LOCUS       AP011959                8670 bp    DNA     circular BCT 11-OCT-2013
DEFINITION  Salmonella enterica subsp. enterica serovar Typhimurium str.
            T000240 plasmid pSTMDT12_S DNA, complete genome.
ACCESSION   AP011959
VERSION     AP011959.1
DBLINK      BioProject:PRJNA45951
            Sequence Read Archive:DRR000467
KEYWORDS    .
SOURCE      Salmonella enterica subsp. enterica serovar Typhimurium str.
            T000240
  ORGANISM  Salmonella enterica subsp. enterica serovar Typhimurium str.
            T000240
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Salmonella.
REFERENCE   1  (bases 1 to 8670)
  AUTHORS   Oguchi,A., Ichikawa,N., Nishiko,R., Katano,Y., Nakamura,S.,
            Kuroda,M., Sekizuka,T., Izumiya,M., Watanabe,H., Ohnishi,M.,
            Yamazaki,S. and Fujita,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Bioresource
            Information Center (NBIC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Izumiya,H., Sekizuka,T., Nakaya,H., Taguchi,M., Oguchi,A.,
            Ichikawa,N., Nishiko,R., Yamazaki,S., Fujita,N., Watanabe,H.,
            Ohnishi,M. and Kuroda,M.
  TITLE     Whole-Genome Analysis of Salmonella enterica Serovar Typhimurium
            T000240 Reveals the Acquisition of a Genomic Island Involved in
            Multidrug Resistance via IS1 Derivatives on the Chromosome
  JOURNAL   Antimicrob. Agents Chemother. 55, 623-630 (2011)
  REMARK    DOI:10.1128/AAC.01215-10
COMMENT     Genome Coverage; 88x
            Sequencing Technology; Illumina and Sanger. de novo assembly of
            short read 50 -mer reads using Euler-SR v1.0. Finished Genome.
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps
            and the genomic and proteomic data of the microorganisms
            analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..8670
                     /db_xref="taxon:718274"
                     /mol_type="genomic DNA"
                     /organism="Salmonella enterica subsp. enterica serovar
                     Typhimurium str. T000240"
                     /plasmid="pSTMDT12_S"
                     /serovar="Typhimurium"
                     /strain="T000240"
                     /sub_species="enterica"
     CDS             1..213
                     /codon_start=1
                     /locus_tag="STMDT12_S00010"
                     /product="hypothetical protein"
                     /protein_id="BAJ39806.1"
                     /transl_table=11
                     /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMA
                     SLNLDGCTLSLFREDKPFGPGKFLGD"
     CDS             206..421
                     /codon_start=1
                     /locus_tag="STMDT12_S00020"
                     /product="repressor protein F"
                     /protein_id="BAJ39807.1"
                     /transl_table=11
                     /translation="MTDMKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLT
                     DDEYEALRECLEELRAAQGGGSDPASA"
     CDS             451..1290
                     /codon_start=1
                     /locus_tag="STMDT12_S00030"
                     /note="COG3598 RecA-family ATPase"
                     /product="replication protein A"
                     /protein_id="BAJ39808.1"
                     /transl_table=11
                     /translation="MATHKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKS
                     MLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAV
                     ADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVI
                     GRMEAIAADTGCSIVFLHHASKGAAMMGAGDQQQASRGSSVLVDNIRWQSYLSSMTSA
                     EAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFRRHDGGVLKPAVLERQRKSKGVPR
                     GEA"
     CDS             1277..2230
                     /codon_start=1
                     /locus_tag="STMDT12_S00040"
                     /product="replication protein C"
                     /protein_id="BAJ39809.1"
                     /transl_table=11
                     /translation="MVKPKNKHSLSHVRHDPAHCLAPGLFRALKRGERKRSKLDVTYD
                     YGDGKRIEFSGPEPLGADDLRILQGLVAMAGPNGLVLGPEPKTEGGRQLRLFLEPKWE
                     AVTADAMVVKGSYRALAKEIGAEVDSGGALKHIQDCIERLWKVSIIAQNGRKRQGFRL
                     LSEYASDEADGRLYVALNPLIAQAVMGGGQHVRISMDEVRALDSETARLLHQRLCGWI
                     DPGKTGKASIDTLCGYVWPSEASGSTMRKRRQRVREALPELVALGWTVTEFAAGKYDI
                     TRPPPLYCKQDIFIFYIQWLIFLLIGNTMKNTMLRKGLTIF"
     CDS             2418..3233
                     /codon_start=1
                     /locus_tag="STMDT12_S00050"
                     /product="dihydropteroate synthase"
                     /protein_id="BAJ39810.1"
                     /transl_table=11
                     /translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADV
                     IDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAY
                     LNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAA
                     LTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRA
                     LTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR"
     CDS             3294..4097
                     /codon_start=1
                     /locus_tag="STMDT12_S00070"
                     /note="COG3231 Aminoglycoside phosphotransferase"
                     /product="hypothetical protein"
                     /protein_id="BAJ39811.1"
                     /transl_table=11
                     /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASR
                     RGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAW
                     PSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLL
                     ARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLA
                     LMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
     CDS             4097..4933
                     /codon_start=1
                     /locus_tag="STMDT12_S00080"
                     /note="COG3570 Streptomycin 6-kinase"
                     /product="streptomycin phosphotransferase"
                     /protein_id="BAJ39812.1"
                     /transl_table=11
                     /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLK
                     PIEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATE
                     IAAELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMM
                     SNASELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDP
                     RRIAQMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQT
                     SY"
     CDS             complement(4905..5444)
                     /codon_start=1
                     /locus_tag="STMDT12_S00090"
                     /product="transposase"
                     /protein_id="BAJ39813.1"
                     /transl_table=11
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFGVVCGKGRNPTLRLWPAIFSGEIDV
                     FPGDRRSRLISSMTSVAPA"
     CDS             complement(5998..6282)
                     /codon_start=1
                     /locus_tag="STMDT12_S00100"
                     /product="mobilization protein C"
                     /protein_id="BAJ39814.1"
                     /transl_table=11
                     /translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRR
                     KVLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
     CDS             6481..8610
                     /codon_start=1
                     /locus_tag="STMDT12_S00110"
                     /product="mobilization protein A"
                     /protein_id="BAJ39815.1"
                     /transl_table=11
                     /translation="MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAES
                     GHMPEFVERPADYWDAADLYERANGRLFKEVEFALPVELTLDQQKALASEFAQHLTGA
                     ERLPYTLAIHAGGGENPHCHLMISERINDGIERPAAQWFKRYNGKTPEKGGAQKTEAL
                     KPKAWLEQTREAWADHANRALERAGHDARIDHRTLEAQGIERLPGVHLGPNVVEMEGR
                     GIRTDRADVALNIDTANAQIIDLQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEH
                     GDTGRRSPAGHEPDPAGQRGAGGGVAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERP
                     ERVAGVALEAMANRDAGFHDAYGGAADRIVALARPDATDNRGRLDLAALGGPMKNDRT
                     LQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIR
                     PAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQ
                     IARTLASEYDADPASADSRHYGRLAGFTNRKDKHTTRAGYQPWVLLRESKGKTATAGP
                     ALVQQAGQQIEQAQRQQEKARRLASLELPERQLSRHRRTALDEYRSEMAGLVKRFGDD
                     LSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAERKPGHEADYIERTVSKVMGLPSV
                     QLARAELARAPAPRQRGMDRGGPDFSM"
BASE COUNT         1754 a         2623 c         2661 g         1632 t
ORIGIN      
        1 atggaatacg aaaaaagcgc ttcagggtcg gtctacctga tcaaaagtga caagggctat
       61 tggttgcccg gtggctttgg ttatacgtca aacaaggccg aggctggccg cttttcagtc
      121 gctgatatgg ccagccttaa ccttgacggc tgcaccttgt ccttgttccg cgaagacaag
      181 cctttcggcc ccggcaagtt tctcggtgac tgatatgaaa gaccaaaagg acaagcagac
      241 cggcgacctg ctggccagcc ctgacgctgt acgccaagcg cgatatgccg agcgcatgaa
      301 ggccaaaggg atgcgtcagc gcaagttctg gctgaccgac gacgaatacg aggcgctgcg
      361 cgagtgcctg gaagaactca gagcggcgca gggcgggggt agtgaccccg ccagcgccta
      421 accaccaact gcctgcaaag gaggcaatca atggctaccc ataagcctat caatattctg
      481 gaggcgttcg cagcagcgcc gccaccgctg gactacgttt tgcccaacat ggtggccggt
      541 acggtcgggg cgctggtgtc gcccggtggt gccggtaaat ccatgctggc cctgcaactg
      601 gccgcacaga ttgcaggcgg gccggatctg ctggaggtgg gcgaactgcc caccggcccg
      661 gtgatctacc tgcccgccga agacccgccc accgccattc atcaccgcct gcacgccctt
      721 ggggcgcacc tcagcgccga ggaacggcaa gccgtggctg acggcctgct gatccagccg
      781 ctgatcggca gcctgcccaa catcatggcc ccggagtggt tcgacggcct caagcgcgcc
      841 gccgagggcc gccgcctgat ggtgctggac acgctgcgcc ggttccacat cgaggaagaa
      901 aacgccagcg gccccatggc ccaggtcatc ggtcgcatgg aggccatcgc cgccgatacc
      961 gggtgctcta tcgtgttcct gcaccatgcc agcaagggcg cggccatgat gggcgcaggc
     1021 gaccagcagc aggccagccg gggcagctcg gtactggtcg ataacatccg ctggcagtcc
     1081 tacctgtcga gcatgaccag cgccgaggcc gaggaatggg gtgtggacga cgaccagcgc
     1141 cggttcttcg tccgcttcgg tgtgagcaag gccaactatg gcgcaccgtt cgctgatcgg
     1201 tggttcaggc ggcatgacgg cggggtgctc aagcccgccg tgctggagag gcagcgcaag
     1261 agcaaggggg tgccccgtgg tgaagcctaa gaacaagcac agcctcagcc acgtccggca
     1321 cgacccggcg cactgtctgg cccccggcct gttccgtgcc ctcaagcggg gcgagcgcaa
     1381 gcgcagcaag ctggacgtga cgtatgacta cggcgacggc aagcggatcg agttcagcgg
     1441 cccggagccg ctgggcgctg atgatctgcg catcctgcaa gggctggtgg ccatggctgg
     1501 gcctaatggc ctagtgcttg gcccggaacc caagaccgaa ggcggacggc agctccggct
     1561 gttcctggaa cccaagtggg aggccgtcac cgctgatgcc atggtggtca aaggtagcta
     1621 tcgggcgctg gcaaaggaaa tcggggcaga ggtcgatagt ggtggggcgc tcaagcacat
     1681 acaggactgc atcgagcgcc tttggaaggt atccatcatc gcccagaatg gccgcaagcg
     1741 gcaggggttt cggctgctgt cggagtacgc cagcgacgag gcggacgggc gcctgtacgt
     1801 ggccctgaac cccttgatcg cgcaggccgt catgggtggc ggccagcatg tgcgcatcag
     1861 catggacgag gtgcgggcgc tggacagcga aaccgcccgc ctgctgcacc agcggctgtg
     1921 tggctggatc gaccccggca aaaccggcaa ggcttccata gataccttgt gcggctatgt
     1981 ctggccgtca gaggccagtg gttcgaccat gcgcaagcgc cgccagcggg tgcgcgaggc
     2041 gttgccggag ctggtcgcgc tgggctggac ggtaaccgag ttcgcggcgg gcaagtacga
     2101 catcacccgg ccccccccac tctattgtaa acaagacatt tttatctttt atattcaatg
     2161 gcttattttc ctgctaattg gtaataccat gaaaaatacc atgctcagaa aaggcttaac
     2221 aatattttga aaaattgcct actgagcgct gccgcacagc tccataggcc gctttcctgg
     2281 ctttgcttcc agatgtatgc tcttctgctc ctgcagctaa tggatcaccg caaacaggtt
     2341 actcgcctgg ggattccctt tcgacccgag catccgtatg atactcatgc tcgattatta
     2401 ttattataga agcccccatg aataaatcgc tcatcatttt cggcatcgtc aacataacct
     2461 cggacagttt ctccgatgga ggccggtatc tggcgccaga cgcagccatt gcgcaggcgc
     2521 gtaagctgat ggccgagggg gcagatgtga tcgacctcgg tccggcatcc agcaatcccg
     2581 acgccgcgcc tgtttcgtcc gacacagaaa tcgcgcgtat cgcgccggtg ctggacgcgc
     2641 tcaaggcaga tggcattccc gtctcgctcg acagttatca acccgcgacg caagcctatg
     2701 ccttgtcgcg tggtgtggcc tatctcaatg atattcgcgg ttttccagac gctgcgttct
     2761 atccgcaatt ggcgaaatca tctgccaaac tcgtcgttat gcattcggtg caagacgggc
     2821 aggcagatcg gcgcgaggca cccgctggcg acatcatgga tcacattgcg gcgttctttg
     2881 acgcgcgcat cgcggcgctg acgggtgccg gtatcaaacg caaccgcctt gtccttgatc
     2941 ccggcatggg gttttttctg ggggctgctc ccgaaacctc gctctcggtg ctggcgcggt
     3001 tcgatgaatt gcggctgcgc ttcgatttgc cggtgcttct gtctgtttcg cgcaaatcct
     3061 ttctgcgcgc gctcacaggc cgtggtccgg gggatgtcgg ggccgcgaca ctcgctgcag
     3121 agcttgccgc cgccgcaggt ggagctgact tcatccgcac acacgagccg cgccccttgc
     3181 gcgacgggct ggcggtattg gcggcgctga aagaaaccgc aagaattcgt taactgcaca
     3241 ttcgggatat ttctctatat tcgcgcttca tcagaaaact gaaggaacct ccattgaatc
     3301 gaactaatat tttttttggt gaatcgcatt ctgactggtt gcctgtcaga ggcggagaat
     3361 ctggtgattt tgtttttcga cgtggtgacg ggcatgcctt cgcgaaaatc gcacctgctt
     3421 cccgccgcgg tgagctcgct ggagagcgtg accgcctcat ttggctcaaa ggtcgaggtg
     3481 tggcttgccc cgaggtcatc aactggcagg aggaacagga gggtgcatgc ttggtgataa
     3541 cggcaattcc gggagtaccg gcggctgatc tgtctggagc ggatttgctc aaagcgtggc
     3601 cgtcaatggg gcagcaactt ggcgctgttc acagcctatc ggttgatcaa tgtccgtttg
     3661 agcgcaggct gtcgcgaatg ttcggacgcg ccgttgatgt ggtgtcccgc aatgccgtca
     3721 atcccgactt cttaccggac gaggacaaga gtacgccgca gctcgatctt ttggctcgtg
     3781 tcgaacgaga gctaccggtg cggctcgacc aagagcgcac cgatatggtt gtttgccatg
     3841 gtgatccctg catgccgaac ttcatggtgg accctaaaac tcttcaatgc acgggtctga
     3901 tcgaccttgg gcggctcgga acagcagatc gctatgccga tttggcactc atgattgcta
     3961 acgccgaaga gaactgggca gcgccagatg aagcagagcg cgccttcgct gtcctattca
     4021 atgtattggg gatcgaagcc cccgaccgcg aacgccttgc cttctatctg cgattggacc
     4081 ctctgacttg gggttgatgt tcatgccgcc tgtttttcct gctcattggc acgtttcgca
     4141 acctgttctc attgcggaca ccttttccag cctcgtttgg aaagtttcat tgccagacgg
     4201 gactcctgca atcgtcaagg gattgaaacc tatagaagac attgctgatg aactgcgcgg
     4261 ggccgactat ctggtatggc gcaatgggag gggagcagtc cggttgctcg gtcgtgagaa
     4321 caatctgatg ttgctcgaat atgccgggga gcgaatgctc tctcacatcg ttgccgagca
     4381 cggcgactac caggcgaccg aaattgcagc ggaactaatg gcgaagctgt atgccgcatc
     4441 tgaggaaccc ctgccttctg cccttctccc gatccgggat cgctttgcag ctttgtttca
     4501 gcgggcgcgc gatgatcaaa acgcaggttg tcaaactgac tacgtccacg cggcgattat
     4561 agccgatcaa atgatgagca atgcctcgga actgcgtggg ctacatggcg atctgcatca
     4621 tgaaaacatc atgttctcca gtcgcggctg gctggtgata gatcccgtcg gtctggtcgg
     4681 tgaagtgggc tttggcgccg ccaatatgtt ctacgatccg gctgacagag acgacctttg
     4741 tctcgatcct agacgcattg cacagatggc ggacgcattc tctcgtgcgc tggacgtcga
     4801 tccgcgtcgc ctgctcgacc aggcgtacgc ttatgggtgc ctttccgcag cttggaacgc
     4861 ggatggagaa gaggagcaac gcgatctagc tatcgcggcc gcgatcaagc aggtgcgaca
     4921 gacgtcatac tagatatcaa gcgacttctc ctatcccctg ggaacacatc aatctcaccg
     4981 gagaatatcg ctggccaaag ccttagcgta ggattccgcc ccttcccgca aacgacccca
     5041 aacaggaaac gcagctgaaa cgggaagctc aacacccact gacgcatggg ttgttcaggc
     5101 agtacttcat caaccagcaa ggcggcactt tcggccatcc gccgcgcccc acagctcggg
     5161 cagaaaccgc gacgcttaca gctgaaagcg accaggtgct cggcgtggca agactcgcag
     5221 cgaacccgta gaaagccatg ctccagccgc ccgcattgga gaaattcttc aaattcccgt
     5281 tgcacatagc ccggcaattc ctttccctgc tctgccataa gcgcagcgaa tgccgggtaa
     5341 tactcgtcaa cgatctgata gagaagggtt tgctcgggtc ggtggctctg gtaacgacca
     5401 gtatcccgat cccggctggc cgtcctggcc gccacatgag gcatgttccg cgtccttgca
     5461 atactgtgtt tacatacagt ctatcgctta gcggaaagtt cttttaccct cagccgaaat
     5521 gcctgccgtt gctagacatt gccagccagt gcccgtcact cccgtactaa ctgtcacgaa
     5581 cccctgcaat aactgtcacg cccccctgca ataactgtca cgaacccctg caataactgt
     5641 cacgccccca aacctgcaaa cccagcaggg gcgggggctg gcggggtgtt ggaaaaatcc
     5701 atccatgatt atctaagaat aatccactag gcgcggttat cagcgccctt gtggggcgct
     5761 gctgcccttg cccaatatgc ccggccagag gccggatagc tggtctattc gctgcgctag
     5821 gctacacacc gccccaccgc tgcgcggcag ggggaaaggc gggcaaagcc cgctaaaccc
     5881 cacaccaaac cccgcagaaa tacgctggag cgcttttagc cgctttagcg gcctttcccc
     5941 ctacccgaag ggtgggggcg cgtgtgcagc cccgcagggc ctgtctcggt cgatcattca
     6001 gcccggctca tccttctggc gtggcggcag accgaacaag gcgcggtcgt ggtcgcgttc
     6061 aaggtacgca tccattgccg ccatgagccg atcctccggc cactcgctgc tgttcacctt
     6121 ggccaaaatc atggccccca ccagcacctt gcgccttgtt tcgttcttgc gctcttgctg
     6181 ctgttccctt gcccgcaccc gctgaatttc ggcattgatt cgcgctcgtt gttcttcgag
     6241 cttggccagc cgatccgccg ccttgttgct ccccttaacc atcttgacac cccattgtta
     6301 atgtgctgtc tcgtaggcta tcatggaggc acagcggcgg caatcccgac cctactttgt
     6361 aggggagggc gcacttaccg gtttctcttc gagaaactgg cctaacggcc acccttcggg
     6421 cggtgcgctc tccgagggcc attgcatgga gccgaaaagc aaaagcaaca gcgaggcagc
     6481 atggcgattt atcaccttac ggcgaaaacc ggcagcaggt cgggcggcca atcggccagg
     6541 gccaaggccg actacatcca gcgcgaaggc aagtatgccc gcgacatgga tgaagtcttg
     6601 cacgccgaat ccgggcacat gccggagttc gtcgagcggc ccgccgacta ctgggatgct
     6661 gccgacctgt atgaacgcgc caatgggcgg ctgttcaagg aggtcgaatt tgccctgccg
     6721 gtcgagctga ccctcgacca gcagaaggcg ctggcgtccg agttcgccca gcacctgacc
     6781 ggtgccgagc gcctgccgta tacgctggcc atccatgccg gtggcggcga gaacccgcac
     6841 tgccacctga tgatctccga gcggatcaat gacggcatcg agcggcccgc cgctcagtgg
     6901 ttcaagcggt acaacggcaa gaccccggag aagggcgggg cacagaagac cgaagcgctc
     6961 aagcccaagg catggcttga gcagacccgc gaggcatggg ccgaccatgc caaccgggca
     7021 ttagagcggg ctggccacga cgcccgcatt gaccacagaa cacttgaggc gcagggcatc
     7081 gagcgcctgc ccggtgttca cctggggccg aacgtggtgg agatggaagg ccggggcatc
     7141 cgcaccgacc gggcagacgt ggccctgaac atcgacaccg ccaacgccca gatcatcgac
     7201 ttacaggaat accgggaggc aatagaccat gaacgcaatc gacagagtga agaaatccag
     7261 aggcatcaac gagttagcgg agcagatcga accgctggcc cagagcatgg cgacactggc
     7321 cgacgaagcc cggcaggtca tgagccagac ccagcaggcc agcgaggcgc aggcggcgga
     7381 gtggctgaaa gcccagcgcc agacaggggc ggcatgggtg gagctggcca aagagttgcg
     7441 ggaggtagcc gccgaggtga gcagcgccgc gcagagcgcc cggagcgcgt cgcgggggtg
     7501 gcactggaag ctatggctaa ccgtgatgct ggcttccatg atgcctacgg tggtgctgct
     7561 gatcgcatcg ttgctcttgc tcgacctgac gccactgaca accgaggacg gctcgatctg
     7621 gctgcgcttg gtggcccgat gaagaacgac aggactttgc aggccatagg ccgacagctc
     7681 aaggccatgg gctgtgagcg cttcgatatc ggcgtcaggg acgccaccac cggccagatg
     7741 atgaaccggg aatggtcagc cgccgaagtg ctccagaaca cgccatggct caagcggatg
     7801 aatgcccagg gcaatgacgt gtatatcagg cccgccgagc aggagcggca tggtctggtg
     7861 ctggtggacg acctcagcga gtttgacctg gatgacatga aagccgaggg ccgggagcct
     7921 gccctggtag tggaaaccag cccgaagaac tatcaggcat gggtcaaggt ggccgacgcc
     7981 gcaggcggtg aacttcgggg gcagattgcc cggacgctgg ccagcgagta cgacgccgac
     8041 ccggccagcg ccgacagccg ccactatggc cgcttggcgg gcttcaccaa ccgcaaggac
     8101 aagcacacca cccgcgccgg ttatcagccg tgggtgctgc tgcgtgaatc caagggcaag
     8161 accgccaccg ctggcccggc gctggtgcag caggctggcc agcagatcga gcaggcccag
     8221 cggcagcagg agaaggcccg caggctggcc agcctcgaac tgcccgagcg gcagcttagc
     8281 cgccaccggc gcacggcgct ggacgagtac cgcagcgaga tggccgggct ggtcaagcgc
     8341 ttcggtgatg acctcagcaa gtgcgacttt atcgccgcgc agaagctggc cagccggggc
     8401 cgcagtgccg aggaaatcgg caaggccatg gccgaggcca gcccagcgct ggcagagcgc
     8461 aagcccggcc acgaagcgga ttacatcgag cgcaccgtca gcaaggtcat gggtctgccc
     8521 agcgtccagc ttgcgcgggc cgagctggca cgggcaccgg caccccgcca gcgaggcatg
     8581 gacaggggcg ggccagattt cagcatgtag tgcttgcgtt ggtactcacg cctgttatac
     8641 tatgagtact cacgcacaga agggggtttt
//