPQRVDLVVLDFDGVMTDNRVWVN
                     EEGREMVAANRSDSLGLGYLRREGVKVVVLSTETNPVVAARCRKLNLPVYQGVADKAA
                     ALPGILQEMGVLPENTIYVGNDSNDIPCFPLVACALVVEDAQTAARRAADIILTRKGG
                     HGAVREVCDILLQRMGKFA"
     CDS             698105..698977
                     /codon_start=1
                     /locus_tag="ANT_06470"
                     /product="putative N-acetylneuraminate synthase"
                     /protein_id="BAJ62681.1"
                     /transl_table=11
                     /translation="MAREVKIGNRMVGDGHPTYIAAEIGINHNGDLDIAKRMILEAKR
                     AGVDSVKFQKRTPEICVPRDQWDIMRETPWGYISYIEYRRKMEFGLEEYKEIDRYCKE
                     VGIDWFASVWDEPSVDFLEQFDPIAYKVPSAALTDHGLLSKLRETGRPVILSTGMSTM
                     EQIRAAVSLLDMDKLVITHATSTYPCDPEELNLRVIEKLRAEFPCPIGYSGHEVGLIP
                     SVVAVALGACLVERHITLDRAMWGSDQAASVEPQGFERLVKYIRVTEVALGDGVKRVY
                     PSELSSLKKLRRFQ"
     CDS             698990..700600
                     /codon_start=1
                     /locus_tag="ANT_06480"
                     /product="capsule polysaccharide biosynthesis family
                     protein"
                     /protein_id="BAJ62682.1"
                     /transl_table=11
                     /translation="MKRLVKRIEHGLRRRWVHGQANLRLAALDEAVRRASPRADGTAP
                     VVLFNASTRLQGMSLNAGFQRVTAWALQMAGVPVVHFVCQGGMSRCVLGTKPDDPAAL
                     PPCAECIAQSRAMYAYSNARWFLPERDDALERSLSGLNLPELMSFEWQDLPLGALCLP
                     GLRWALRRHHLYDDDPTRFLYREYILSAYRVARAFRALLDEVQPQAVVVFNGMFYPEA
                     TARWVARQRGLRVISHEVGLRPFTAFFTTGDATAYPIDIPADFTLTPEQEQRLDAYLE
                     QRLQGNFTMAGVRFWPHMRGLEADMLEKIARFRQMVPVFTNVIFDTSQPHSNVLFSNM
                     FEWLDQILEVIRRHPETLFVIRAHPDESRPGKASRESVAQWVDSRGVKQLPNVHFVDS
                     HEYISSYELIQRGKFVALYNSTIGLEASLMGAPVLCAGRARFTQIPTVFFPASAEEYL
                     RQMEAFLETETIEVPPEFRQNARRFLYYQLYRVSLPFDEFLEEDGVWNGYVRVKDLPP
                     QAFDPHQSAVLQVIVNGILHDTPFVLEG"
     CDS             700603..701298
                     /codon_start=1
                     /locus_tag="ANT_06490"
                     /product="acylneuraminate cytidylyltransferase family
                     protein"
                     /protein_id="BAJ62683.1"
                     /transl_table=11
                     /translation="MTTALNRVVALVPMRHHSERVPGKNYRPLAGKPLYRHILDTLLA
                     VPEISEVVIDTDSPVILEGLARDYPQVRAIERPVHLRDGGIPMNEILMHDTSLVPADL
                     YLQTHSTNPLLRAETLSRAIQTLRGVYPAYDSLFGVTRLQVRLWDQLTRPINHNPAIL
                     LRTQDLPPVYMENSCVYLFTRQTLEQRRNRLGERPYMFEISQEEAWDIDEESTFQMVE
                     FLLLGRQAKNQQG"
     CDS             701306..702274
                     /codon_start=1
                     /EC_number="1.1.1.-"
                     /locus_tag="ANT_06500"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62684.1"
                     /transl_table=11
                     /translation="MPTVLLSAPYMIPVVDRFRPVFAHYGLEIIVPPVRERLEEAELL
                     EYAGQFDGAICGDDRFTARVIERCLPRLKVISKWGTGIDSIDHQAAQRLGVQVRNTPN
                     AFTLPVSDSVMGYILAFARQIPWMDRAVKSGVWAKLPGYSLSERTLGVVGVGNIGKAV
                     IRRARAFGMKILGNDIVPIAPDFILENGVEMTSLHDLLERSDFVSLNADLNPTSYHLI
                     NAETLAHMKPTAVLINTARGPLVDEPALIRALEEKRIAGAALDVFEIEPLPEDSPLRR
                     MENVLLAAHNSNSSPAAWERVHWNTIRNLLDGLGIPHEDLAQWMQS"
     CDS             702280..703929
                     /codon_start=1
                     /locus_tag="ANT_06510"
                     /product="hypothetical membrane protein"
                     /protein_id="BAJ62685.1"
                     /transl_table=11
                     /translation="MKKRLSESLFFLIVLAYLAYGVVFLLKMVVEIDGKPYFLLFDDA
                     TISMTYARNLAQGYGLVWNPGGERVEGFTNLLWVLYMALFHLFPIPENWMALPIQLTG
                     LALVIANLFVVRRIAERLAPGNLWVMVLGVGMTAFYYPLTNWSLIGTEVSVILLGVSV
                     SVWLALEILNDGRFRPELYLWMGLLTLVRPDAAVGFLTVWGFLLWFDSRNRRAHLLWG
                     TGMFLLFMGGQTLWRCWYYGEWVPNTYVLKMEGLPAWARIRRGLVAFYHFTLGMFFPL
                     VLFPLSLPFFRRDRKVLLLALVFLAHCAYSIYVGGDAWEHRGGANRFIAPGMPAFFLL
                     FALTAWHWMDGIRRWVQSRFSSLKVGVSALAGVGLAAFALASLLMMNRLVNNGWLLTN
                     LRNPEKGALRFFLLYERSIYVPGSLRYARDGLLIREVTTPEAKVAMVTAGNICYFAHR
                     TCIDLLGKADPYIARAPIQVPPDADWQILRPGHIKFDYEYSIGILQPDVVVELLESTY
                     DIGERYLTDYEKVKLNGHWMYFRKNSTAVNWERLYVLREDS"
     CDS             703907..704683
                     /codon_start=1
                     /locus_tag="ANT_06520"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ62686.1"
                     /transl_table=11
                     /translation="MSFEKTHEPRYMLITGAAGGIGRATVKVFAEAGWVVIGVDRRPF
                     GEDFPQNGLFIQADIADPEALRGIYDQAAAFTHTLDAVINNAAIQIAKPLLETTAEEW
                     DLVMASNLRSVFLGAKLGYPLLKAGGGGAIVNVSSVHAIATSANISSYAASKGGLLAL
                     TRAMAIEFAPDNIRVNAILPGAVDTPMLRMSMQRGSLTGSDVLDRLENLARKTVNGRV
                     AQPEEIARCIYFLADSTQSSFMTGQALVVDGGATARLSTE"
     CDS             704697..705500
                     /codon_start=1
                     /locus_tag="ANT_06530"
                     /product="hypothetical protein"
                     /protein_id="BAJ62687.1"
                     /transl_table=11
                     /translation="MLDSLKKAIPVPVRRAIGETLDAFDRARQMPAAMLHPWRRDTME
                     RLEALHNRHKGERCFIIGNGPSLRHTDMSKLRGEYTLGMNRIYLMFPELGFQTTYYLS
                     VNDLVIEQCAAEIQALKLPRFVSWRARRWLTPEPDLYFLWTTYTGPKFATDLRGRLWE
                     GATVTYTALQTAYYLGFSEVILIGVDHNFATQGKPNTTVVSQGDDPNHFSPAYFGKGF
                     RWQLPDLETSERAYRMAREAFERDGRRVLDATVGGKLTVFPKVGYETLF"
     CDS             705513..706448
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /