LOCUS       AP011958              106510 bp    DNA     circular BCT 11-OCT-2013
DEFINITION  Salmonella enterica subsp. enterica serovar Typhimurium str.
            T000240 plasmid pSTMDT12_L DNA, complete genome.
ACCESSION   AP011958
VERSION     AP011958.1
DBLINK      BioProject:PRJNA45951
            Sequence Read Archive:DRR000467
KEYWORDS    .
SOURCE      Salmonella enterica subsp. enterica serovar Typhimurium str.
            T000240
  ORGANISM  Salmonella enterica subsp. enterica serovar Typhimurium str.
            T000240
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Salmonella.
REFERENCE   1  (bases 1 to 106510)
  AUTHORS   Oguchi,A., Ichikawa,N., Nishiko,R., Katano,Y., Nakamura,S.,
            Kuroda,M., Sekizuka,T., Izumiya,M., Watanabe,H., Ohnishi,M.,
            Yamazaki,S. and Fujita,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Bioresource
            Information Center (NBIC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Izumiya,H., Sekizuka,T., Nakaya,H., Taguchi,M., Oguchi,A.,
            Ichikawa,N., Nishiko,R., Yamazaki,S., Fujita,N., Watanabe,H.,
            Ohnishi,M. and Kuroda,M.
  TITLE     Whole-Genome Analysis of Salmonella enterica Serovar Typhimurium
            T000240 Reveals the Acquisition of a Genomic Island Involved in
            Multidrug Resistance via IS1 Derivatives on the Chromosome
  JOURNAL   Antimicrob. Agents Chemother. 55, 623-630 (2011)
  REMARK    DOI:10.1128/AAC.01215-10
COMMENT     Genome Coverage; 88x
            Sequencing Technology; Illumina and Sanger. de novo assembly of
            short read 50 -mer reads using Euler-SR v1.0. Finished Genome.
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps
            and the genomic and proteomic data of the microorganisms
            analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..106510
                     /db_xref="taxon:718274"
                     /mol_type="genomic DNA"
                     /organism="Salmonella enterica subsp. enterica serovar
                     Typhimurium str. T000240"
                     /plasmid="pSTMDT12_L"
                     /serovar="Typhimurium"
                     /strain="T000240"
                     /sub_species="enterica"
     CDS             94..378
                     /codon_start=1
                     /inference="similar to AA sequence:UniProtKB:B5FH76"
                     /locus_tag="STMDT12_L00010"
                     /note="putative frameshift mutation"
                     /product="dsba oxidoreductase"
                     /protein_id="BAJ39667.1"
                     /transl_table=11
                     /translation="MFKYWPTFVQQWENSLKAAQKGLEIWKSARADAWLAYHNGIFAT
                     SHYEGALTSEDISSAAAAALKGHKIRGGNVNTKSILDGSNRLAHTLALQG"
     CDS             391..546
                     /codon_start=1
                     /inference="similar to AA sequence:UniProtKB:B5FH76"
                     /locus_tag="STMDT12_L00020"
                     /note="putative frameshift mutation"
                     /product="dsba oxidoreductase"
                     /protein_id="BAJ39668.1"
                     /transl_table=11
                     /translation="MMPVKEATEKNVTMIPGGAGQETLENAAVLILAGMERNDRATTR
                     EGNNNLS"
     CDS             712..972
                     /codon_start=1
                     /inference="similar to AA sequence:UniProtKB:Q93GS9"
                     /locus_tag="STMDT12_L00030"
                     /note="putative frameshift mutation"
                     /product="putative phospholipase D"
                     /protein_id="BAJ39669.1"
                     /transl_table=11
                     /translation="MFIPAGLPASYCGTVRSGRFFTGGQRKQLVLKTIEAAQHNIRLM
                     EYSFTSPEVAGALISAKRRGVDVRGGDWTGKPIPGKTITPAG"
     CDS             975..1154
                     /codon_start=1
                     /inference="similar to AA sequence:UniProtKB:Q93GS9"
                     /locus_tag="STMDT12_L00040"
                     /note="COG1502 Phosphatidylserine/
                     phosphatidylglycerophosphate/cardiolipin synthases and
                     related enzymes"
                     /note="putative frameshift mutation"
                     /product="putative phospholipase D"
                     /protein_id="BAJ39670.1"
                     /transl_table=11
                     /translation="MNLLTSAGIPVRTVSVYKILHDKVIVSDGRHTEVGSFNYSRAAD
                     RSNSENVLSSGMTQS"
     CDS             1354..1599
                     /codon_start=1
                     /locus_tag="STMDT12_L00050"
                     /product="replication protein"
                     /protein_id="BAJ39671.1"
                     /transl_table=11
                     /translation="MSQIENAVTSSSKRIYRKGNPLSSAEKKRLSISRKKTTHKELNV
                     FIQNIHKESLQQLCEETGTTQAQMIELLIEREMAKRA"
     CDS             1919..2788
                     /codon_start=1
                     /locus_tag="STMDT12_L00060"
                     /product="replication protein"
                     /protein_id="BAJ39672.1"
                     /transl_table=11
                     /translation="MTDTRTLFTHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGFT
                     SRFDFSVHVAFVRSLGKRHRMPPLLRRRAIDALLQGLCFHYDPLANRVQRSITNLAIE
                     CGLATESKSGNLSITRATRALKFMAELGLITYQTEYDPQIGCNIPTDITFTPALFSAL
                     DVSDVAVMAARRSRVEWENQQRKKQNLEPLEMDELIAKAWRFVRERFRSYQSERKLHG
                     LKRARARRDADRSRKDIETLVKQQLTREYASGRFTGGLDAMKRELQRRVKERMMMSRG
                     KNYTRLTMATVPI"
     CDS             3729..3869
                     /codon_start=1
                     /locus_tag="STMDT12_L00070"
                     /note="COG3204 Uncharacterized protein conserved in
                     bacteria"
                     /product="putative outer membrane protein"
                     /protein_id="BAJ39673.1"
                     /transl_table=11
                     /translation="MSLHRGLCGLRSDIPQAEGITSDDRDTLWIVSEPNLFYRFTRTA
                     AS"
     CDS             complement(3966..4724)
                     /codon_start=1
                     /locus_tag="STMDT12_L00080"
                     /note="COG2207 AraC-type DNA-binding domain-containing
                     proteins"
                     /product="putative AraC family transcriptional regulator"
                     /protein_id="BAJ39674.1"
                     /transl_table=11
                     /translation="MELDKYLLFFLAGGSTFNQGKAFSFRCAQDSIVLTKVHQTEMHF
                     YRWYHHVVITRETLCRFARQLDVDVLKFYIPKDIPRYLVQPCPEDSVFRPLMVRLCAG
                     TDNSYGETGPENPFLTFALVSAFCEQDIFFPFLKTCLKQSMADQVATVINRNVSENWT
                     IHRVAGELYVSVSLLKKKLKEENTSYTRILLECRMKKASELIVMQEGAVKKVAYQCGY
                     SSVPYFISQFRKYYGYTPSRCKPDGNLFYSFIAK"
     CDS             complement(4991..5548)
                     /codon_start=1
                     /locus_tag="STMDT12_L00090"
                     /note="COG3637 Opacity protein and related surface
                     antigens"
                     /product="resistance to complement killing"
                     /protein_id="BAJ39675.1"
                     /transl_table=11
                     /translation="MKKIVLSSLLLSAAGLAAVPVAQADTHSVSVGYAQSRIEHFKDI
                     RGVNLKYRYEAQTPLGLMASFSWQSGKRGESGGIPGGMSWRDDVKATYWSLMAGPAVR
                     VNELVSLYALAGAGTGRAEVKERISMPGYNGRFTGSERRTGFAWGAGVQFNPVENVVI
                     DLGYEGSKVGAAKLNGVNVGVGYRF"
     CDS             complement(5638..6483)
                     /codon_start=1
                     /locus_tag="STMDT12_L00100"
                     /note="COG3204 Uncharacterized protein conserved in
                     bacteria"
                     /product="putative outer membrane protein"
                     /protein_id="BAJ39676.1"
                     /transl_table=11
                     /translation="MFRYLCNQKAALLTAILLMAAGVLTLCFPESWYPQETEWHLTAE
                     KEITGIHGGLSGLTWNPDSRTLFAVTDHPSSVVELDTEGNVLRVIPSDGDHDFEAIEY
                     LGGNRYALSRERERTLTTHCIDSSTTVLPPATYSLTLDVNRHSDNAGFEGLARGRGEH
                     ALMVAQEKKPLRLYVTDRSPDALSVSDSLTHRASLPWFLKDISGLHYDRNNGLLYVLS
                     HESAVVVVSGLDGGRKVMSLHRGLCGLRSDIPQAEGITSDDRDTLWIVSEPNLFYRFT
                     RTAAS"
     CDS             complement(6534..6680)
                     /codon_start=1
                     /locus_tag="STMDT12_L00110"
                     /product="hypothetical protein"
                     /protein_id="BAJ39677.1"
                     /transl_table=11
                     /translation="MQTDDKGTIQAGDILPLRALILLLLTSVFISGFLTGVLVVIWLI
                     SRGT"
     CDS             complement(6670..7323)
                     /codon_start=1
                     /locus_tag="STMDT12_L00120"
                     /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
                     /product="putative thiol-disulfide isomerase/thioredoxin"
                     /protein_id="BAJ39678.1"
                     /transl_table=11
                     /translation="MTMNYARDLFSLKGILFSFLLAGCVCPVVAQEWESITPPVVDAP
                     AVVEFFSFYCPPCYAFSQTMGVDQAIRHVLPQGSRMVKYHVSLLGPLGHELTRAWALA
                     MVMKETDVIEKAFFTAGMVEKRLHSPDDVRRVFMSATGISRGEYDRSIKSPAVNDMVA
                     LQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVENFRSRYAAVVRKLLAGNPDAD"
     CDS             complement(7568..7918)
                     /codon_start=1
                     /locus_tag="STMDT12_L00130"
                     /note="COG2771 DNA-binding HTH domain-containing proteins"
                     /product="putative LuxR-family transcriptional regulator"
                     /protein_id="BAJ39679.1"
                     /transl_table=11
                     /translation="MASALTAFPEDGDFSRIWYDRLCIEFNSDGGLSPAELRVIRLLL
                     RGYNSGQIAALCFRSVKTISAQKGQAFRRLGVRNDATLLPTLMLLGMVTLYTDLNRVH
                     SLEEAGLECGPEAG"
     CDS             complement(7903..8115)
                     /codon_start=1
                     /locus_tag="STMDT12_L00140"
                     /product="plasmid-encoded fimbriae"
                     /protein_id="BAJ39680.1"
                     /transl_table=11
                     /translation="MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLY
                     LEQLHDVGVLEKVNAGKGVPGLWRLL"
     CDS             complement(9675..10205)
                     /codon_start=1
                     /locus_tag="STMDT12_L00150"
                     /product="putative outer membrane protein"
                     /protein_id="BAJ39681.1"
                     /transl_table=11
                     /translation="MKRHVCAGALVTGLLFPLATEAASKENITIPFTLTNPQQTCKLT
                     FDNGGNTMNYQLGVMNKGVRMQHRPFTVKVDCGQSTVVKTALTARNTTGTLQGGGDSS
                     VVIMRMNGQPSNNGPLFWLENGSKRVKLTGKDDDAFCISPSPNNCELRPVTDIPANSP
                     EGNIDVTVVFDVVYPQ"
     CDS             complement(10247..10939)
                     /codon_start=1
                     /locus_tag="STMDT12_L00160"
                     /note="COG3121 P pilus assembly protein, chaperone PapD"
                     /product="chaperone protein"
                     /protein_id="BAJ39682.1"
                     /transl_table=11
                     /translation="MNKMMKWGLVSLLSLAVSGQAMAAFVLNGTRFIYEEGRKNTSFE
                     VTNQADETFGGQVWIDNTTQGSSTVYMVPAPPFFKVRPKEKQIIRIMKTDSTLPSDRE
                     SLFWLNVQEIPPKPKASEGNVLAVAVNTKVKLIYRPKALVEGRRNAEKNLQIAHRGGE
                     AYLKNPTPYYFAVTGVKLNGQPVRLNDRVMNEIAQLAPKSEVALGKLSLNGTVTVQAV
                     NDWGGTQDYTLK"
     CDS             complement(10932..13340)
                     /codon_start=1
                     /locus_tag="STMDT12_L00170"
                     /note="COG3188 P pilus assembly protein, porin PapC"
                     /product="plasmid-encoded fimbrial usher protein"
                     /protein_id="BAJ39683.1"
                     /transl_table=11
                     /translation="MSFHHRVFKLSALSLALFSHLSFASTDSELNLDFLQGMSAIPSV
                     LKSGSDFPAGQYYVDVIVNQENVGKARLSITPQEESANALCLSPEWLKAAGVPVRLEG
                     YASTLNAAGQCYVLSRNPYTRVDFSYGSQSLVFSIPQSFLVGKTDPSRWDYGVPAARL
                     KYSANASQTSGQSTSAYANADLMVNLGRWVLASNMSASRYADGSGEFTARDITLSTAI
                     SQVQGDLLLGKSQTRSALFSDFGFYGAALRSNSNMLPWEARGYAPLITGVANSTSRVT
                     ISQNGYAVYSKVVPPGPYQLDDVRSVGNGDLVVTVEDASGHKTTTVYPVTTLPTLLRP
                     GEVEYNVAVGRKSSNYKLKKPFADGENGMFWMGSVGYGFDSTTLNAASILHGKYQAGG
                     VSVTQALGGFGAVSAGMNLSQAKYDNGDNKRGHSVSAKYAKSFSDSSDLQLLAYRYQS
                     KGYVEFADFYSTDRYTRYNTKSRYEMRFSQRLGNSNLNLAGWQEDYWWMKGKAIGGDV
                     SLSTTILDGVSVFLNGSYSKRPYLDKPDYSTSLSFSIPFTLGGVRHYSSTGLSYSSSG
                     RMGMNSGVSASPTDRLSYGLNTNLSDKGDRSLSGNLSYGFDAIQTNMMLSQGRDNTTV
                     SGSVSGTILGTADSGLMMTKETGNTLGVARIPGVKGVRINGSAPTNSKGYTVVNLSDY
                     SLNRVSVDMENVPDDLELQTTSFNVVPTEKAVVYREFGAEHVLRYILRVKERDGRILN
                     GGSAQTEQGLDAGFIAGNGVLLMNMLSAPSRVSVERGDGSVCHFSVKGIVPNTGKVQE
                     VYCE"
     CDS             13424..13540
                     /codon_start=1
                     /locus_tag="STMDT12_L00180"
                     /product="hypothetical protein"
                     /protein_id="BAJ39684.1"
                     /transl_table=11
                     /translation="MQDGGMNIQVLSRPAISDIKITNKVIKCGARRCAASFK"
     CDS             complement(13568..14086)
                     /codon_start=1
                     /locus_tag="STMDT12_L00190"
                     /product="plasmid-encoded major fimbrial subunit"
                     /protein_id="BAJ39685.1"
                     /transl_table=11
                     /translation="MKKSIIASIIALGVLGGTAHAANEVTFLGSVSATTCDLTTSVNG
                     AAQPNQVVQLGTVQANQPGNFVDFAMKPVDPNAQGCANLAQKTATVSWASAALDGEGF
                     GATSGTATDAKVLVESVNSKNPGAVNANASTVDFEGAKLTTDGLQFKAKLKGGATEGD
                     FKSVASFAVAYK"
     CDS             complement(14361..14663)
                     /codon_start=1
                     /locus_tag="STMDT12_L00200"
                     /product="fimbrial regulator"
                     /protein_id="BAJ39686.1"
                     /transl_table=11
                     /translation="MMLNRKDADYYLGKEIMLARIRRGALIPAKVNEEHFWLLIGISS
                     IHSEKIIQALRDYLVFGVSRKDVCERYEVNNGYFSTSLNRLSRISQAAAQMVVYYS"
     CDS             15554..15763
                     /codon_start=1
                     /locus_tag="STMDT12_L00210"
                     /note="COG3111 Uncharacterized conserved protein"
                     /product="YgiW"
                     /protein_id="BAJ39687.1"
                     /transl_table=11
                     /translation="MVLEGNIIRQVGHELYEFRDSSGTVYVDIDNKYWMGQTASPADK
                     IHIKGEVDRGWDGIKIDVKNIQVMK"
     CDS             16266..16376
                     /codon_start=1
                     /locus_tag="STMDT12_L00220"
                     /product="resolvase"
                     /protein_id="BAJ39688.1"
                     /transl_table=11
                     /translation="MDVYIRVLALDMAATLAVPFTGDRHDAAQILRTLPP"
     CDS             complement(16635..17624)
                     /codon_start=1
                     /locus_tag="STMDT12_L00230"
                     /product="DNA replication protein"
                     /protein_id="BAJ39689.1"
                     /transl_table=11
                     /translation="MFVEVDKSSGEIVNLTPNASNTVQPVALMRLGVFVPTLKSLKNR
                     KKNTLSRTDASEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGVIHSFARHKVIG
                     DKVELSFVEFAKLCGIPSSQSSRKLRERISPSLKRIAGTVISFSRTTEKHTKEYITHL
                     VQSAYYDTEKDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLP
                     RDPAPISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHY
                     RRPKLKPPHDESAENPQLPATPGDVSPEMAEKLALLDKLGITLDDLEKLFKSR"
     CDS             complement(18118..18414)
                     /codon_start=1
                     /locus_tag="STMDT12_L00240"
                     /product="putative cytoplasmic protein"
                     /protein_id="BAJ39690.1"
                     /transl_table=11
                     /translation="MDAEFQKQGLTDLTETDLQAVVTPGETLRLLPTLARLLHVLREK
                     PEAFSLSAASYEEDTSSALKTLLVRTGFTIHQIREMRLHLIRWQLISQEEYDRE"
     CDS             18534..18647
                     /codon_start=1
                     /locus_tag="STMDT12_L00250"
                     /product="Orf20"
                     /protein_id="BAJ39691.1"
                     /transl_table=11
                     /translation="MNMTNMPAEPLIFQSGTQSAGLERVNIYFWIFRQFME"
     CDS             complement(18898..19386)
                     /codon_start=1
                     /locus_tag="STMDT12_L00260"
                     /product="exported protein"
                     /protein_id="BAJ39692.1"
                     /transl_table=11
                     /translation="MNTALLAPFISIALSGVGVYTHYYFKKYQASMDQCQKVHKMMVD
                     TLLGTKRLFSRSAPAQALKSELRIMQQQLSQEAQKLDKMTIRLPLKRLQREQRHILRH
                     ADWLLHYLDSHLADNEGKFFLFLHDLAMDSDDKVLDFLTSLHDTKRFRNRRLQTGSTT
                     CP"
     CDS             20095..20313
                     /codon_start=1
                     /locus_tag="STMDT12_L00270"
                     /note="COG5302 Post-segregation antitoxin (ccd killing
                     mechanism protein) encoded by the F plasmid"
                     /product="plasmid maintenance protein CcdA"
                     /protein_id="BAJ39693.1"
                     /transl_table=11
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     QEENREGMAEVASFIEANGSFADDNRNW"
     CDS             20315..20620
                     /codon_start=1
                     /locus_tag="STMDT12_L00280"
                     /product="plasmid maintenance protein CcdB"
                     /protein_id="BAJ39694.1"
                     /transl_table=11
                     /translation="MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSE
                     KVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEVADLSLRENDIKNAINLMFRGI"
     CDS             20622..20912
                     /codon_start=1
                     /locus_tag="STMDT12_L00290"
                     /product="hypothetical protein"
                     /protein_id="BAJ39695.1"
                     /transl_table=11
                     /translation="MRVSEQVLLSSLRQGGCVRSFWRRSARLAGTPSPIVPDGLVLET
                     PGERGDTPLCHVDFAVVQKWLVCEETWTQTLGGTEFGGTVWRLRTDRENTTS"
     CDS             20909..21430
                     /codon_start=1
                     /locus_tag="STMDT12_L00300"
                     /product="hypothetical protein"
                     /protein_id="BAJ39696.1"
                     /transl_table=11
                     /translation="MTRSRICPDTESTGLSPASDALPVRETTEQFAQVFFGKSVSLLT
                     PEERFTTVYAGSRDIPADLHPASWFPADTWFRNELRACAAYVGRRQGWPLYHASEAER
                     LRALYPLRLATPATDPGKQLLTRTALLKAGYSRATIAAMTPVAERQNRHSGDWYPLYR
                     VQTETRDDSGEKT"
     CDS             21465..22247
                     /codon_start=1
                     /locus_tag="STMDT12_L00310"
                     /note="COG0582 Integrase"
                     /product="resolvase"
                     /protein_id="BAJ39697.1"
                     /transl_table=11
                     /translation="MSQPPLPAVCTQAASALLPVAIDYPAALALRQMAMQHDDYPKYL
                     LAPEVSALLHYVPDLHRRMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATLKQ
                     RAEKAARTAGRMPSGSQPHRLVPLSDNQYVSELQMMVATLKIPLERRNRRTGRTEKAR
                     LWEITDRTVRTWIGEAVEAAAADDVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQALM
                     GHKSVSSTEVYTKVFALDVAARHRVQFQMPGADAVAMLKGGS"
     CDS             22256..22807
                     /codon_start=1
                     /locus_tag="STMDT12_L00320"
                     /note="COG2200 FOG: EAL domain"
                     /product="putative diguanylate cyclase/phosphodiesterase"
                     /protein_id="BAJ39698.1"
                     /transl_table=11
                     /translation="MHFSAFRLQQAIRNREFTPFYQPIVCATGGEVVGCEMLARWLHP
                     QKGLLSAGNFIPAIEATGLGGALLRGLADEVCGDGQDLARSAGRRLMMTLNLSLSLVM
                     TPLFRPHLLALSIRLEQAGMTPVFEITEREDIRAFPQAAVFRQLAAGGLRFAVDDFGT
                     GHAGPASTVADRMIARTVSLARC"
     CDS             22973..23482
                     /codon_start=1
                     /locus_tag="STMDT12_L00330"
                     /product="putative inner membrane protein"
                     /protein_id="BAJ39699.1"
                     /transl_table=11
                     /translation="MRTGVISMNQPLLFRTVAGRQSNHEGFYMPPGIRHLGTLSLYRA
                     VAWWGLFLGREFTRDDVSEAFSIEPRRASGILNYICNRHNDDDICFDSRLHPVRGGRA
                     QLVVRIRAVESRPDTIRRQRTDRPGGKVSDRQYDRQMAHWLLSRPAGGDTAKLAAWQA
                     ACPVREASC"
     CDS             23476..23961
                     /codon_start=1
                     /locus_tag="STMDT12_L00340"
                     /product="putative inner membrane protein"
                     /protein_id="BAJ39700.1"
                     /transl_table=11
                     /translation="MLIIVSDCQFTRLALTRLLAHLDPVNMSVARWLQTAPPAGSHVL
                     LAASPGMLASLVPACHHARTSLSLKLALLGSGGQAVFLNTLGLRPDCLLPRTASATQL
                     KAAVSSWLRRARGWRQATTESLSLRERQALCATLAGLSARTAPGSASAPKPFTAIAAA
                     R"
     CDS             23988..24158
                     /codon_start=1
                     /locus_tag="STMDT12_L00350"
                     /product="Orf9"
                     /protein_id="BAJ39701.1"
                     /transl_table=11
                     /translation="MIGLPDPAAHYSMMLHPGSPPFFSSRTTGAGSHNVSAHHPVHLP
                     VTHRSHYTDMTL"
     CDS             24214..24801
                     /codon_start=1
                     /locus_tag="STMDT12_L00360"
                     /note="COG0739 Membrane proteins related to
                     metalloendopeptidases"
                     /product="hypothetical protein"
                     /protein_id="BAJ39702.1"
                     /transl_table=11
                     /translation="MQATTPLVLTLTPAMTARADIASRIGQSPFSADRDAALAGIRTV
                     PYTLKKGETVAQAHGLTVPQLKKLNGLRTFARGFDHLQAGDELDVPAVPLTGGKGDNN
                     RHDARGPFAADRENEDAQAQQMAGMASQAGSFLASHPDGQAAAGMVTVTSGRLTCSGR
                     TSSSTMTSPATTPAPASAENTGATSLSFPPTPMSA"
     CDS             24825..25241
                     /codon_start=1
                     /locus_tag="STMDT12_L00370"
                     /product="putative adhesin"
                     /protein_id="BAJ39703.1"
                     /transl_table=11
                     /translation="MEDYEERPASGWDLRAEGYLPSYPQLGAKMVYEQYYGNEVGLFG
                     KDERQKNPHALTAGVSWTPVPLLKLSAEQRAGKAGEHDTRFGAEASYRIGDSLRSQLD
                     PDAVGALRSLAGSRYDLTDRNNDIILEYRKQEVTCQ"
     CDS             complement(25308..25658)
                     /codon_start=1
                     /locus_tag="STMDT12_L00380"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /product="putative transposase"
                     /protein_id="BAJ39704.1"
                     /transl_table=11
                     /translation="MLRATKVCIYPTPEQAEHLNAQFGAVRFVYSKSLHIKKHAYQRH
                     GVSLTPRKDIKPLLAVAKKFRKFRKYAWLKEYDSIALQQAVINLDVAFSNCFNPKLKA
                     RFPMFKRKHGKLLG"
     CDS             25897..26139
                     /codon_start=1
                     /locus_tag="STMDT12_L00390"
                     /note="COG1943 Transposase and inactivated derivatives"
                     /product="putative transposase"
                     /protein_id="BAJ39705.1"
                     /transl_table=11
                     /translation="MDGEQDHVHLLIAYPLKLGVSVMVNNLKSVSSRLLRQQNTHLRM
                     QSKTGLLWSRSYFACSAGGATIETLKAYVLRQNTPE"
     CDS             complement(26266..26916)
                     /codon_start=1
                     /locus_tag="STMDT12_L00400"
                     /product="virulence protein SpvD"
                     /protein_id="BAJ39706.1"
                     /transl_table=11
                     /translation="MRVSGSASSQDIISRINSKNINNNDSNEVKRIKDALCIESKERI
                     LYPQNLSRDNLKQMARYVNNTYVHYSGNCVLLSACLHYNIHHRQDILSSKNTASPTVG
                     LDSAIVDKIIFGHELNQSYCLNSIDEVEKEILNRYDIKRESSFIISAENYIAPIIGEC
                     RHDFNAVVICEYDKKPYVQFIDSWKTSNILPSLQEIKKHFSSSGEFYVRAYDEKHD"
     CDS             complement(27177..27902)
                     /codon_start=1
                     /locus_tag="STMDT12_L00410"
                     /product="SpvC"
                     /protein_id="BAJ39707.1"
                     /transl_table=11
                     /translation="MPINRPNLNLNIPPLNIVAAYDGAEIPSTNKHLKNNFNSLHNQM
                     RKMPVSHFKEALDVPDYSGMRQSGFFAMSQGFQLNNHGYDVFIHARRESPQSQGKFAG
                     DKFHISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQARVSLGAQFTLYIK
                     PDQENSQYSASFLHKTRQFIECLESRLSENGVISGQCPESDVHPENWKYLSYRNELRS
                     GRDGGEMQRQALREEPFYRLMTE"
     CDS             complement(28184..29959)
                     /codon_start=1
                     /locus_tag="STMDT12_L00420"
                     /note="COG5585 NAD+--asparagine ADP-ribosyltransferase"
                     /product="virulence protein SpvD"
                     /protein_id="BAJ39708.1"
                     /transl_table=11
                     /translation="MLILNGFSSATLALITPPFLPKGGKALSQSGPDGLASITLPLPI
                     SAERGFAPALALHYSSGGGNGPFGVGWSCATMSIARRTSHGVPQYNDSDEFLGPDGEV
                     LVQTLSTGDAPNPVTCFAYGDVSFPQSYTVTRYQPRTESSFYRLEYWVGNSNGDDFWL
                     LHDSNGILHLLGKTAAARLSDPQAASHTAQWLVEESVTPAGEHIYYSYLAENGDNVDL
                     NGNEAGRDRSAMRYLSKVQYGNATPAADLYLWTSATPAVQWLFTLVFDYGERGVDPQV
                     PPAFTAQNSWLARQDPFSLYNYGFEIRLHRLCRQVLMFHHFPDELGEADTLVSRLLLE
                     YDENPILTQLCAARTLAYEGDGYRRAPVNNMMPPPPPPPMMGGNSSRPKSKWAIVEES
                     KQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEFKNAMSVY
                     INDIAEGLSSLPETDHRVVYRGLKLDKPALSDVLKEYTTIGNIIIDKAFMSTSPDKAW
                     INDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVNCGSQDFASQLSK
                     LRLSDDATADTNRIKRIINMRVLNS"
     CDS             complement(30011..30178)
                     /codon_start=1
                     /locus_tag="STMDT12_L00430"
                     /product="hypothetical protein"
                     /protein_id="BAJ39709.1"
                     /transl_table=11
                     /translation="MIAGTLRASRQFSFPRYQSSEQQTILQNLSDVIVQVHSTALYGG
                     STFEQAVEQTL"
     CDS             complement(30141..30908)
                     /codon_start=1
                     /locus_tag="STMDT12_L00440"
                     /product="28.1 kDa virulence protein"
                     /protein_id="BAJ39710.1"
                     /transl_table=11
                     /translation="MNMNQTTSPALSQVETAIRVPAGNFAKYNYYSVFDIVRQTRKQF
                     INANMSWPGSRGGKTWDLAMGQAQYIRCMFRENQLTRRVRGTLQQTPDNGTNLSSSAV
                     GGIQGQAERRPDLATLMVVNDAINQQIPTLLPYHFPHDQVELSLLNTDVSLEDIISES
                     SIDWPWFLSNSLTGDNSNYAMELASRLSPEQQTLPTEPDNSTATDLTSFYQTNLGLKT
                     ADYTPFEALNTFARQLAITVPPGGTVDCGYSACQPAV"
     CDS             complement(31082..31246)
                     /codon_start=1
                     /locus_tag="STMDT12_L00450"
                     /note="COG3772 Phage-related lysozyme (muraminidase)"
                     /product="lysozyme"
                     /protein_id="BAJ39711.1"
                     /transl_table=11
                     /translation="MGINALAHATLLKKLNNGDYDGAANEFLKWDHASGQVVPGLTRR
                     RSAERCLFLS"
     CDS             complement(31420..32313)
                     /codon_start=1
                     /locus_tag="STMDT12_L00460"
                     /note="COG0583 Transcriptional regulator"
                     /product="virulence genes transcriptional activator"
                     /protein_id="BAJ39712.1"
                     /transl_table=11
                     /translation="MDFLINKKLKIFITLMETGSFSIATSVLYITRTPLSRVISDLER
                     ELKQRLFIRKNGTLIPTEFAQTIYRKVKSHYIFLHALEQEIGPTGKTKQLEIIFDEIY
                     PGSLKNLIISALTISGQKTNIMGRAVNSQIIEELCQTNNCIVISARNYFHRESLVCRT
                     SVEGGVMLFIPKKFFLCGKPDINRLAGTPVLFHEGAKNFNLDTIYHFFEQTLGITNPA
                     FSFDNVDLFSSLYRLQQGLAMLLIPVRVCRALGLSTDHALHIKGVALCTSLYYPTKKR
                     ETPDYRKAIKLIQQELKQSTF"
     CDS             32922..33959
                     /codon_start=1
                     /locus_tag="STMDT12_L00470"
                     /note="COG3335 Transposase and inactivated derivatives"
                     /product="putative integrase"
                     /protein_id="BAJ39713.1"
                     /transl_table=11
                     /translation="MPIIAAIPDEERQLMRKEAQQTHDKNHARRLIAMLMLHQGMTVT
                     DVARLLCAARSSVGRWINWFTLHGVEGLKSLRPGRAPRWPVADILQLLPLLVQRSPKD
                     FGWLRSRWSTELLALVINRLFDVTLHRSTLHRYLRQADMVWRRAAPTLKIKDPHYEEK
                     RLVIDQALAQEQTAHPVFYQDEVDIDLNPKIGADWMPKGQQKRIATPGQNQKHYLAGA
                     LHSGTGRVHYVSGSSKSSDLFISLLETLRRTYRRAKTITLVADNYIIHKSRKVERWLE
                     ENPKFRLLFLPMYSPWLNPIERLWLSLHETITRNHQCRYMWQLLKQVAQFMNAASLFP
                     GNQQGLAKVER"
     CDS             complement(34148..35116)
                     /codon_start=1
                     /locus_tag="STMDT12_L00480"
                     /note="COG3267 Type II secretory pathway, component ExeA
                     (predicted ATPase)"
                     /product="phosphoribulokinase/uridine kinase family
                     protein"
                     /protein_id="BAJ39714.1"
                     /transl_table=11
                     /translation="MRVEVMEHYGLTQSIEQAGYYETAHHKQLMKDIKGAIREGRLIA
                     VCGVVGSGKTVTLRRLQQQLLDENKIIVARSLSVDKQSVRLATLINALFYDLAQDKQV
                     QIHKQGERRERELQELVKKGKRPVALFVDEAHDLNGNTLTGLKRLMEVVEDGGGRLSV
                     VLAGHPKLRNDLRRPTMEEIGYRTDIFTLDGITGSQREYIQWLLKTSTGKGKPEDILT
                     TEAVDLLAMKLRTPLQVQLHLTLAMEAGYQTGEKPITATLVESVLSRQLDDLEPTLTR
                     HGYRLKDMVEQFDAKPAEIRALFNNQLDPARTAELRDRMLAVGLPI"
     CDS             complement(35106..36770)
                     /codon_start=1
                     /locus_tag="STMDT12_L00490"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /product="integrase, catalytic region"
                     /protein_id="BAJ39715.1"
                     /transl_table=11
                     /translation="MSSRRSAIPSDSLLQLRQRLDRLPPKSPERANQIAATAQLYGIS
                     VTTVYRALHLVLKPRTAHRSDHGQPRILPPSELEHYCELIAALKLRTTNKSGRHLSTG
                     RAIQLLEEHGVETVQGLIKSPKGLLRKQTVNRWLSRWRLDQPRLLREPPAVRFQAENS
                     NDCWQFDMSPSDLKHIERPDWVDPARGEPTLMLFSVVDDRSGVAYQEYRCVYGEDAES
                     ALRFLFNAMAPKTRSDFPFQGRPKLLYLDNGPVAKNHVFQNVMQSLKVDWLTHTPAGK
                     DGTRTTARSKGKVERPFRTVKEAHETLYHFHKPETELQANEWLWNYLSRYNAQRHRSE
                     KHSRLEDWLANIGQEGVRDMCSWEQYCRFAREPESRKVGVDARITIDGTAWEVEPDMA
                     GETVILLWGLFDEEMYVEFTGETWGPYYPVSGPVPLHRYRTFRRGKAAERADRIHALA
                     RQLNIPISALSGSDLRVVSDDTQQRIDALPHQPFDTRKFEYHFPTVIAAKLAIADDLA
                     IPLARMSDEDRAFIDSILTETLNRSEVLARIRDYFRSRQSGEDHAG"
     CDS             complement(36754..37029)
                     /codon_start=1
                     /inference="similar to AA sequence:UniProtKB:O52219"
                     /locus_tag="STMDT12_L00500"
                     /note="COG1961 Site-specific recombinases, DNA invertase
                     Pin homologs"
                     /note="transposase insertion"
                     /product="putative resolvase"
                     /protein_id="BAJ39716.1"
                     /transl_table=11
                     /translation="MDTRSAAGKAFLDMLGVFAEFETNLRRERQMEGIAAAKARGVYR
                     GRKPSIDPAVVYRLYTIEKMGATAIARQLGIGRASVYRALENYEQPA"
     misc_feature    37054..49676
                     /note="Salmonella T000240 resistance island"
     CDS             complement(37106..37810)
                     /codon_start=1
                     /locus_tag="STMDT12_L00510"
                     /note="COG3316 Transposase and inactivated derivatives"
                     /product="IS26 transposase"
                     /protein_id="BAJ39717.1"
                     /transl_table=11
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     CDS             complement(37857..37979)
                     /codon_start=1
                     /locus_tag="STMDT12_L00520"
                     /product="putative transposase"
                     /protein_id="BAJ39718.1"
                     /transl_table=11
                     /translation="MGQLPGGQQRLFYSFNLEDHVPAQHLLRSIDQCLDRHCCK"
     CDS             complement(38097..39233)
                     /codon_start=1
                     /locus_tag="STMDT12_L00530"
                     /product="hypothetical protein"
                     /protein_id="BAJ39719.1"
                     /transl_table=11
                     /translation="MSQLSQLRSPAAVQAAIDEFVQLGRTKFLARHGYGKSRDFLVRD
                     PKTGTDCDSKAIAGVAFGKQFPEQGPLTADSFSGGETTVVPALTRLGFRIIRIGEDWS
                     EEEVLATVEDYFDMLRAEAAGEPYHKSEHNQALRQLLNGRSKSSVELKHQNISAVLDA
                     LGLPYINGYKPRGNSQLLLRKSVHAYVLEHQQTVGALVDALEEVKLPGDKTYRAALVE
                     PPAREVLVRTPASLRQRLPRKFDYAARDEANRKLGRAGEQWVIGYEQQRLTELGHPEL
                     FQRLDWVSDTQGDGAGFDILSFEEDAHERFIEVKTTNGGVGSSFLVSHNELEFSKEAG
                     DQFHLYRVFQFRDGPRLFTLPGDLSQHVHLKPTDYRASFRSLVG"
     CDS             complement(39284..39511)
                     /codon_start=1
                     /locus_tag="STMDT12_L00540"
                     /product="hypothetical protein"
                     /protein_id="BAJ39720.1"
                     /transl_table=11
                     /translation="MVNSYSLSDDSGVMAAAAITHFLFGQAVFSYLNGWSVLIGPGTG
                     LDSTGCKYARDLMGLVAFTAFIVTFLFRGYS"
     CDS             complement(40208..40750)
                     /codon_start=1
                     /locus_tag="STMDT12_L00550"
                     /note="COG0194 Guanylate kinase"
                     /product="hypothetical protein"
                     /protein_id="BAJ39721.1"
                     /transl_table=11
                     /translation="MIIWINGPFGAGKTTLAKRLRDRRSKSLIFDPEEIGFVVKETVP
                     MPASGDYQDLPLWRGLTIAAVREIRRNYSQDIIIPMTLVHPDYLTEILDGVRRIDDQL
                     LHIFLTLNEDLLRHRIANQTMHPDPNRNAEIREWRLANVARCLAARERLPCTTRVLDS
                     GAHTSDELAAMVLDGIDGRT"
     CDS             complement(40763..41623)
                     /codon_start=1
                     /locus_tag="STMDT12_L00560"
                     /note="COG2746 Aminoglycoside N3'-acetyltransferase"
                     /product="aminoglycoside 3-N-acetyltransferase"
                     /protein_id="BAJ39722.1"
                     /transl_table=11
                     /translation="MHTRKAITEALQKLGVQTGDLLMVHASLKAIGPVEGGAETVVAA
                     LRSAVGPTGTVMGYASWDRSPYEETLNGARLDDEARRTWLPFDPATAGTYRGFGLLNQ
                     FLVQAPGARRSAHPDASMVAVGPLAETLTEPHELGHALGEGSPVERFVRLGGKALLLG
                     APLNSVTALHYAEAVADIPNKRWVTYEMPMLGRDGEVAWKTASDYDSNGILDCFAIEG
                     KPDAVETIANAYVKLGRHREGVVGFAQCYLFDAQDIVTFGVTYLEKHFGTTPIVPPHE
                     AVERSCEPSG"
     CDS             41856..42560
                     /codon_start=1
                     /locus_tag="STMDT12_L00570"
                     /note="COG3316 Transposase and inactivated derivatives"
                     /product="IS26 transposase"
                     /protein_id="BAJ39723.1"
                     /transl_table=11
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     CDS             complement(42612..42725)
                     /codon_start=1
                     /locus_tag="STMDT12_L00580"
                     /note="COG1695 Predicted transcriptional regulators"
                     /product="hypothetical protein"
                     /protein_id="BAJ39724.1"
                     /transl_table=11
                     /translation="MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHG"
     CDS             complement(42736..43941)
                     /codon_start=1
                     /locus_tag="STMDT12_L00590"
                     /note="COG2059 Chromate transport protein ChrA"
                     /product="chromate transport protein"
                     /protein_id="BAJ39725.1"
                     /transl_table=11
                     /translation="MTNNPTDDSRPWSVFLIFLRLGLTSFGGPIAHLGYFRAEFVTRR
                     RWLSERSYADLVALCQFLPGPASSQVGIAVGLSRAGYSGALAAWAGFTLPSAIALILF
                     ALGISSYGDYVSQGALHGLKVVAVAVVAQAVWGMARNLCTDGLRVTIMAIATCVVLLV
                     PSAWGQVGVIAIAGIAGRLLFKPAKVVEHDPLPITVSHRAGVLWLSLFFVLLIGLPVL
                     AELMPSQTMAMVDSFYRVGSLVFGGGHVVLPLLQAEVVPSGWVNNESFLAGYGAAQAV
                     PGPLFTFAAFLGASMNTAPSGWIGGIVCLLAIFAPSFLLVVGSMPFWERLRRNTGIQA
                     ALAGINAAVVGLLLAALYQPVWTSAIFQPQDFGLALVALVALMFWKLPPWLVVLGSGA
                     AGWLLSVAL"
     CDS             complement(44097..44300)
                     /codon_start=1
                     /locus_tag="STMDT12_L00600"
                     /product="hypothetical protein"
                     /protein_id="BAJ39726.1"
                     /transl_table=11
                     /translation="MDSEEPPNVRVACSGDIDEVVRLMHDAAAWMSAKGTPAWDVARI
                     DRTFAETFVLRSELLGIASENGK"
     CDS             44337..44498
                     /codon_start=1
                     /locus_tag="STMDT12_L00610"
                     /product="hypothetical protein"
                     /protein_id="BAJ39727.1"
                     /transl_table=11
                     /translation="MQFDPDEPSMSAPTFAEPDQGPLAGGRKVNARHDLTLGLWRRDC
                     EISRGFPRR"
     CDS             complement(44428..45267)
                     /codon_start=1
                     /locus_tag="STMDT12_L00620"
                     /note="COG0294 Dihydropteroate synthase and related
                     enzymes"
                     /product="dihydropteroate synthase"
                     /protein_id="BAJ39728.1"
                     /transl_table=11
                     /translation="MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDV
                     GPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLND
                     IQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSAL
                     RRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGAT
                     VGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGL
                     DHA"
     CDS             complement(45261..45608)
                     /codon_start=1
                     /locus_tag="STMDT12_L00630"
                     /note="COG2076 Membrane transporters of cations and
                     cationic drugs"
                     /product="multidrug efflux protein"
                     /protein_id="BAJ39729.1"
                     /transl_table=11
                     /translation="MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAF
                     YFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLAR
                     SPSWKSLRRPTPW"
     CDS             complement(45772..46563)
                     /codon_start=1
                     /locus_tag="STMDT12_L00640"
                     /note="COG1708 Predicted nucleotidyltransferases"
                     /product="aminoglycoside resistance protein"
                     /protein_id="BAJ39730.1"
                     /transl_table=11
                     /translation="MREAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKP
                     YSDIDLLVTVAVKLDETTRRALLNDLMEASAFPGESETLRAIEVTLVVHDDIIPWRYP
                     AKRELQFGEWQRNDILAGIFEPAMIDIDLAILLTKAREHSVALVGPAAEEFFDPVPEQ
                     DLFEALRETLKLWNSQPDWAGDERNVVLTLSRIWYSAITGKIAPKDVAADWAIKRLPA
                     QYQPVLLEAKQAYLGQKEDHLASRADHLEEFIRFVKGEIIKSVGK"
     CDS             complement(46569..46859)
                     /codon_start=1
                     /locus_tag="STMDT12_L00650"
                     /product="hypothetical protein"
                     /protein_id="BAJ39731.1"
                     /transl_table=11
                     /translation="MFIQTAFSFSGVIQCLFCLFSGLRLHGLRRFSVFLASSPCVASA
                     SSYRFCSAVPPRWRSVFSRLAPVAKFKLSVLASGSNISVKPTRILRSAYLAR"
     CDS             complement(46971..47468)
                     /codon_start=1
                     /locus_tag="STMDT12_L00660"
                     /note="COG0262 Dihydrofolate reductase"
                     /product="dihydrofolate reductase"
                     /protein_id="BAJ39732.1"
                     /transl_table=11
                     /translation="MNSESVRIYLVAAMGANRVIGNGPNIPWKIPGEQKIFRRLTEGK
                     VVVMGRKTFESIGKPLPNRHTLVISRQANYRATGCVVVSTLSHAIALASELGNELYVA
                     GGAEIYTLALPHAHGVFLSEVHQTFEGDAFFPMLNETEFELVSTETIQAVIPYTHSVY
                     ARRNG"
     CDS             47613..48626
                     /codon_start=1
                     /locus_tag="STMDT12_L00670"
                     /note="COG0582 Integrase"
                     /product="IntI1"
                     /protein_id="BAJ39733.1"
                     /transl_table=11
                     /translation="MKTATAPLPPLRSVKVLDQLRERIRYLHYSLPTEQAYVHWVRAF
                     IRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQ
                     EIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDF
                     DHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALER
                     KYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATP
                     HTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLT
                     SER"
     CDS             48595..48867
                     /codon_start=1
                     /locus_tag="STMDT12_L00680"
                     /note="COG0610 Type I site-specific
                     restriction-modification system, R (restriction) subunit
                     and related helicases"
                     /product="transposon Tn21 modulator protein"
                     /protein_id="BAJ39734.1"
                     /transl_table=11
                     /translation="MRCRPSLVRGRAAQVNPGGFTTPARRPSVPHRTAGCGKSSLRPL
                     MAGSSPSLPDGSNPSAAIVQSASDVQCSRLLKTTMEVVAEGALLQS"
     CDS             complement(48901..49605)
                     /codon_start=1
                     /locus_tag="STMDT12_L00690"
                     /note="COG3316 Transposase and inactivated derivatives"
                     /product="IS26 transposase"
                     /protein_id="BAJ39735.1"
                     /transl_table=11
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     CDS             complement(49617..49937)
                     /codon_start=1
                     /inference="similar to AA sequence:UniProtKB:O52219"
                     /locus_tag="STMDT12_L00700"
                     /note="COG1961 Site-specific recombinases, DNA invertase
                     Pin homologs"
                     /note="transposase insertion"
                     /product="putative resolvase"
                     /protein_id="BAJ39736.1"
                     /transl_table=11
                     /translation="MALYGYARVSTSDQDLTLQTQILRAAGCEIIRAEKASGSGRTGR
                     SELQLLLEFLRPGDTLMVTRVDRLARSIKDLQDIVYALNQQGVTLRALLQIVGGDKLI
                     IPFC"
     CDS             complement(50144..50884)
                     /codon_start=1
                     /locus_tag="STMDT12_L00710"
                     /note="COG0288 Carbonic anhydrase"
                     /product="putative carbonic anhydrase"
                     /protein_id="BAJ39737.1"
                     /transl_table=11
                     /translation="MEQNQPAQPSRRAILKQTLAVSALSVTGLAALSVPTISFAASLS
                     KEERDGMTPDAVIEHFKQGNLRFRENRPAKHDYLAQKRNSIAGQYPAAVILSCIDSRA
                     PAEIVLDAGIGETFNSRVAGNISNRDMLGSMEFACAVAGAKVVLVIGHTRCGAVRCAI
                     DNAELGNLTGLLDEIKPAIAKTEYSGERKGSNYDFVDAVARKNVELTIENIRKNSPVL
                     KQLEDEKKIKIVGSMYHLTGGKVEFFEV"
     CDS             51377..51469
                     /codon_start=1
                     /locus_tag="STMDT12_L00720"
                     /product="hypothetical protein"
                     /protein_id="BAJ39738.1"
                     /transl_table=11
                     /translation="MLLLMYFQPQAFLISGSSSSNWPKNLRNVE"
     CDS             complement(51539..52027)
                     /codon_start=1
                     /locus_tag="STMDT12_L00730"
                     /product="hypothetical protein"
                     /protein_id="BAJ39739.1"
                     /transl_table=11
                     /translation="MPQDESVVKRAREYFFRHHRYTEEDLESDYQAELCNYRDDTWEA
                     PQRAARLSAAVKRYKTYEMLYFFFQIADEAGLDYTPLVVKRLCAHLFDRQGSQNIIVD
                     IFGQKGRMHRSHDSDPDIIAAVAERYRQQAEDHWQTVLKNIGRVKQDYQKNQNRQKGA
                     GD"
     CDS             52286..53401
                     /codon_start=1
                     /locus_tag="STMDT12_L00740"
                     /product="alpha-helical coiled coil protein"
                     /protein_id="BAJ39740.1"
                     /transl_table=11
                     /translation="MRPATYEPEQIIEAGLALQAEGRNITGFALRNQVGGGNPTRLRQ
                     IWDEYQASQSTVVTEPVAELPVEVAEEVKAVSAALSERITQLATELNDKAVRAAERRV
                     AEVTRAAGEQTAQAERELADAAQTVDDLEEKLDELQDRYDSLTLALESERSLRQQHDV
                     EMAQLKERLAAAEENTRQREERYQEQKTVLQDALNAEQAQHKNTREDLQKRLEQISAE
                     ANARTEELKSERDKVNTLLTRLESQENALASERQQHLATRETLQQRLEQAIADTQARA
                     GEIALERDRVSSLTARLESQEKASSEQLVRMGSEIASLTERCTQLENQRDDARLETMG
                     EKETVAALRGEAEALKRQNQSLMAALSGNKQTGGQNA"
     CDS             53394..53903
                     /codon_start=1
                     /locus_tag="STMDT12_L00750"
                     /note="COG0847 DNA polymerase III, epsilon subunit and
                     related 3'-5' exonucleases"
                     /product="YacC"
                     /protein_id="BAJ39741.1"
                     /transl_table=11
                     /translation="MRDDDNSDACDEAPRAEDKCYTKGRLRDEFRMKPAPGAEPVRMY
                     KSPYGGKYGVWRLADCVPMRAKRPQTEKQRLASTRLGLQARMKSERGRFAMLAHTWLA
                     LGPVFLDTETTGLDAGAQALEIGLVNARGERIFETRLKPTVGIDPAAAAVQIVTEPYR
                     FPVLSVRLA"
     CDS             54006..54422
                     /codon_start=1
                     /locus_tag="STMDT12_L00760"
                     /product="hypothetical protein"
                     /protein_id="BAJ39742.1"
                     /transl_table=11
                     /translation="MMTQGVSQHNAALWLVRQLQGLIQESEMENMLKTMREHFPVRTV
                     VIEQSLDMFGVKRNEDGTLLFPRHSDKRFPVARIRKRLAAYGWRGERLNKEVARIVAG
                     PDILPERRDYSIIFPYGWEKKQLTREMRRMFLRKTG"
     CDS             54479..55045
                     /codon_start=1
                     /locus_tag="STMDT12_L00770"
                     /product="hypothetical protein"
                     /protein_id="BAJ39743.1"
                     /transl_table=11
                     /translation="MTLTEKSGHLAWCALVALALARQDGGVLSPAQENLFLTRWLATA
                     LKQRRFSRDVTPDIEWLLKQGRQMGVSAKLASKLNYLWRSCTGELSEQNDLFRLTYAL
                     ETAKDMHWNYRLLSDREWSGRNAVALSAGVNGIYLSRAKLDVGFNDSGRQINSLTARL
                     TGNVAGVMKLFDRCGWQSLMPPCPTSIR"
     CDS             complement(55077..56018)
                     /codon_start=1
                     /locus_tag="STMDT12_L00780"
                     /note="COG5464 Uncharacterized conserved protein"
                     /product="putative transposase"
                     /protein_id="BAJ39744.1"
                     /transl_table=11
                     /translation="MKKKNTTPTPHDATFRQFLTQPDIARDFMELHLPAELRAICDLS
                     TLKLESGSFVEDDLRQYFSDVLYSLKTTAGDGYIHVLVEHQSTPDKHMAFRLIRYAVA
                     AMQRHLEAGHKKLPLVIPVLFYTGKRSPYPYSTRWLDEFDDTALADKLYSSAFPLVDV
                     TVIPDDEIAGHRSMAALTLLQKHIHQRDLAELVDRLAPILLAGYLSSSQVISLVHYIV
                     QAGETSDAEAFVRELAQRVPQHGDALMTIAQQLEQKGIEKGIQLGEQRGIEKGRSEGE
                     REATLKIARTMLQNCIDRNTVMKMTGLTEDDLAQIRH"
     CDS             56433..57638
                     /codon_start=1
                     /locus_tag="STMDT12_L00790"
                     /note="COG1192 ATPases involved in chromosome
                     partitioning"
                     /product="plasmid partition protein A"
                     /protein_id="BAJ39745.1"
                     /transl_table=11
                     /translation="MENIEQLRKVATRAGKLLTSLSESIRQQKEELKLTEFYQEYSKA
                     ALYKLPKLSKGSVEYAVAEMEASGYIFKKKPSGNTMKYAMTIQNVIDLYFHRKVPKYR
                     DRFDKAFTIFVCNLKGGGSKTVSTASLSHAFRAHPQLLFEDLRILAIDFDPQASLTMF
                     LSHENSVGLVENTAAQAMLQNVSREELLSDFIVSSIIPGVDVIPASIDDAFLAEGWKG
                     LCEEHLPGQNIHAVLKENIIDKLRYDYDFIFLDSGPHLDAFLKNCIGAADLMLTPLPP
                     ATVDFHSSLKFVASLPALIDSIEQDGHTCNLIGNVGFMSKILNKSDHKICHSQAKEVF
                     GADMLDMVLPRLDGFERCGETFDTVISANPATYDGSTEALKSAKSAAEDFAKAVFDRI
                     EFIRTNGGM"
     CDS             57638..58612
                     /codon_start=1
                     /locus_tag="STMDT12_L00800"
                     /note="COG1475 Predicted transcriptional regulators"
                     /product="plasmid partition protein B"
                     /protein_id="BAJ39746.1"
                     /transl_table=11
                     /translation="MSNERRKTIGRQLNTQASMVEMTDTQRSQVFTLKTGRKITFRFV
                     RVPASDVESKTFVNQETNGRDQLALTRESLKSIIQTIKFQQFFPCIGIQQGERIEILD
                     GSRRRASAIYIRTGLDVMVTNELLSADEARHLAKDIQTAKEHNLREIGLRLMALKESG
                     FNQKEIAELEGLSQAKVTRALQAAAVPQELISLFPVQSELSFSDYKILLEVNEKLSEK
                     GLTSEGLIQSVSDQHDAILSDYERPDDEQKSSILKLISQASQALIAPPPKEKSVISAL
                     WTFEEKDKFARKRVKGRTLTYEFSRMSKVVQDELDKAINEVLERNLSQ"
     CDS             complement(58694..59968)
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="umuC"
                     /locus_tag="STMDT12_L00810"
                     /note="COG0389 Nucleotidyltransferase/DNA polymerase
                     involved in DNA repair"
                     /product="DNA polymerase V subunit UmuC"
                     /protein_id="BAJ39747.1"
                     /transl_table=11
                     /translation="MFALADVNSFYASCEKVFRPDLRDRSVVVLSNNDGCVIARSAEA
                     KKLGIKMGVPWFQLRSAKFPEPVIAFSSNYALYASMSNRVMVHLEELAPRVEQYSIDE
                     MFLDIRGIDSCIDFEDFGRQLREHVRSGTGLTIGVGMGPTKTLAKSAQWASKEWSQFG
                     GVLALTLHNQKRTEKLLSLQPVEEIWGVGRRISKKLNTMGITTALQLARANPTFIRKN
                     FNVVLERTVRELNGESCISLEEAPPPKQQIVCSRSFGERVTTYEAMRQAVCQHAERAA
                     EKLRGERQFCRHIAVFVKTSPFAVTEPYYGNLASEKLLIPTQDTRDIIAAAVRALDRI
                     WVDGHRYAKAGCMLNDFTPTGVSQLNLFDEVQPRERSEQLMQVLDGINHPGKGKIWFA
                     GRGIAPEWQMKRELLSPAYTTRWADIPAAKLT"
     CDS             complement(59968..60390)
                     /codon_start=1
                     /locus_tag="STMDT12_L00820"
                     /note="COG1974 SOS-response transcriptional repressors
                     (RecA-mediated autopeptidases)"
                     /product="protein SamA"
                     /protein_id="BAJ39748.1"
                     /transl_table=11
                     /translation="MLLLVAPEQEPVQSTAPLFTERCPAGFPSPAADYTEEELDLNAY
                     CIRRPAATFFVRAIGDSMKEMGLHSGDLMVVDKAEKPMQGDIVIAETDGEFTVKRLQL
                     KPRIALLPINPAYPTLYPEELQIFGVVTAFIHKTRSTD"
     CDS             60901..61371
                     /codon_start=1
                     /locus_tag="STMDT12_L00830"
                     /product="hypothetical protein"
                     /protein_id="BAJ39749.1"
                     /transl_table=11
                     /translation="MFRVTCIDLENGEFALYINGHYLSSEDGSGEKLYLGDILERLSR
                     LPGVTTETVERPVPDSDEWSWNDVADSVFPACITLSRNMTVAAFKQRLSRFPDDALCC
                     GTFWLASDFLALDSSLTEDDIDAAMELAQHCHDANDGFNWSHLQWAIDEVKRGG"
     CDS             61364..61720
                     /codon_start=1
                     /locus_tag="STMDT12_L00840"
                     /product="putative cytoplasmic protein"
                     /protein_id="BAJ39750.1"
                     /transl_table=11
                     /translation="MDNNSNINDTWLVGLSVDVNGTEMMVHYLVSATDLEHAEAGVLQ
                     MGRTWWPSLKREDDRHRWEYETGVVWFNSIILLDDVENSILRGLKFLDAWTVTGSTDA
                     PVLRDEWGNDWRDITR"
     CDS             61769..61957
                     /codon_start=1
                     /locus_tag="STMDT12_L00850"
                     /product="hypothetical protein"
                     /protein_id="BAJ39751.1"
                     /transl_table=11
                     /translation="MSRSSSFFGASAGGAGATLPVVSIPRPAGHGTGDFSAPAGRCRY
                     YAPGTRLLMNALQAAFAA"
     CDS             62102..62782
                     /codon_start=1
                     /locus_tag="STMDT12_L00860"
                     /note="COG0863 DNA modification methylase"
                     /product="putative methylase"
                     /protein_id="BAJ39752.1"
                     /transl_table=11
                     /translation="MSRLILGNCVDIMSGFPERAVDFILTDPPYLVGFRDRSGRSIAG
                     DRTDEWLQPACNQMYRVLKKDALLVSFYGWNRVDRFMAAWKSAGFSVVGHLVFTKNYS
                     SKSAYVGYRHECAYVLAKGRPALPQNPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THTNAIVLDPFAGSASTCVAALQAGRRYIGIELMEQYHKAGIERLTAVQRAMQRPAAN
                     DVFYPEAA"
     CDS             62782..63003
                     /codon_start=1
                     /locus_tag="STMDT12_L00870"
                     /product="putative cytoplasmic protein"
                     /protein_id="BAJ39753.1"
                     /transl_table=11
                     /translation="MNYSGHEKLRAEVAALANSMCDLRATLKVLEERYHWQRHGLTER
                     LAGQSLRRINTLLDEAYNESLMLNECFKD"
     CDS             63059..63472
                     /codon_start=1
                     /locus_tag="STMDT12_L00880"
                     /product="hypothetical protein"
                     /protein_id="BAJ39754.1"
                     /transl_table=11
                     /translation="MMYGTRKELNSKLKRMFGNDERFALLIWTKQDVMSLTQAMTEVE
                     ADAILREIGRKGMGEHTGDGISDSTVQALYAGLRTEIPTVSVPADLLARVTNIAGRAL
                     DTEDAQAWPLVCQEYPGVADAQVDIARLRQLALAA"
     CDS             63544..64308
                     /codon_start=1
                     /locus_tag="STMDT12_L00890"
                     /product="putative inner membrane protein"
                     /protein_id="BAJ39755.1"
                     /transl_table=11
                     /translation="MRNTLSTLIVRHGDNLLRRSGWPETVGVTQVAPGVVPGWLAVCG
                     VLSAAEILALTTHLCQPLNYGRAQLLTASAQRLAGTPVRLHLYPVQAYPHPATVRECT
                     EIRLPYAQEWLTTDEYADLLAFLKASADRVCEIVRQDTKRIAAALAPSGESRLMEKRI
                     GNWRLLADEYDHDNWLDEEDEDGLDKVLDAVLVRNARFCPVLLTLVNEPEEEIEAAGV
                     ITDCLRFPGEPNRRWLDRRVLRDVVNEARSFTGNIR"
     CDS             64804..65238
                     /codon_start=1
                     /locus_tag="STMDT12_L00900"
                     /product="hypothetical protein"
                     /protein_id="BAJ39756.1"
                     /transl_table=11
                     /translation="MQYSNQQRARVINVEESDRLSFLPYMFGNDFMLAELQLYALAKK
                     WMPEYNGGFWHFIRLPEGGGYMMPDCDRVHMINGENWFDRTVSADAAGIILTSLAINR
                     RCWTHHDCGNAALTRLYMLRDTQLWNHITFHPECNAIYAALD"
     CDS             65305..65739
                     /codon_start=1
                     /locus_tag="STMDT12_L00910"
                     /product="hypothetical protein"
                     /protein_id="BAJ39757.1"
                     /transl_table=11
                     /translation="MYGTVSTICCDLLKVYENHEKIAVIIWCEGDVREMGAEFNPTAD
                     DIQAVLRAIGESDSDALWRDGIGQNFVEGVLRELVALRPPRQIAVPEDVLRTLLPLME
                     AGMNLPRYQTQDRAAEEETALDTLRYLLSTNIPAHNLTEGNY"
     CDS             65975..66298
                     /codon_start=1
                     /locus_tag="STMDT12_L00920"
                     /product="putative inner membrane protein"
                     /protein_id="BAJ39758.1"
                     /transl_table=11
                     /translation="MSGLNLAATTKEEQDKVAIDLVASGVVYKERLAMPVVAELVVRE
                     QPEHLREYFRARLEYLRNSRTRMPRNMPEKRMRLKNSAIPDAFCLSLAGFYACRVMFF
                     SGRGV"
     CDS             66981..67499
                     /codon_start=1
                     /locus_tag="STMDT12_L00930"
                     /note="COG0629 Single-stranded DNA-binding protein"
                     /product="single-stranded DNA-binding protein"
                     /protein_id="BAJ39759.1"
                     /transl_table=11
                     /translation="MAARGVNKVILVGHIGQDPEVRYMPNGGAVANLTLATSETWRVR
                     QDGEMREHTEWHRVVVFGKLAEIASEYLRKGAQVYIEGQLRTRKWTDQSGQDKYTTEV
                     IVNVGGTMQMLGRHNSQPQQEPQTPPTAAKGEGKAVKGAGNAAKGKNAAAPQQPPAQP
                     DPAYDFDDDIPF"
     CDS             67554..67796
                     /codon_start=1
                     /locus_tag="STMDT12_L00940"
                     /product="putative cytoplasmic protein"
                     /protein_id="BAJ39760.1"
                     /transl_table=11
                     /translation="MTDNIMSPLKSLPDGTFTHEQAEAVAAQYQNVAIEDDQGTHLRL
                     VVRKDGEMVWRGWNFEPGGEYWLNRCIESHGIRKTQ"
     CDS             67865..69862
                     /codon_start=1
                     /locus_tag="STMDT12_L00950"
                     /note="COG1475 Predicted transcriptional regulators"
                     /product="putative DNA-binding protein"
                     /protein_id="BAJ39761.1"
                     /transl_table=11
                     /translation="MSVTNSNAKSAVKTSRKAKNAASASNTVLSAVLAQTEEQHVPLS
                     ALVKSPQNVRIVPYSTESVRELADSIKGIGLLQNLVVHALPDGLYGVAAGGRRLAAMN
                     LLATENTIHPDWPVRVKVVPDNLATAASLTENGQHLEMHPAEQIAGFRAMAAEGKTPA
                     QTGDLLGYSPRHVQRMLKLAGLAPVILEALAADKITTEHCQALALEDNPDRQVQVYEA
                     ACREGWNNKPEVRVIRNLITDSQVSTLNNSKYTFVGEKAFSGDEIRADLFSDEQGGFV
                     DKLALDTALLEKLQWVAECLKEAEGWAWCAGRMEPVSRYGEDTEVYRIQDEPDAVYTE
                     QEQQRLDELQELYDENQTASDETDTMESEIEAIECAAQLRAWTLEMRAQSGVVVSWRH
                     GEICVQRGVSLREQSETEDEPDQVPVYERQPEPVDEISVPLLTRMCAERTLSVQAALM
                     QQPEKSLALLAWTLCLNVFSSGAYNRPAQISLNCKHYSLTKDAPPGESGVAFVTLSQE
                     GKRLETLLPEGWTQDFTTFFTLSAKDLTALLSFCTACSLDGMQMRGAGGTTRSPLDKL
                     EIALAFHLRDWWQPTKADFFTGLKKPQIIAALNEAGLTGAARDAEKMKKGDAAELAED
                     KMRDNRWVPVWMRAPDAENDVSDTENGSADADSHHTLPDAA"
     CDS             69905..70336
                     /codon_start=1
                     /gene="psiB"
                     /locus_tag="STMDT12_L00960"
                     /product="plasmid SOS inhibition protein B"
                     /protein_id="BAJ39762.1"
                     /transl_table=11
                     /translation="MRNIITPAVLSTMIPQEFEDWRDGGEDLRRELTHAAMRDLTCPA
                     GWDMNGEYRSEFGGFFPVQIRFTPSRGNFSLAVCSPGDISPSWMVVFIPVSGRPFSVI
                     RTLPAWSPEVITHTLSLVAHLDADGYSQASIISVLAMEGAA"
     CDS             70333..71070
                     /codon_start=1
                     /locus_tag="STMDT12_L00970"
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="BAJ39763.1"
                     /transl_table=11
                     /translation="MIHSSHALVTLKPARQAALQAILTVEESRRRGARLPALPHARTF
                     LRVLSGSSRINTTVAQRIPGLNWEPKNRLTSLKQVEEALDRLISSHGEYCPLPLSVDV
                     QAELFPEVIHARTDRRMQREKIAFNRKMRREEKALEHAWLLRQNLLGQAMTELNFQSP
                     ETVNAWYTRWADEFDARELAQGFWQWRTRFTSLTSLDWLRDSDEPLYNVMYEIWFIVR
                     ENPVYVREAERWQVPNKLTNRRPGRLP"
     CDS             71105..71233
                     /codon_start=1
                     /locus_tag="STMDT12_L00980"
                     /product="hypothetical protein"
                     /protein_id="BAJ39764.1"
                     /transl_table=11
                     /translation="MDQLEVQIRLIPVATPPLQQKVDEIAHMLHLMAQFAGTELRK"
     CDS             71319..71477
                     /codon_start=1
                     /locus_tag="STMDT12_L00990"
                     /product="hypothetical protein"
                     /protein_id="BAJ39765.1"
                     /transl_table=11
                     /translation="MKSQLVAAADRAAMSVAYGQEAADHYGIQYGFIRSVRDWITGFT
                     EGIKGERC"
     CDS             71580..71849
                     /codon_start=1
                     /locus_tag="STMDT12_L01000"
                     /product="hypothetical protein"
                     /protein_id="BAJ39766.1"
                     /transl_table=11
                     /translation="MRLASRFGRQNSIRRESPLADAELMQTVPSVFSGDKHESRSERY
                     TYIPTINIINRLREEGFQSFFACQSRVRDLSRREYSKHMLRFRRE"
     CDS             71896..72186
                     /codon_start=1
                     /locus_tag="STMDT12_L01010"
                     /product="hypothetical protein"
                     /protein_id="BAJ39767.1"
                     /transl_table=11
                     /translation="MTVRQVIRWFPGCSDLSVQMDWYADHFGEIRVPHKGDIVGQVIE
                     GDYEVMGIFDKATENMESMKSVILNQDEQYLFGKAALTVRYEDENKIPVSPE"
     CDS             complement(72709..73233)
                     /codon_start=1
                     /locus_tag="STMDT12_L01020"
                     /note="COG0741 Soluble lytic murein transglycosylase and
                     related regulatory proteins (some contain LysM/invasin
                     domains)"
                     /product="putative transglycosylase"
                     /protein_id="BAJ39768.1"
                     /transl_table=11
                     /translation="MELEWVKLLPDDYARGKLMYKWLLSVLLVLMSTVVHAADCFDLA
                     GRDYKIDPDLLRAISWKESRNRANAVGINPVTGYGSGLMQVDSQHFNELARYGIKPEQ
                     LVSDPCLNIYTGAYYLAIAFRKWGVSWTAVGAYNAGFKKTPLQDARRLDYATDVHRIW
                     IAIKQSKTRQTPAR"
     CDS             73594..73974
                     /codon_start=1
                     /locus_tag="STMDT12_L01030"
                     /product="conjugal transfer protein TraM"
                     /protein_id="BAJ39769.1"
                     /transl_table=11
                     /translation="MAKVNVYISNEVHNKITAIVEKRRQEGARDKDISFSGTSSMLLE
                     LGLRVYEAQMERKESPFNQTEFNKVLLENVLKTQSSVAKILGIGSLSPHVAGNPKFEY
                     ANMVEDIKEKVSSEMERFFHENEE"
     CDS             74167..74853
                     /codon_start=1
                     /locus_tag="STMDT12_L01040"
                     /note="COG0197 Ribosomal protein L16/L10E"
                     /product="conjugal transfer regulatory protein"
                     /protein_id="BAJ39770.1"
                     /transl_table=11
                     /translation="MCPTDRRERTLASQSVNKYILSIQDIYKNSPVPVCVRNQSRKII
                     YANGAFIELFSKEDQPLSGDSYNRYGVEVFLSSLELECQSLGHGAAFCRRFNFHGEIY
                     QIRMENISFDNNEIIVLWQINLFPDHPFFSPDTKTKNLSLSGTESFWNELSPGTLLVF
                     SFYTLGVSHANIAKELGITIRASEDRIKPVKRKIKRNYESFDSFRISCISKGKIISLI
                     DIIREFYCVK"
     CDS             74854..75174
                     /codon_start=1
                     /locus_tag="STMDT12_L01050"
                     /product="conjugal transfer protein TraY"
                     /protein_id="BAJ39771.1"
                     /transl_table=11
                     /translation="MLIKARHFWRVFFCRFPCNHKFISRVSRGEFVRRRNAREGISRT
                     VSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRYPDFYNEEIFREVIEETEST
                     FKEI"
     CDS             75216..75578
                     /codon_start=1
                     /locus_tag="STMDT12_L01060"
                     /product="conjugal transfer pilin subunit TraA"
                     /protein_id="BAJ39772.1"
                     /transl_table=11
                     /translation="MSAILSVQGASAPVKKKSFLSTFTRLNLLKLARAVIPAAVLIFF
                     FPQLAMAAGGSQDLMASGNGTVKATFGKDSSAVKWVILAEVLVGAVMYMMTKNVKFLA
                     GFAIISVFIAVGMAVVGL"
     CDS             75593..75904
                     /codon_start=1
                     /locus_tag="STMDT12_L01070"
                     /product="conjugal transfer pilus assembly protein TraL"
                     /protein_id="BAJ39773.1"
                     /transl_table=11
                     /translation="MSGDENKLRKYRFPETLTNQSRWFGLPVDELIPAAVCIGWGLMT
                     SKQLFGISAAVLVYFGIRKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
                     K"
     CDS             75926..76492
                     /codon_start=1
                     /locus_tag="STMDT12_L01080"
                     /product="conjugal transfer pilus assembly protein TraE"
                     /protein_id="BAJ39774.1"
                     /transl_table=11
                     /translation="MEHGARLSTSRVLAISFIFMALLIVLSLAVNVIQGINNYRLQNE
                     QRTAVTPMGFNASFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRS
                     GAQNQMKVILAEEARRIKADNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
                     IKHYILILKRENGVTWLDNFGETDDEKK"
     CDS             76479..77219
                     /codon_start=1
                     /locus_tag="STMDT12_L01090"
                     /product="conjugal transfer protein TraK"
                     /protein_id="BAJ39775.1"
                     /transl_table=11
                     /translation="MRKNKPYKPFLLAAGWLFSGLVMASGSGTLAPVVVSLANGGQAN
                     IAVSNTDPNLFTVPGDRITAVSGLDGMLTNSEQTGTGGVVVATVSKKPFTFILETERG
                     LNFSVRAVPRAGAGRTVQLVSDLRGTGEEAGAWETATPYESLLVAVSQAVRGGTLPAG
                     WYQIPVTKEALQAPAGLSARADAVWTGNHLKLVRFAVENKMPSALNIRESDFWQPGTR
                     AVMFSQPVSQILAGARMDVYVIRDGEGN"
     CDS             77219..78640
                     /codon_start=1
                     /locus_tag="STMDT12_L01100"
                     /note="COG0419 ATPase involved in DNA repair"
                     /product="conjugal transfer pilus assembly protein TraB"
                     /protein_id="BAJ39776.1"
                     /transl_table=11
                     /translation="MASINTVVKRKQYIWLGIVAVGAAAAIGGGLYLSDVDMSGNGTA
                     AEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYDEIRHELDVLNKQRGDDQ
                     RRIEKLGQDNAALAEQVKALGANPVTTTGEPVPHTPVSPPGPEGEPQPGNTPMTFPPQ
                     GAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKTFSYDAAAKKGPSLPYIPSGSFA
                     KTMLIEGADANASVTGNESTVPMQLRITGPVEMPNSKTYDLTGCFVGLEAWGDVSSER
                     AIVRTRNISCLKDGKTIDMSVKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIG
                     QGMERASQQAVGLGATATYGAGDVFRMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIG
                     AGNEVTVVFQDGFQLKTVEEMAQEQARHRKEDENAESPVPIPPSVDSHMNGFNTDQML
                     KQLGDLNPQQFMSGSQGGHVNGK"
     CDS             78630..79226
                     /codon_start=1
                     /locus_tag="STMDT12_L01110"
                     /product="conjugal transfer protein TraP"
                     /protein_id="BAJ39777.1"
                     /transl_table=11
                     /translation="MGNNRLNNLKGRAVLYRIAGLLRWLIWGVKYAVIWPLATTAIVV
                     ILLFRTGDTTPGQQMAQEIGRVRAMAPSGMFPVRDCPDPAFTVSSPVPLNLTENCPLK
                     ITGAEEYAADIDQSLSQTGWLLWGMLALLYTAVAVMIGDRPYRHNPLTYAYDTATNNL
                     KYIDKENEIRTLKVNTNGQVSYSGNKEAKKEGDKNEHT"
     CDS             79213..79449
                     /codon_start=1
                     /locus_tag="STMDT12_L01120"
                     /note="COG1112 Superfamily I DNA and RNA helicases and
                     helicase subunits"
                     /product="conjugal transfer protein TrbD"
                     /protein_id="BAJ39778.1"
                     /transl_table=11
                     /translation="MNIRNVISVPDESVQDDFVKYVISNCTTKIILSGRREYNFSRQE
                     YNFSVTGMPGAGKTCVLSELIKKLLRENKKGAKS"
     CDS             79446..79961
                     /codon_start=1
                     /locus_tag="STMDT12_L01130"
                     /product="conjugal transfer protein TraV"
                     /protein_id="BAJ39779.1"
                     /transl_table=11
                     /translation="MNRISCLIPFCGALLLSGCAGTNSDFECTATTSDTCMTMEQANE
                     KAKRQEQPETVKPGAVSLPRLAEGNFRTTPVQVVSTVTLPVAKTVAAPRSGQKPPAPH
                     PLFTAAREVKPVAAVSTVSPVVPPRPLRTREQTAALWIAPYIDSQDIYHQPSGVFFVI
                     KPSVWGKPRIN"
     CDS             80096..80317
                     /codon_start=1
                     /locus_tag="STMDT12_L01140"
                     /note="COG1734 DnaK suppressor protein"
                     /product="conjugal transfer protein TraR"
                     /protein_id="BAJ39780.1"
                     /transl_table=11
                     /translation="MSDEADEAYSVTEQLTVTGINRIRQKVNRKGIPVYRCEACGNPI
                     PEARRKIFPGVTLCVECQSFLEKQGRHYA"
     CDS             80310..80777
                     /codon_start=1
                     /locus_tag="STMDT12_L01150"
                     /product="conjugal transfer protein"
                     /protein_id="BAJ39781.1"
                     /transl_table=11
                     /translation="MHKSDAEKMESIIDKHDRIYRRQVRVFKNLGFLSIITAVLSVIT
                     ALFSTSLLLKYTLCVVICVCLIYLVFMFFCLDRYIALSRQTLLWLLRRVEDTADVRRE
                     LLRRLLSGKTLTGRDEDDILRLWWESSNEVEELATRQREQDAIRKFVGGDKSE"
     CDS             80774..80893
                     /codon_start=1
                     /locus_tag="STMDT12_L01160"
                     /product="hypothetical protein"
                     /protein_id="BAJ39782.1"
                     /transl_table=11
                     /translation="MKVYLQRYGVAGFLLVYWSLSFVNEYFLHKHPLSAESWK"
     CDS             80894..81157
                     /codon_start=1
                     /locus_tag="STMDT12_L01170"
                     /product="putative inner membrane protein"
                     /protein_id="BAJ39783.1"
                     /transl_table=11
                     /translation="MRLQALLVTGSVVVTVLRLFLLNSVVRREATAIMTGVAAGLHVF
                     ALLAPSVWLFYQWQWNGLFLLQWQGAVFLFCLFALPVSTFCFS"
     CDS             81173..83821
                     /codon_start=1
                     /locus_tag="STMDT12_L01180"
                     /note="COG3451 Type IV secretory pathway, VirB4
                     components"
                     /product="conjugal transfer ATP-binding protein TraC"
                     /protein_id="BAJ39784.1"
                     /transl_table=11
                     /translation="MKNLLDTVTQAANSLLTALKLPDESAQANQILGEMSFPQFSRLL
                     PYRDYNQESGLFMNDATMGFMLEATPVNGANETIALSLDHLLRTKLPRGIPLCVHLMS
                     SQLVGERIEYGLRKFSWSGEQAERFNAITRAYYMKAAETHFPLPEGMNLPLTLRHYRV
                     FISYCAPSRKKSRADILEMENLVKIIRASLQGAYISTQTVDAKAFINIVGEMINHNPE
                     SIHPTRRRLDPYSDLNYQCVDDSFDLKVRQDYLTLGLRDNGKNSTARIMSFHLARNPE
                     IAFLWNSADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSY
                     AKWFPSVEKEAKEWGDLRQRLASNQSSVVSYFFNITAFCRDNKETALETEQDILNSFR
                     KNGFELISPRFNHMRNFLACLPFMAGKGLFKQLKEAGVVQRAESFNVTNLMPLVADNP
                     LTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSGG
                     FAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITNIDQSAERIRDQLSVMASPNG
                     NLDEVHEGLLLQAVRAAWLTKKNRARIDDVVDFLENARTSEQYAESPGIRSRLDEMIV
                     LLNQYTAAGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRM
                     YRTPRNLKKLNVIDEGWRLLDFKNRKVGDFIEKGYRTARRHTGAYITITQNIVDFDSD
                     KASSAARAAWGNSSYKIILKQSAKEFAKYNQLYPDQFPQLHREMIEKFGAAKDQWFSS
                     FLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGLSIHEAVWQLAWKKSGP
                     EMASLEAWLQEHETFRGTYEYKAETD"
     CDS             83796..84182
                     /codon_start=1
                     /locus_tag="STMDT12_L01190"
                     /product="conjugal transfer protein TrbI"
                     /protein_id="BAJ39785.1"
                     /transl_table=11
                     /translation="MSTKQKQTDGTGARKRDGLWMIPGCLGMVVLNAAISYGIVRLNT
                     PVTVAFNMKQTVDAFFDSAGQKKLTEAQSKALSGRFNAALEASLQAWQREHHAVILVS
                     PAVVQGAPDITREIQQDIARRMRAEP"
     CDS             84179..84811
                     /codon_start=1
                     /locus_tag="STMDT12_L01200"
                     /product="conjugal transfer pilus assembly protein TraW"
                     /protein_id="BAJ39786.1"
                     /transl_table=11
                     /translation="MKWRGLTALLIWGQSVAAADLGTWGDLWPVQEPDMLAVIMHRLE
                     ALQQSGEMGRRMEAFKERVIHNSLRPPAVPGIGRAEKYRSRLFDPSVRLAADIRDNEG
                     RVFARQGEVMNPLQYVPFNQTLYFINGDDPEQVSWMKRQTPPTLESKIILVQGSIPEM
                     EKALDSRIYFDQNGVLCQRLGIDQVPARVTAAKDGRFLKVEFIPAEDGRK"
     CDS             84808..85800
                     /codon_start=1
                     /locus_tag="STMDT12_L01210"
                     /product="conjugal transfer pilus assembly protein TraU"
                     /protein_id="BAJ39787.1"
                     /transl_table=11
                     /translation="MKRYLWLCVLILLAGHVPTVSADAACESRFVNPITDICWSCIFP
                     LSLGSTKVSQGKLPDTANPSMPLQFCPAPPPIFKRPGLAIGYWEPMALTDVTRSPGCM
                     VNLGFSLPAFGKTAQGTAKKEDKQVNGAFYHVHWYKYPLTYWLNIITSMGCLEGGDLD
                     IAYLSEIDPTWTDSSLTSILNPEAVIFANPIAQGACAADAIASTFNKPLDVLFWCAGS
                     QGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGQIMETIGQNTAVCFEYPSPILP
                     KERWRYQMVNMYPDSGQCHPFGRSVMRWETGKNPPNTKKNFGYLMWRKRNCVFL"
     CDS             85825..86127
                     /codon_start=1
                     /locus_tag="STMDT12_L01220"
                     /product="conjugal transfer protein"
                     /protein_id="BAJ39788.1"
                     /transl_table=11
                     /translation="MRIIYKRQHYLSVIRWGAVAVVQVLNESVKLFPFALVMFALMAF
                     YFLPERIISDVVNSWMETDTTGKISLIRLYLEVTFMLSLESSSLLFMYRGKRCTGK"
     CDS             86112..86750
                     /codon_start=1
                     /locus_tag="STMDT12_L01230"
                     /product="conjugal transfer pilus assembly protein TrbC"
                     /protein_id="BAJ39789.1"
                     /transl_table=11
                     /translation="MHRKIKYLAGLIMVISGTVSAGGVANTPENRQFLKQQEELSRQL
                     RDRPDAELKAWADRQIQANPLVQSDRHFLDDLARKQQTSQADKPEQGAVYFISFSIPE
                     EGLKRMLGETRRYGIPATLRGMRDNDLKATADAVLSLVKDGATDGVQIDPTLFTKYDI
                     RSVPTLVVYCRQGYDVIRGNLRVKQALEKVVTAGDCRQVAAGLLDGAGDKPQ"
     CDS             86787..87206
                     /codon_start=1
                     /locus_tag="STMDT12_L01240"
                     /product="putative HNH endonuclease"
                     /protein_id="BAJ39790.1"
                     /transl_table=11
                     /translation="MALTRKQRERLRMKFGGRCAYCGCELPEKGWHADHVQAVLRKSE
                     RCMKAAEKGIFRLKSTGDVFRPEADCPENIFPSCAPCNLLKTTYSLEMFRKQVSLQVE
                     RGRRSSVNFRTAERFGLISVVNKPVVFWFEQYEGENK"
     CDS             87203..89029
                     /codon_start=1
                     /locus_tag="STMDT12_L01250"
                     /product="conjugal transfer mating pair stabilization
                     protein TraN"
                     /protein_id="BAJ39791.1"
                     /transl_table=11
                     /translation="MKRMLPLFLLLAAGQAQADSNSDYRAGSDFAHQIKGQGTGSIRN
                     FNPQESIPGYNANPDETKYYGGVTAGGDSGLKNDGTTQWATGETGKTITESFMNKPKD
                     ILSPDAPFIEKGRDVVNRADSIVGNTGQQCSAQEINRSEFTNYTCERDTTVEEYCTRT
                     ATITGDWRETTEVRTYTLTAFSFSRSGKQIVFSVTVPEAGTISSASLNVITQNYLWNS
                     RAGFMNTIFNMTWGSTITLGGATGMMLSKGQILSGTSCSGNGSCTGTLDDRIFNELTS
                     GRTTFTLTLVMQVKDREWIPRVEWVESCPFNKADGVLKGTECSEPGGTKTGVMEGKPW
                     SLTEACWAYRDKYVTQSADNGTCQAYVDNPACTLATRQCAFYSGEGTCLHEYATYSCE
                     SKTSGKVMICGGDVFCLDGECDKAQSGKSNDFGEAVSQLAALAAAGKDVAALNGIDVR
                     AFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKTNKLTVSVGEFCS
                     KKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLHISFGSSKHPDCRGITVDELQQIK
                     FDQLDLTNFYEDLMNNQKIPDSGALTEKVKEQIADQLRQAGK"
     CDS             89040..89255
                     /codon_start=1
                     /locus_tag="STMDT12_L01260"
                     /product="conjugal transfer protein TrbE"
                     /protein_id="BAJ39792.1"
                     /transl_table=11
                     /translation="MKIMSFLVRVVVTLIVISPAVYWSWDAVSTTTADDIMLAVLIIA
                     AYGLMFTLLFCFVNVLTKLLQHDNESS"
     CDS             89267..90016
                     /codon_start=1
                     /locus_tag="STMDT12_L01270"
                     /product="conjugal pilus assembly protein TraF"
                     /protein_id="BAJ39793.1"
                     /transl_table=11
                     /translation="MRKIQTVWVAALLCGSLTAYGKDAGWQWYNDPVKLPDPKTTDKS
                     AQVRQEPDIMQKLSALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFSMSAK
                     KAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAISKLAEHYGIMFFYRGQDPIDG
                     QLAQVINGFRATYGLSVIPVTVDGVINPMLPDTRPDQGQAQRLGVKYFPAMMLVDPKQ
                     GSVRPLSYGFITQDDLAKQFLNVSEDFKPNF"
     CDS             90230..90523
                     /codon_start=1
                     /locus_tag="STMDT12_L01280"
                     /product="conjugal transfer pilin chaperone TraQ"
                     /protein_id="BAJ39794.1"
                     /transl_table=11
                     /translation="MRKYKLSLPLPDITGVWVFSLGVWFHIVGRLVYRKPWMAFFLAE
                     LIAIILVLSGAYRVLDAWIARVSREERALLEARQAAILAAEKEEKGDKSHVSQ"
     CDS             90510..91058
                     /codon_start=1
                     /locus_tag="STMDT12_L01290"
                     /product="conjugal transfer protein TrbB"
                     /protein_id="BAJ39795.1"
                     /transl_table=11
                     /translation="MSLNKALLFLLLLMGTGVNASTREEIERLYNPHGMAAPSGQKQP
                     ADTQGVQKVTPAPRWFRLSNGKTVNLADWKVVLFMQRSCPWCHQFDPVLKQVAQQYGF
                     SVFPYTLDGQGDAAFPEALPAPPEVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGAT
                     DAAGFMARMDTVLQMYGEKHAG"
     CDS             91048..92430
                     /codon_start=1
                     /locus_tag="STMDT12_L01300"
                     /product="conjugal transfer pilus assembly protein TraH"
                     /protein_id="BAJ39796.1"
                     /transl_table=11
                     /translation="MQGKTRIKPLFILCTALMTVAPAVSADVNSDMNQFFNKLGFASN
                     TTQPSVWQGQAAGYASGGSLYARTQVKNVQLVSMTLPDINAGCGGIDAYLGSFSFING
                     EQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKMASDINSMNLSSCQAAQGI
                     VGGLFPKTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSDSVRDKASDKDKERVT
                     KNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEIMPLPARTTDRAIIRALM
                     EGGTAKIYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLTSIQNKAVSDTPLDNKE
                     KGFISSTTIPVFKYLVDPQMLGVSTSMIYQLTDYIGYDILLQYIQELIQQARAMVATG
                     NYDEAVIEHITDNMNDATRQIASFQAQVQVQQDALLVVDRQMSYMRQQLSARMLSRYQ
                     NNYHFGGGAQ"
     CDS             92427..95249
                     /codon_start=1
                     /locus_tag="STMDT12_L01310"
                     /product="conjugal transfer mating pair stabilization
                     protein TraG"
                     /protein_id="BAJ39797.1"
                     /transl_table=11
                     /translation="MNEVYVIAGGEWLSNNLNAIAAFMSTRTWDSIEKIALTLSVLAV
                     SVMWVQRHNVMDLLGWVAVFVLISLLVTIRTSVQIIDNSDLVRVYRVDNVPVGLALPL
                     SLTTRIGHAMVASYEMIFAQPDSVTYSKTGMLFGANLIVKSTDFLSRNPEIINLFQDY
                     VQNCVLGDIYLNHKYSLEELMESDDPYTLIFSRPSPLRGVYDKNNHFVTCKDASVTLK
                     DKLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRELVSDSYSYFYGSSQSASQIMRKNV
                     TMNALKEGITSNAARNGDTASLVNLATTSSMEKQRLSHVSIGYVTMRNLPMVQTILLG
                     IAIGIFPLLVLAAVFNKLTLSVLKGYVFALMWLQTWPLLYAILNSAMVFYAKQNGAPV
                     VLSELSQIQLKYSDLASTAGYLSAMIPPLSWMMVKGLGAGFSSVYSHFASSSISPTAS
                     AAAGVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMTYQTGSGATATQTRDGNMVMDA
                     SGAQSRLPVNINATRQIAAAQQEMAREASTQAESALHGFSSSIASAWNTLSQFGTNRG
                     SSDSVTSGADSTMSAQDSIMASRMRSAVESYAKAHNISNEQATQELAARSTRTSGGIY
                     GDASAEWGIRPKILGVGGGAGVKAGGRAGIDWSDDDTHQASSSSRSSQDVRHGVDAKA
                     TQDFKEASDYFTSRKVSESGSHTDNNADSRVDHLSAALNSAKQSYDQYTTNLTRSHEY
                     AEMASRTESMSGQMSEDLSQQFVNFVQKHAPQDAENILTNTSSPEVAERRRAMAWAFV
                     QEQVQPGVDNAWGEARGDIGSGMSTVSGGGDKQDVVADHQAHQATVEQRTRDSNISND
                     VKNQVDNMVTDYHSDINDTYGNIQGEEKTIDQQYSGLQKQYKTEALSQNNKYNEEKAA
                     QERMPGADSPEELMKRAKEYQDKHKQ"
     CDS             95271..95759
                     /codon_start=1
                     /locus_tag="STMDT12_L01320"
                     /product="entry exclusion protein"
                     /protein_id="BAJ39798.1"
                     /transl_table=11
                     /translation="MKNLAQIVLVTVVQFIACYLAEWGVAETGIILLFVLLWQGLFIW
                     LFIQIRKKNNISDEFKFSKGIWYVIMPVCSLLSPLLSLMIFIGGTLYELRRVSGCISI
                     KEWVKCQLDDQYDEDRGLDFESVEYRQTTYYNPSTGYPMHGGVDSAGNTFGSRWQDNN
                     DR"
     CDS             95795..96526
                     /codon_start=1
                     /locus_tag="STMDT12_L01330"
                     /product="conjugal transfer surface exclusion protein
                     TraT"
                     /protein_id="BAJ39799.1"
                     /transl_table=11
                     /translation="MKMKKIMMVTLVSSTLALSGCGAMSTAIKKRNLEVKTQMSQTIW
                     LDPSSERTVYLQVKNTSDKDMSDLQSLIAKDIQAKGYTVVTSPDKAYYWIQANVLKAD
                     KMDLRESQGWLNRGYEGALSGAALGAGITAYNSNSAGATLGVGLAAGLVGMAADAMVE
                     DINYTMITDVQISERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNAN
                     KVNLKFEEAKPVLEEQLAKSIANIL"
     CDS             96903..99137
                     /codon_start=1
                     /locus_tag="STMDT12_L01340"
                     /note="COG3505 Type IV secretory pathway, VirD4
                     components"
                     /product="conjugal transfer protein TraD"
                     /protein_id="BAJ39800.1"
                     /transl_table=11
                     /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIIFYCLFIFFWILVGLV
                     LWVKLSWQTFVNGGIYWWCTTLEGMRDLIKSQPVYEIRYYGQTFRMNAAQVLQDKYTV
                     WCGEQLWSAFVLAACVALVICLITFFMTTWILGRQGKQQSEDDVTGGRQLTDNPKDVA
                     RMLKKDGKASDILIGDLPIIKDSEIQNFLLHGTVSTGKSEIIRRLANYARQRGDMVVM
                     YDRSCEFVKSYYDPSIDKILNPCDARCAAWDLWRECLTLPDFDNAANTLIPMGTKEDP
                     FWQGSGRTIFAEAAYLMRNDSDRSYSKLVDTLLSIKIEKLRTYLRDSPAANLVEEKIE
                     KTAISIRAVLTNYVKAVRYLQGIERNGEPFTIRDWMRGVREDQKNGWLFISSNADTHS
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEIVPEARKFGGCY
                     VFGIQSSTQMEDIYGEKAAATLLDVMNTRAFFRSPSYKIADYVAHEIGEKEILKASEQ
                     YSYGADPVRDGVSTGKEMERVTLVSYSDIQSLPDLTCYVTLPGPYPAVKLALKYQERP
                     KVAPEFIPREMNPEAEARLSAVLAAREAEVRQMSSLFEPDTEAVAPTAAEAQAEQPQQ
                     PQQPQQPQQPQQPQQPQQPQQPQQPQPTVVSDKKSAAAGTAVNTPAGGVGQELKMKPE
                     DEEQPLPPGINASGEVVDMAAYERWRQEQEVNTQQQMQRREEVNINVHRGHGKDEPEP
                     GDDF"
     CDS             complement(99146..99544)
                     /codon_start=1
                     /locus_tag="STMDT12_L01350"
                     /note="COG1487 Predicted nucleic acid-binding protein,
                     contains PIN domain"
                     /product="plasmid maintenance protein"
                     /protein_id="BAJ39801.1"
                     /transl_table=11
                     /translation="MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELI
                     YGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHTGQIRAELARQGRPVGPFDQMIA
                     GHARSRGLIVVTNNTREFERVGGLRTEDWS"
     CDS             complement(99544..99771)
                     /codon_start=1
                     /locus_tag="STMDT12_L01360"
                     /note="COG4456 Virulence-associated protein and related
                     proteins"
                     /product="putative cytoplasmic protein"
                     /protein_id="BAJ39802.1"
                     /transl_table=11
                     /translation="METSVFLSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAG
                     ESWDEWFDGNNVSADFMDNREQPSVQERESF"
     CDS             99853..105111
                     /codon_start=1
                     /locus_tag="STMDT12_L01370"
                     /note="COG0507 ATP-dependent exoDNAse (exonuclease V),
                     alpha subunit - helicase superfamily I member"
                     /product="conjugal transfer nickase/helicase TraI"
                     /protein_id="BAJ39803.1"
                     /transl_table=11
                     /translation="MMSIAQVRSAGSAAGYYSDRDNYYVLGSMEERWAGKGAEQLGLQ
                     GTVDKEVFTRVLEGRLPDGADLSRQQDGGNKHRPGYDLTFSAPKSVSLMAMLAGDKRL
                     TEAHNQAVDIAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQEPQLHTHA
                     VVVNVTQHDGEWKTLSSDKVGKTGFIENVYANQIAFGKIYRAVLKEKVEALGYETEVV
                     GKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVKMAE
                     WMQTLKDTGFDISAYRESADRRAEIQAAQPVPSQEQPDIQQAVTQAIAGLSDRKVQFT
                     YTDVLARTVGMLPPEAGVIEKARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVR
                     ALSSDIMKQNRVTVHPEKSVPRTGSYSDAVSVLAQDRPSLAIISGQGGAAGQRERVAE
                     LTMMAREQGREVQIIVADRRSQTNLKQDERLSGELITGRRQLQEGMLFSPGSTVIVDQ
                     GEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKEAGVNSYRWQGRQQTP
                     ATVISEPDRNVRYARLAGDFVAAVKAGEESVAQVSGMREQAILAGMIRSELKTQGILG
                     QQDTMMTALSPVWLDSRNRYLRDMYREGMVMEQWNPEKRSHDRYVIDRVTAQSHSLTL
                     RDAQGETQMVRISALDSSWSLFRPEKMPVADGERLMVTGKIPGLRVSVGDRLQVSAVN
                     DGVMTVTVPGRAEPASLPVGDSPFTALKLENGWVETPGHSVSDSAKVFASVTQMAMDN
                     ATLNSLARSGRDVRLYSSLDETRTAEKLSRHPSFTVVSEQIKARAGEVSLETAISRQK
                     AGLHTPAQQAIHLALPVVESKNLAFSQVDLLTEAKSFAAEGTGFADLGREIDAQIKRG
                     DLLYVDVAKGYGTDLLISRASYDAEKSILHHILEGKEAVTPLMERVPGELMETLTSGQ
                     RAATRMILETKDRFTVVQGYAGVGKTTQFRAVMSAVNLLPESERPRVVGLGPTHRAVG
                     EMRSAGVEAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAA
                     GGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVAIMKEIVRQTPELRDAVYSLINRD
                     VNKALSGLENVKPVQVPRLKGAWAPENSVTEFSRLQERELAKAAQEAEKKGEAFPDVP
                     VTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIQDALAKPGEQQVTVPVLTT
                     ANIRDGELRRLSTWEAHPGALALVDNVYHRIAGISKEDGLITLEDKAGNTRLISPREA
                     AAEGVTLYNPETIRVGAGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGKQTRV
                     VRPGQDRAEQHIDLAYAITAHSAQGASETFAIALEGTEGGRKQMAGFESAYVALSRMK
                     QHVQVYTDDRQGWVKAINSAEQKGTAHDVLEPKSEREMMNAERLFSTARELRDVAAGR
                     AVLRNAGLAQGDSRARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGAGLRG
                     FTGEGRVKGSEEAQFVALQGSRNGESLLAGSMQDGVRIARENPDSGVVVRIVGDGRPW
                     NPVAITGGRVWGDIPDSNVQPGAGNGEPVTAEILAQRQAEEAVRRETERRADEIVRKM
                     AEDKSDLPEEKTAQAVREIAGQEQDRMTPPEREPPLPESVLREPQRERETIREVAREN
                     RGRERLQQMEQEMVRDLQKEKTPGGD"
     CDS             105131..105871
                     /codon_start=1
                     /locus_tag="STMDT12_L01380"
                     /product="conjugal transfer pilus acetylation protein
                     TraX"
                     /protein_id="BAJ39804.1"
                     /transl_table=11
                     /translation="MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVA
                     DHINRILHLNQEWLFLAGRGAFPLFALVWGLNLSQHTHIRQSAINRLWGWAVIAQSGY
                     FLAGFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAALLLLTAWIPLSGTSYGVAGVL
                     VLVICYRLYRTTDTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLTVWLVSLTG
                     KSRPRFWPADFFPVFYTCHLAALGVLAM"
     CDS             105926..106489
                     /codon_start=1
                     /locus_tag="STMDT12_L01390"
                     /product="conjugal transfer fertility inhibition protein
                     FinO"
                     /protein_id="BAJ39805.1"
                     /transl_table=11
                     /translation="MTEQKRPVLTLKRKTDGEAPARSRKTIINVTTPPKWKVKKQQLA
                     DRAVREASLAEKKARARKDLSIYLRFQSVEEAVSTLKPWWPGLFDGDTPRLFACGVRE
                     ALFEDASRRGIPLSHKKIIRALKAIARSEAYLSAMKAGACRYDTEGYVTEHITVEEEQ
                     YALARLAKVRAQNARKAELRAVLAQTV"
BASE COUNT        25206 a        27622 c        29328 g        24354 t
ORIGIN      
        1 gagtgaacgg atgaaacaga aagaccgtct gtacggcgtg gcaccggcct taccccgatt
       61 gcaggctgtg aagctaggcc gcaggtccgc tatgtgttta agtactggcc cacatttgta
      121 cagcagtggg aaaactcgct gaaagccgca cagaaggggc tggaaatctg gaaatcagcg
      181 agggcggatg cctggcttgc gtatcacaac ggtatttttg ccaccagtca ttatgaaggc
      241 gcgctcacca gtgaagatat cagtagtgcg gcggccgccg ccctgaaagg gcataaaatc
      301 aggggtggaa acgtgaacac gaaaagcata ctggatggca gtaaccgact ggcacatacg
      361 cttgcgctgc agggctagcc ggtgatgata atgatgccgg ttaaggaggc cacggagaag
      421 aacgtgacaa tgataccggg cggcgcggga caggaaactc tggaaaacgc ggccgtgctg
      481 attctggccg ggatggagcg taatgatcgt gccaccacta gggaaggcaa taacaattta
      541 tcctgacgcc tccgccgctc gcgtcgttgt ccagccccgg caatccggga aaaacgagtt
      601 tcccccgatt ccggcgtttc tgaagtaata aaatcactac tctaatcaag tttatatgag
      661 gtacataatg agactcagga aaggtcatgg attgacgttg gtcacacttg cgtgtttatc
      721 cctgctgggc tccctgccag ctattgcggc accgtccgtt caggccggtt tttcaccgga
      781 gggcagcgca agcagctggt tcttaagact attgaggctg cgcaacataa tatccggctg
      841 atggagtatt ccttcacctc tccggaggtg gctggcgctc ttattagtgc aaaacgtcgg
      901 ggagtggatg tcaggggggg ggactggact ggaaagccaa taccgggaaa aacaataacg
      961 ccagcagggt gacaatgaac ctgctgacca gtgccggcat tccggttcgt accgtcagtg
     1021 tgtacaaaat tcttcatgac aaagtgatcg tcagcgacgg tcgccacacc gaagtgggat
     1081 cgtttaatta ttcccgtgca gcagaccgtt cgaattcgga gaacgtgctg tcgtctggga
     1141 tgactcagtc ctagcccgca gctacctgaa ccactggaca tcccgctggg cgcagggaac
     1201 ggactggaaa cagacgtact gacatcccag gaaacgatcc tgaaacgtaa accgtgcgcc
     1261 aacacaggtt acgttcataa agtaagtcgc tgattttaga aatctgtagt attctctgca
     1321 aacgatccag gtttgatcct tgaggaggca gagatgtcgc agattgaaaa tgcagtaact
     1381 tcctcatcga aacgcattta cagaaagggt aatcccttat cttccgctga gaagaagaga
     1441 ttatctattt cacgaaaaaa gacgacgcat aaagagctca atgttttcat acaaaacata
     1501 cataaagaaa gcttgcagca gctttgtgaa gagactggaa ctactcaggc tcaaatgatt
     1561 gagctactaa ttgaacggga aatggctaaa agagcctgag ataagaaggt gaatgagtaa
     1621 ctttcttgat cgtctcgtca gtgagtgtta gattgctgat cgtctaaaga attttgatgg
     1681 ctggccacgc cgtaaggtgg cagggaactg gttctgatga ggtgtctacc cgggaccaga
     1741 aaagcaaaaa ccccgataat cttctcattt cttggcggga acgaaagatt aacggggcct
     1801 acttaaactg tatagccacc aatcaggcta tgcagggagt atagttttat gctcagaaaa
     1861 tttcaatact tgtttctgtg gcatttactc cttccgtgca ttgtaagtgc aggcagaagt
     1921 gactgacacc cgaacactgt tcactcatta ccgacaggtc aaaaatccga atccggaatt
     1981 cacgccgaga gaagggaaaa agaccctgcc gttctgtcgt aagctgatgg cgaaagccga
     2041 agggttcacg tcccgttttg atttttccgt ccatgtggcg ttcgttcgtt cgctgggaaa
     2101 gcgtcaccgg atgccgcctt tgctgcgccg tcgtgccatc gatgcgctgc ttcaggggtt
     2161 gtgcttccat tatgatccac tggccaaccg tgtacagaga tccatcacca atctggctat
     2221 agagtgcggt ctggccactg agtcaaaaag tggtaatctg tccatcaccc gcgccacacg
     2281 ggcgctgaag tttatggcag agctggggct gattacctac cagaccgagt acgatccgca
     2341 gattggctgc aacatcccga ccgatatcac cttcacgccg gcactgttct ccgcgctcga
     2401 cgtttctgac gtggctgtta tggccgcccg ccgcagtcgt gtcgaatggg aaaatcagca
     2461 gcgcaaaaag cagaatctgg agccgctgga gatggatgaa ctgatagcga aagcctggcg
     2521 atttgtgcgc gaacggttcc gcagctacca gtctgaacgt aaactgcacg gactgaaacg
     2581 cgcccgggcg cggcgtgacg cggacagaag ccgtaaggac atcgaaacac tggtgaaaca
     2641 gcagctgacg cgggaatacg ccagcggacg ctttaccggc gggcttgatg ccatgaagcg
     2701 ggagctgcag cggcgcgtga aagagcgcat gatgatgtcg cggggcaaaa actacacgcg
     2761 actgaccatg gccaccgtcc ccatataacc caccagatta tgaaaatccg gctgacgtcg
     2821 gaggattttg tacgtctgtc gccgggtgcc gcctgttttc tgcgcggaac gctcgttctt
     2881 cctgccaaaa tatctctcat tctgctgcca gaatggccag aaatgttccc gcctgagcca
     2941 tttccggtcg caatattcag ttactcacag ataactgcaa gggacctttc cataaagtta
     3001 caaccgatat actgacaaag cgccaggcga cctgatttca aagtgcgtgg tttcctttaa
     3061 accccagatc tgtacttctt ttaaatacat aatctttctc tcttataaat aaataaccta
     3121 ttcatcacct gccctgtgga caggttccag agaatgcccg cccttgcagc ggactcacgt
     3181 ccgcgccggt tcggaaacaa cattagtacc tcccgtcgcg acgcgccggg ccccggtcat
     3241 gcaaatagtt acaacatcca aaatcctgac caacgaaacc ggagcaaaaa cctgatatcc
     3301 agcccattcc caccactgaa aagcgccgcc gccccggccc aaagggccgg aatggagtcg
     3361 cttttaataa tgaatgatgt aactaaatta ctgagtggcg ttatgtcccg tctggctttg
     3421 cagggcgatg gcccactacg tgaaccatca ccccgccagc agggtatttt atatgcagtt
     3481 gtcaaccact gaatcggaac ccacgccaaa ggcgcgggac cccgcgattc agcagttgac
     3541 aattttagct accgtgacgt catacgttcc ttttgctcca tcccctgaac gtaacaggag
     3601 ccactcagaa ccgttttaaa cagaaagtac cagcaaagca gaaaaaattg ctcagaacgc
     3661 actacaaact caattctcat gagtctgccg tggtcgtggt gtcggacctg gacggcggga
     3721 ggaaggtgat gtcgctgcac cggggactct gcggcctgcg aagcgatatc ccgcaggcgg
     3781 aggggataac ctcagatgac cgggacacgc tgtggatagt cagtgaaccg aatctgtttt
     3841 accgcttcac ccgcacggca gcgtcctgag gatgaagcgg cgtctccatg gcttgaggat
     3901 tggagccttt atgccagaag ttacaacccc ggattgcagc cggatgttat acgacggttt
     3961 tactgttatt ttgcaataaa actataaaat aaatttccgt caggcttgca tcttgaaggc
     4021 gtgtatccgt aatatttcct gaactggctg ataaaatacg gcacactact gtacccgcac
     4081 tgatatgcca ctttcttgac cgccccctcc tgcataacaa ttaactccga tgcttttttc
     4141 atcctgcatt ccagcagaat acgtgtgtag gatgtattct cctctttcag ttttttcttt
     4201 aacaggctga cactgacata cagctcgccg gcaacccggt gtatggtcca gttttcactc
     4261 acattccggt ttatcaccgt agccacctgg tctgccatac tttgtttcag gcatgtcttc
     4321 aggaaaggga aaaaaatatc ctgctcacaa aaggccgata ccagtgcaaa cgtcaggaac
     4381 ggattctctg gtccggtctc tccgtaactg ttatccgttc cggcacagag tctcaccatc
     4441 aacggacgga acacagagtc ctctgggcaa ggctgcacaa ggtaccgggg gatgtctttc
     4501 gggatataaa atttaagaac atccacatcc agctgccggg caaaccggca cagcgtttcc
     4561 cttgttatca ccacatgatg gtaccaccgg taaaaatgca tctctgtctg atgcactttc
     4621 gtcaggacaa tactgtcctg agcgcaacga aatgaaaatg cctttccctg attgaaggtt
     4681 gatcctcctg ccaggaaaaa aagaagatat ttatccagct ccattattac ctgccattcc
     4741 ctcccatgac ggggccggtg tttgtactgc tctccccccc tgaagccccg gccgggtgat
     4801 gccggggcct gtggttgtca gtagtagtgc tgcagcagcc cgggcatgta ccacaccaca
     4861 aaccagcttc ctgccatcac cacaaaccag aataattccc tgaaaaaaga tgcgctgaat
     4921 gttatgtttt tcatcatatc tgaccgggag cggaagcctg cggctccgct ccctttcctg
     4981 ctctccgtta tcagaaccgg taaccgacac caacgttaac gccgttcagt ttcgctgcgc
     5041 caactttact tccctcatag cccagatcga tgaccacatt ttccaccgga ttaaactgta
     5101 cgccggctcc ccaggcaaac cccgttctgc gctccgaacc cgtgaaccgc ccgttgtatc
     5161 ccggcatgct gatacgctct ttcacttcag ccctgccggt accggcaccg gccagtgcat
     5221 acagagatac cagctcgttc acacggacag ccggacccgc catcagcgac cagtacgtcg
     5281 ccttcacatc atcacgccag ctcattccgc caggaatgcc accggactct ccgcgcttac
     5341 ctgactgcca actgaacgac gccatcagtc ccagcggcgt ctgagcctca tagcggtatt
     5401 tcaggttcac cccacggata tccttaaaat gctctatccg gctctgggca tatcccaccg
     5461 acacggaatg ggtgtcagcc tgtgccaccg gtacggcagc cagcccggct gcggacagca
     5521 gcagtgagga cagaacgatt tttttcatga taaaactccc tgaacacagt taagttcatt
     5581 gtgttatgac agaaggtgtg ctttctgctc ctgcacaccc gtaacgccgc ttcatcctca
     5641 ggacgctgcc gtgcgggtga agcggtaaaa cagattcggt tcactgacta tccacagcgt
     5701 gtcccggtca tctgaggtta tcccctccgc ctgcgggata tcgcttcgca ggccgcagag
     5761 tccccggtgc agcgacatca ctttcctccc gccgtccagg cccgacacca cgaccacggc
     5821 agactcatgg gaaagtacat acaggagccc gttgttccgg tcataatgca gaccggagat
     5881 atccttcagg aaccatggca gggacgcccg gtgtgtcagc gagtcactca ccgacagcgc
     5941 atcagggctc cggtccgtca cgtaaagccg cagcggtttt ttctcctgcg ccaccatcag
     6001 ggcatgctct ccccgtcccc gggcaaggcc ttcaaaaccg gcattgtcgc tgtgcctgtt
     6061 cacatccagc gtcaggctgt atgttgccgg cgggaggacg gtcgtgctgc tgtcaatgca
     6121 gtgggtggtg agcgtccgct cccgctcccg ggacagggca tagcggttcc cgccgaggta
     6181 ttcgatggcc tcaaaatcgt ggtcgccgtc tgacggtatc acccgcagca cgttcccttc
     6241 cgtgtccagc tccaccaccg aggaggggtg gtcggtcacg gcaaacagcg ttctgctgtc
     6301 cgggttccat gtcaggccgg agaggccgcc gtgtatcccg gtaatttctt tttctgccgt
     6361 gagatgccat tctgtttcct gcgggtacca ggactccggg aaacacaggg tgagcacgcc
     6421 ggccgccatc aggagaatgg cggtcagcag tgctgctttc tgattacata aatatctgaa
     6481 catcgtggtg gtgaaggtta tgttttctgt tacaggggag accggactcc acatcatgtc
     6541 ccacggctga taagccagat cacgaccagg acgccggtca gaaagccgga gataaagacg
     6601 ctggtcagca gcaggagaat cagtgcacgg agcgggagga tatctccggc ctgtatggtg
     6661 cctttatcat cagtctgcat cagggttacc ggccagcagt ttccggacca ccgcagcata
     6721 acggctcctg aagttttcga cggagaatgc accgaaggcg gcattgttga tatggtaacg
     6781 gccacggaca tacacggaag gcgtccccct cacgccatat tccttaaaca gccgttcctg
     6841 taatgccacc atgtcattca cggcgggact ttttatactt ctgtcatact ccccacgact
     6901 gataccggtg gcagacataa acacccggcg gacatcgtcc ggggaatgca ggcgtttctc
     6961 caccatgccg gccgtgaaga aggccttctc gatcacgtca gtttccttca tcaccatggc
     7021 cagcgcccag gcccgtgtca gctcatggcc gagggggccc agcaggctga catggtattt
     7081 gaccatccgg ctaccttgcg gcagtacgtg ccggatggcc tggtccacgc ccattgtctg
     7141 tgagaacgca tagcagggcg ggcagtaaaa ggaaaagaac tccaccacag cgggggcatc
     7201 aaccaccggg ggagttatgg actcccactc ctgcgcaacc acaggacaga cgcagccagc
     7261 taacaaaaaa gaaaataata ttcccttcag ggaaaacaga tcccgggcat aattcatcgt
     7321 cacggaaaca ctccatggat aacagatata cagaacgaaa ggccgcttaa cggcaccgcc
     7381 tgacagcagc agtaaatatt aattcatcag gtatggtcat taaggcggca gccggaatat
     7441 tccggttatg cgttttccag aataaaaaat actgacacac aaaagaccat tgccattaat
     7501 ataactacgg ccagacaggc gtaataaata aatttcatga acatcataaa ataactttca
     7561 gtgatactta tccggcctcc ggtccgcatt ccaggccggc ttcttccagt gaatgaaccc
     7621 ggttcaggtc ggtgtacagt gtcaccatcc ccagaagcat cagggtcggc aacagggttg
     7681 catcattccg gacgccgagg cgcctgaaag cctggccttt ctgggcagaa atggttttga
     7741 cgctgcgaaa acagagggca gcaatctgcc cgctgttata gccccgcagc agcagccgga
     7801 taacccgcag ctcagccgga ctcagtccgc cgtcgctgtt aaattcgata caaagccggt
     7861 cgtaccatat ccggctgaaa tccccgtctt ccgggaaagc ggtcagagca gacgccataa
     7921 tccgggaact ccctttccgg cattcacttt ctcaagcacc ccgacatcgt ggagttgctc
     7981 aagatacaag cggacctggt agatactgag tccggcagca tcggcaatat cgcgggtttt
     8041 aactggcgcg ccgtcatcca tgttctgacg ttcctggacg atggaaataa tttttgtaac
     8101 aatggattca ctcataaacc ggaattgctc tttttatgta aataaaaaca gtctcattaa
     8161 tattcataac acaaggattc taagccaccc tctcagcctt aagagacata tgatataaat
     8221 atgtaccagt ctgtttgttg cttaatttat cgttgcatct gagctaacta aaccacgtat
     8281 tttgtacatc gttaactaat ttacgtctgg taattcgtgt tactttttgt tctcacccca
     8341 ttagagtcga gacacaactg ttacctcata gttatttacg aaattcctct tggtcgccta
     8401 tagatacgtt gaggaaaatg taatgttatt agcgccgggt ataacgcaga tgctttggcc
     8461 tcagtacacc acgcatggat attttttgtc acctgtcaat tatggctata tcgcctgcct
     8521 tgcttatgtg gcgtgaagat tacgctttat tgcagttgca cacttattaa cactgtgccc
     8581 gaacttgtct gtcctggtcg tattgttcct ggcgcaagaa caagtttaca ttcatctcca
     8641 gcacgcattg tcgtgcactg acctccagta gtttttaaca attgtgcatt tctggccact
     8701 tcgctgggag ttatcgactg tgttacacga atagaagcac caggagtccc actagccttt
     8761 agtatcactt gctcgaacgc accatttacc ccagccttgc tgtttatcga atctggatgc
     8821 tcaacggtaa tactttttgt cgtacctcct gcaggaaagc ttgtcgacat tacaccatta
     8881 ccgagggtat aacgtgctcc agatgaagaa gtgagtgtga cgctcggtga tggtaagtga
     8941 tattggtgaa gccacgatcc cagcgaactg gcctcacatt catcatatag ggttctagtc
     9001 gtacggactt ctcctgttcg gctgagacta aacatcaacg tatagccagc ggggagtata
     9061 tacccttcac ccgcaacaat gccattctga accaggcccg gggcccgaaa cattacgccg
     9121 aaacccttat ctgcaacctt gcactcaact tctgcgggat atcgtgttcc atcgggtgct
     9181 ataaccatag ctgttccatt acaggtacgc gatataattt gtacgttgca ctgactgaat
     9241 gaagtcattg ttaccataga aagggctgct tggtctgact taatcataaa gttacttgcc
     9301 tgcatttggt attggtagat tccttgacta tatgtggata cagttgtggt ttttgcatga
     9361 gcagggtaag tgatgaccgt tccccccatg atgatgactg aagcaattag taattttaac
     9421 attttatagc ccatattttt acgttgttat tcactacata gttctttcgt ccgatgttta
     9481 gtcagaccca tagtgagtta acctacataa tcatttacag agccggtgtc agtcttagcc
     9541 actcggcatt cagttgattc cggcagcata tcccccatag ttcctctggt ttcagattgg
     9601 ggtacgatga ttttctgttg accgtggtat tgcataaacg gggttctctt catcaaacag
     9661 tagcccagcc gtttttactg tgggtaaacc acatcaaaaa ccaccgtcac atcaatattc
     9721 ccctccggtg aatttgccgg aatatcagtc acagggcgga gctcacagtt gttcggggag
     9781 ggggatatgc agaaagcatc atcgtccttc ccagtcagtt tcacccgctt actaccattt
     9841 tccagccaga acagcgggcc attatttgac ggctgaccgt tcatccgcat aatgactacg
     9901 ctgctgtcac cgcccccctg cagggttcca gtggtgtttc ttgctgtcag tgctgtcttc
     9961 accacagtac tctgcccaca atccactttc acggtaaacg gtctgtgttg catccggact
    10021 cctttattca ttactcccag ttgatagttc atcgtattac cgccgttatc aaaggtcagt
    10081 ttgcaggtct gttgcgggtt ggttaacgtg aatggaatgg ttatattttc cttcgaagcc
    10141 gcttctgtcg ccaaagggaa cagcagccca gtaaccagcg ctcctgcaca cacatgacgt
    10201 ttcatccacc tgatttcact tcgtctcatc atcctgctct cccggctcac ttcagcgtgt
    10261 agtcctgggt gccgccccag tcgttaacag cctgcaccgt caccgttccg ttcagcgaca
    10321 gtttccccag cgccacctca ctcttcggcg ccagctgcgc aatctcattc atcaccctgt
    10381 cgttcagcct gaccggctgc ccgttcagtt tcaccccggt gaccgcaaag tagtacggcg
    10441 tcgggttctt caggtaagcc tcaccgccgc ggtgcgcaat ctgcaggttt ttctcggcat
    10501 tacggcgtcc ctcaacaagc gctttcggcc ggtaaatcag cttcaccttc gtgttcacgg
    10561 ccaccgccag gacattccct tccgacgcct ttggcttcgg cggaatctcc tgaacgttca
    10621 gccagaacag cgactcacgg tctgacggca gcgtgctgtc cgtcttcatg atgcggataa
    10681 tctgcttttc cttgggcctg accttaaaga acggcggcgc cggtaccata tacaccgtac
    10741 tgctgccctg ggtggtgttg tctatccaca cctggccgcc aaaggtctca tccgcctggt
    10801 tggtcacctc aaatgaggtg ttctttctcc cttcctcata gataaaacgc gtgccgttca
    10861 gcacaaaggc tgccatggcc tgcccgctga cggccaggga cagcagggac accagtcccc
    10921 acttcatcat cttattcaca ataaacctcc tgaactttgc cggtattagg cacaatacct
    10981 ttcactgaaa aatggcagac actgccgtcc ccccgctcga cgctgacccg tgacggcgcg
    11041 ctcagcatat tcatcagcag gacgccgtta ccggcaatga acccggcatc cagtccctgc
    11101 tccgtctgcg cgctgccccc gttcaatatc cgtccgtcac gctccttcac ccgcaggatg
    11161 tagcgcagca catgctcggc gccaaactcc cggtacacga cagctttttc cgtcggcacc
    11221 acgttaaagg aggtggtctg cagctccagg tcatccggca cgttttccat gtccacgctg
    11281 acccggttca gggagtaatc cgacaggttc accacggtgt atcccttgct gttggtgggg
    11341 gctgagccgt taatcctcac gcccttcacc cccggaatgc gcgccacgcc cagcgtgtta
    11401 ccggtttcct tcgtcatcat caggccgctg tctgccgtgc ccagaattgt gccgctcacg
    11461 ctgcctgaca cggtggtgtt atcacgtccc tgcgacagca tcatgttggt ctggatggca
    11521 tcaaagccat acgagaggtt gccgctcagg ctgcggtcgc ccttatcact caggttggtg
    11581 ttcaggccgt agctcaggcg gtccgtcgga cttgccgaca ccccgctgtt catccccatc
    11641 ctgccgctgc tgctgtagct cagtccggta ctgctgtaat ggcgaacccc acccagggtg
    11701 aacggaatgc taaaggagag cgacgtgctg tagtccggtt tgtccaggta cgggcgttta
    11761 ctgtagctgc cgttcaggaa gaccgacaca ccgtccagaa tggtggtact gagggaaaca
    11821 tcgcctccga tggcctttcc tttcatccac cagtagtcct cctgccagcc ggccagattc
    11881 aggttactgt tccccaagcg ttgcgagaag cgcatctcat agcgtgattt tgtgttgtag
    11941 cgggtatacc ggtctgtact gtagaagtct gcgaactcca catacccctt actctggtaa
    12001 cggtaggcca gcaactgcag gtccgagctg tcagagaagc ttttggcata cttggcgctg
    12061 acgctgtgcc cgcgtttgtt gtctccgttg tcgtatttcg cctgtgacag gttcatcccg
    12121 gcggacacgg cgccgaagcc gcccagggcc tgcgtcacgc tcaccccgcc ggcctggtat
    12181 ttaccgtgca ggatagaagc ggcattcagc gtggtggaat caaagccgta ccccacgctt
    12241 cccatccaga acatgccgtt ttcaccgtca gcgaacggtt ttttcagctt atagttactg
    12301 gacttgcgac cgaccgccac attgtattca acctccccgg gacgcagcag cgtcggcagg
    12361 gtggtgaccg gatagacggt ggtggttttg tggccggacg catcctccac ggtcaccacc
    12421 aggtcaccgt tccccacgga gcggacatca tccagctggt acggaccggg cggcaccact
    12481 tttgagtaca cggcgtaccc gttctggctg atggtgacgc gggaggtgga gttcgccacc
    12541 ccggtgataa gcggggcata cccgcgggcc tcccacggca gcatgttact gttggagcgc
    12601 agtgccgccc cgtaaaagcc gaaatcagag aacagggcgc tgcgggtctg ggatttaccg
    12661 agcagcaggt ccccctgcac ttggctgatg gcggtggaca gcgtgatatc ccgggcggtg
    12721 aactcaccgg agccgtcagc gtaccgggat gcgctcatgt tactggccag cacccagcgt
    12781 ccgaggttga ccatcaggtc ggcatttgca taggcactgg tgctttgccc ggacgtctgc
    12841 gaggcgttgg cggagtactt caggcgtgcc gccggcacgc cgtagtccca gcggctgggg
    12901 tccgttttac cgaccaggaa cgactgggga atactgaaca ccaagctctg ggagccatag
    12961 ctgaagtcca ccctggtata ggggttgcgg ctgaggacat agcactgccc ggcagcattc
    13021 agcgtggagg catatccctc caggcggaca ggaaccccgg cagctttcag ccactccggc
    13081 gacaggcaca gggcatttgc tgattcttcc tgtggcgtaa tggacaaacg ggctttaccc
    13141 acgttttcct ggttaacaat gacgtcgaca taatactgtc cggccggaaa atccgagccg
    13201 gattttaata cggagggaat ggcgctcatt ccctgcagga aatccaggtt cagctctgag
    13261 tcagtgctgg caaaagatag gtgagaaaat aaggcgagac tcagcgccga cagtttaaat
    13321 acccggtgat gaaatgacac aacaaccccc ctgactcagg cagtccctct ccggaggaaa
    13381 ttgcacggaa aatacaattt cctgttaaac aggtaataac ggaatgcagg atggcgggat
    13441 gaatatacag gtgctgtccc ggcctgcaat cagcgatata aaaataacga acaaggtaat
    13501 taaatgcggc gcacggcggt gcgccgcgtc atttaaataa aatatgtaag gttctgctta
    13561 cgggggatta tttgtaagcc actgcgaaag atgccacaga cttgaagtca ccttcggtcg
    13621 caccaccttt cagcttggct ttgaactgca ggccgtcggt ggtcagcttg gcaccttcaa
    13681 agtcaaccgt gctggcgtta gcgtttacag cccccgggtt tttggagttc acgctttcaa
    13741 ccagtacttt ggcatcagta gctgtaccgc tggttgcccc aaagccttcg ccatccaggg
    13801 cagcagaagc ccaggaaaca gtggccgttt tctgagccag atttgcacaa ccctgtgcat
    13861 tcgggtcaac cggtttcatg gcgaagtcaa caaaattacc cggctggtta gcctgaacgg
    13921 tacccagctg aacaacctgg ttcggctgag cggcgccgtt gacagaagtg gtcaggtcac
    13981 aggttgttgc gcttactgaa cccaggaaag ttacttcatt ggcagcgtgt gcagtcccgc
    14041 ccagaacacc cagtgcaata atggaagcaa taatgctctt tttcatgtat ataacctctt
    14101 gaatttaatt ttttgtcttt cacaaaatga aaatacacat tcacattttc cagcatggct
    14161 ggcgttattc cttcccggac agggcagaaa taaagtcagc tatgacgtga catcgtaaaa
    14221 atcctgagtt accatccgat atatttaata accaccctgt aaaacaggcg cgcaaatacg
    14281 catccgaatt aaattcagtg tctgttatct gtttttaatg ccaggcggaa gctgcccctc
    14341 agtccgtgaa caacacagac ttatgaataa taaacaacca tctgcgcagc ggcctgactg
    14401 atgcgtgaca ggcggttcag gctggtactg aaatacccgt tgttcacttc atagcgttca
    14461 cagacatcct ttctggacac accaaaaaca aggtagtccc tgagtgcctg aataatcttc
    14521 tcactgtgaa tggatgatat accgatgagt aaccagaaat gttcctcatt tacttttgca
    14581 ggtatcagcg cccctcttct tattctggcc agcatgattt ctttgcccaa ataataatca
    14641 gcatcttttc tgttcagcat cattggatta tctccggctc aatctggtgt tgtgacagaa
    14701 aatttccaaa ggaaacaaac tttatgccgg gaattatata cagatgtttg ttttgaaaaa
    14761 gatcattttt gcgatctttt ctaccatgca aacaaaataa atcagaatgt ttcaccacaa
    14821 aatcacaaga aaacaggtta aacgtctatt tatcatacat aatgcagaat aaaagatcgc
    14881 tatagcacaa aaaatcaaaa tatctgcaat gcaaatcttt ttgtacatga aaagacatat
    14941 atcaaaaaag aaaaaataaa tataaacttt caaaaatata aaaaacagac aaataagcac
    15001 cagaaaaaac ataataaaaa taagttctta acatccgtga aattattatg taatgcttcg
    15061 ggctgtgaga ttatccgagt gtatctttgc cttcagaggc tttgggcagg acactccgta
    15121 agaagatgaa aaaatcacgg cgaccttcac gccaaaacag agaagtaatg accagatctc
    15181 gtgtattgct ctgtaatgtt tatgctctcc ggggttaaga gcctccccat gaaagcgctc
    15241 actggataaa ggttatccat actagcaaaa ccggatgcaa tcaggaaaaa ggagcaaata
    15301 tcctgtcgct tactttcgct taagatttag ttaagatttg ttcattaagt tttccaggaa
    15361 tttttttcag ggaaaacaga aatggaaaaa actttaatca ctcttatcat taccactctt
    15421 tctttcagtt tgcttgcccg gcaaacggac attatttctt ccgtagagca ggtatgttca
    15481 gggaggattt acaggcccgg cccccaccca gacatcggtt tcacaggcta aaaaacagtg
    15541 ggatgatgcg tgggtggtac tggaaggcaa cattatcagg caagtcggtc acgagcttta
    15601 tgaattccgt gacagcagcg gtactgttta tgtggacatc gataacaaat actggatggg
    15661 gcaaacagcc tcgcctgcgg ataagattca tattaaagga gaagtggatc gaggctggga
    15721 tggtataaag atagatgtaa aaaacatcca agtgatgaag tgataccgga gtttaagaac
    15781 aagttgtata tgcgggctgc gccgggcaat taaggccaga ctaactgtat ccataaccag
    15841 tgcgtacgct acgtgaaaaa tagccgataa acaacatcat ttccttcccc tgcaaatttc
    15901 accagaacgc gtttcgttgt tgccgatcac ccgggcgctg tctgaaaaaa tacaggcacg
    15961 acgcgggcac ctgccaaaag atgaggtccg tctggtcccg ctaacagata taagctatgt
    16021 caggcagatg gaaggctgga tgatcaccac ccgttccact ggcgcgaacc cttgtggacc
    16081 gccaccgatg aaaccatgca taactgacta aagcaggcag tcaggcgggc cgaagctgat
    16141 ggggacattt ctcaattccg gagacgctgt ataccttccg gcacagctat atcatgcaca
    16201 tgctctatca cagccggccc cggaaagtga ttcaggcact ggccggtcac aaggagccgc
    16261 gctcaatgga tgtgtatatc agagtgcttg cgctggacat ggcggccaca ctggccgtgc
    16321 cgttcactgg tgacaggcat gatgccgcgc agatcctccg aacactcccg ccctgacatg
    16381 acaacgtcac tcaccacagc ttatataagc tgtagtgagc atattacgat atatggaggg
    16441 aaaacgacgg gttcacaggg ctccggcagt aacaggaatg ccattctgaa aagtttgtgg
    16501 atcagggata tgcttccggt atgggctgct ctcatcactg cttatataag ctgtagtgag
    16561 cagaacactc accagaggca gtaatataag ctgtaataag taaacagtaa tggataactc
    16621 actacagatt atgttcagcg ggatttgaag agtttctcca ggtcatcaag tgtgatgccc
    16681 agtttatcaa gaagtgcaag tttttcagcc atctccggac tgacgtcacc cggtgtggct
    16741 ggcagttgcg ggttctccgc actctcatca tgaggtggct ttaacttggg ccggcggtag
    16801 tgaatacaga agagttttgt acgcccacgc tggatctcag tgtaatccag atagccaatc
    16861 tcccggagct gctccatggc acgcctcacc gtctggttct gcgagaacac aggggatttc
    16921 aggttcagac gggcccgtag acgcgccagt gatatcggcg ccggatcccg cggcagactc
    16981 tctataaagg tataaagagc ctgagcggac tcccggcgct tcagggcatt gatggccttg
    17041 agctgcagca gcactttccg gtcaaactgg tagagttcaa agaggcgcgg atcggcttgc
    17101 agctgaacga tatctttttc cgtatcatag taagccgact gtaccagatg cgtaatgtac
    17161 tctttggtgt gcttctccgt tgtgcgggaa aacgagatca cagtacccgc gatacgctta
    17221 agtgaaggac tgatacgttc ccggagcttc cgggatgact gactggaggg gatcccacag
    17281 agtttggcga attcgacaaa cgacagctca actttatcgc caataacttt atgccgggca
    17341 aaggaatgaa tcacccctac ccaggtcttg aagtcattat ccatatccag gcggggacca
    17401 gtgatctcca ctttatcaaa cccctcggcc ctggcgagag acagacgcgt cagttcttcc
    17461 gacgcatcag tacgcgaaag cgtgttcttt ttacggtttt tcagtgactt aagcgtagga
    17521 acaaatactc caagccgcat cagagctaca ggctgcacgg tattactggc attaggagtg
    17581 agatttacga tttcaccgga ggatttatcc acctctacaa acaacttttt tatgtccaga
    17641 ttgtccttgt ccagagcgcc tccgatcggt ggatagttta agaataaaag cagccactgt
    17701 tttcatgtta tagcctgaaa ggtgctaaac aacttgcttc agcttataca cagccctgaa
    17761 gaagtttcag gggaacatac tcattgtagt ttatattact aactcattac agtatatcct
    17821 ttgcataata cagcttattg tttaccagtt acagcttatg attaacatgc tacagtttag
    17881 gtgatcatcc tccaggccca gtactgacgc ggcctttaga agagtcggga tcttcttttg
    17941 atctaacagg gatcgttgta aggatcttat tactggatcg agtgactgta tatgtggata
    18001 acctgctgac cgacaaggta attcgtatag tttttcaata atcacttgct gtgactccag
    18061 tgcgtatctg cttcctttaa cttctgtttt tttgcgcttc cttgccggtt cgcgggctta
    18121 ttcccggtca tactcttcct gacttattaa ttgccagcga ataaggtgaa gtcgcatttc
    18181 tcttatctgg tgtattgtga atcctgtacg gaccagcagt gttttcaaag ctgaggaagt
    18241 atcttcttcg tatgaagctg ctgagaggga gaaggcctct ggtttttctc gcaaaacatg
    18301 cagtaaccgc gccagtgtcg gcagtaaccg gagtgtctcc ccgggagtta caacggcctg
    18361 cagatctgtt tctgttaggt cggtgagccc ctgtttctga aattcagcat ccatctgccg
    18421 gaaccatcat tgtggatcag cagttacagt ttaattcctc ctaacgggaa ctgaacgagt
    18481 tttatttcaa tattcgcgaa caaccgtggg aacctgaacc aggattgctc gttatgaata
    18541 tgacaaacat gccagctgaa ccacttattt tccagtcggg tacgcaaagt gcagggttag
    18601 aacgggttaa tatttatttc tggattttca ggcaatttat ggaatagaag gaattaacca
    18661 agcctcttgc gtgccttgtt tataccaatc ttaagaccgc cagaacagac agcgtttccc
    18721 tgcagtcagt tggaaaacgt tttgaggcat cttttgaaaa ttaacctgag cctacagcag
    18781 agaaaatggc tcaggtacgt gaactgtatg aattagaaga ggccagacgt atgccatatg
    18841 tgatgtccaa ataactcttt taataccggt tatatattta cgtttacctg tcccctctca
    18901 gggacaggta gttgatccag tttgcagacg gcgatttctg aatctctttg tgtcatgtaa
    18961 tgacgtcagg aaatccagga ctttatcatc gctatccatc gccaagtcat gcaggaacag
    19021 aaaaaatttc ccttcattat ctgccagatg cgaatcgaga taatgtaata accagtcagc
    19081 atgcctcaaa atatgacgtt gttcccgttg cagacgcttt aacggaaggc gtatcgtcat
    19141 tttatccagt ttttgagcct cctgagagag ttgctgctgc atgattctca gttctgattt
    19201 aagcgcctgc gcgggggcgc tccggctgaa cagtcttttg gtaccgagca gtgtatctac
    19261 catcattttg tggacctttt ggcactgatc catggaagcc tgatatttct taaagtaata
    19321 gtgggtataa acgcccactc cagataatgc aattgagata aatggagcaa gtaatgctgt
    19381 gttcatgaaa atctccttac aagtaggtgg aatggccacg tgatgtggac gacggatgaa
    19441 atataaccca ctttagcaat ttgtgctatc agtttttgca aaaagtgcta attttaattt
    19501 tgtgtattga tttgttaatg attatgtgat ttgcctattt tgtgtcttcc cctttcacct
    19561 gagatccgaa aaaaggtagt cccggatctt ctttatcctc accggtgcgc cgcgacccgg
    19621 taacacaaga tgtagcggct cagtcatctg ctgttgctac cagatgttgt gttatacccc
    19681 ttccctgtga cccggcgcgc agggcagaaa agaccgcttt gcttattccc tgaccgtggt
    19741 acacttccgg aaagtcgtga atagacaaaa aatcggatca cctgaaaata gccgtcctgt
    19801 aattccgtta cgtttttata agttggattg taattgcatg tggttaaagt ttcattatga
    19861 aaaagatgag tgatttacta atagcgtgat aacagtatgc gttttaagga ttgaaaacat
    19921 gcatcagtaa aatgcacgag aaaatacata taagagatat gtagataatg gcggcgaaca
    19981 gttaactcag tcactataag ctggttaaca gtattcacaa tgcgtggcag atttttgctt
    20041 tatcggaatg tatacttaat tgcatacctg aagtatgtaa aaaagaggtg aatcatgaag
    20101 cagcgaatta cagtgacagt ggacagcgac agctatcagc tgctcaaggc atacgacgtg
    20161 aatatctccg gtctggtcag tacgaccatg cagaacgaag cccgccgtct gcgagccgaa
    20221 cgctggcagg aagaaaatcg ggaaggtatg gctgaggtgg ccagctttat agaggctaac
    20281 ggatcgtttg ctgacgacaa caggaactgg tgatatgcag tttaaggttt acacctgtaa
    20341 aagggagagt cgctaccggc tgtttgtgga cgtgcagagc gacatcattg acacccccgg
    20401 acggcggatg gctgtcccgc tggtcagcgc ccgtctgctg tcggaaaagg ttccccgcga
    20461 tctttacccg gtgatgcata tcggggatga gccttaccgc ctgctgacca cggatatgac
    20521 cagtgtgccg gccaccgtca tcggggaaga ggtggccgat ctcagcctcc gggagaacga
    20581 tatcaaaaac gccattaacc tgatgttccg ggggatctga tatgcgtgtc agcgaacagg
    20641 tgctgctcag tagtctacgt cagggcggct gtgtgcggag tttctggcgc cgctccgcca
    20701 gactggcggg tacgccctct ccgatcgttc cggacgggct tgtgctggaa acccccggtg
    20761 aacgcgggga taccccactc tgtcatgtgg attttgcggt ggtacagaag tggctggtct
    20821 gcgaggaaac ctggacacag accctcgggg gaacggagtt cggcgggacg gtctggcgac
    20881 tgcgtactga cagggagaac accacctcat gacacggtca cgcatctgtc cggatactga
    20941 atccaccggt ctcagtccgg catcggatgc cctgccggtc agggagacga cagaacagtt
    21001 tgcacaggtc tttttcggaa aatccgtgtc cctgctgacg ccggaagagc ggttcacgac
    21061 ggtgtacgcc ggctcccggg atatacctgc ggatttgcat ccggcgagct ggtttccggc
    21121 cgacacctgg tttcgtaacg aacttcgcgc ctgcgcggcc tatgtcggac gtcgtcaggg
    21181 ctggccactg tatcacgctt cagaagcgga acggctgcgc gcactctatc cgctacggct
    21241 cgccacgccc gcgaccgatc cgggaaaaca attgctgacc cgtacggcgc tgctgaaagc
    21301 gggttactca cgtgccacga ttgcggccat gacaccggtg gccgaacggc agaaccgtca
    21361 cagcggcgac tggtatcctt tatacagggt tcagactgaa accagagatg actccgggga
    21421 aaaaacatga tgtcccggaa tatttcactt aacggagaga ggacatgagt cagccaccgt
    21481 tacctgctgt ctgtacgcag gcagcgtccg ccctgctgcc ggtggccatt gattacccgg
    21541 cggccctcgc actgcgccag atggcaatgc agcatgacga ctacccgaaa tatctgctgg
    21601 caccggaggt aagtgccctg ctccactacg tccctgatct gcatcgcagg atgctgctgg
    21661 ccactctatg gaataccggc gcacggatta acgaggcgct ggccctgaca cggggagact
    21721 tttcgctggc accaccttat ccgtttgtgc agctggccac tctgaaacag cgggcggaaa
    21781 aggcggccag aacggcagga cggatgccgt ccggcagcca gccccaccgc ctggtgccgc
    21841 tttctgataa ccagtatgtc agcgaactgc agatgatggt ggccacgctg aaaatcccgc
    21901 tggagcgtcg taacagacgt accggcagaa cggaaaaggc gcgcctctgg gagatcaccg
    21961 accggacggt ccgtacctgg attggggagg cggttgaggc cgcagcggct gacgacgtga
    22021 cgttctcagt cccggtgaca ccccatacat tccgccactc ctatgcgatg cacatgctgt
    22081 acgccggcat accgctgaag gtgctgcagg cgctgatggg acacaaatcg gtgagctcga
    22141 cggaagtgta cacgaaagtg tttgcgcttg atgttgccgc acgacaccgg gtgcagtttc
    22201 agatgccggg tgctgatgca gtggctatgc tcaaaggagg ttcatagaga cgtgtatgca
    22261 tttttcagcc tttcgcctgc aacaggccat ccggaaccgg gagtttacgc cgttttatca
    22321 gcccattgtc tgcgccacag gaggggaggt ggtgggctgc gaaatgctgg cccgctggct
    22381 gcatccgcag aagggcctgc tgagcgccgg gaactttatt cccgccattg aagccaccgg
    22441 cctcggcgga gcgctgctgc gcggactggc cgacgaggtc tgcggggacg ggcaggacct
    22501 tgcccgcagt gccggccgca ggctgatgat gacgctgaat ctcagcctga gcctggttat
    22561 gacgccgctt ttccgtccgc acctgctggc cctcagcatc cggctggagc aggccggcat
    22621 gacccccgtc tttgaaatca ccgagcggga agatatccgc gcctttcctc aggcggcggt
    22681 attccgccag cttgccgccg gggggctgcg gttcgccgtg gacgacttcg gcaccggtca
    22741 tgccggtccc gccagcacgg tggctgatcg gatgattgcg cgcaccgtca gtctggcccg
    22801 gtgctagggg gcccgggtca ttgccgaagg tatcgagacc ccggcgcagg cggcgcgcct
    22861 gcgggacgcg gggggcgatt acctgcaggg ctggcactgc ggcgccccga tgcccttcgg
    22921 gctgtttcat ttccggctga cgcaaaaaag ccagccggcc tttggttaag ttatgcgcac
    22981 aggagtcatt tctatgaacc agccgttgtt attccggacc gttgccggca ggcagagcaa
    23041 ccatgaaggg ttttacatgc ccccgggcat ccgccatctg ggcaccctgt ccctgtaccg
    23101 ggccgtggcc tggtgggggc tgtttctggg ccgggagttt acccgcgatg acgtcagcga
    23161 ggcgttcagc attgagcccc gccgtgccag cggtatcctc aattacatct gtaaccgtca
    23221 caatgacgac gacatttgct ttgattcccg cctgcacccc gtgcggggag gccgcgccca
    23281 gctcgtggtg cgtatccggg cagtggaatc ccgcccggac accatccgcc ggcagcggac
    23341 agaccggccg ggcgggaagg tgagtgaccg gcagtatgac cgccagatgg cgcactggct
    23401 gctgtcccgc ccggccggcg gtgatacggc aaaactagcc gcctggcagg cagcctgccc
    23461 ggtccgggag gcatcatgct gattatcgtc agtgactgtc agtttacccg cctggcgctg
    23521 acgcgcctgc tcgcacatct ggaccccgtg aacatgagtg ttgcccggtg gttacagacc
    23581 gcgccgccgg caggcagcca tgtgctgctg gcggcctctc ccggcatgct ggcatcgctg
    23641 gtcccggcct gccatcacgc caggacatca ctgtccctga aactggcgct gctgggctca
    23701 ggaggacagg ctgtcttcct gaacaccctc ggtctcaggc cggactgcct gctgccgcgc
    23761 accgcctccg cgactcagct gaaggccgcg gtcagcagct ggctgcgccg tgcgcggggc
    23821 tggcggcagg cgacgacgga gagtctctcc ctgcgcgagc gacaggcgct gtgtgccacg
    23881 ctcgccggcc tctccgcgcg cacggcgccc ggctcggcat cagccccaaa accttttacg
    23941 gccatcgccg cagcgcgctg aaccgcctgg agctgctggc caatccggtg atcggcctgc
    24001 ctgaccctgc ggcgcactac agcatgatgc tccacccggg gtcgccgccc tttttcagca
    24061 gccggacgac cggcgccggt agccacaacg tttctgcaca tcaccccgtg caccttccgg
    24121 taacacaccg ttctcattat acggacatga cactatgaaa ttatcctcct gtactccccg
    24181 gcgtggacgg ggtgtacctg ggccacattg tggatgcagg ccaccacacc gctggtttta
    24241 acgctcacgc cggccatgac ggcccgggcg gacatcgcgt cccggatcgg gcagagcccg
    24301 ttctctgccg accgggatgc cgccctcgcc gggatccgga ccgtgcctta taccctgaaa
    24361 aagggggaga cggtggcgca ggcgcacggc ctgaccgtcc cacagctgaa aaaactgaac
    24421 gggctccgca ctttcgcccg cggctttgac cacctgcagg ccggcgacga gcttgacgtg
    24481 ccggcggtcc cgctgaccgg cgggaaaggt gacaataacc gccatgacgc ccgcggtccg
    24541 tttgctgctg accgggaaaa tgaggacgcg caggcgcagc agatggccgg catggcctca
    24601 caggccggca gcttcctcgc cagccatccg gacggtcagg ccgccgccgg gatggttacc
    24661 gtcacttccg gccgtctgac atgctcgggg cgaacatctt cctcgactat gacctctccc
    24721 gcgaccacgc ccgcgccggc ttcggcggag aatactggcg cgacttcctt aagctttccg
    24781 ccaacgccta tgtcggcctg accggctgga aaacctcccc ggatgtggag gactacgaag
    24841 agcgtccggc cagcggctgg gacctgcgtg ctgaaggcta cctgccgtcg tacccgcagc
    24901 tcggggcgaa gatggtgtat gagcagtatt acggaaatga agtgggcctg ttcgggaagg
    24961 atgagcggca gaagaacccg cacgccctga ccgccggggt cagctggact ccggtgccgc
    25021 tgctgaagct cagcgcggag cagcgcgccg gcaaggccgg ggagcatgac acccgcttcg
    25081 gggcagaagc gagttaccgc attggtgaca gcctgcgcag ccagctggat ccggatgccg
    25141 tgggcgccct gcgcagcctg gcgggcagcc gctacgacct gactgaccgt aacaatgaca
    25201 ttatcctcga gtaccgtaag caggaggtga cgtgccagta atttcacgat gcaattgtgc
    25261 ttcaatcatc gggattttcg ggattctgac cgcaccatcc agcactttta ccccaacagc
    25321 ttgccgtgtt tgcgcttgaa catagggaag cgggctttta gcttcggatt gaagcagttg
    25381 gaaaaggcaa catcgagatt gatcaccgcc tgttgcaacg caatagagtc atattccttt
    25441 agccatgcgt atttacggaa tttacggaat tttttcgcta cagccagaag cggtttaatg
    25501 tctttacgcg gggttaaact tacgccgtgt cgttgataag cgtgtttctt gatatgcaga
    25561 gatttgctgt acacaaaacg gactgcaccg aactgggcgt taaggtgctc cgcctgttcc
    25621 ggtgtcggat atatgcatac tttcgtggct cttaacatat tcagcgctca ttaatatatt
    25681 gtatttattt taacatgtta agtgaaaaat tcaattgagt aatcaccacg aatcactgga
    25741 aggctttctt cgtaaacggc atagtgtaag taagctggtt gtgcattaat ctttacgaca
    25801 aaataccgct gcaagctgtt tgacgggcag attatcgctc agttacgtga tgcttttggt
    25861 tcggctgcgg caaagttgga gtgcgaaatt atcgagatgg atggtgaaca agatcacgtc
    25921 catctgctga tagcgtatcc gctaaaactg ggggtcagcg tgatggtaaa taatttaaag
    25981 tcggtatcgt cgcggcttct ccgtcagcag aatacccact tgcggatgca gagcaaaacc
    26041 gggctgctgt ggtctcgttc ttactttgcc tgtagcgccg gtggtgccac gatagaaacg
    26101 cttaaagcat acgtgctcag acagaatacg ccggagtagc ctgccctaaa gcccttcggg
    26161 cttttcgcct tatatccccg cccgcattgg gcgagggttt acagcggatc ttgctaaggc
    26221 tctctattaa cttaccattc ataaaatgaa tatttaaaaa agttatcaat cgtgtttttc
    26281 atcataagcc ctgacataaa attcccctga tgatgagaag tgttttttta tttcttgtaa
    26341 gctaggaagt atgttggatg ttttccaaga atcaatgaat tgtacatatg gttttttatc
    26401 atattcacag ataaccacag cgttgaaatc atgtctacat tcgccaatta ttggagctat
    26461 gtagttctct gcgctaatga taaaagaact ttccctctta atgtcataac ggtttaatat
    26521 ttctttttcc acctcatcga tggaatttaa acaatatgat tggttaagct catgaccaaa
    26581 aatgatttta tcaacaatgg cgctgtctaa tcccactgta ggagaggcag tgttcttcga
    26641 acttaatata tcctgtcggt gatgtatgtt ataatgtaaa cacgctgata ataaaacgca
    26701 gttcccagag taatggacgt atgtattatt tacatatcta gccatttgtt ttaaattatc
    26761 tcgactcaaa ttttgtggat acaaaattct ctcttttgat tcaatacaaa gcgcatcttt
    26821 aattctcttg acttcatttg aatcattatt attgatattt tttgaattta tacgtgatat
    26881 tatatcttgg gatgacgcac taccagaaac tctcatagtt acactacctc aataaaatgc
    26941 atattacaaa acattaaata taatattttt caaaaaacgc tcttgcttat gtaattttca
    27001 ccattacagt gcggacatat caatatgcat gagcgttatt cctttacggt gccggaattc
    27061 gtcagtaagg ggggagcctt caatgaaaat ttgtaattta ttgattaata aattaatgag
    27121 catttaaaat agctgtttaa cggcgtttac tgttccgttg ctccccaaac ccatacttac
    27181 tctgtcatca aacgataaaa cggttcctca cgtaaagcct gtctctgcat ttcgccacca
    27241 tcacgcccac ttcgtagttc attacgataa ctgagatatt tccaattttc aggatgaacg
    27301 tctgactcag gacactgtcc tgaaataacc ccattttcgg atagtctgga ttccagacac
    27361 tctataaatt gccgtgtctt gtggagaaac gacgcactgt actgcgaatt ttcctggtct
    27421 ggttttatat acaacgtgaa ctgagcgccc aggctaacac gggcttgttg aacgaccttc
    27481 tccatatcgg tcactttcca cttatctacc ggactgtcct ctgaaaacag caatccggac
    27541 agcgcttgaa atgcttgtgg caccatatcc ctgagcacac tgatgtggaa cttgtcaccg
    27601 gcaaatttgc cctgagactg aggtgattct cgacgagcat ggatgaaaac atcgtaacca
    27661 tggttattca gctgaaaacc ttggctcata gcaaagaaac cactctggcg catccctgaa
    27721 tagtcaggca catccagcgc ctctttaaag tgggataccg gcatcttccg catttggttg
    27781 tgcaaggagt tgaaattatt tttcaggtgc ttatttgtag atggtatttc cgccccatca
    27841 taagcagcta caatattcaa aggagggatg tttagattta gattaggcct atttatgggc
    27901 atgggaaatc tcctttgcga tatggatata tcgccatatt attagatata aattctcagt
    27961 ttttttttaa taaaacgatt agttatccag aaaacctcat tttttatcag gcgaaaaaat
    28021 gatatttcgg tccgttccga gcagaaagtt aaagaagggt aatggcaaaa gtttagatgc
    28081 actactttgc gggcctaggg tgacggaaaa atctggggtt ccggagtata accccttata
    28141 gagctaggcc gctcatacca cttctggaat agattcttag tatctatgag ttgagtaccc
    28201 tcatgtttat tattcttttt atcctgtttg tgtcagcagt tgcatcatca cttaatctca
    28261 gcttactaag ctggcttgca aagtcttggg atccacaatt tacaatgctt tcgattttga
    28321 gtttagtatt tggagggaaa agcatctctg cctctccctt aaaatgtgca acatctccga
    28381 gtattctacc tttatgtcct ttttctaggt atatgttgag aatagtgtca tttatccatg
    28441 ccttatctgg cgatgtactc ataaaagctt tatctattat tatattacct atagtagtgt
    28501 attccttcag cacatccgat aatgcgggct tatcaagctt caggccccgg tatacgactc
    28561 tgtgatctgt ttcgggaagt gaacttaatc cctccgcaat atcatttata taaactgaca
    28621 tggcattttt aaactcctca tcactgggtt catttgtgga aagatagtct ctggagagca
    28681 gagtttcttt tgcctgtgtt tcaggataat catccccacg taaatattta ttaatcacac
    28741 tgtacccttg agctgaatag tacctcagag cttgaatctg ctttgattcc tctacaatcg
    28801 cccattttga ttttggtcga gatgaattac ctcccatcat cggaggaggc ggtggcggtg
    28861 gcatcatatt gttgacagga gctcttctat aaccgtcgcc ttcataggcc agcgtccgag
    28921 cagcgcaaag ctgtgtcagt atcggatttt cgtcatactc cagcagcaga cgggaaacca
    28981 gcgtatcggc ttcacccagt tcatcaggaa agtggtggaa catcaggact tggcggcaca
    29041 ggcgatggag gcggatctca aagccgtagt tatacaggga gaagggatcc tggcgggcga
    29101 gccagctgtt ctgagcagtg aatgcaggcg gtacctgtgg atctacacca cgttcgccgt
    29161 agtcaaacac tagggtgaac agccactgta ccgcgggtgt ggcgctagtc cagaggtaca
    29221 gatcggcggc gggggtcgcg ttgccatact gtaccttgct gagatagcgc atggcgctgc
    29281 gatcgcgtcc ggcctcgttc ccattgaggt ccacattgtc accgttctcc gccaagtagg
    29341 agtaatagat atgctcgccg gcaggggtca ccgactcctc aaccagccat tgcgccgtat
    29401 gagaggcggc ctgcggatcg ctgaggcgtg ctgcggcggt tttccccagc aggtgcagga
    29461 tgccgttact gtcatgcagt aaccagaaat catcgccgtt gctgttgccc acccagtact
    29521 ccaggcgata aaaactgctc tccgtgcggg gctgatagcg ggtcaccgtg tagctttgcg
    29581 ggaacgatac gtcaccgtac gcgaagcagg tgacgggatt gggggcatca ccggtgctga
    29641 gcgtttgaac cagcacttct ccgtccggcc ccagaaactc atcgctgtcg ttatactgcg
    29701 gcacgccatg gctggtgcgg cgggcaatgc tcattgtcgc gcaggaccag cccacgccga
    29761 aggggccatt gccgccaccg ctgctgtagt gcagcgccag cgcaggcgca aagccgcgtt
    29821 cggcgctgat gggcagaggc agcgttatac tggctaggcc gtcagggcct gactgactca
    29881 gcgccttgcc cccttttggc aggaaagggg gagtgatcag cgctaaagtg gcagatgaaa
    29941 aaccatttag tatcaacata cactatctcc tgaaactggc cgtctgacga tggccaggta
    30001 tattttctgc ttacagcgtc tgctctacgg cctgttcaaa agtgctgccg ccgtacagcg
    30061 cggtagaatg cacctgaaca atgacgtcgc tcagattctg cagaatggtc tgctgctcac
    30121 tactctggta gcgcgggaag ctaaactgcc ggctggcacg cagagtaccc gcaatcaact
    30181 gttccacctg ggggaacggt aatcgctaac tgtcgggcaa aggtattcag tgcttcaaat
    30241 ggcgtatagt cggcggtttt cagccccaga ttggtctggt aaaaagaggt caggtcagtg
    30301 gcggtactgt tgtccggctc ggtcggcagt gtctgctgct ctggtgacag ccggctggcg
    30361 agctccatgg catagttact gttatcgccg gtcagcgagt tgctcaggaa ccacggccag
    30421 tcaatgctgc tctcgctgat aatatcttcc agcgacacat cggtattcag cagagataac
    30481 tccacctggt cgtgtggaaa atgatacggc agcagggtcg gtatttgctg gttaatggca
    30541 tcattaacca ccatcagggt ggccaggtcc ggccgacgct ctgcctgtcc ctgaataccg
    30601 ccgacagcgg aactgctcag gttcgtgcca ttgtccggtg tctgctgcaa ggtcccccga
    30661 actctgcggg tcaattgatt ttctcggaac atgcagcgga tatactgcgc ctggcccatc
    30721 gccaggtccc aggttttacc tccgcgggag cccggccatg acatattggc gttaataaac
    30781 tgtttacggg tctgacggac aatatcaaac acggaataat aattatattt tgcaaaattc
    30841 cctgccggga cccggatggc ggtttcgacc tgtgaaagtg ccggactggt ggtctgattc
    30901 atattcataa ataatgatga ctcctgaaaa taaacagaat gaaatcctga agactgataa
    30961 tgtctgcagg ggaattattt tgtattgcca gaaaatgagt ggcttatatt gagtttattt
    31021 atgtgctatt tttctgctgt gcggaatcgc ggttcccggt gtgcaaagat ggcacaacaa
    31081 attaactcag gaataaacaa cgttcagcgc tccggcgtcg ggtcaggccg ggaacaacct
    31141 gaccgctggc gtggtcccat ttcaggaatt cattcgctgc gccgtcatag tcaccgttat
    31201 tcagtttctt cagtaaagtg gcgtgagcca gcgcgttaat gcccatgttt taggtaatcc
    31261 accagagcat caaactgatt ctgtgtcaga ttgacggcga ccagccggtt tactccatgc
    31321 tccgcggtga actaccgcta tggaggatgg ggattgctga caatctgaat ctggcaaatg
    31381 ccgtgaatac aggtgttgcg gcccttacgc tgcataaggt cagaaggtgg actgtttcag
    31441 ttcctgctgt atcagtttta tagctttacg ataatctggt gtctcccgtt tcttggtcgg
    31501 gtaatacaag gaggtacaga gcgctacgcc tttgatgtgc agtgcgtgat ctgttgataa
    31561 tcccagagcc cgacagactc tgacggggat gagtaacatc gccagccctt gttgtaaccg
    31621 gtacagtgaa ctgaacaaat cgacgttatc aaaactgaat gcagggttgg taatacctag
    31681 tgtctgttca aaaaaatggt atatggtgtc cagattaaaa tttttagccc cctcatgaaa
    31741 aagtacaggt gttccggcca gcctgttgat atcaggtttg ccgcagagaa agaatttttt
    31801 aggaataaat aacatgaccc caccctccac tgatgtccgg cagacaagcg attcccgatg
    31861 aaaataattt ctggcagaaa taacaatgca gttgtttgtc tgacacagtt cttctattat
    31921 ttggctgtta acggctctcc ccattatatt tgttttttgg ccggaaatgg tcagtgctga
    31981 aatgatcaga ttttttaaac ttcccggata aatttcgtca aatattattt ctagttgttt
    32041 cgttttaccc gtaggtccga tttcctgctc cagtgcatgt aagaaaatat aatgggattt
    32101 tacttttcga taaatagttt gtgcaaattc ggttgggata agagtgccat tcttccgtat
    32161 aaagagtctt tgtttcagct ctctttccag gtctgaaata accctgctca gcggggttcg
    32221 ggtgatatac agtactgatg ttgcgatact gaaggaacct gtttccatca gtgttatgaa
    32281 aatttttaat tttttattaa tcaagaaatc cataatatct cctttttttt ttcagaataa
    32341 tcctgaaaaa atgttttgat gtgcaaaaac aggatggcgg tgacctgttt ttgcacagac
    32401 tgattagttc ttactaatca tggggttact ggataggatt atgggcgata gattttatgc
    32461 ataccctgac tttatttctg agtggattta attgacctgt tatgatgtat agctggataa
    32521 caacgatgta tacccatgat caatgaagat gcttggtttc aaaaataatc aggatcatgc
    32581 tgatggctat gaatgttgag ttgaccgcag aacaaaaaat cgctcttgaa gcattacaac
    32641 gaaaaagtcg cgatcccata aatgaacaga accgatgtac gaccgggccg gaattaaacg
    32701 ggaggcgtta ttaggcctgg cgcactacag gacagaatgc agagcctttt tataggttca
    32761 gtcgaacgaa aactcacgcc aggcgagaaa ggttgtctga aaaatcgatt agtgtgcact
    32821 aaatagcttc gcaaaatagt agatcactga aagggaactc agcccggatt gtgcgatctg
    32881 atcaatcgcc aaacatcaca aatcaccaac cggactgagc gatgccgatc atagcagcaa
    32941 ttcctgatga agaacgacaa ctgatgcgca aagaggccca acaaacccac gataaaaacc
    33001 atgcgcgacg gcttatcgcc atgctgatgc tgcatcaggg aatgaccgtc actgacgttg
    33061 ccagattact ctgtgccgcc cgttcatccg ttggtcgatg gataaactgg tttactttac
    33121 atggtgttga aggactaaaa agcctcagac ccggacgtgc tccacgctgg ccggtcgctg
    33181 atatccttca gctcttgcca ctattggtac agcgttcccc gaaggatttt ggctggctgc
    33241 gctcacgctg gagcacggag cttctggcac tcgtcatcaa ccgacttttt gatgtgacgc
    33301 tgcaccgctc caccctgcac cgatatctga ggcaggcaga tatggtctgg cgcagggcag
    33361 cgccaacgct gaaaatcaaa gatccgcact atgaagaaaa acggcttgtc attgatcagg
    33421 cgctggctca ggagcagact gcacatcctg tgttttatca ggatgaagtc gacatcgacc
    33481 tgaacccaaa aattggcgct gactggatgc ccaaagggca acagaaacgc atcgccacgc
    33541 cgggacagaa ccagaagcat tatctggcag gcgcactgca ttcaggtacg ggacgggttc
    33601 actacgtcag tggcagcagc aagagttctg atttatttat cagtctgtta gaaacgttac
    33661 gccgtacata caggcgggcg aaaaccatca cactggtggc ggataactac atcatccata
    33721 aaagccgcaa agtggaacgc tggctggaag aaaacccgaa gttccggttg ctgttcctgc
    33781 cgatgtattc gccgtggctg aatccgatag agcgactgtg gttgtcgtta cacgaaacca
    33841 taacgagaaa tcatcagtgt cggtacatgt ggcagttact gaaacaggta gcacaattta
    33901 tgaatgccgc ttcactgttt cccggcaatc aacagggtct ggctaaagtg gagcggtaat
    33961 atgcgaagct atttgtagcg gctcgcaatc gaaatccccc cgactcgcaa tcagcgccaa
    34021 ttttggctca cattaactgc aaatgaaaaa cgccaccggc tcacattagg tgataatggg
    34081 ctcgcattta tcctgcccgg ctcgcaatcc attccaccgg gctcacaata actgcaaatc
    34141 aacatcgtca tattggcaga ccgaccgcca gcattctgtc gcgtagttcg gccgtgcggg
    34201 cagggtctaa ctgattatta aataatgccc tgatttcagc tggttttgca tcgaactgct
    34261 ccaccatatc cttcagccgg taaccatgtc gcgtgagcgt cggctccagg tcatccagct
    34321 gacgtgacag cacggattca accagagtgg cagtaatcgg tttttcgccc gtctggtatc
    34381 ctgcttccat cgccagcgtc aggtgcaact ggacctgcag cggtgttcgc agtttcatcg
    34441 ccagcaggtc aacggcttcg gtcgttagaa tatcttccgg cttaccctta ccggtgctgg
    34501 tcttcagcag ccactggata tattcacgct gactgccggt gatcccgtcc agtgtaaaaa
    34561 tatcggtacg atagccaatt tcctccatcg tcggacgacg caggtcatta cgcagttttg
    34621 ggtgaccggc cagaacgacg gacagcctac caccgccgtc ttcaaccact tccatcagcc
    34681 gtttgagccc cgttagtgta ttaccgttca ggtcatgggc ttcatcaaca aacagcgcca
    34741 ccgggcgttt gccttttttg accagttcct gcagctcacg ctcgcggcgt tcaccttgtt
    34801 tgtggatctg cacctgttta tcctgtgcca ggtcataaaa cagggcatta atcagcgtgg
    34861 cgagccggac actctgtttg tccaccgaca gggagcgggc gacaatgatt ttattttcat
    34921 ccagcagttg ctgctgcagg cgtcgcagag tgacggtttt accgcttccc accacgccac
    34981 agaccgctat cagtcgtcct tcgcgtatcg cacccttaat gtctttcatc agctgcttat
    35041 ggtgggcagt ttcataatac ccggcctgtt caatagactg cgtcagtcca taatgctcca
    35101 tcacttcaac ccgcatggtc ctctcctgat tgtctgctac gaaaatagtc tctgatgcgg
    35161 gcgagtactt cactacggtt aagcgtctca gtcagaatac tgtcgataaa cgcccggtct
    35221 tcatccgaca ttctggccag cggtatggcc agatcgtcgg caattgccag ttttgccgca
    35281 ataacggtgg gaaagtggta ttcaaatttt cgggtatcaa agggctgatg tggcaacgca
    35341 tcaatgcgct gctgagtgtc atcactgacc acgcggagat cgctgccgga caatgcgctg
    35401 atggggatgt tcagctgcct ggccagagca tggatacgat cggcccgttc agccgcttta
    35461 ccgcgtctga acgtccggta acggtgcagc ggcacaggcc ccgacaccgg ataataaggc
    35521 ccccatgttt caccggtaaa ctccacatac atctcttcgt caaacagccc ccacagcaga
    35581 atgacggttt cacccgccat atccggttca acttcccatg cggtgccgtc tatcgttatc
    35641 cgcgcatcaa cacccacctt gcgggattcc ggctcccggg cgaaccgaca gtattgttcc
    35701 cagctgcaca tatccctcac accttcctgg ccgatatttg ccagccagtc ctccagtcgg
    35761 gagtgtttct cgctgcggtg acgctgcgcg ttataacggc tcagatagtt ccagagccat
    35821 tcgttggcct gcagctccgt ttccggttta tggaaatggt acagagtttc atgtgcctcc
    35881 ttgacggtcc ggaaaggacg ttcaacttta cctttggacc gtgccgtcgt ccgggtgccg
    35941 tccttgcctg ccggcgtatg cgtcagccag tcaaccttca gggactgcat cacattctgg
    36001 aatacatggt ttttggccac cggtccatta tcgaggtaca gcaatttcgg gcggccctga
    36061 aaaggaaaat cagacctggt ttttggggcc atggcgttaa agagaaaacg cagcgcagat
    36121 tccgcatcct caccgtacac acaccggtat tcctggtatg cgacaccgct ccggtcatcc
    36181 actacgctga acagcatcag cgtgggttcg ccccgggcag gatctaccca gtcaggccgc
    36241 tcaatatgtt tgagatcgga tggcgacata tcaaactgcc aacagtcatt gctgttttca
    36301 gcctgaaatc ttaccgccgg aggctcccgt aacaggcggg gctggtcgag acgccagcgg
    36361 gaaagccagc gattgacggt ctgcttacga agtaagcctt tgggactttt aatcaatccc
    36421 tggaccgtct ccacgccatg ctcttccagc agctgtattg cccgtccggt cgacagatgg
    36481 cggccggatt tatttgtggt tcgtaatttc agtgcagcaa tcagttcgca gtaatgctcc
    36541 agctcggacg gtggcagtat ccggggttga ccatgatcac tgcggtgggc cgttcgcggt
    36601 ttcaaaacaa ggtgaagagc gcgataaacc gtcgtgactg aaataccata cagctgggcg
    36661 gtagcggcaa tctgattggc acgttcaggg ctttttggcg gcaggcgatc gagccgttgc
    36721 cgtagttgca acagggagtc agacggaatc gcgctacgcc ggctgctcat aattttccag
    36781 cgcccggtag actgacgccc tcccaatccc gagctggcgg gcgatggctg tggctcccat
    36841 cttctcaatg gtatacagac gatataccac agcaggatct atggacggtt tccttccccg
    36901 gtatacgccc ctggctttcg ccgcggcaat gccttccatc tggcgttcac gtctcagatt
    36961 ggtttcaaac tcagcgaaaa cacccagcat atcgaggaag gctttgcctg cagctgaacg
    37021 cgtgtccact ggctgttctg ttgccctgag cgtggcactg ttgcaaagtt agcgatgagg
    37081 cagccttttg tcttattcaa aggccttaca tttcaaaaac tctgcttacc aggcgcattt
    37141 cgcccagggg atcaccataa taaaatgctg aggcctggcc tttgcgtagt gcacgcatca
    37201 cctcaatacc tttgatggtg gcgtaagccg tcttcatgga tttaaatccc agcgtggcgc
    37261 cgattatccg tttcagtttg ccatgatcgc attcaatcac gttgttccgg tacttaatct
    37321 gtcggtgttc aacgtcagac gggcaccggc cttcgcgttt gagcagagca agcgcgcgac
    37381 cataggcggg cgctttatcc gtgttgatga atcgcgggat ctgccacttc ttcacgttgt
    37441 tgaggatttt acccagaaac cggtatgcag ctttgctgtt acgacgggag gagagataaa
    37501 aatcgacagt gcggccccgg ctgtcgacgg cccggtacag atacgcccag cggccattga
    37561 ccttcacgta ggtttcatcc atgtgccacg ggcaaagatc ggaagggtta cgccagtacc
    37621 agcgcagccg tttttccatt tcaggcgcat aacgctgaac ccagcggtaa atcgtggagt
    37681 gatcgacatt cactccgcgt tcagccagca tctcctgcag ctcacggtaa ctgatgccgt
    37741 atttgcagta ccagcgtacg gcccacagaa tgatgtcacg ctgaaaatgc cggcctttga
    37801 atgggttcat gtgcagctcc atcagcaaaa ggggatgata agtttatcac caccgactat
    37861 ttgcaacagt gccgatccaa gcactggtcg atgctgcgca ggagatgttg ggccgggacg
    37921 tgatcttcca gattgaacga gtagaacagg cgctgctgtc ctcccggtaa ctgtcccatc
    37981 atgctgttcg cccccacgct cgctgacaaa gcaattttgc caacggcatg gggaggccgc
    38041 tactttttca acagaatcgg ccgcacacag ccattcggct caacagaacc ctgcctttac
    38101 cccaccaaac tccggaaact cgcccggtag tccgtcggct tgagatgcac atgttggctg
    38161 aggtcgccgg gtagcgtgaa caggcgcgga ccgtcccgaa actggaacac gcgatacaga
    38221 tggaattgat cgcccgcctc cttggagaat tcgagttcgt tgtggctgac caagaaagac
    38281 gagcctaccc cgccattggt ggttttcacc tcgatgaagc gctcatgggc gtcctcttcg
    38341 aacgacagga tgtcgaaccc cgcaccgtct ccctgggtgt cggacaccca atccagccgc
    38401 tgaaaaagct ctgggtggcc gagctcggtc aggcgttgct gttcgtagcc aatcacccac
    38461 tgctcccctg cccggcccag cttgcggttg gcttcatcgc gagcggcata atcgaacttt
    38521 cgcggtaggc gttgccgtag agatgccggg gtacgcacaa gcacttcacg ggcgggtggt
    38581 tctaccaaag ccgctcggta ggttttgtca cccggaagtt ttacctcctc cagggcatcg
    38641 acaagagcgc cgaccgtctg ctgatgttcc agaacgtagg cgtgtacgga tttacgcagc
    38701 agcagttggc tgttgccgcg tggcttgtag ccgttgatat agggcaggcc cagggcatcg
    38761 agtacggcgc taatgttctg gtgcttgagc tcgactgaag acttgctgcg accgttcagc
    38821 agttggcgca gtgcctggtt gtgctcggac ttgtggtacg gctccccagc cgcctcggca
    38881 cgcagcatgt cgaaatagtc ttcgaccgtg gccaggacct cttcttcgga ccagtcttcg
    38941 ccgatgcgaa tgatgcgaaa cccgagccgc gtcagcgccg gaacgacggt cgtctcgcca
    39001 ccggagaagc tgtcagcagt gagcgggccc tgctcgggaa attgcttgcc gaaggccaca
    39061 ccggcgatgg ccttggaatc gcaatcggtg ccggtcttcg gatcacgtac caggaagtcg
    39121 cgggacttgc cgtagccgtg gcgcgccagg aatttcgtgc ggcccagttg cacgaactca
    39181 tcgatggcag cctgcacggc ggcggggctt cgaagctggg agagttgaga cacagggtcc
    39241 ttccttactg tcatggtgtg ccgggaaccg ccgagccacg agattatgag tagcccctga
    39301 acagaaacgt cacgataaaa gccgtgaacg ccaccaggcc cattaaatcc cttgcgtatt
    39361 tgcagcccgt gctgtccaaa cctgtaccag gtccgatcaa cacgctccaa ccattgaggt
    39421 acgaaaacac cgcctgaccg aacaaaaaat gcgtgatagc cgccgcagcc atgacgccgg
    39481 aatcgtcaga caggctgtag ctgttgacca ttgccctgta cgcctgcatc tgaaatggct
    39541 attgccctga tgggagccgg cttttcagcc accgacacca gcgatgccgt caatattctt
    39601 tacccgataa ccatgaccgt acaagctaac aaggcctggc aagccagcgg acttaaaaag
    39661 tctttttttc taccatccca caaaaaagtt cgtggtggag aaaagataag ctatgcaagg
    39721 ctttaggaga cgtggttttt caggatgacg aagaacgatt cggcgctagg tgcaacatag
    39781 gtgcatcgca cgagcgctag gaacggcgaa aaaaggcgga cgtggcgaaa tcggtagacg
    39841 cagcagactt taaaattgga gtgcccgcgg ggaaatccgc ggagtagaac cgctcaaagt
    39901 cggggaacgc taacgggcaa taccctaagc caatcccgag ccaagcccct tcgggggaag
    39961 gtgtagagac tggacgggcg gcgcctaaag ccttcgggca atggcgaagg gacagtccag
    40021 accacgaacg tcatcagacg gcggcgaaag tcgaggtggt acgaaaatct gcttctctgt
    40081 gagagtacgg gttcgagtcc cgtcgtccgc accacaaagc caaacatccc tgcgatgatc
    40141 gacctctggg cgtttggtcg tgagcccgcc accctcgcgc tacgctttgc gcaggcgtcg
    40201 aaggcgatca ggtgcgccca tcgattccgt cgagcaccat cgctgcgagt tcatcgctgg
    40261 tgtgtgcacc actatcgaga acacgggttg tgcatggaag ccgttccctt gcggccaagc
    40321 atcgggcgac attcgctaat cgccactctc gaatctccgc atttcgattc gggtcaggat
    40381 gcatggtctg gttcgcgatc cggtgacgca ataggtcctc gttgagcgtc agaaagatgt
    40441 gcagcagctg atcgtcgatc cgccttaccc cgtcgagtat ctcagtcaga tagtccgggt
    40501 gcacgagcgt cattgggatg atgatgtcct gcgagtaatt ccttcgaatc tccctgaccg
    40561 ccgcgatcgt aagtcccctc cacaagggga gatcctgata gtctccgctc gctggcatgg
    40621 ggaccgtttc tttcaccacg aacccgattt cctcggggtc aaagatcagc gatttggaac
    40681 gccgatcgcg cagccgctta gcgagcgtcg tctttccggc gccgaaaggt ccgttgatcc
    40741 agattatcat tgtcgacggc ctctaacctg aaggctcgca agagcgctcg acggcctcgt
    40801 gcggaggcac gatcggagtg gttccgaaat gcttctcaag ataggtgacg ccgaacgtca
    40861 cgatgtcctg cgcgtcgaac aggtagcact gagcaaagcc cacgacacct tctcgatggc
    40921 gaccgagctt cacgtaagca tttgctatag tttcaaccgc atccggcttt ccttcgatag
    40981 caaagcaatc gagaatgccg tttgaatcgt aatccgatgc cgttttccag gcgacttcac
    41041 cgtctcttcc aagcatcggc atctcatacg tcacccaccg tttgttgggg atatcggcaa
    41101 ccgcctcggc gtagtgcaat gcggtaacgg agtttagcgg cgcacccaac agcagggcct
    41161 tcccgccaag gcgaacgaac cgctcgacgg gcgatccttc ccccaaggcg tgaccgagtt
    41221 cgtgaggctc cgtcagcgtt tcagccagcg gaccaaccgc gaccatcgat gcatcggggt
    41281 gcgcgctgcg ccgcgcgccg ggggcttgaa ccagaaattg attcagcagg ccgaacccac
    41341 ggtaagtccc ggctgttgcg ggatcgaacg gcagccaggt acggcgggct tcgtcatcca
    41401 gccgagcgcc attcagagtc tcctcgtagg gtgatcggtc ccacgacgcg tatcccatca
    41461 cagtgccagt cggcccaacc gcggagcgta acgcggcaac gaccgtctcc gctcctcctt
    41521 cgaccggacc aatcgcttta agtgaggcat gcaccatcaa gaggtcaccg gtttggactc
    41581 cgagtttttg aagcgcctcc gttattgcct tccgcgtatg catcgcgata tctcctctaa
    41641 actgcaaaac actatacggg gtctgacgct cagtggaacg aaaactcacg ttaagggatt
    41701 ttggtcatga gattatcaaa aaggatcttc acctagatcc ttttaaatta aaaatgaagt
    41761 tttaaatcaa tctaaagtat atatgagtaa acggcactgt tgcaaatagt cggtggtgat
    41821 aaacttatca tccccttttg ctgatggagc tgcacatgaa cccattcaaa ggccggcatt
    41881 ttcagcgtga catcattctg tgggccgtac gctggtactg caaatacggc atcagttacc
    41941 gtgagctgca ggagatgctg gctgaacgcg gagtgaatgt cgatcactcc acgatttacc
    42001 gctgggttca gcgttatgcg cctgaaatgg aaaaacggct gcgctggtac tggcgtaacc
    42061 cttccgatct ttgcccgtgg cacatggatg aaacctacgt gaaggtcaat ggccgctggg
    42121 cgtatctgta ccgggccgtc gacagccggg gccgcactgt cgatttttat ctctcctccc
    42181 gtcgtaacag caaagctgca taccggtttc tgggtaaaat cctcaacaac gtgaagaagt
    42241 ggcagatccc gcgattcatc aacacggata aagcgcccgc ctatggtcgc gcgcttgctc
    42301 tgctcaaacg cgaaggccgg tgcccgtctg acgttgaaca ccgacagatt aagtaccgga
    42361 acaacgtgat tgaatgcgat catggcaaac tgaaacggat aatcggcgcc acgctgggat
    42421 ttaaatccat gaagacggct tacgccacca tcaaaggtat tgaggtgatg cgtgcactac
    42481 gcaaaggcca ggcctcagca ttttattatg gtgatcccct gggcgaaatg cgcctggtaa
    42541 gcagagtttt tgaaatgtaa ggcctttgaa taagacaaaa ggctgcctca tcgctaactt
    42601 tgcaacagtg cctagccgtg tcggcgtagc tcttcgatga tccccagccc aaagacaggt
    42661 tcctcggctg catggtgaag gatgtgcagg cggatcaaac cgccgtagag gtctttgtca
    42721 gtcatttttt gtgcctcaca gagcgacgct caacagccac ccagctgcac cgctaccgag
    42781 gacaaccagc cacggcggga gcttccagaa cataagtgcg acaagggcaa ctaatgccaa
    42841 gccgaagtct tgcggctgaa agatggcgct agtccataca ggctgataca gcgcggccag
    42901 cagcaagccg actacagcgg cattgatccc ggccagcgca gcttggatgc ctgtattgcg
    42961 gcgcaaacgc tcccaaaatg gcattgatcc gacgaccagc aagaacgagg gcgcgaagat
    43021 agccagcaga cacacaatgc cgccgatcca gcccgacggg gcggtgttca tcgaggcacc
    43081 aagaaacgcg gcgaacgtga acaaagggcc gggcaccgct tgagctgccc cgtaccccgc
    43141 gagaaaggat tcattgttga cccagccgga gggcaccact tcggcttgca gtaatggcag
    43201 cacaacgtga ccaccgccga acaccagtga tccgacacga tagaaggaat ccaccattgc
    43261 catggtttga cttggcatca gttcggccaa caccggcagg ccaatcagca agacaaagaa
    43321 cagcgagagc caaagcacgc cggcccggtg actgaccgtg ataggtaggg ggtcatgctc
    43381 aacaactttc gctggcttga acaataaccg gcctgcgatg cctgcgatag caatcacgcc
    43441 aacctgtccc cacgcggacg gcacaagtaa aacgacgcag gtagcaattg ccatgatggt
    43501 gactcgcagc ccatccgtgc ataggttacg cgccatgccc catactgctt gagcgaccac
    43561 ggccacagcc accactttta agccatgcaa cgcgccctgc gagacgtaat cgccatagct
    43621 ggagatgccg agcgcaaaaa ggatcaaggc tatggcagac ggcagcgtga agccagccca
    43681 agcagccagc gccccgctgt atccagcccg agacagtcct accgctatgc cgacctggct
    43741 gcttgcaggc cctggcaaga actgacaaag cgcgaccaag tcagcatagc tccgttcgga
    43801 gagccagcgc cgccgtgtga caaattcggc gcggaagtag cccaagtgcg caatggggcc
    43861 gccaaaagat gtcaatccaa gccgcagaaa aataagaaag accgaccatg gtctgctgtc
    43921 atcggtaggg ttattcgtca tactttcgcc ttcatgatct gcaacgagtt gatcaataat
    43981 aagcgaaatt cgataacgaa attcgatata aatctagaaa aaaatacctc tatgtgtact
    44041 acgcagtttt agctgtggct ttcacaggag cacgcttact tacggcttag cgtgctttat
    44101 tttccgtttt ctgaggcgat ccctaggagc tcggatctca ggacgaaggt ctccgcgaat
    44161 gtccggtcga tccgcgcgac gtcccaggcg ggcgttccct tggcggacat ccacgccgca
    44221 gcgtcgtgca tcagccgcac aacctcgtcg atatcacccg agcaggcgac ccgaacgttc
    44281 ggaggctcct cgctgtccat tcgctcccct ggcgcggtat gaaccgccgc ctcatagtgc
    44341 agtttgatcc tgacgagccc agcatgtctg cgcccacctt cgcggaacct gaccagggtc
    44401 cgctagcggg cggccggaag gtgaatgcta ggcatgatct aaccctcggt ctctggcgtc
    44461 gcgactgcga aatttcgcga gggtttccga gaaggtgatt gcgcttcgca gatctccagg
    44521 cgcgtgggtg cggacgtagt cagcgccatt gccgatcgcg tgaagttccg ccgcaaggct
    44581 cgctggaccc agatccttta caggaaggcc aacggtggcg cccaagaagg atttccgcga
    44641 caccgagacc aatagcggaa gccccaacgc cgacttcagc ttttgaaggt tcgacagcac
    44701 gtgcagcgat gtttccggtg cggggctcaa gaaaaatccc atccccggat cgaggatgag
    44761 ccggtcggca gcgaccccgc tccgtcgcaa ggcggaaacc cgcgcctcga agaaccgcac
    44821 aatctcgtcg agcgcgtctt cgggtcgaag gtgaccggtg cgggtggcga tgccatcccg
    44881 ctgcgctgag tgcataacca ccagcctgca gtccgcctca gcaatatcgg gatagagcgc
    44941 agggtcagga aatccttgga tatcgttcag gtagcccacg ccgcgcttga gcgcatagcg
    45001 ctgggtttcc ggttggaagc tgtcgattga aacacggtgc atctgatcgg acagggcgtc
    45061 taagagcggc gcaatacgtc tgatctcatc ggccggcgat acaggcctcg cgtccggatg
    45121 gctggcggcc ggtccgacat ccacgacgtc tgatccgact cgcagcattt cgatcgccgc
    45181 ggtgacagcg ccggcggggt ctagccgccg gctctcatcg aagaaggagt cctcggtgag
    45241 attcagaatg ccgaacaccg tcaccatggc gtcggcctcc gcagcgactt ccacgatggg
    45301 gatcgggcga gcaaaaaggc agcaattatg agccccatac ctacaaagcc ccacgcatca
    45361 agcttttgcc catgaagcaa ccaggcaatg gctgtaatta tgacgacgcc gagtcccgac
    45421 cagactgcat aagcaacacc gacagggatg gatttcagaa ccagagaaag aaaataaaat
    45481 gcgatgccat aaccgattat gacaacggcg gaaggggcaa gcttagtaaa gccctcgcta
    45541 gattttaatg cggatgttgc gattacttcg ccaactattg cgataacaag aaaaagccag
    45601 cctttcatga tatatctccc aatttgtgta gggcttatta tgcacgctta aaaataataa
    45661 aagcagactt gacctgatag tttggctgtg agcaattatg tgcttagtgc atctaacgcc
    45721 ggagttaagc cgccgcgcgt agcgcggtcg gcttgaacga attgttagac atcatttacc
    45781 aactgacttg atgatctcgc ctttcacaaa gcgaataaat tcttccaagt gatctgcgcg
    45841 tgaggccaag tgatcttctt tttgtcccag ataagcttgc ttagcttcaa gtaagacggg
    45901 ctgatactgg gcaggtaggc gttttattgc ccagtcggca gcgacatcct tcggcgcgat
    45961 tttgccggtt attgcgctgt accaaatgcg ggacaacgta agcactacat ttcgctcatc
    46021 gccggcccag tcgggctgcg agttccatag cttcaaggtt tccctcagcg cctcgaatag
    46081 atcctgttca ggaaccgggt caaagaattc ctccgctgcc ggacctacca aggcaacgct
    46141 atgttctctt gcttttgtaa gcaggatagc tagatcaatg tcgatcatgg ctggctcgaa
    46201 gatacccgca agaatgtcat tgcgctgcca ttctccaaat tgcagctcgc gcttagccgg
    46261 ataacgccac gggatgatgt cgtcatgcac gacaagggtg acttctatag cgcggagcgt
    46321 ctcgctctcg ccagggaaag ccgaagcctc cataagatca ttgagcaatg ctcgccgcgt
    46381 cgtttcatca agctttacgg ccacagtaac caacaaatca atatcgctgt atggcttcag
    46441 gccgccatcc actgcggagc cgtacaaatg cacggccagc aacgttgatt ccagatggcg
    46501 ctcaatgacg cttagcacct ctgatagttg gttcgaaatt tcgatggtca ccgcttccct
    46561 catgatgtct aacgggcgag gtaagccgac cgcagaatgc gggtcggctt gaccgaaatg
    46621 ttagaaccag aagccaaaac ggataacttg aatttggcga cgggcgctaa ccgtgaaaaa
    46681 acgctgcgcc accgaggcgg cacagcactg caaaaacgat agctgcttgc gcttgctacg
    46741 caagggctag aggccaaaaa gactgaaaac ctgcgcagcc catgcaggcg aagcccggaa
    46801 aaaaggcaaa acaggcactg aataacgcct gaaaagctaa atgccgtttg aataaacatg
    46861 agctaaataa agctgggttt cagtggtgct aacgttggac gtaacgagag ccggagcgca
    46921 gcggagggaa ccaaaatgcg cagcattttg gcgtcccgtt gacggaatgg ttagccgttt
    46981 cgacgcgcat aaacggagtg ggtgtacgga attacagctt gaatggtttc ggttgagaca
    47041 agctcgaatt ctgtttcgtt gagcattggg aagaaggcgt caccctcgaa ggtttgatgt
    47101 acctcagata gaaacacgcc gtgggcgtga ggtagtgcca gagtgtatat ctcagctccg
    47161 cccgcgacgt agagttcatt gccgagttcg gatgccaaag cgatagcgtg cgacagcgtt
    47221 gaaacaacta cgcagccagt ggcgcggtag ttagcttggc gtgagattac caatgtgtga
    47281 cggttcggta gaggcttgcc gatagactca aaggtctttc gccccatgac aacgactttt
    47341 ccctcagtga gtctgcgaaa aatcttctgc tcacccggaa ttttccaggg gatattagga
    47401 ccattgccaa taacccgatt ggctcccatc gcagcaacga gataaatgcg tactgattcc
    47461 gagttcatat ggctaacttt gttttagggc gactgccctg ctgcgtaaca tcgttgctgc
    47521 tccataacat caaacatcga cccacggcgt aacgcgcttg ctgcttggat gcccgaggca
    47581 tagactgtac aaaaaaacag tcataacaag ccatgaaaac cgccactgcg ccgttaccac
    47641 cgctgcgttc ggtcaaggtt ctggaccagt tgcgtgagcg catacgctac ttgcattaca
    47701 gcttaccaac cgaacaggct tatgtccact gggttcgtgc cttcatccgt ttccacggtg
    47761 tgcgtcaccc ggcaaccttg ggcagcagcg aagtcgaggc atttctgtcc tggctggcga
    47821 acgagcgcaa ggtttcggtc tccacgcatc gtcaggcatt ggcggccttg ctgttcttct
    47881 acggcaaggt gctgtgcacg gatctgccct ggcttcagga gatcggaaga cctcggccgt
    47941 cgcggcgctt gccggtggtg ctgaccccgg atgaagtggt tcgcatcctc ggttttctgg
    48001 aaggcgagca tcgtttgttc gcccagcttc tgtatggaac gggcatgcgg atcagtgagg
    48061 gtttgcaact gcgggtcaag gatctggatt tcgatcacgg cacgatcatc gtgcgggagg
    48121 gcaagggctc caaggatcgg gccttgatgt tacccgagag cttggcaccc agcctgcgcg
    48181 agcagctgtc gcgtgcacgg gcatggtggc tgaaggacca ggccgagggc cgcagcggcg
    48241 ttgcgcttcc cgacgccctt gagcggaagt atccgcgcgc cgggcattcc tggccgtggt
    48301 tctgggtttt tgcgcagcac acgcattcga ccgatccacg gagcggtgtc gtgcgtcgcc
    48361 atcacatgta tgaccagacc tttcagcgcg ccttcaaacg tgccgtagaa caagcaggca
    48421 tcacgaagcc cgccacaccg cacaccctcc gccactcgtt cgcgacggcc ttgctccgca
    48481 gcggttacga cattcgaacc gtgcaggatc tgctcggcca ttccgacgtc tctacgacga
    48541 tgatttacac gcatgtgctg aaagttggcg gtgccggagt gcgctcaccg cttgatgcgc
    48601 tgccgcccct cactagtgag aggtagggca gcgcaagtca atcctggcgg attcactacc
    48661 cctgcgcgaa ggccatcggt gccgcatcga acggccggtt gcggaaagtc ctccctgcgt
    48721 ccgctgatgg ccggcagcag cccgtcgttg cctgatggat ccaacccctc cgctgctata
    48781 gtgcagtcgg cttctgacgt tcagtgcagc cgtcttctga aaacgacaat ggaggtggta
    48841 gccgaggggg cactgttgca aagttagcga tgaggcagcc ttttgtctta ttcaaaggcc
    48901 ttacatttca aaaactctgc ttaccaggcg catttcgccc aggggatcac cataataaaa
    48961 tgctgaggcc tggcctttgc gtagtgcacg catcacctca atacctttga tggtggcgta
    49021 agccgtcttc atggatttaa atcccagcgt ggcgccgatt atccgtttca gtttgccatg
    49081 atcgcattca atcacgttgt tccggtactt aatctgtcgg tgttcaacgt cagacgggca
    49141 ccggccttcg cgtttgagca gagcaagcgc gcgaccatag gcgggcgctt tatccgtgtt
    49201 gatgaatcgc gggatctgcc acttcttcac gttgttgagg attttaccca gaaaccggta
    49261 tgcagctttg ctgttacgac gggaggagag ataaaaatcg acagtgcggc cccggctgtc
    49321 gacggcccgg tacagatacg cccagcggcc attgaccttc acgtaggttt catccatgtg
    49381 ccacgggcaa agatcggaag ggttacgcca gtaccagcgc agccgttttt ccatttcagg
    49441 cgcataacgc tgaacccagc ggtaaatcgt ggagtgatcg acattcactc cgcgttcagc
    49501 cagcatctcc tgcagctcac ggtaactgat gccgtatttg cagtaccagc gtacggccca
    49561 cagaatgatg tcacgctgaa aatgccggcc tttgaatggg ttcatgtgca gctccatcag
    49621 caaaagggga tgataagttt atcaccaccg actatttgca acagtgccct gagcgttacg
    49681 ccctgttgat tcagggcata cacaatgtcc tgcaggtcct taatgctgcg ggccaggcga
    49741 tccacgcgtg tcaccatcaa cgtatcacca gggcgcagga actccagcag cagctgcaac
    49801 tcgctccttc cggtccggcc gcttccgctg gctttttctg cacgaataat ttcacaacca
    49861 gcagcgcgga gaatttgtgt ctgcagagta agatcctgat cgctggttga aacgcgggca
    49921 tagccgtaaa gtgccataat ggtgaaaact gtctcgttta actctagatg atgaaaacgt
    49981 aacaccggaa tgggataaaa acaacccaaa tgagacagaa aaactgtctc accagactgt
    50041 gcgttttggg tgtactcaaa aaatacattt tcattccaga gaaaatttaa tgagctctta
    50101 atgtaatgcg aggctgactg tattcggact cggactgctt cagttatact tcgaaaaact
    50161 caaccttacc gccagtaagg tgatacatac tgccaacgat tttaattttc ttctcatctt
    50221 ccagttgttt cagcaccggg ctgtttttgc ggatgttttc gatagtcagc tcgacatttt
    50281 ttcgtgccac cgcatcgaca aaatcataat tgctaccttt acgctcaccg ctatactccg
    50341 tttttgcaat cgcgggttta atttcatcca gcagccccgt caggttaccc agttcagcat
    50401 tatcaatagc acagcgtact gcgccacagc gggtgtgtcc tataaccagc actactttcg
    50461 cgccggcaac tgcacaggca aactccatgc tgcccagcat atcgcgatta ctgatattac
    50521 ccgctacgcg ggaattaaac gtctcaccga tccccgcatc cagcacaatt tccgccggcg
    50581 cacgtgagtc aatgcagcta aggatcaccg cagcaggata ctgacccgca atactgttgc
    50641 gcttctgtgc caggtaatca tgtttagccg ggcgattttc ccggaagcgc aggttaccct
    50701 gtttaaaatg ttcaatgact gcatctggag tcataccgtc acgttcctct ttgctcagtg
    50761 atgcggcgaa agagatagtt ggtaccgata aggccgccag cccggtgaca gacaaagcag
    50821 atactgcaag agtttgtttc agtattgcac gtcgtgaagg ttgtgctggt tggttttgtt
    50881 ccattatttg ctcctattta ctgagttaac tccaattgct gcgattatac gtaggtaaac
    50941 gttaatcaaa ccaaaacgac aatttttaac cagtatgaat aaatatctga gaccagtcga
    51001 actggaaaat agaatgctgg cagtcggttt gccgatatga cgaagttgac ttgcagttat
    51061 tgtgagcccg gtggaatgga ttgcgagccg ggcaggataa atgcgagccc attgtcactt
    51121 aatgtgagcc ggtggcattt ttcatttgca gttaatgtga gccgaaattt gcgctgattg
    51181 cgagtcgggg ggatttcgat tgcgagccgc tacaactagg aactctgtgt gttccgaact
    51241 tcataagtct ggagcgttca tctcattctt tgagtgtccg tttggtaatt ccggttgtcg
    51301 cgtcacagtt atgatacgga gaaatcaggt gtggctctca gtctggtctg gcttgaacgt
    51361 ggccatccca gagccagtgc tgttgctgat gtactttcag ccgcaggctt tcctgatttc
    51421 gggaagtagc tccagcaact ggccaaagaa ccttcgcaac gttgaataag cctgatttat
    51481 tttcactgac ttatgtgatt aatgctaatg tacgcataca ttagcattaa tcatgcattt
    51541 aatcccctgc gcctttctgt ctgttctgat ttttctggta gtcctgcttc actctcccga
    51601 tattcttcag aactgtctgc cagtggtcct ctgcctgctg ccggtagcgt tcggcaacgg
    51661 cagcaataat gtcaggatca ctgtcatggc tgcggtgcat gcgtcccttc tggccaaaga
    51721 tatcaacaat aatattctgg ctgccctgcc tgtcgaaaag atgagcgcac aggcgcttta
    51781 caaccagcgg agtatagtcc agcccggcct catcagcgat ctggaagaag aagtacagca
    51841 tctcatacgt tttgtagcgc ttgacggccg cactgagtct ggctgcccgt tgtggtgctt
    51901 cccaggtgtc atccctgtag ttacacagtt ctgcctggta gtcggattcc aggtcttcct
    51961 ctgtataccg gtggtggcgg aaaaagtatt ccctggcccg tttgacgact gattcatcct
    52021 gcggcatgtc tgtctctggt taatgctaac gtatgcgtac attagcatta acaccagtac
    52081 ctggcaagga gagtggcgtg catcgtacct gtggtgcatc ccgcccgggc tccggacatg
    52141 ctgtgccagc aattcgaccg gcggtgcgct gtcctggtgc cctttttcgc taccctgtca
    52201 cgtctttaat ttgtttgtta gttagtttat ttgttggttt gtttgtgtat aatataagca
    52261 taccccttta tgcggagact gacagatgcg tccggcgaca tacgaaccag aacagattat
    52321 tgaagcaggg ctggccctgc aggctgaagg acggaatatc accgggttcg cactacgtaa
    52381 ccaggtgggt ggcggcaatc cgacacgtct ccgccagata tgggacgaat accaggcttc
    52441 acagagcacg gtcgtcactg aacccgttgc cgagctgcca gtggaagtgg ctgaagaagt
    52501 gaaggccgtc tccgccgcgc tgtccgaacg catcacccag ctggcgacag aactgaatga
    52561 caaggcggtc cgggctgcag aacgccgggt tgcggaagtc acgcgtgctg ccggtgaaca
    52621 gaccgcacag gcagagcggg agctggccga cgccgcgcag acagtcgacg acctggaaga
    52681 aaaactggat gaactgcagg acagatatga cagtttgacg ctggcgctgg agtcagaacg
    52741 ttcactgcgt cagcagcatg atgtggagat ggcccagctg aaagagcgtc ttgcggccgc
    52801 tgaagagaat acccgtcagc gagaggaacg gtatcaggag cagaagacag tgctgcagga
    52861 tgcgcttaat gcggagcagg cacagcacaa aaacacgcgg gaagacctgc agaaacgact
    52921 ggagcaaatt tctgccgaag ctaatgcgcg tacagaagaa ctgaagtctg aacgcgataa
    52981 agtcaatact ctccttaccc gccttgaatc gcaggaaaat gcgctggcct cagaacgtca
    53041 gcagcatctg gccacccgcg aaacgctgca gcaacgcctc gagcaggcca tcgctgacac
    53101 gcaggcgcgc gccggtgaga ttgcacttga acgtgacaga gtcagcagcc tcaccgcaag
    53161 gctggaatcg caggaaaagg cctcctcgga gcaactggtg cgtatgggca gtgaaatagc
    53221 cagtctgaca gagcgttgca cacagctgga aaaccagcgt gatgatgccc gtctggagac
    53281 gatgggggag aaagaaacgg tcgcggcact gcgtggtgag gctgaagccc tgaagcgtca
    53341 gaaccagtca ctgatggcgg cgctttcagg caataaacag accggtggcc agaatgcgtg
    53401 atgatgacaa ttcagacgcc tgtgatgaag cgccccgggc ggaggataaa tgctacacca
    53461 aagggcggct tcgggatgag ttcaggatga agccagcccc tggtgcggaa ccggtcagaa
    53521 tgtacaaaag tccttacggc gggaaatacg gcgtatggcg gctggctgac tgcgtcccga
    53581 tgcgggcgaa acgccctcag acagaaaaac agcggctggc cagcacacgt ctgggcctgc
    53641 aggcccggat gaagagtgag cgtggcaggt tcgccatgct ggcacatacc tggttagcac
    53701 tgggccccgt cttcctcgat accgaaacga ccggacttga tgccggcgcg caggcgctgg
    53761 aaatcggtct ggtgaatgcc cgcggtgaga ggatatttga gacccgcctg aaacccacag
    53821 tcggcatcga tccggcagca gctgcagtac aaatcgttac ggaaccatat cgctttccgg
    53881 tgctgtcagt caggctggcc tgagctggat cggggtggct cattccgccg tcactgacgc
    53941 cgttatgaca gcacaggtgg taaacaatat tgccggatac tggcatgaac tccagtgtga
    54001 aatgaatgat gacgcaggga gtgagccagc ataacgctgc tctctggctg gtcagacagt
    54061 tgcagggatt aattcaggag tctgaaatgg agaatatgtt gaaaactatg cgtgagcatt
    54121 tccccgttcg aacagtggtg atcgaacagt ctctggatat gtttggtgtc aaacgaaatg
    54181 aggacgggac gttactcttc ccccgtcact ccgataaacg ttttcccgtt gcacgtatcc
    54241 gtaagcgact ggcggcttat ggctggcgag gagaacgcct gaataaggag gtggcgcgaa
    54301 tcgtcgcggg ccctgatatc ctccctgaga ggagggacta cagcattatt ttcccttacg
    54361 gatgggagaa gaagcagctg acgcgtgaga tgcggcgaat gtttctccgt aagacgggct
    54421 gacgtgtgct gattatgcct gatgaattac atcatttttc tgacttgcgg gagaagccgt
    54481 gacattgaca gaaaaatcag gtcatctggc gtggtgtgcc ctggtggcgc ttgcgctggc
    54541 caggcaggat ggtggcgttc tctcgccggc acaggaaaac ctctttctca cccgctggct
    54601 ggcgactgcg ctgaagcaac ggcgtttttc tcgtgatgtg acgcccgata tcgagtggct
    54661 tttgaaacag ggacgtcaga tgggcgtcag cgccaagctg gccagcaagc tgaattacct
    54721 ctggcgttca tgcaccggtg agttgtccga gcagaacgac ctgttccggc tgacgtatgc
    54781 tctggaaaca gcgaaagata tgcactggaa ctaccgtctg ctgagcgatc gggaatggtc
    54841 cggccggaat gctgtggcgc tcagtgcagg cgtgaacggc atttatctct cacgggccaa
    54901 actcgatgtc ggttttaacg acagcggccg acagataaat tcgctgacag cacgtttgac
    54961 agggaacgta gcgggggtaa tgaagctgtt tgatcgctgt ggctggcaga gcctgatgcc
    55021 tccctgcccc accagtattc gctgatggcc gggcagggag tgccagaaaa gggggattag
    55081 tggcggatct gcgctaggtc gtcttcagtc agaccggtca ttttcatgac ggtattgcgg
    55141 tcaatgcagt tctggagcat ggtacgggct attttcagag tcgcttcgcg ctccccttct
    55201 gaacggcctt tttcgatacc acgttgttca ccgagctgaa tccccttctc gatgcccttc
    55261 tgttcgagct gttgtgcgat ggtcataagt gcgtctccgt gttgcggcac acgctgtgcc
    55321 agttcgcgta caaaggcttc ggcgtccgat gtttcgcctg cctgcactat atagtgtacc
    55381 agcgatatta cctgcgatga agacagatat ccggccagca aaatgggcgc cagccggtca
    55441 accaattctg ccaggtcccg ctgatgaata tgtttctgca ataaagtcag ggcggccatg
    55501 ctacggtggc cggcgatttc atcatccgga atgaccgtaa cgtctaccag cgggaaagca
    55561 ctgctgtaga gtttgtctgc cagagccgta tcgtcaaatt cgtccagcca gcgggtggag
    55621 tatggatacg ggctgcgttt ccccgtatag aacaacactg gtatcaccag tggcagtttt
    55681 ttatgccctg cctccaggtg gcgctgcatg gcggccaccg catagcgtat caggcggaaa
    55741 gccatatgtt tgtcaggtgt tgactggtgt tcaaccagga catgaatata tccgtcgccg
    55801 gctgtggttt tcaggctgta gaggacgtcg ctgaaatact ggcggagatc atcctcaaca
    55861 aacgagccgg attccagttt cagtgtactg agatcgcaga tggcacgcag ctctgccggc
    55921 agatgcagct ccataaaatc ccgggcaatg tcaggttgtg tcagaaactg ccggaatgtc
    55981 gcgtcgtggg gagtcggcgt agtgtttttc tttttcatca gtccatgctc tgaaaaatga
    56041 cccggtcata gtatcacagg caaaaaatgt tgacattgcg aggaacggaa ttgcaattcc
    56101 ttcaggggca gtcccctctt tcttttttaa tcatcagctt gcttgcccgg agatatccat
    56161 gtcctggcag aaactggtac tgctgaacta taccctaatg tgcctggctg acgcgcccct
    56221 tgggcttgtc caacccttcg cctgctcaga tgcaagctct gaacagactc acggtttgcg
    56281 ctgtgggtta acaaaatgat tgtggatgta gtgccctctt ctccatttaa tcttcggtgc
    56341 ctcctgtgag agcaaaatca aaatattatg atttatttct tgcaacatga ttctttttgt
    56401 tcaaaatgac aaaaaacatc atgaggtgat aaatggaaaa tattgagcag ttacggaaag
    56461 tcgccacacg tgcaggtaaa cttctgacat ccttgagcga aagtatccgc cagcaaaaag
    56521 aggaattgaa gcttaccgag ttctatcagg aatacagcaa agccgcccta tataagctgc
    56581 ctaagctcag caaagggagt gttgagtatg ctgtggccga aatggaagcc agtggctaca
    56641 tttttaaaaa gaaaccttct ggcaatacca tgaagtacgc gatgacgatt cagaacgtta
    56701 tcgatctgta tttccatcgt aaagtgccca agtacagaga tcgcttcgat aaagctttca
    56761 ctatatttgt atgtaacctt aaaggtggcg gttccaagac agtttctacc gcttcattat
    56821 cccatgcatt tcgggctcat cctcagcttc tgttcgaaga cctgcgtatc ctggccatcg
    56881 atttcgatcc gcaggcatct ctgacaatgt tcctgagcca tgagaattca gtgggcctgg
    56941 ttgaaaatac ggctgctcag gccatgctcc agaacgtgtc tcgtgaagaa ttactttccg
    57001 atttcatcgt gtcgtcaatt atcccgggcg ttgatgttat tcccgcttcc attgacgatg
    57061 cattccttgc tgaaggctgg aagggattgt gtgaggaaca tctgccaggg caaaatattc
    57121 atgcagtgct taaagagaac attatcgaca agctccggta tgactacgac tttatcttcc
    57181 ttgatagtgg tcctcacctc gatgcgttcc tgaaaaactg catcggagcg gcagacctga
    57241 tgttgactcc acttcctccg gcaacggttg attttcattc ttccctgaag tttgtagcca
    57301 gccttcctgc gcttattgat tcgatcgaac aggatggaca cacctgcaat ctcatcggga
    57361 atgtaggttt tatgtccaaa atcctgaaca agtctgatca caaaatttgc catagtcagg
    57421 ccaaagaagt attcggtgcc gatatgctcg acatggttct gccgaggctg gatggcttcg
    57481 agcgatgcgg ggagactttt gacacagtta tttccgcaaa tccagcaacc tatgatggaa
    57541 gcaccgaggc gcttaaaagc gcaaaatcag cagcggaaga ctttgcgaag gccgtatttg
    57601 atcgcattga gttcattcgt actaatggag gtatgtgatg tcgaatgaga gaagaaaaac
    57661 tattggcaga cagttaaata cccaggcgtc aatggttgag atgactgaca cccaaagaag
    57721 tcaggtattt accctaaaaa ccggcaggaa gataacgttc aggtttgttc gggtacctgc
    57781 atcggacgtt gaaagtaaga cattcgtaaa ccaggaaacc aacggaagag atcaacttgc
    57841 tctgaccagg gagtccctga aatctattat ccagacgatt aagtttcagc agttcttccc
    57901 ctgtattggc attcagcaag gtgaaaggat tgagatactg gatggttcaa gacggcgagc
    57961 ctcagcgatt tatatccgta caggccttga tgtaatggtt accaatgaac ttttatcagc
    58021 tgatgaagct cgccatctgg ctaaagatat ccagacagct aaagagcata accttcggga
    58081 gatcggctta agattgatgg ctctgaaaga gtctggattc aatcaaaagg aaattgctga
    58141 actggagggg ttatcccagg ctaaggtcac cagggcactg caggcggcag cagtaccgca
    58201 agaattgatt tctctgttcc cggttcagtc tgagctgtcg tttagtgact ataaaattct
    58261 gttagaggtt aatgaaaaac tcagtgaaaa gggtttaacg tctgaagggc tcattcagtc
    58321 tgtctcagat cagcatgatg caattttgag tgactacgag cgaccagacg acgaacagaa
    58381 atccagtata ctgaaattga tttctcaggc ctctcaggca ttgatagctc cgcctcctaa
    58441 ggaaaagtca gtaatttccg cactctggac ctttgaagaa aaggacaagt tcgcgcgcaa
    58501 gcgtgtgaaa gggcgtacgc taacttatga gtttagtcgt atgtcaaaag tggttcagga
    58561 tgaactggac aaagctatca acgaggtcct tgagagaaat ttgagtcaat aatttcgcca
    58621 cggcgatttc acatctaact tattgtaatt aagtaattta tattgagaat ttcaaggtga
    58681 aatcgccaca atttcaagtc aatttcgctg caggaatatc tgcccaacgt gtcgtataag
    58741 ctggcgaaag tagttccctt ttcatctgcc actcgggggc aatcccccga ccggcgaacc
    58801 atattttccc cttgcccgga tggttaatcc catccaggac ttgcatcagc tgctcgctcc
    58861 gttcccgcgg ctgtacttca tcaaacaaat taagctgcga taccccggtt ggcgtgaaat
    58921 cgttcagcat acagcctgcc tttgcgtaac ggtgaccatc cacccagatc ctgtccagag
    58981 ctctgacggc agcggcaatg atgtcccgtg tatcctgcgt ggggatgagc agtttttcac
    59041 tggccagatt accgtagtag ggctcagtta cggcgaacgg cgatgttttc acaaacacgg
    59101 caatatgcct gcagaactgc cgttccccac gcagcttttc ggcggcacgt tcagcgtgct
    59161 gacagactgc ctgccgcatc gcttcataag tcgtgactcg ttctccaaag cttctgctgc
    59221 agactatctg ctgtttgggg ggcggtgctt cctccaggga aatacagctt tctccattga
    59281 gttcccggac cgttctctcc agaaccacat taaagttttt cctgatgaac gttggattcg
    59341 cgcgggccag ctgcagtgct gtggtgatcc ccattgtgtt cagcttcttt gagatcctgc
    59401 ggcccacacc ccagatttcc tccaccggtt gcagtgacag cagtttctcc gttcgtttct
    59461 gattgtgtaa cgtcagggca agcacgcctc cgaactgtga ccattctttc gatgcccatt
    59521 gcgcgctttt agccagcgtt ttggtcggtc ccattccgac gccgatggtc agccctgtgc
    59581 cggaacgaac gtgctcacgc agctgtcggc cgaaatcctc gaaatcgatg caactgtcta
    59641 taccgcgaat atccagaaac atctcgtcaa tggagtactg ctcaacgcgt ggcgccagct
    59701 cttccaggtg aaccatgacc ctgttcgaca ttgatgcgta gagggcgtaa ttactggaga
    59761 acgcgataac cggctccgga aatttcgccg acctcagttg aaaccacggc acccccattt
    59821 ttatgcccag tttttttgct tcagcgctgc gcgcgattac acaaccatcg ttgttactca
    59881 ggaccaccac agacctgtca cgcaaatcgg ggcgaaagac cttttcgcaa ctggcataga
    59941 acgagttgac gtcagccaaa gcgaacatca gtctgtgctc cgggttttgt gtataaaagc
    60001 cgtcaccacc ccgaaaatct gcagttcttc cggataaagc gtggggtagg ccggattaat
    60061 cggcagcagg gcgatacggg gcttcaactg caggcgctta acggtgaact cgccatctgt
    60121 ttccgcgatg acaatatccc cctgcatggg tttctcagct ttgtcgacaa ccattaaatc
    60181 gccggaatgc agacccattt ctttcatcga atccccgata gccctgacga agaatgttgc
    60241 agccggacgc cgtatacagt aggcattcag atccagttcc tcctctgtgt aatcggcggc
    60301 cggcgacgga aaccccgccg ggcaacgttc ggtgaacagc ggggcagtgg actgtaccgg
    60361 ctcctgttcg ggtgctacaa gcagtaacat ggcatacctc ttaaaatgcc tgtttttata
    60421 tacagcatta tttaagatat tttctgtcct gcaagtgaaa ttttactgtt tcccctcaga
    60481 taactgttct gcctggaaaa acagatgtca ggttatccac agaatcagtt aataaccctg
    60541 tggaggagca acgcagaact gttggtatgt catctgtcct cctctggtgt ttcccttcag
    60601 ctcctgttgt caccccggcc attcctgcac acctgatgct gactgccacc cgctgccagt
    60661 gtgccgcgtc cggcctgtca cgggacgggc gctggcgtcg ttgtgattgt actccatacc
    60721 ctcgccagtt taagggcgcc cttcaagccg ctttcgcggc ataagctcgc cgacgatgag
    60781 aattgtcggc tcgttattcc acggtcggcg ttgacccgtt accggacgcg acgaacaggc
    60841 agcgtgcggc agggaacggt atcgcggtga tgcctcctgc cggatgttga ggaaaatctt
    60901 atgttcagag tgacctgtat cgacctggaa aatggcgagt ttgcgcttta tatcaacgga
    60961 cattatctgt ccagtgaaga cggcagcggc gagaagctgt acctggggga tattctggaa
    61021 cgtttatccc gtctgcctgg tgtgaccacg gaaaccgtgg agcgaccagt accagacagt
    61081 gatgagtgga gctggaacga tgtggcagac agtgtttttc cggcctgtat cacgctgtcc
    61141 cgcaatatga cagtcgctgc gtttaaacag cgtctttccc ggtttcctga tgatgcgctg
    61201 tgctgcggta cgttctggct ggccagtgat tttctggcgc tggacagttc gctcacggaa
    61261 gacgatatcg atgcggcgat ggagctggca cagcactgcc atgatgcgaa tgacgggttc
    61321 aactggagcc atctgcaatg ggcaatcgat gaggtgaagc gcggtggata ataattcaaa
    61381 cattaatgat acctggcttg ttggcctgag tgtcgacgtc aatggcactg aaatgatggt
    61441 gcattacctg gtttccgcga ctgacctgga gcatgccgaa gcgggtgttc tgcaaatggg
    61501 gcgcacctgg tggccatcgt tgaaacgcga ggatgaccgg catcggtggg aatatgaaac
    61561 aggcgtggtc tggtttaaca gcatcattct gctcgatgac gtggaaaaca gtatcctgcg
    61621 tggtctgaag ttcctcgatg cgtggacagt gaccggctca acggatgcgc cggtactgcg
    61681 cgatgagtgg gggaatgact ggcgggatat cacccgctga taatctgccg ggcagtacgt
    61741 ctgcctggta cttcctgaat gaataatgat gtcgcgcagc tcctcttttt tcggcgccag
    61801 cgccggcggc gcgggagcaa cgctgcctgt ggtcagtatc ccgcgtccgg ccgggcacgg
    61861 gacgggcgat ttttctgctc ctgccgggcg ctgtcgctat tatgcgcccg gcactcgcct
    61921 tctgatgaac gcccttcaag ccgctttcgc ggcataaact caccgacggt gaggactgtc
    61981 ggctcgttat tccacggtcg gcctgacccg ttaccggacg cggtgaacag cccacaggca
    62041 gcggggaacg ggcgtcacag ggacgccctc ccggtgcctc ctgtaaccgc gaggaatctc
    62101 tatgtcccgt ttaatcctgg ggaactgtgt cgatattatg tccggctttc cggagcgcgc
    62161 cgtcgatttc attctgaccg acccgcctta ccttgtcgga ttccgtgacc gttccggccg
    62221 cagtattgcc ggtgacagaa ccgacgagtg gctgcaaccc gcctgtaacc agatgtaccg
    62281 cgtactcaaa aaagatgcgc tgctggtcag tttctacggc tggaaccgcg tggaccgttt
    62341 catggcggcc tggaaaagtg ccggtttcag cgtggtcgga cacctggtat tcaccaaaaa
    62401 ctactcgtca aaatccgcgt atgtcggcta ccgccatgaa tgcgcttacg tgctggcgaa
    62461 aggccgtccg gccctgccac agaacccgct gccggatgtc ctcggctgga agtattccgg
    62521 caatcgccac cacccgacgg aaaagcccgt taccagcctg caaccgctga ttgagtcttt
    62581 cacacacacg aacgccattg ttctcgaccc gtttgccggc tccgcctcca cctgcgttgc
    62641 cgcgttacag gcggggcgca gatatatcgg tatcgagctg atggagcagt accacaaagc
    62701 cgggattgag cgcctgacag ccgtacagcg cgccatgcaa cgcccggccg ccaacgacgt
    62761 cttttatccg gaggccgcgt aatgaactat tccggacacg aaaaactccg cgcagaagtg
    62821 gcggcgctgg ccaacagcat gtgcgacctg cgcgccaccc tgaaagtgct ggaagagcgt
    62881 tatcactggc agcgtcacgg acttactgaa cgactggccg ggcagagtct gcggcgtatc
    62941 aacaccctgc tggatgaagc gtacaacgaa agcctgatgc tcaatgagtg ttttaaagac
    63001 tgacagatga cgagaccacg ggcggcggtg ccgccccact gaaccaacgg agaaaatcat
    63061 gatgtatggc acacgtaaag aactgaactc aaagctgaaa cgcatgtttg gcaacgacga
    63121 gcgttttgcc ctgctgatct ggacgaagca ggacgttatg tcactgactc aggcgatgac
    63181 cgaagtggag gccgatgcga ttttgcgtga gattggccga aaaggtatgg gcgaacatac
    63241 cggagacggt atttcagaca gcacggtaca ggcgctgtac gccggattac ggactgaaat
    63301 cccgaccgtc agtgttcccg ccgacctgct ggcaagggtg acgaatatcg ccgggcgggc
    63361 gctggatacg gaggacgctc aggcctggcc tcttgtatgt caggagtacc ccggcgttgc
    63421 cgacgctcag gtcgatattg cgcggctcag gcaactggcg ctggcggcgt aacgtaccac
    63481 cccgtaccgg gtgacgggcg gggtatcaat cacaactgta tgaacacgaa gaggaacaac
    63541 acaatgagaa acacgctcag tacgctgata gtgcgccacg gagataatct gttacgccgg
    63601 tccggctggc ccgaaaccgt cggcgtgacg caggtggccc ccggtgtggt gcccggctgg
    63661 ctggccgtct gcggtgtgct cagtgctgcc gaaatcttgg cactgacgac gcatctttgt
    63721 cagcccctta attatggacg ggcgcaactg ctgacggcca gtgcgcagcg gctggcgggg
    63781 acgccagtcc ggttacatct gtacccggta caggcatatc cgcaccctgc cacggtacgc
    63841 gaatgcactg aaattcgcct tccgtatgct caggagtggc tgaccacgga cgaatatgcc
    63901 gacctgctgg cgttcctgaa agcgtccgct gaccgggtat gtgaaattgt ccgccaggat
    63961 acgaagcgca tcgcggcggc gctggcaccg tccggcgagt cccgcctgat ggaaaaacgc
    64021 atcgggaact ggcggttact ggccgatgaa tacgaccatg ataactggct tgacgaagag
    64081 gacgaggacg gactggataa ggtgctggac gcggtactgg tacgtaacgc ccgtttctgc
    64141 ccggtgctgc tgacgctggt taatgagccg gaggaagaaa tcgaagccgc cggcgtgata
    64201 accgactgtt tgcgcttccc gggggaaccg aaccgccgct ggcttgaccg ccgcgtgctc
    64261 cgggatgtgg tgaacgaagc ccggagtttc acaggcaaca tccgttaaat aagctgtgtg
    64321 cggtgaacga taagctgtaa acggtaacga gaaagaaaag agaaggggag gtctccttct
    64381 cttttttcag tttttcagcc ggcgactgcg acgatgccgg ggacgacagg caaaacaggc
    64441 aaaaggatgt cgccttttcg gctccgcatt cacccggctc aggcctgccg gccgtcgcct
    64501 tgtggttttc cactctgaca gtcctgtgtc gtgtgcgggc tgtgccgtgc atccatcgta
    64561 gtcgggctgt cgtggataca agggtaaagt gcacgcggcg gtcacccggt ccttccttca
    64621 cgtcagccgc gatcttccgg tcgttcgacc gttcaggttt cacggtctca cccttcagct
    64681 cccgtcttcc gtgcgcgtca ggctgcggct tcccttgcgc ccttgcatcc acgattgatc
    64741 gcccgactgg tatggatgca cggcaccgcc cggtgtcgcg gaatatgtga ttacggaggt
    64801 tttatgcagt attcaaatca gcaacgtgcg cgtgttatta acgttgaaga atccgaccgc
    64861 ctgtctttcc tgccgtacat gttcggcaac gattttatgc tggctgaatt acagttatat
    64921 gccctggcga aaaaatggat gcctgaatac aacggtggtt tctggcattt tatccgtctg
    64981 ccggaaggcg gcggatacat gatgcccgac tgcgatcggg tacacatgat caacggtgaa
    65041 aactggtttg atcgtaccgt cagcgccgac gctgccggaa ttattctgac ttcgctcgcc
    65101 attaaccgcc gttgctggac gcatcacgac tgcggcaacg ctgcgctcac tcgcctgtat
    65161 atgctgcgtg atacccagct ctggaatcac attacgtttc accctgaatg caacgctatt
    65221 tacgccgcgc tcgactgatt aaccgacggg gcggcgatgc cgccccgctg taactgtcat
    65281 tcattgattt aagaggagtc tgttatgtac ggaaccgtca gcaccatctg ctgcgactta
    65341 ctgaaagtgt atgagaatca cgaaaaaatc gctgtcatca tctggtgtga aggcgatgtg
    65401 cgggaaatgg gggcggagtt taatccgacc gctgatgaca tacaggccgt actgcgcgcc
    65461 attggcgagt cggacagtga tgcgctctgg cgtgatggta ttggccagaa ttttgttgag
    65521 ggtgtattac gcgagttagt cgcactgcgc ccaccgcgcc agattgctgt acctgaagat
    65581 gtgctgcgca cgcttttacc cctgatggaa gccggaatga accttcctcg ttaccagacg
    65641 caggacaggg ctgctgaaga agaaaccgcg ctggatacgt tgcgatacct gctttccaca
    65701 aatatcccgg cgcataacct gaccgaagga aactactgac agatattagt gcgccgtgta
    65761 caccggtggt cacttcctct tacagggcgg aaaaagcagt caggcatgat ggcaggcggg
    65821 gagggcgcct gtcagcccgc gcgaaaaaac ctgcaggctg gcgcctgcgg ggggaaggac
    65881 aggggccgcg cttcgcgccg ctccctgccc ttttccccct ctgcctctga tggcgtacac
    65941 ttacagccgg tttccatttc tgtcggagga tgtgatgtcc ggactgaatc tggcggcaac
    66001 aactaaagaa gagcaggata aagtggccat tgacctggtt gcttcaggcg tggtctataa
    66061 agaaaggctg gcgatgccgg tggtcgctga gcttgtcgtc agagaacagc ctgagcattt
    66121 gagagagtat ttccgggcgc ggctggagta tttgcgcaac tcccggacaa gaatgccccg
    66181 gaatatgcca gaaaagagga tgaggttaaa aaatagcgcc attcctgatg cattctgcct
    66241 gtcgctggcc ggattttacg catgccgggt gatgtttttt tctggccggg gtgtgtgatt
    66301 ttcttcctgc cggtgataat acgctgcctg ttcctgttcc tgttcctgtt cattctgctg
    66361 ctgatattcc ctgacagatt tcgctgacgc cgggcgactt ccctgacggg aaccgggact
    66421 gtcatgctgc gcaccgagcc agctgcgctg tctctgcccg gccccttcgg ggcagcgggt
    66481 ttccatccca ctgtcgcaac gtcaacggca ggcttgctgc gaccgttccg gtcacgccgc
    66541 ccctggcgcg ccgtttcctg cgcttttcgc accccggcgg taaggctgcc gggctgtaag
    66601 gcgcaacgcc gtttcgcgtg ccgcgtcccg acgttgcggc gggttcctgc tcatctccgc
    66661 ttctggtgcc gttacccgtt taagtccctg tcgccggggg ctgatacagc cacaacccgc
    66721 cgcactggct gtccaaggtg aaatgaacag cccacaaaac tttttgccgt aaaaggccgg
    66781 caaaaacttt tgcgttctgc cccggacagg tgcgtcgggc cgtggcagtg atgccccttg
    66841 cggcgaaggt tctcaaacgg gtgatggcag taccagaggg aacagaacag caggtccccg
    66901 caaaacgtca aaaccgcggc tcccgaaact caacgggtga tggtttttaa agtcaaaaca
    66961 acgcattaag gagatttatc atggcagcac gtggcgtaaa caaagttatt ctggtcggtc
    67021 atatcgggca ggacccggaa gtacgttaca tgcccaacgg gggcgcggtg gcaaatctta
    67081 ccctcgccac gtcagaaaca tggcgtgtca ggcaggacgg ggagatgcgc gaacacaccg
    67141 aatggcaccg tgttgtcgtg tttggcaagc tcgctgaaat tgccagtgaa tatctgcgta
    67201 aaggtgctca ggtctacatc gagggccagt tacgcacccg caaatggacc gatcagtccg
    67261 gtcaggacaa atacaccacc gaagtgatcg ttaacgtggg cggcaccatg cagatgctcg
    67321 gtcgccacaa cagccagcca cagcaggagc ctcagacccc acctacggcg gcaaagggag
    67381 aaggcaaagc ggtaaaaggg gcgggaaatg cagcaaaagg gaaaaacgca gcagcaccgc
    67441 agcagccgcc agcgcaaccc gatccggcgt atgacttcga cgatgatatt cccttttgac
    67501 tcggtaaatt ttcactgatg ccccgtctga cggggcttat ccaggagaac acgatgacag
    67561 acaacatcat gagcccactg aaatccctgc ctgatggcac gttcacccac gaacaggccg
    67621 aagcggtggc agcacagtat cagaatgtcg ccattgaaga cgatcagggg acgcaccttc
    67681 gcttggttgt gcgtaaggac ggcgaaatgg tctggcgggg ctggaatttt gaaccgggcg
    67741 gcgagtactg gctcaaccgc tgtatcgaaa gccacggtat ccgtaaaacg cagtaagccg
    67801 taagaggtgc cggacgggaa cacgtccggc agacaattat taatatcatg aaggagtatc
    67861 aataatgtca gttaccaatt ctaatgcaaa atccgcagta aaaaccagcc gtaaggcgaa
    67921 aaacgccgcc agtgccagta acaccgtatt gtcggcggtg ctggcgcaga ccgaagaaca
    67981 acacgtaccg ctgtccgcac tggtcaaatc cccgcagaac gtgcgtatcg tgccgtattc
    68041 cacagagagc gtccgcgaac tggcggactc tattaaaggg attggactgc tccagaatct
    68101 ggttgttcac gccctccctg acggcctgta cggtgttgcc gctggcggtc gccgtctggc
    68161 ggcgatgaat ctgttggcca ctgagaacac gatccacccg gactggcctg tccgcgtgaa
    68221 ggttgtgccg gataatctgg cgaccgccgc ttcactgacc gagaacgggc agcatctgga
    68281 aatgcaccct gccgaacaaa ttgcgggatt ccgcgcgatg gcagcggaag gcaaaactcc
    68341 tgcacagact ggcgatctgc tgggctattc gccccgtcac gtacagcgga tgctgaaact
    68401 cgcggggctg gctccggtta tcctggaagc gctggctgcg gacaaaatca ccacggagca
    68461 ctgtcaggcg ctggcgctgg aggacaatcc cgaccgtcag gtgcaggtgt acgaggcggc
    68521 gtgtcgagag ggctggaaca ataaaccgga agtgcgcgtg atccgtaatt tgatcaccga
    68581 cagtcaggtt tccaccctca acaacagcaa atatacgttt gtcggtgaaa aagctttctc
    68641 cggcgatgaa atccgcgcag acctgttcag cgacgaacag ggcggttttg tggacaaact
    68701 ggcgctggat acggccctgc tggaaaaact tcagtgggtg gcggagtgcc tgaaagaggc
    68761 cgagggctgg gcatggtgcg cgggacggat ggagcctgtc agccgctatg gtgaggatac
    68821 cgaagtgtac cgtattcagg atgagcctga cgcggtttac acggagcagg aacagcagcg
    68881 cctggacgag ttgcaggaac tgtacgacga aaaccagacc gccagcgatg aaaccgacac
    68941 gatggagtca gagatagagg ccatcgaatg cgcggcacaa ctccgggcat ggacgctgga
    69001 aatgcgcgca cagtccggcg tggtggtgtc atggcgtcac ggtgaaatct gtgtccagcg
    69061 cggggtgagc ctgcgtgagc agtctgaaac ggaagatgaa cccgatcagg ttccggtata
    69121 tgagcgccag ccggagcctg tggacgaaat cagtgttccc ctgctgacca gaatgtgtgc
    69181 agaacggaca ttgtcggtcc aggcggcact gatgcagcag ccggaaaaat ccctggcgct
    69241 tctggcatgg acgctgtgtc tgaacgtgtt cagcagcggc gcgtataacc gacccgctca
    69301 aatcagcctg aactgtaagc attactccct gacaaaggat gcgccgcccg gcgagagcgg
    69361 tgttgcgttt gtgacgctgt cgcaggaggg aaaacgtctt gaaacgttgc taccggaggg
    69421 ctggacacag gacttcacca cctttttcac cctcagcgcc aaagacctta ccgccctgct
    69481 cagtttctgc accgcatgca gtcttgacgg tatgcagatg cgcggcgccg gaggcaccac
    69541 ccgcagtccg ctcgataagc tggaaatcgc gctcgctttc catctgcgcg actggtggca
    69601 accgacgaag gccgatttct tcactggcct taaaaaaccg caaatcatcg ccgcgctgaa
    69661 tgaggccgga ctgacaggcg cggcgcggga tgcggagaag atgaagaagg gtgatgcggc
    69721 tgaactggca gaggacaaaa tgcgtgacaa ccgttgggtg cctgtctgga tgcgcgcccc
    69781 tgatgcagaa aacgacgtat ctgataccga aaacggcagt gctgatgcag acagccacca
    69841 caccctgccc gatgcagcct gataacggag gccgcccttc gggggcggca gcaaggagaa
    69901 aatgatgcgt aacattatta cccccgctgt attgagtaca atgatccccc aggaattcga
    69961 agactggcgc gacggcggcg aagacctgcg ccgtgaactg acccacgccg cgatgcgtga
    70021 cctgacatgt cccgcaggct gggacatgaa cggcgaatat cgcagtgagt ttggtggttt
    70081 tttcccggtg cagatccgtt tcacgccatc ccgcggcaat ttcagcctgg cggtatgcag
    70141 tcccggggat atcagcccgt cctggatggt ggtctttatt ccggtcagcg gtcgcccgtt
    70201 ctctgttatc cgcacgctgc cagcctggtc gccggaggtt atcacgcata cactcagcct
    70261 ggtggctcac cttgatgccg atggttacag tcaggccagc atcatcagcg ttctggcgat
    70321 ggagggcgca gcatgatcca ctcttcacac gccctggtta ccctgaagcc agcccgtcag
    70381 gcggcattac aggccattct gacggtggaa gaatcccgcc gccgtggagc acgtctgccc
    70441 gccctgccac atgcgcgtac ttttttgcgc gtgctgagcg gcagcagccg gattaacacg
    70501 acagtggcac agcgtattcc cggtctgaac tgggagccga agaaccggct gaccagcctg
    70561 aaacaggtgg aagaggcgct ggatcgcctc atctccagtc acggggagta ttgcccgcta
    70621 ccactctccg tggatgtgca ggccgaactg ttcccggagg tgatacacgc gcgcacagat
    70681 cgccggatgc agcgtgagaa aatcgccttt aaccgcaaaa tgcgccggga ggaaaaagcg
    70741 ctggaacatg cctggctgct gcgccagaac ctgctggggc aggccatgac ggagcttaac
    70801 tttcagtcgc cggaaaccgt caatgcctgg tatacgcgct gggctgacga gtttgacgcg
    70861 cgggagctgg cgcaggggtt ctggcagtgg cggacgcggt ttacctcgct gacgtcgctg
    70921 gactggctgc gcgacagtga tgagccgctg tacaacgtga tgtatgaaat ctggttcatc
    70981 gtccgggaaa acccggtata tgtgcgcgag gccgaacgtt ggcaggtacc caacaagctg
    71041 acgaaccgga ggcccgggcg acttccctga taaagcccgt ctggaaacgc agaccgcccg
    71101 gctgatggat cagctggagg tacaaatccg gctcatcccg gtggcaacgc cgccattgca
    71161 gcaaaaagtg gatgaaatag cacatatgct tcacctgatg gcgcagtttg ccggaactga
    71221 actcaggaag tgacccggat ggcggggaat atccccgccc cgttatcgaa aggagatatc
    71281 atgcgtaact ttgaatctac tgaaagatgg tggaaaaaat gaaaagccag ctggtagccg
    71341 ctgctgatcg tgcggccatg agtgtcgcgt atggtcagga agccgcagat cattacggta
    71401 ttcagtatgg ttttatccgg tctgtacgtg actggatcac cggcttcacc gaggggatta
    71461 aaggggagcg ttgttgaata acacccgctt ttgttacttg agtgttaacg gaaatggcgg
    71521 tgtctccggt cactgctttt tcttcagaat tttttcatta attatataag gaatacgtta
    71581 tgagactcgc ttcccgtttt ggtagacaga attccattcg tcgtgagagt cctttggctg
    71641 acgctgaatt aatgcagact gtgccttcag ttttttccgg agacaaacat gaatcccgga
    71701 gcgaacgtta tacttatatt ccaaccatta atatcatcaa caggttacgt gaggaaggtt
    71761 ttcagtcgtt ctttgcctgc cagagtcgtg tacgtgattt aagtcgccgg gaatacagta
    71821 aacatatgct gcgttttcgt cgtgaatgac agattaatgg gaaagaggtt ccggaaatta
    71881 ttttgctcaa ttctcatgac ggttcgtcaa gttatcagat ggttcccggg ctgttcagat
    71941 ttatctgtac aaatggactg gtatgcggat cattttggtg aaatacgtgt gccacacaag
    72001 ggagatattg ttgggcaggt gattgagggg gattatgagg ttatggggat cttcgataaa
    72061 gccaccgaaa atatggagtc aatgaagtca gtgatactta atcaggatga gcaatatctg
    72121 tttggtaaag cggcactgac tgtcagatat gaggacgaaa ataaaatccc tgtttctcct
    72181 gaataaataa ttactccacg tcgtcgggaa gataaacaaa atgacctgtg gacaacatat
    72241 cagcgtgtac agaagaatat gatgaagagt gggttacccg gcaggaatgc cccggaaaaa
    72301 acacccggat cagggcagtt accggtatta atggtgatat ccggttaaac aaggcgctgt
    72361 ggatgattgc tgaacagttt cgtgaatgta agtcataata acataagtaa agccccgaaa
    72421 atttttcggg gctttactta tgttattctt cccggacatt gtcagattgt ctgtaacatc
    72481 ccattttaat caacagactt catcgttttc tgtcatttat gtgccagcga taaaaacgga
    72541 tctgacaggg tggaagaaga tatgataacg ggttcccgtt tcgcgggatt ccgggcagtc
    72601 agtattacat ttctgtgttt attccattct gctatgcggc ataaaaaata tatgggtttc
    72661 ggttgataat attatccctt cttctgcttg ccggatacaa aaaggggatc atcgggcggg
    72721 agtctgcctg gttttacttt gttttatcgc gatccagatt cggtgtacat cagtcgcata
    72781 gtccagacga cgtgcatcct gaaggggagt ctttttaaat ccggcgttgt acgctccgac
    72841 tgctgtccag gatacccccc actttctgaa tgcgattgcc agataataag ctccggtgta
    72901 aatattcagg cagggatcgg agacaagttg ttccggtttt attccataac gagccagttc
    72961 gttaaagtgc tgagagtcaa cctgcattaa ccccgagcca tatcccgtaa ccggattaat
    73021 accgacggca ttagcccggt tacgggattc cttccatgaa atcgcccgca gtaaatccgg
    73081 atctatttta tagtctctcc cggccagatc aaaacagtca gcggcatgga ctaccgtgct
    73141 cattaatacc aggaggacag acaggagcca tttatacatt aatttgcctc ttgcgtagtc
    73201 atccggtaat aacttaaccc actccaactc catactcaac aaatttgccg tcctcaccac
    73261 caaaagcacc acaccccacg caaaattaaa atttttctga tttgttttta gtaacagtga
    73321 gttatgttca taataatgta atttaattta ttttaatgta ttaaatagcg gtgcaggcac
    73381 gtcaccggca ccgctatgac gacgctatac aggggtagta ctgactattt ttataaaaaa
    73441 cattgcatta tatcaggggc gctgctagcg tcgctgtgcc tgtttttaag taacacccct
    73501 gggggcgctg ccaggggtgt taccccttac agagtgctcc tgaatccgga gtttataatg
    73561 ttcttattcg ttgcggaaaa aaggtgatag tgaatggcta aagtcaatgt atatataagt
    73621 aatgaggtac acaataaaat aactgctatt gtggaaaaac gacgccagga aggggcgaga
    73681 gataaagata tcagtttttc tggtacatct tcgatgttgc tggaattagg gcttcgtgtc
    73741 tatgaggcac aaatggagcg taaggagtcg ccatttaatc agacagaatt caataaagta
    73801 ttacttgaaa atgtacttaa aacacagtca tccgtagcca aaattttagg tataggatct
    73861 ctcagccctc atgtcgccgg aaatccaaaa tttgaatatg caaatatggt tgaagatatc
    73921 aaagaaaaag tatcttcaga gatggaaaga tttttccatg aaaatgaaga ataatagcgg
    73981 gattaaatcc tgatttagtt taaataaaag tatgttgatc tataaaaata tagtgacaaa
    74041 ttaaggctga aaacaatata gtgtctttgt agttaacgct acgttaaaaa aacaagttaa
    74101 atcgccgata cagggagctg tcactccctg catcgactgt ccatagaatc ctttgaggag
    74161 gttcctatgt gtccgacgga tcgtagagaa agaacactcg ccagtcaatc tgtaaataaa
    74221 tacattctga gtattcagga tatctataaa aactcaccag tccctgtttg cgtccgtaat
    74281 caaagtcgga aaatcattta cgcaaatgga gcctttattg aactcttctc taaagaggat
    74341 cagcctcttt cgggagatag ttataatcgt tatggggttg aagtttttct gtcatccctg
    74401 gaacttgaat gtcagtcgct tggacatgga gctgcttttt gccggcgttt taattttcat
    74461 ggggaaattt atcagataag aatggagaat atttcattcg ataataatga gataattgtg
    74521 ttgtggcaga taaatttatt tccagatcat ccattttttt ctcctgacac aaaaactaaa
    74581 aatttgtctc tctcaggaac tgaatcattc tggaacgaac tgtcccccgg aactttgctt
    74641 gttttttctt tttatacatt aggagttagt cacgcaaata tagctaaaga attaggtatt
    74701 actatcagag catcagaaga cagaatcaaa cctgttaagc gtaaaattaa aaggaattat
    74761 gaatctttcg attcattcag aatatcatgt atttctaaag gtaaaataat atcattgata
    74821 gacattattc gtgaatttta ttgtgttaag tgaatgttaa ttaaggcgcg ccatttttgg
    74881 cgtgtttttt tttgccgttt tccgtgtaat cataagttta ttagtcgtgt aagcagaggt
    74941 gaatttgtga ggaggagaaa cgcaagagag gggataagtc gaactgtctc agtgtatctc
    75001 gatgaagata cgaataaccg tcttatcagg gctaaagatc ggagtggaag aagtaaaaca
    75061 atagaagttc agattcgtct gagggatcat ctgaaacgat atccggattt ctataatgaa
    75121 gaaattttca gggaggtaat tgaagaaaca gagtccacat ttaaagagat ttaactttca
    75181 tattcatagt tgatattact caaaagagga accatatgag cgctatttta agtgttcagg
    75241 gtgcttctgc gcccgttaaa aagaaatcgt ttctgtctac gttcacacgt ctgaacctgc
    75301 tgaaacttgc ccgcgcagtg atcccggcgg cagtactgat attctttttc ccgcaactgg
    75361 caatggctgc cggcggttcg caggacctga tggccagcgg taacggtacg gtcaaggcga
    75421 catttggtaa ggattccagc gccgtcaagt gggttattct cgcggaagtg ctggtcggtg
    75481 ccgtgatgta catgatgacc aagaacgtca aattcctggc gggttttgcc atcatctcgg
    75541 tctttattgc cgttggtatg gctgtcgtcg gcctctgaca ggaaataaga ccatgtcggg
    75601 agacgagaat aaactcagga aatatcgttt cccggaaaca ctgaccaacc agagccgctg
    75661 gtttggcctg ccggtggatg aattaattcc tgctgctgtc tgtattggct ggggattaat
    75721 gacatcaaaa caacttttcg gcatcagcgc tgcggttctg gtttatttcg ggataagaaa
    75781 actgaaaaaa gggcggggaa gctcctggct gcgtgacctg atttactggt atatgccgac
    75841 agccctgctt cgcggtattt ttcataacgt tcccgattcg tgtttccggc agtggattaa
    75901 gtaatcatta ttccgggatg agtatatgga acacggcgcc cgtttaagta ccagccgcgt
    75961 actggcaata agttttattt ttatggccct gctgattgtg ctcagtctgg ccgtgaatgt
    76021 cattcagggt attaataact accggctgca gaatgagcaa cgcacggcgg tcactcctat
    76081 gggatttaac gcgtcctttg cggtgtcaca gaacagtgcc gatgcctctt atttacagca
    76141 gatggcgctg tcgtttattg ccctgcgtct gaatgtgtcg tcagaaaccg tcgacgcgtc
    76201 acaccaggca cttctgcaat atattcgttc gggcgcacag aaccaaatga aagtcattct
    76261 ggcagaagaa gcgagacgaa ttaaggccga caacgttaac tccgcttttt tccagaccag
    76321 tgtcagggtc tggccacagt atggccgcgt ggaaattcgc ggtgtgctga aaacctggat
    76381 tggagattca aaaccgttta ccgacatcaa acattacatt cttattctga aacgggaaaa
    76441 cggcgtgacc tggctggata atttcgggga aactgacgat gagaaaaaat aagccgtata
    76501 agccattttt actggcggcc ggatggttat tttccggtct ggtgatggcg tcgggttccg
    76561 gtacgctggc cccggtggtg gtgtccctgg ctaacggcgg tcaggcgaac attgctgtca
    76621 gcaacaccga cccgaacctg tttacggtac cgggtgaccg tatcactgcg gtcagcggtc
    76681 tggacggcat gctgacaaac agtgagcaga caggcacggg cggcgtggtg gtggccacgg
    76741 tcagtaaaaa gccgttcacc ttcattctgg agacggagcg cgggctgaac ttttccgtcc
    76801 gggccgtccc ccgggccggt gccggacgca ccgtacaact ggtcagcgac ctgcgcggaa
    76861 ccggggagga ggctggcgca tgggaaacgg ccacccctta tgaatccctg ctggttgccg
    76921 tcagccaggc agttcgtgga ggcacgctgc ctgccggctg gtatcagatc cccgtcacga
    76981 aagaagcgct gcaggccccg gccggtctgt ctgcacgggc tgacgctgtg tggaccggca
    77041 atcacctgaa actggtacgg tttgctgtgg aaaataaaat gccgtcagcc ctgaacatca
    77101 gggaaagtga tttctggcag cccggaaccc gcgccgtgat gttcagccag cccgtcagcc
    77161 agatactggc cggcgcacga atggacgtgt acgtcatccg tgacggggag ggcaactgat
    77221 ggcgagcatc aatacggttg taaagcgtaa acagtacatc tggctgggga ttgttgcggt
    77281 gggggctgcc gctgccattg gcggaggcct ttacctgtct gacgtcgaca tgagtggcaa
    77341 cgggacggcc gcagagcagg agccggtacc ggatatgacc ggggtggtgg acacgacctt
    77401 tgatgacaaa gttcgtcagc atgccaccac ggaaatgcag gtgacggcgg cgcagatgca
    77461 gaaacagtac gacgaaatcc gccatgagct ggatgttctg aataagcagc gcggtgacga
    77521 ccagcgtcgt attgagaagc tggggcagga caacgccgcc ctggccgaac aggtgaaggc
    77581 cctgggagcg aacccggtga cgaccacagg agagcccgtg ccgcatacac ctgtctcacc
    77641 gcccggtccg gaaggagaac ctcagccggg taatacgccg atgaccttcc cgccacaggg
    77701 agccgttcct ccgccaaccg ctttttatcc ggggaatggc gtcacgcctc cgccacaggt
    77761 gacataccag tccgtgccgg tgccgaaccg tatacagcgt aaaacgttca gctatgacgc
    77821 tgccgcgaag aaaggtccct ccctgccgta tatcccgtcc gggagttttg caaaaaccat
    77881 gctgatcgaa ggagcggatg ccaatgcctc cgtcaccggt aatgaatcga cggtccctat
    77941 gcagttgcgc attaccggcc cggtggagat gccgaacagt aaaacatatg acctgacagg
    78001 gtgctttgtg ggtctggaag cctgggggga tgtgtccagt gaacgcgcga tagtacgtac
    78061 ccgtaatatc agctgcctga aggacggcaa aaccatcgac atgtcggtta agggacatgt
    78121 cagcttccgt ggaaagaacg gcatcaaggg tgaagtggtg atgcgtaatg gcaaaatcct
    78181 cggctgggcg tggggcgccg gttttgtgga cggtatcggc caggggatgg agcgggcatc
    78241 ccagcaggcg gtggggctgg gggccactgc gacttacggc gcgggcgatg tgttcagaat
    78301 ggggattggt ggtggtgcat cgaaagcggc acagacactc agtgattatt acatcaaacg
    78361 tgccgagcag tatcacccgg tgatcccgat tggtgccggt aatgaagtga ccgtggtgtt
    78421 tcaggacggt tttcagctga aaaccgtgga agaaatggca caggagcagg cccgtcaccg
    78481 gaaggaggat gaaaatgcgg aaagcccggt gcctatacct ccgtcagtcg acagccatat
    78541 gaacggcttt aacaccgacc agatgctgaa gcagctgggt gacctgaatc cacagcagtt
    78601 tatgtccggc agccagggag gacatgtaaa tgggaaataa ccggctgaac aacctgaagg
    78661 gacgtgccgt tttatatcgt attgccggtc ttctgcgctg gctgatatgg ggcgtgaaat
    78721 atgccgttat ctggccgctg gccacaacag ccattgttgt cattctgctc ttccggacgg
    78781 gggataccac gccgggacaa cagatggcgc aggaaatcgg acgggtgagg gcaatggccc
    78841 cgtccgggat gtttccggtc cgggactgcc ctgacccggc tttcacggtg tcgtcacctg
    78901 taccgctgaa tctgacggaa aactgtccgc taaaaataac cggcgcggaa gaatacgcgg
    78961 cagatatcga ccagtccctg tcgcaaacgg gatggctgtt atgggggatg ctggcgctgt
    79021 tgtataccgc ggtggcagta atgattggag accggccgta ccgtcacaat ccactgacat
    79081 atgcgtatga cacagcgaca aacaacctga agtatattga taaagaaaac gaaatccgga
    79141 ctttaaaagt aaatacaaac gggcaggttt cttattctgg taataaagag gctaaaaaag
    79201 agggtgataa aaatgaacat acgtaatgtt atttcagttc ctgatgaatc cgtgcaggat
    79261 gattttgtga aatatgttat cagtaactgc actacaaaaa taatactctc cggtcgccgg
    79321 gaatataatt tctcacgaca ggaatataat ttttcagtta ccggaatgcc tggcgcaggg
    79381 aaaacatgtg ttctgtctga attaatcaaa aagctgctgc gtgagaataa gaaaggggcg
    79441 aaatcatgaa ccggatttca tgcctgatcc ctttctgtgg cgcgcttctg ctgtccggat
    79501 gcgccggaac gaactccgac tttgaatgta ccgccaccac gtcagacacc tgtatgacga
    79561 tggagcaggc caatgaaaaa gcgaaaagac aggagcaacc tgagacggta aagccgggtg
    79621 cggtatcact gccgcgcctg gctgagggta actttcgcac gacgccggta caggtagtca
    79681 gtaccgtcac tctacccgtc gcaaagaccg tggccgcccc gcgttccggg cagaaaccgc
    79741 cggcaccaca cccgctgttt acggctgccc gggaggtgaa accggtggcg gctgtcagta
    79801 cggtctctcc tgtggtgccg ccccgtccac tgagaaccag ggagcagacg gcggcgttat
    79861 ggatagcgcc ctatattgac agccaggata tttaccatca gccgtccggc gtattttttg
    79921 tcattaaacc gtccgtgtgg ggaaagccac ggattaatta actgacgcgt cagtcagata
    79981 tcagccggca atgccggccg gctttctgta ttcaaaacct gcctgtaaaa cgagtgccct
    80041 gtgcgtgaaa agggacgggc ggtagcgtgt cagaacgtgt caggagacat attccatgag
    80101 cgatgaagcc gatgaggcat attcagtgac agaacaactg accgtgacgg gaataaaccg
    80161 gatacggcag aaagtaaacc gtaaaggtat tccggtttac cggtgtgaag catgcggtaa
    80221 tcccattccg gaggcgcggc gaaaaatatt tcctggcgtg acgttgtgtg tcgaatgcca
    80281 gtcttttctg gaaaaacagg gcaggcatta tgcataaatc agacgctgaa aaaatggaat
    80341 ccattattga taaacatgac cggatatacc gacgacaggt gcgggtattt aaaaacctgg
    80401 gcttcctctc aataattacc gccgtactga gtgtgattac tgcgttattc agtacctccc
    80461 tgctcctgaa atacacgctg tgtgtcgtga tatgcgtttg tctgatttat ctggttttta
    80521 tgttcttctg cctggacagg tatatcgcgc tcagtcgtca gacactgctg tggctgttgc
    80581 gccgggtgga agataccgca gacgttcgcc gggagctgct ccgccgcctg ctgtccggga
    80641 aaacgctgac cggacgggat gaagacgaca tcctgcgtct ctggtgggag agcagtaatg
    80701 aagtggagga gcttgcaacc cgtcagcgtg aacaggatgc catccggaag tttgtcggcg
    80761 gggataaatc agaatgaagg tttatctgca gcgttacggc gtggccggtt ttctcctggt
    80821 gtactggagt ctttcctttg tgaatgaata tttcctgcat aagcatccgc tttctgctga
    80881 atcctggaag tgaatgagat tacaggcgct gctggtaaca ggctctgttg tggtgaccgt
    80941 gctgcggctt tttctcctga actccgtggt gcgccgggag gcaacggcca tcatgaccgg
    81001 ggtcgctgca ggtcttcatg tttttgctct gctggctcct tccgtctggt tgttttatca
    81061 gtggcagtgg aatggactgt ttcttctgca gtggcaggga gcagtcttcc tgttctgtct
    81121 gttcgcgctt cccgtttcaa cattctgttt ttcttaaggt taaggtgttc gtgtgaagaa
    81181 cctgcttgat actgtcactc aggcggccaa ctcgctgctg accgcgctga agctgccgga
    81241 tgaatcggca caggccaatc agatcctcgg cgagatgagc ttcccgcagt tcagccgtct
    81301 gctgccgtac cgggactata accaggagtc cggcctgttc atgaatgacg ccacgatggg
    81361 ctttatgctg gaagccacgc ctgtcaacgg cgctaacgag accattgcgc tctcccttga
    81421 ccatctgctg cgtaccaaac tgccgcgcgg gatacccctg tgtgtccacc tgatgtccag
    81481 ccagctggtc ggggagcgta ttgagtacgg gctgcggaag ttctcctggt ccggtgagca
    81541 ggcggagcgg ttcaacgcca tcacccgcgc ctactacatg aaagccgcag agactcactt
    81601 tccgttaccg gaaggaatga acctgcccct gaccctgcgc cattaccggg tgttcatctc
    81661 atactgcgcg ccctccagaa aaaaaagccg ggccgatatc ctggagatgg aaaacctggt
    81721 gaagattatc cgggcttccc tgcagggggc atacatcagc acacagaccg ttgatgcgaa
    81781 ggcatttatt aatattgtcg gggagatgat taatcacaat ccggaatcca tccatccgac
    81841 ccggcgccgg ctggacccgt attccgacct gaattaccag tgcgtggacg actcctttga
    81901 cctgaaggtc aggcaggatt acctgacgct gggactgcgc gataacggga aaaacagcac
    81961 cgcgcgcatc atgagttttc atctggcccg taacccggaa atcgccttcc tgtggaactc
    82021 ggcggataat tacagcaatc tgctgaaccc ggagctgtcc atctcctgtc cgttcattct
    82081 gacgctgacc ctggtggtgg aagaccaggt gaagacccac agcgaagcga acctgaagta
    82141 catggatctg gagaagaagt cgaagacctc ctacgccaaa tggttcccgt ccgtggagaa
    82201 ggaagcgaag gagtggggag acctgcgcca gcgcctggcg tcgaaccagt cctcggtggt
    82261 gtcctacttt ttcaatatca cggcgttctg ccgcgacaac aaggaaacgg cgctggaaac
    82321 ggagcaggat atcctgaaca gtttccgtaa aaacggtttt gagctgattt cgccgcgctt
    82381 taaccacatg cgtaatttcc tggcctgcct gccctttatg gccgggaagg gactgtttaa
    82441 gcagctgaag gaagccggtg tggtgcagcg ggcggagagc ttcaatgtga ccaacctgat
    82501 gcccctggtg gcggataacc cgctgacgcc cgccgggctg ctggctccga cctaccgtaa
    82561 ccagctggcc tttattgata ttttcttccg gggaatgaac aacaccaact acaacatggc
    82621 ggtctgcgga acttccgggg cgggcaagac cgggctgata cagccgctta tccgcagcgt
    82681 gctggattcc ggcggctttg cagtggtgtt tgacatgggg gacgggtaca agtccctgtg
    82741 cgaaaatatg ggcggggtgt acctggacgg ggagaccctg cgttttaacc ccttcgccaa
    82801 tatcaccaat attgaccagt cggccgaacg tatccgcgac cagttgtcgg tgatggccag
    82861 ccccaacggc aaccttgacg aagtccatga gggcctgttg ctgcaggcgg tcagggcagc
    82921 ctggctgaca aaaaagaacc gggcgcgtat tgatgacgtg gtggattttc tggaaaacgc
    82981 ccgcacgagc gaacagtatg cggagtcacc cggtatccgc agccgcctgg atgaaatgat
    83041 tgtcctgctg aaccagtaca cggcagcagg cacttacggc agatacttca actccgatga
    83101 accctccctg cgcgatgatg ccaggatggt ggtgctggag ctgggtggcc tggaagaccg
    83161 cccgtccctg ctggttgcgg tgatgttttc cctgattatc tacatcgaaa accggatgta
    83221 ccgcacgccg cgtaacctca aaaagctgaa cgtgatcgac gaaggctggc gtctgctgga
    83281 cttcaaaaac cgcaaggtcg gggacttcat cgaaaaaggc taccgtactg cccgccgtca
    83341 caccggcgcg tatatcacca tcacgcagaa tatcgtcgac tttgactccg acaaggcgtc
    83401 cagcgccgcc cgcgcggcat ggggtaactc ttcctacaaa attatcctca aacagagcgc
    83461 caaagaattc gcgaaataca accagctgta tccggatcag ttcccgcagc tacaccggga
    83521 gatgattgag aaatttggcg ccgcgaaaga ccagtggttc agctcgttcc tgctgcaggt
    83581 ggaaaaccat tcctcctggc accgtctgtt tgtcgacccg ctcagccgcg ccatgtacag
    83641 ctcggacggt cctgattttg agtttgtaca gcagaagcgg aaagaggggc tgagtattca
    83701 cgaggcggtc tggcagctgg cgtggaaaaa gtcaggaccg gagatggcct cgctggaggc
    83761 ctggctgcag gagcatgaga cattcagggg aacttatgag tacaaagcag aaacagactg
    83821 acggcacggg agcgcgtaag cgtgacgggc tgtggatgat accgggatgc ctggggatgg
    83881 tggtacttaa cgccgccatc agttacggga tagtccggct gaacacgccg gtgacggtgg
    83941 cattcaacat gaaacagacc gtggatgcgt tttttgacag cgccggccag aaaaaactga
    84001 cggaagcgca gtcgaaagcg ttgtccgggc gctttaatgc ggccctggag gccagcctgc
    84061 aggcgtggca gcgggagcac catgccgtca ttctggtttc accggcggtg gtacagggcg
    84121 cgccggatat cacccgggag atccagcagg atattgcccg gcgtatgagg gcagagccgt
    84181 gaaatggcgg gggctgacag ccctgctgat atgggggcag agcgtggcgg ccgcagacct
    84241 gggcacctgg ggcgatctgt ggccggtgca ggagccggac atgctggcgg tgattatgca
    84301 ccggctggaa gccctgcagc agtccggtga gatgggccgc cggatggagg cctttaagga
    84361 gcgggtgatc cacaacagcc tgcgaccgcc tgcggtgccg ggtatcgggc gcgcggagaa
    84421 ataccgcagc cggctgtttg atccgtcggt cagactggcg gccgatatcc gggataacga
    84481 aggacgggtg tttgcccgtc agggggaggt gatgaatccg ctgcagtatg tgccctttaa
    84541 ccagacgctg tatttcatta acggcgatga tccggaacag gtgtcgtgga tgaaacgcca
    84601 gacgccgccg acgctggaga gcaaaattat tctggtgcag ggcagtatcc ctgagatgga
    84661 gaaggcgctg gacagccgga tttactttga ccagaacggg gtgctgtgtc agcgcctcgg
    84721 gatcgaccag gtgccggcca gggtgacggc cgcaaaagac gggcgtttcc tgaaagtgga
    84781 atttattccg gcggaggacg gcagaaaatg aaacggtatc tgtggctgtg tgtactgatt
    84841 ctgctggccg gtcatgtccc cacggtatcg gctgatgcgg cctgtgaaag tcgttttgta
    84901 aacccgatca cggatatctg ctggagctgc atctttccgc tgtcgctggg cagtacaaaa
    84961 gtgagtcagg gaaagctgcc ggatacggcc aatccctcaa tgccgctcca gttctgtccg
    85021 gcgccgccgc ccatttttaa gcgtcccgga ctggcgattg gctactggga gccaatggcg
    85081 ctgacggacg tcacccgctc tccgggctgc atggtgaatc tggggttcag cctgccggcc
    85141 ttcgggaaaa cggcacaggg tacggcgaag aaggaggata aacaggtgaa cggggcgttc
    85201 taccacgttc actggtacaa atacccgctc acgtactggc tgaatatcat cacgtcgatg
    85261 gggtgtctgg agggcggtga cctggacatt gcgtacctct ccgaaatcga ccccacgtgg
    85321 acggacagca gcctgaccag cattctcaat ccggaagcgg taatttttgc caatcccata
    85381 gcccaggggg cctgcgcggc agatgccatt gccagcacct tcaataaacc gctggatgtc
    85441 ctgttctggt gtgcaggctc tcagggctcc atgtatccgt ttaacggctg ggtgagtaac
    85501 gaatccagtc cgctgcagtc ctccctgctg gtcagtgagc ggatggcctt caaactgcac
    85561 cggcaggggc aaattatgga gaccatcggg cagaataccg ccgtctgctt tgaatatccg
    85621 tcgcccattc tccctaaaga gcgctggcgt tatcagatgg tgaacatgta tccggacagc
    85681 gggcagtgcc acccgttcgg gcgcagtgtg atgcgctggg aaaccgggaa aaatccaccc
    85741 aacacgaaga agaactttgg ctatctgatg tggcgtaagc gcaactgtgt atttctgtaa
    85801 accgataccg aagagagggt gtttatgcga attatttata agagacagca ttatctgtcc
    85861 gttatcaggt ggggggcggt tgctgtcgtg caggtcctga atgagagtgt aaaactgttt
    85921 ccgtttgcgc tggtgatgtt tgcgctgatg gctttttatt ttcttccgga acgcatcatc
    85981 tctgatgttg ttaattcgtg gatggaaaca gacacgaccg gaaaaatatc gctcatcaga
    86041 ctttacctgg aagtgacatt tatgctgtcc ctcgagtctt cttctctttt atttatgtac
    86101 cggggaaagc gatgcacagg aaaataaaat acctggccgg actgattatg gtcataagcg
    86161 ggacggtatc agccggcgga gtcgctaata cccctgaaaa ccgccagttc ctgaagcagc
    86221 aggaggaact gagccggcag ttgcgcgacc ggcctgatgc tgaactgaaa gcgtgggcag
    86281 accggcagat tcaagcgaat cccctggtgc agtcagaccg gcatttcctg gatgaccttg
    86341 cccgaaagca gcagacttct caggcggata aaccggagca gggcgcggtg tactttatct
    86401 cgttttccat tccggaagag gggctgaagc gcatgctggg cgaaacccgt cgctacggta
    86461 ttccggccac gctgcgggga atgcgggata acgacctgaa agccacggca gatgccgttc
    86521 tgtccctggt aaaggatggg gcaacagatg gtgtgcagat tgacccgacg ctgttcacga
    86581 aatatgacat ccgcagcgta ccgactctgg tggtgtactg ccgacaggga tatgacgtta
    86641 tccggggcaa tctgcgggtg aagcaggcgc tggagaaagt ggtcaccgcc ggggactgca
    86701 ggcaggtggc tgccggatta cttgatggtg ccggagataa accgcaatga cattccctgc
    86761 ggaataaaca gcaggaagga gatgttatgg cgctgaccag aaaacagcgg gaaagactgc
    86821 gtatgaaatt cggcggccgc tgtgcttact gcggctgtga actgccggag aaaggatggc
    86881 atgccgacca cgttcaggca gtgctccgca aatcagagcg gtgcatgaag gcggcagaga
    86941 aaggcatttt cagactgaaa tccaccggtg acgttttcag gccggaggcc gactgtccgg
    87001 aaaacatctt cccgtcctgt gcgccgtgca atttgctgaa aacgacatat tcgctggaga
    87061 tgttcagaaa acaggtctcc ctgcaggttg agcgggggcg ccggagcagc gttaacttcc
    87121 ggacagcaga gcgttttggg ctgattagtg tggtgaataa accggttgtt ttctggtttg
    87181 agcaatacga gggggagaat aaatgaaacg tatgttacct ctgtttctgc ttctggcagc
    87241 cggccaggca caggctgaca gtaacagtga ttatcgtgcg ggttcagatt ttgcccatca
    87301 gatcaaaggc cagggcaccg gcagtatccg gaattttaat ccgcaggaga gtatacccgg
    87361 ctataacgcg aatccggatg aaacgaaata ttacggtggc gtgaccgccg gtggtgacag
    87421 tgggctgaag aatgacggca cgacgcagtg ggccacaggc gaaaccggta aaaccattac
    87481 agaatcgttc atgaacaagc ccaaagatat tctgtcaccg gatgcgccgt ttattgaaaa
    87541 aggaagggat gtggtgaacc gtgccgacag tattgtggga aataccgggc agcagtgcag
    87601 cgcgcaggag attaaccgca gcgaattcac gaattatacc tgtgaacgcg acaccactgt
    87661 ggaggaatac tgtacccgga cggccaccat caccggcgac tggagagaga caacagaggt
    87721 cagaacctac accctcaccg cctttagttt cagccgttcc ggtaagcaga tcgttttcag
    87781 cgtaaccgtg ccggaagcgg gtacgataag cagcgccagc ctgaatgtga tcacacagaa
    87841 ttatctgtgg aattcccgtg ccggctttat gaataccatc ttcaacatga cgtggggcag
    87901 taccattaca ctgggtggcg cgacgggaat gatgctgagt aagggccaga ttctgagcgg
    87961 gacaagctgc agcgggaacg gtagctgtac cgggacgctg gatgaccgca tttttaacga
    88021 actgaccagc gggagaacga cgttcacgct gacactggtg atgcaggtaa aggaccggga
    88081 gtggataccc cgggtggagt gggtggaaag ctgcccgttt aataaagcgg atggcgtgct
    88141 gaaaggcaca gaatgctcag agccaggtgg tacgaaaacc ggggtgatgg aaggaaaacc
    88201 ctggagcctg acggaggcct gctgggcata ccgcgataaa tatgtcaccc agtctgcgga
    88261 caatggcacc tgccaggcgt atgtggacaa tccggcctgt actcttgcca cccggcagtg
    88321 cgcgttttat tccggtgagg gcacctgcct gcatgagtac gccacgtact cctgtgagtc
    88381 gaaaacgtca ggaaaggtca tgatttgtgg cggggatgtg ttctgcctcg atggggaatg
    88441 cgataaggcg cagagcggaa agagcaatga ttttggcgag gcggtatcgc aactggcggc
    88501 gctggcggcg gcaggtaaag atgtcgcggc cctgaacggt attgacgtcc gtgcattcac
    88561 cggacaggcg aaattctgta agaaggccgc agccgggtac agcaactgct gtaaggacag
    88621 tggctggggg caggatatcg gtctggctaa atgcagtagt gacgaaaaag ctctggccaa
    88681 agcaaaaacg aacaaactga cggtcagtgt cggggaattc tgttcgaaaa aggtactggg
    88741 tgtctgtctg gagaagaaac gcagctactg ccagtttgat tcgaagctgg cgcagatagt
    88801 ccagcagcag gggcgcaacg gccaactgca tatcagcttc ggcagttcaa aacatcctga
    88861 ctgccggggt atcaccgtgg acgaactgca gcagattaaa ttcgaccagc tggacctcac
    88921 gaacttctac gaagacctga tgaataacca gaaaatcccg gacagtggcg cgctgacgga
    88981 gaaggtgaaa gaacaaattg cagaccaact caggcaggcc gggaaataag gacagtcaga
    89041 tgaagataat gtcttttctg gttcgggtgg tggtgacgct tattgtgata tccccagcgg
    89101 tgtactggtc atgggatgcg gtaagcacaa ccacagcgga cgatatcatg ctggcggtgc
    89161 tcattattgc cgcttacggt ctgatgttca cgctgctgtt ctgtttcgtg aatgtactga
    89221 cgaaactact gcagcatgat aatgaatcca gttgaagggg ggtatgatgc gaaaaataca
    89281 gaccgtatgg gtggcagcgt tactctgtgg ctccctgacg gcatacggaa aagatgccgg
    89341 atggcagtgg tataacgacc cggtaaaatt acctgaccca aaaacgacgg ataaatccgc
    89401 tcaggttcgt caggagcctg acattatgca gaaattatct gcgctgcaga ccgcaacaaa
    89461 gcgggcgctt tatgaagcca ttctgtatcc cggtgtggat aattttgtga aatatttccg
    89521 gctgcagaat tactggacgc agcaggcggg gcttttcagc atgagcgcca aaaaagccat
    89581 gctggcgcat cctgaactgg actataacct gcagtacagc cactacaacg gcacggtacg
    89641 taaccagctg gccgcagacc aggctcagca acggcaggcc atatcaaagc tggctgaaca
    89701 ctacggtatc atgttctttt accgcgggca ggaccccatt gacggccagc tggcgcaggt
    89761 gattaatggc tttcgcgcca cttacggtct gagcgttatc ccggtgaccg tggacggggt
    89821 gattaacccg atgctgccgg atacgcgtcc tgaccagggg caggcgcagc gtcttggtgt
    89881 gaaatatttc ccggccatga tgctggtaga cccgaaacag ggcagtgtcc gtccgttgtc
    89941 atacgggttt attacgcagg acgacctggc aaaacagttc ctgaatgtgt cagaagattt
    90001 taagccgaat ttctaaagta atatcagggg attgtattac tgtcactcgt tcgcaggtaa
    90061 ataatgcaga tgaagcggct gtctttatgc cctttatttt taattcagat aaatagcccc
    90121 cactgttaaa tagtttattc atggcggcgt tttttagctg atgaatattc tgttctctga
    90181 taataaatca ggtatcgcat atattaaata acaatggagt gactccactg tgcgtaaata
    90241 taaattatcg cttcctttac cggatattac tggagtatgg gttttctccc tgggcgtctg
    90301 gtttcacatt gtcgggcggc tggtttaccg caaaccctgg atggcttttt ttctggcgga
    90361 actgattgcc atcattctgg tgttgtccgg cgcttaccgg gtgctggatg cctggatagc
    90421 ccgcgtcagc cgggaagagc gtgcgttact ggaagcccgt caggctgcca ttctggctgc
    90481 tgaaaaagaa gaaaaggggg ataaatcaca tgtctctcaa taaggctttg ctgttcctgt
    90541 tgcttctgat ggggacgggg gttaatgcct ccacgcggga agagattgaa cggctgtata
    90601 acccgcacgg gatggccgca ccgtccgggc aaaagcagcc agcagatacg cagggcgtgc
    90661 agaaagtaac gccggcgccc cgctggtttc gtctcagcaa cggtaaaacg gttaacctcg
    90721 ccgactggaa agtggtgttg ttcatgcaaa gaagctgccc ctggtgccac cagtttgacc
    90781 cggtactgaa gcaggtggca cagcagtatg gattttcggt attcccttat accctggacg
    90841 gacaggggga tgccgcgttt ccggaggcgc tgccggcacc gccggaagtg atgcagacct
    90901 tcttccccaa tattcccgtc gccaccccga caacatttct ggttaacgtg aacacacttg
    90961 aagcattacc tcttttgcag ggggccaccg acgccgccgg ttttatggcc cggatggata
    91021 ccgttctgca gatgtacgga gaaaaacatg cagggtaaaa cgagaattaa accgcttttc
    91081 atattatgta cggcgctgat gaccgtcgca cccgccgtct ctgccgatgt gaacagcgac
    91141 atgaaccagt tcttcaataa gctgggcttt gcttccaata ccacacagcc ctccgtctgg
    91201 cagggacagg cggcaggata tgcctccggc ggctctttat atgcccggac acaggtaaaa
    91261 aatgtccagc tggtctccat gaccctgccg gatatcaatg ccggttgcgg gggcatcgat
    91321 gcctatctcg gctcattcag tttcattaac ggcgagcagc tgcagcgttt tgtgaagcag
    91381 attatgagta acgccgcagg gtactttttt gaccttgcgc tgcagacgac ggtgccggaa
    91441 atcaaaacgg caaaggattt tctgcagaaa atggcctccg acattaacag tatgaacctc
    91501 agctcctgcc aggcggcgca ggggattgtc ggggggcttt tcccaaaaac acaggtctcc
    91561 cagcagaagg tctgccagga cattgccggt gagagcaata tttttgccga ctgggcggcg
    91621 tcccggcagg gatgtactgt gggcgggcaa tccgacagcg tcagggataa agccagtgac
    91681 aaggataagg agcgggtgac caaaaatatc aacatcatgt ggaatgcttt gtccaaaaac
    91741 aggatgtttg acggcaacaa ggagctgaaa gagttcgtga tgacgctgac cggttcactg
    91801 gtttttggac ccaacggcga aatcatgccc ctgcctgcca gaaccaccga ccgggctatt
    91861 atccgggcat taatggaagg cggaacggcg aagatatacc actgcaatga ttcggataaa
    91921 tgcctgaagg tggtggccga cacgccggtg accatcagtc gcgacaatgc gctcaaatca
    91981 cagattacga agctgctgac cagtattcag aacaaggcgg tcagcgacac tcccctggat
    92041 aataaggaaa aagggtttat ctccagcacc accatcccgg ttttcaaata cctggttgac
    92101 ccgcagatgc tcggcgtgtc aaccagcatg atttatcagc tgacggatta tatcgggtac
    92161 gacatcctgc tgcagtatat ccaggagctg atccagcagg cccgggcgat ggtggccaca
    92221 gggaattatg acgaggcggt tatcgaacat atcaccgaca acatgaatga cgcgacccgg
    92281 cagatagcgt ccttccaggc gcaggtccag gtgcagcagg atgcgctgct ggttgtcgac
    92341 cgtcagatga gctacatgcg ccagcagctg tcagcccgca tgctcagccg ttaccagaac
    92401 aactatcatt ttggcggagg tgcgcagtga acgaagtcta tgtcattgcc ggcggagaat
    92461 ggctgagtaa taacctgaac gccattgcgg ccttcatgag cacccggacg tgggactcca
    92521 ttgagaaaat tgcgctgacc ctgtccgttc tcgcggtgtc cgttatgtgg gtacagcgac
    92581 ataacgtgat ggatctgctg ggctgggtgg cggtgtttgt gctgatatca cttctggtga
    92641 ccatacggac atcagtacag ataattgata acagcgacct ggtgagggtt taccgggtgg
    92701 ataatgtgcc ggtcggactg gcactccccc tttcgctgac gacccggatc gggcatgcga
    92761 tggtggccag ctatgagatg atttttgccc agccggacag cgtcacctac agcaagacag
    92821 gtatgctgtt cggggcgaat ctgattgtga aaagcaccga tttcctgtcc cggaatccgg
    92881 aaatcattaa cctgtttcag gactacgtcc agaactgtgt gctgggggat atttatctca
    92941 atcacaaata ttccctggaa gaactgatgg aatccgatga cccctatacg ctgatttttt
    93001 cccgcccaag tccgttgcgg ggggtttatg acaaaaataa tcattttgtc acctgcaagg
    93061 atgcgtcggt cacgctgaaa gacaagctga atctcgatac aaagacagga ggcaagacct
    93121 ggcattatta tgtgcagcag atatttgggg gcaggccgga ccctgacctg ttattcaggg
    93181 aactggtaag tgacagttac agttatttct atggctccag ccagtcagcc agccagatca
    93241 tgcgtaagaa tgtaacaatg aacgctctga aagaagggat caccagtaat gcagcccgta
    93301 acggtgatac cgccagtctg gtgaatctgg ccaccacatc ctcgatggaa aaacaacgtt
    93361 tgtcacatgt ctccattggt tatgtgacaa tgcgaaacct gccgatggta cagactattc
    93421 tgctggggat agccatcggg attttcccgt tactggttct ggccgctgtc tttaataaac
    93481 tgacgctgtc agtgctgaaa gggtatgtat ttgccctgat gtggctgcag acatggccgt
    93541 tgctgtatgc cattctgaac agcgccatgg tgttctatgc gaaacagaat ggtgccccgg
    93601 tggtgctgtc agaactctct cagatacagc tgaaatattc cgatctggca tcaaccgcag
    93661 gttatctctc tgccatgatt cccccgctgt cgtggatgat ggtaaaaggt ctgggcgctg
    93721 gattttccag cgtttacagc cactttgcgt cttcgtctat cagcccgacg gccagtgcgg
    93781 ctgccggcgt ggtggacggc aattattcct acggcaacat gcagacggag aacgtcaacg
    93841 gcttcagctg gagtaccaac agtaccacgt catttggcca gatgacttac cagaccggta
    93901 gtggggcgac cgccacgcag acccgggacg gcaatatggt catggatgcc agcggtgcgc
    93961 agtccagact gccggtgaat atcaacgcga cccggcagat agcggcggca cagcaggaga
    94021 tggcgcggga agccagcacg caggcagaaa gcgccctgca tggtttcagc agcagtatcg
    94081 ccagcgcctg gaatacgctc agccagttcg ggacgaaccg gggcagcagc gactcagtga
    94141 ccagtggtgc tgacagcacc atgagcgcgc aggattccat aatggccagc cggatgcgca
    94201 gcgcagtgga aagctatgcg aaggcacata atatcagtaa tgagcaggcc actcaggaac
    94261 ttgcagcgag aagtacgcga acatctgggg gtatttatgg tgatgcaagt gcagagtggg
    94321 gcataaggcc caagatattg ggggtcggtg gtggagctgg tgttaaagcc ggtggtcgtg
    94381 ctggtattga ttggagcgat gatgatacgc atcaggccag cagtagttca cgatccagcc
    94441 aggatgttcg tcatggtgtt gatgccaaag ccacgcagga ttttaaggag gccagcgatt
    94501 acttcacgag ccgtaaggtc agtgagtccg gaagccatac ggacaataat gctgattctc
    94561 gtgtggatca tttgtctgcc gccctgaact cagcgaaaca gagttatgac cagtacacca
    94621 cgaacctgac ccgcagccat gagtatgctg agatggcgtc ccgtacagaa agcatgagtg
    94681 ggcagatgag cgaagatttg tcacagcagt ttgtgaattt tgtgcaaaag catgcgccac
    94741 aggatgcaga aaatattctg acaaatacca gctcgccgga ggtggcagaa cgacgtcggg
    94801 caatggcttg ggcctttgtt caggagcagg tacagcctgg tgtggataat gcctggggcg
    94861 aagcccgcgg tgatattggc agtggtatga gcacagtatc cggtggtggt gataaacagg
    94921 atgtggtagc cgatcatcag gcccatcagg caacggtgga acaacggacg cgggacagta
    94981 atatcagtaa tgatgtaaaa aaccaggttg ataatatggt cacagactat cattccgata
    95041 taaacgatac ttatggaaat atccagggtg aggaaaagac tattgaccag cagtattctg
    95101 gcctgcaaaa acagtataaa acagaagcac tatctcagaa taataaatat aatgaagaaa
    95161 aggctgcaca ggaaaggatg cctggcgcgg atagtcctga agaactgatg aagagggcaa
    95221 aagagtatca ggataagcac aaacagtaag gcgatatccg ggaggtggga atgaaaaatt
    95281 tagctcagat tgttctggtg acagtggtac agtttattgc ctgttatcta gctgagtggg
    95341 gagtcgctga aacagggatt atcctgttat ttgtcctgct gtggcagggg ctgtttatct
    95401 ggttatttat tcaaattcgt aaaaaaaata acatatctga tgagttcaag tttagtaaag
    95461 gaatttggta tgtaattatg cccgtatgct cattactctc gccattatta agtttaatga
    95521 tttttatcgg tggaacatta tatgaattaa gacgagtaag tggttgtata agcataaaag
    95581 agtgggtgaa atgtcagctt gatgaccaat atgatgaaga tagggggctg gattttgaat
    95641 ctgttgagta tcgtcaaacg acttactaca acccctcaac tggatatcct atgcatggag
    95701 gagttgattc ggctggtaat acttttgggt ctcgctggca ggataataat gacaggtaat
    95761 aagaaaacta tggttggtaa ataaaggtaa ttggatgaaa atgaaaaaaa taatgatggt
    95821 tacactggtc agttccactc tggccctgtc agggtgtggt gcgatgagca cagcaatcaa
    95881 aaagcgtaat cttgaagtga aaacccagat gagtcagacc atctggcttg acccgtccag
    95941 tgaacggacg gtgtatctgc aggtgaaaaa tacctccgat aaggatatga gtgaccttca
    96001 gagcctgatt gcaaaagata ttcaggcaaa agggtatact gtggttacct caccagacaa
    96061 agcatactac tggattcagg ccaacgtgct gaaggccgac aagatggatt tgcgtgagtc
    96121 ccagggatgg ctgaaccgtg gttatgaagg tgcgctctcc ggggcagcgc tcggggccgg
    96181 tatcacagcg tataactcta actcagcagg tgccacgctg ggagtagggc ttgctgccgg
    96241 gcttgtgggg atggccgctg atgcgatggt ggaagatatt aactacacca tgatcaccga
    96301 cgtacagatc tcagaacgga caaaagcgac cgtgacaacg gacaatgttg ccgccctccg
    96361 ccagggaacc tcgggtgcca aaatccagac cagcaccgaa accggtaatc agcataaata
    96421 ccagacccgt gtggtatcga atgccaacaa ggttaacctg aagtttgaag aggcaaaacc
    96481 agttctggaa gaacaactgg ccaaatcaat tgcaaatatt ctttaatcat cttcaggagg
    96541 ccggtctgac tggcttcctg actgacgcct cgctttgctc gttgtccagg cccggaaaga
    96601 aataaaataa atttcatttc tctccggcgt ttccgaaata aatatgaaaa cactgagcgg
    96661 ttgtgcaaat tctttgtgcg tccgtgaagt gttgccgcga agcgggaata ataaggatac
    96721 ggaatgccat tatcagaact tctttgtcac atgactaacg gcaatccgtt ttcctgactg
    96781 tttgctgtac tggtagtctg tgctgctgtt ctttattttc tgaaaaaacg aaagtaacgg
    96841 ttagttattt attcaaatta attccccgtc cggactgata atctttcttt ggaataacat
    96901 ctatgagctt taatgcgaag gatatgaccc agggcggtca gattgcgtcc atgcgtattc
    96961 gcatgttcag tcagatcgcc aacattatat tttactgcct gtttattttc ttctggatac
    97021 tcgtcggcct agtgttatgg gtgaaactca gctggcagac gtttgtgaat gggggtatct
    97081 actggtggtg taccacgctt gaaggaatgc gggatttaat taaatcccag cctgtctatg
    97141 agatccggta ttacggccag acgttccgga tgaacgccgc tcaggttctg caggacaaat
    97201 acacggtctg gtgtggggag caactgtggt cggcctttgt tctggccgcc tgtgtggcgc
    97261 tggttatctg cctgattaca ttttttatga ccacatggat tctgggacgt cagggaaaac
    97321 agcagagtga ggatgatgtt accggaggac gccaacttac cgacaatccg aaagacgttg
    97381 ccagaatgct gaaaaaagac ggaaaagcgt ccgatatcct gattggcgat ttgccaatca
    97441 ttaaggattc agagattcag aactttttgc tccacgggac agtcagtacc ggtaagtctg
    97501 aaatcattcg ccggctggct aactatgccc gtcagcgcgg cgacatggtg gtgatgtacg
    97561 atcgttcctg tgagtttgtc aaaagctact acgacccgtc catcgataaa attctcaacc
    97621 cctgtgacgc gcggtgtgcc gcatgggatt tatggcggga atgcctcacc ctgccggatt
    97681 ttgataatgc ggcgaatacc ctgatcccga tgggcacgaa ggaagatccg ttctggcagg
    97741 gttccggacg gaccattttt gctgaagcgg catacctgat gcgtaatgac agcgaccgca
    97801 gctacagtaa gctggttgac acgctgcttt caatcaagat tgaaaaactg cgaacctacc
    97861 tgcgtgattc cccggcggcc aacctggtgg aagaaaaaat cgagaagacg gccatttcca
    97921 tccgggctgt gctgaccaac tacgtaaaag ccgtccgcta tcttcagggg atcgagcgta
    97981 acggtgaacc gttcaccatc cgtgactgga tgcgtggtgt acgtgaagat cagaagaatg
    98041 gctggctgtt tatttcttca aacgctgaca cacattcttc cctgaagccg gtgatttcca
    98101 tgtggctgtc cattgccatc cggggcctgc tggcgatggg agagaaccgt aaccgtcggg
    98161 tgtggttctt ctgtgatgag ttgcccacgc tgcacaagct gcccgacctc gtggaaattg
    98221 tcccggaagc ccgtaaattc gggggctgct atgtctttgg tattcagtcc agtacacaga
    98281 tggaggatat ctatggcgag aaagcggcgg caaccctgct ggatgtgatg aacacaaggg
    98341 cctttttccg ctcacccagc tataagattg ccgactatgt cgcccatgag attggtgaaa
    98401 aagagatcct gaaagccagt gagcagtatt cctatggtgc cgatcccgtt cgtgacgggg
    98461 tgtcgaccgg taaagagatg gagcgtgtca cactggtcag ctactccgat attcagtcac
    98521 tgcccgacct gacctgttat gtcacgctgc ccggacccta tccggcagtg aagctggccc
    98581 tgaaatacca ggaacgtccc aaagtggcgc cggagtttat tccccgggaa atgaatccgg
    98641 aggcggaagc ccgtctgagc gccgttctgg ctgcaaggga agccgaggta cgtcagatgt
    98701 ccagcctgtt tgaaccggat acagaagcgg ttgcgccgac agcagcagaa gcgcaggctg
    98761 aacagccgca acagccgcaa cagccgcaac agccgcaaca gccgcaacag ccgcaacagc
    98821 cgcaacagcc gcaacagccg caacagccac agcccacggt tgtcagcgat aaaaaatcag
    98881 cagcggcggg taccgccgtg aatacgcctg caggcggtgt cggacaggaa ctgaaaatga
    98941 agccggaaga cgaagagcag ccactgcccc ccgggattaa tgcgtccggt gaggtggtgg
    99001 acatggcggc gtatgagcgc tggcggcagg agcaggaggt gaatactcag cagcagatgc
    99061 aacggcggga ggaggtgaat atcaacgttc accgtgggca cggaaaggat gaaccggagc
    99121 cgggagatga tttctgatgg cggtatcagc tccagtcctc agttctcagt ccacccacac
    99181 gttcaaactc ccgggtgttg ttcgtgacaa caatcagtcc ccggctgcgt gcgtgaccgg
    99241 caatcatctg atcgaatggc ccgacagggc gtccctgacg ggcaagctct gccctgatct
    99301 gccccgtatg ggtggcggcc ggcgtgtcat aatccagaac atcaagtcgg gaaacaaacc
    99361 cctctatcac agcgagattt ctttcgggca tctggctttt ttcggcgccg taaatcagct
    99421 ccatcagggt gaccgagctg atacacattc tcccctggtt caggttaaaa cgctccctga
    99481 cgctggcagg tttgtttttt atcgtgaaaa tgcagatgtt agtatccagc ataaacttca
    99541 gcatcagaat gattcccgtt cctgcacaga gggttgttcc cggttatcca taaaatcggc
    99601 gctgacgttg ttcccgtcga accattcatc ccacgattct ccggccggcg tgataattcg
    99661 ggttcgcccg acagcgataa cttccacacg ttttacattt tccggcaaag ccactgcttt
    99721 tggcagtctg accgcctggc tgcggttact gagaaatacg ctggtttcca tcatgtgcct
    99781 ccttacaggg atatgtctta cgtatatcca ttatggtttt tgtgatggga tatgtcaaag
    99841 ggatatacat ttatgatgag tattgcgcag gtccggtcgg cgggaagtgc cgccggttat
    99901 tacagcgaca gggataacta ctacgtgctg ggcagcatgg aagagcgctg ggccggaaaa
    99961 ggcgcggagc agctggggtt gcagggcacc gtcgataagg aggtgttcac ccgggtactg
   100021 gaaggcagac tgcccgacgg ggctgatctg agccggcagc aggatggcgg caacaaacac
   100081 cgccccggct atgatctgac cttctctgcc cccaaaagtg tttccctgat ggccatgctg
   100141 gccggtgata aacgcctgac tgaggcacac aaccaggcgg tggatatcgc tgtccgtcag
   100201 gtggaggcgc tggcctccac cagggtgatg acggacggac agtcagaaac ggtgctcacc
   100261 ggtaatctgg tgatggcgct gttcaatcat gacaccagtc gtgaccagga gccgcagttg
   100321 catacccatg ctgtggtggt caacgtcacg cagcatgacg gggaatggaa gaccctgagc
   100381 agcgataagg tgggcaaaac gggatttatc gagaatgtct atgctaacca gatagccttc
   100441 gggaagattt accgcgcggt gctgaaagag aaggttgaag cgctgggcta tgaaacggaa
   100501 gtggtcggta agcacggtat gtgggagatg cccggtgtcc cggtggaggc cttttccagc
   100561 cgttcgcagg ccatccgaga ggcggtcggg gaggatgcct cgctgaaatc ccgggatgtg
   100621 gcggcgctgg atacgcgtaa atccaaacag catgtcgatc cggaagtgaa aatggctgag
   100681 tggatgcaga ccctgaaaga taccgggttt gatatcagcg cataccgtga gtctgcggac
   100741 aggcgggcgg aaatacaggc agcacagcct gttccgtcac aggagcagcc ggatattcag
   100801 caggcggtga cgcaggccat tgccggatta agcgaccgga aggttcagtt tacgtatacc
   100861 gacgtgctgg ccagaacggt cggcatgctg ccgccggaag ccggcgtgat tgagaaagcc
   100921 cgggccggga ttgatgaggc catcagccgc gagcagctta tccccctcga ccgggagaaa
   100981 ggactgttca cctccggtat tcatgtgctc gatgagctgt ctgtccgggc actcagcagc
   101041 gatatcatga agcagaaccg ggtgaccgtc catccggaga agagcgtgcc ccgcacggga
   101101 agttacagcg acgcggtgag tgtcctggct caggaccgcc cgtcactggc cattatcagt
   101161 ggtcagggcg gtgctgccgg tcagcgggag cgggtggcgg aactgacgat gatggcccgg
   101221 gagcaggggc gtgaggtgca gattattgtc gctgaccgcc gttcgcagac aaacctgaag
   101281 caggatgaac gtctgtccgg tgagctgata accgggcgtc gtcagttgca ggagggcatg
   101341 ttattttccc cgggcagtac cgttattgtc gaccaggggg aaaagctgtc cctgaaggag
   101401 actctgaccc tgctggatgg cgcggcgcgt cataacgtcc aggtgctaat taccgacagc
   101461 ggtcagcgca ccggtaccgg cagcgcgctg atggccatga aggaggccgg cgtgaacagt
   101521 taccgctggc agggcaggca gcagaccccg gcgaccgtta tcagcgagcc ggaccggaat
   101581 gtccgctatg cccggctggc cggggatttt gtggctgcgg tgaaagccgg ggaagagagc
   101641 gtggcacagg tcagcggcat gcgtgaacag gccatactgg cggggatgat acgcagtgag
   101701 ctgaagacgc aggggatact cgggcagcag gacaccatga tgaccgccct gtcaccggtc
   101761 tggctggaca gccggaaccg ttacctgcgc gatatgtacc gtgaagggat ggtgatggag
   101821 cagtggaacc cggagaaacg gtcccatgac cggtatgtga ttgaccgggt gaccgcacaa
   101881 agtcacagtc tgaccctgcg ggatgcgcag ggagagacgc agatggtgcg gatttcagcc
   101941 ctggacagca gttggtcact cttccgaccg gagaagatgc cggtggcaga cggtgagcgt
   102001 cttatggtga cgggaaaaat tcccgggctt cgcgtctccg tcggcgaccg gctgcaggta
   102061 tctgcggtga acgatggcgt gatgacggtg acggtacccg gcagggctga accggcttcc
   102121 ctgccggtgg gggattcccc gttcacggcg ctgaagctgg aaaacggctg ggtggaaaca
   102181 cccgggcatt ccgtcagtga cagtgcgaaa gtttttgctt ccgtcacaca gatggcgatg
   102241 gacaacgcca ccctgaacag tctggcccgc agcggccggg atgtccggct gtattcctca
   102301 ctggatgaga cccgcactgc tgaaaaactc tcccgtcacc cgtcttttac ggtcgtttct
   102361 gagcagataa aggcgcgtgc cggtgaggta tcgctggaaa ccgccatcag ccgccagaaa
   102421 gccgggcttc acacgccggc acagcaggcc attcaccttg cccttccggt ggtggaaagt
   102481 aaaaacctgg cattcagtca ggtggacctg ctgacggagg cgaagtcgtt tgctgcagag
   102541 ggaaccggtt ttgctgacct gggacgggaa attgatgcgc agataaaacg gggcgattta
   102601 ctgtatgtgg atgtggcaaa aggttatggc acagacctgc tgatttcccg tgcgtcgtat
   102661 gacgctgaaa agagtattct gcatcatatc cttgagggca aggaggcggt cacgccactg
   102721 atggagaggg tacccggcga actcatggag actctgacat ccggacagcg tgccgccacc
   102781 cgtatgatac tcgaaacgaa agaccgtttc accgtggtac agggttatgc cggggtgggc
   102841 aagaccaccc agttccgggc ggtgatgtca gcggtgaacc tgctgccgga gagtgagcgt
   102901 ccccgcgtcg tggggctggg accgacccac agggcggtcg gggagatgcg cagtgccggc
   102961 gtggaagcac agacgctggc gtcctttctg cacgacacgc aactgcagca gcgcagcggt
   103021 gaaacgccgg atttcagcaa cacgctgttc ctccttgatg agagttcgat ggtgggcaac
   103081 accgatatgg cgcgggcata cgccctgatt gcggccggtg gtggtcgtgc cgtggcgagc
   103141 ggtgacacgg accagctgca ggccatcgca cccggccagc ctttccgcct gcagcagacg
   103201 cgcagcgcgg ctgatgtggc catcatgaag gagattgtac gccagacacc ggaactgcgg
   103261 gacgccgtgt acagcctgat taaccgggat gtgaataagg cactgtccgg gcttgaaaac
   103321 gtgaagccgg ttcaggttcc ccgcctgaag ggggcatggg cgccggaaaa ctcggtgacg
   103381 gagttcagcc gtctgcagga gcgggaactg gcgaaagccg cacaggaggc ggagaaaaag
   103441 ggcgaagcct ttccggatgt gcccgtgacg ctgtatgagg ccattgtccg cgactatacc
   103501 ggcagaacgc cggaagcccg ggagcagacg ctgattgtca cgcatctgaa tgaggaccgt
   103561 cgggtgctga acagcatgat tcaggatgcg ctggcgaaac cgggtgagca gcaggtcact
   103621 gtccctgtac tgaccaccgc gaatatccgt gacggggaac tgcgccgtct gtccacctgg
   103681 gaggcgcatc cgggggcgct ggccctggtg gataatgtgt atcaccggat tgccggtatc
   103741 agtaaggagg acgggctgat taccctggaa gataaggcgg gtaacacccg ccttatttcc
   103801 ccccgggaag cagcggcaga gggcgtcaca ctatacaatc cggaaactat ccgggtgggg
   103861 gccggtgacc ggatgcgttt cacgaagagt gacagggaac gcgggtatgt ggccaacagc
   103921 gtctggacgg tgacggcggt ttccggtgac agcgtcacgc tgtcagacgg gaaacagacc
   103981 cgcgtggtgc gtcccgggca ggacagggca gagcaacata ttgacctggc gtatgccatc
   104041 accgcccaca gtgcgcaggg ggccagtgag acgtttgcca ttgcgctgga gggaaccgaa
   104101 gggggccgga aacagatggc cggttttgag tcggcgtatg tggcgctgtc gcgtatgaag
   104161 cagcatgtgc aggtgtacac cgacgaccgt cagggttggg ttaaggccat caacagtgcg
   104221 gagcaaaagg gcacggccca tgacgtgctg gagcctaaat cagagcgtga gatgatgaac
   104281 gcagagcgcc tgttcagcac cgcccgggaa ctgcgggacg tggccgccgg ccgtgccgtg
   104341 ctgcgcaacg ccggactggc gcagggagac agccgggcgc gttttattgc accggggcgc
   104401 aagtatccgc agccgtatgt ggcgctgccg gcgtttgacc gtaacggtaa atccgccggt
   104461 atctggctga acccgctgac aacggatgac ggtgccgggc tgcggggatt caccggggaa
   104521 ggtcgggtga aaggcagtga agaggcgcag tttgtggccc tgcagggcag tcgtaacggc
   104581 gaaagcctgc tggctggtag catgcaggat ggcgtccgga ttgcccggga gaaccccgac
   104641 agcggcgtgg tggtgcgaat tgtcggtgac gggcgtccat ggaatcccgt cgccattacc
   104701 ggcggcaggg tgtggggcga tattcctgac agtaacgtgc agcccggcgc ggggaacggg
   104761 gagccggtca cggcagagat tctggcacag cggcaggcag aagaggcagt ccgccgtgaa
   104821 acagaacgcc gtgcggatga gattgtccgt aaaatggctg aggacaaatc tgacctgccg
   104881 gaggagaaaa ccgcgcaggc ggtcagggag attgccggcc aggagcagga cagaatgacc
   104941 ccgcctgaac gggaaccccc gctgccggag agtgtgctgc gcgaaccaca aagggagcgg
   105001 gagaccatcc gggaagtggc gcgggaaaac cggggccggg agcggctgca gcagatggag
   105061 caggagatgg tgcgtgacct gcagaaagag aaaacccctg gcggggactg atacgggaag
   105121 ataaaccacg atgacgatgg ataacgccac acgtaacgat tcgcgggcag tccgggtgga
   105181 tacccggctg cagcgactgc tggcctggtc gccgggacag agagatctca tcaaaaccgt
   105241 ggcgctgctg ctgatggtgg ctgaccatat taaccgtatc ctgcacctga accaagagtg
   105301 gctgtttctg gccgggcgcg gggcgtttcc gctgtttgcc ctggtgtggg ggctgaacct
   105361 gtcccagcat acgcatatcc gccagtctgc gattaaccgg ctgtggggat gggcggttat
   105421 cgcgcagtcc ggatattttc tggcgggatt tccgtggtat gaagggaata ttctgtttgc
   105481 ctttgcggtg accgcgcagg cgctgaagtg gtgtgagcag cgctgcctgt ttcactctgc
   105541 ggccgcgctg ttactgctga cggcgtggat acccctgtcc ggaaccagct acggcgttgc
   105601 cggcgtgctg gtgctggtca tctgttaccg gctgtaccgg accacagata ctgaagaaca
   105661 tctggcgctt gcggcctgcc tagtggtggc cgtccccgcg ctgaatctgg tcaccagtga
   105721 tgccgcggcg gtggcaggac ttctggtgac cgggctgacg gtatggcttg tttcgctgac
   105781 aggcaaatca cggccccggt tctggccggc tgattttttc ccggtattct acacctgcca
   105841 tctggctgcc ctgggcgttc tggcgatgtg acgggtgtgg tatctttggc ggtatgagca
   105901 ggatttggca ggggcagcat acagcatgac tgagcagaaa cgaccggtac tgacactgaa
   105961 acggaaaacg gatggggaag cgccggcccg cagccgcaaa accattatta acgtcaccac
   106021 gcccccgaag tggaaggtga agaaacagca gctggctgac agggctgtcc gggaagcgtc
   106081 actggcagaa aaaaaagccc gggcaagaaa agatctgtcc atctacctgc gatttcagtc
   106141 agtggaggaa gcggtcagca cgctgaaacc ctggtggccg gggctgtttg acggcgacac
   106201 gccccgtctt ttcgcctgtg gcgtgcgtga ggcgctgttt gaggacgcct ccaggcgtgg
   106261 tatcccgctg tcacacaaaa agataatccg tgcgctgaaa gcgattgccc gttctgaagc
   106321 atatctcagc gcgatgaaag ccggggcctg ccgatatgac acggaagggt atgtgacgga
   106381 gcatattacc gtggaggaag aacagtacgc gctggcgcga ctggcaaagg tccgggcgca
   106441 gaacgccaga aaagcggaac tccgcgcggt gctggcgcag acggtctgaa ccggagaagc
   106501 ccagtataat
//