LOCUS       AP011526             1846330 bp    DNA     circular BCT 08-MAY-2019
DEFINITION  Methanococcus maripaludis KA1 DNA, complete genome.
ACCESSION   AP011526
VERSION     AP011526.1
DBLINK      BioProject:PRJDA34063
            BioSample:SAMD00170763
KEYWORDS    .
SOURCE      Methanococcus maripaludis KA1
  ORGANISM  Methanococcus maripaludis KA1
            Archaea; Euryarchaeota; Methanomada group; Methanococci;
            Methanococcales; Methanococcaceae; Methanococcus.
REFERENCE   1  (bases 1 to 1846330)
  AUTHORS   Ito,N., Shimizu,A., Harada,T., Hosoyama,A., Horikawa,H.,
            Yamazaki,S., Tanikawa,S. and Fujita,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-2009) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Bioresource
            Information Center (NBIC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Ito,N., Tsurumaru,H., Shimizu,A., Harada,T., Hosoyama,A.,
            Horikawa,H., Wakai,S., Sasaki,K., Nishijima,K., Ataku,H.,
            Yamazaki,J., Mise,M., Yamazaki,S., Tanikawa,S., Harayama,S. and
            Fujita,N.
  TITLE     Molecular Evidence for Microbiologically Influenced Corrosion from
            genome of Methanogen
  JOURNAL   Unpublished (2009)
COMMENT     Please visit our web site. URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE. The database
            contains genome sequence data, physical maps and the genomic and
            proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            The microbial strain and microbial genomic DNA clones used for the
            sequencing project are available through the NBRC.
            URL:http://www.nbrc.nite.go.jp/e/index.html
FEATURES             Location/Qualifiers
     source          1..1846330
                     /db_xref="NBRC:102054"
                     /db_xref="taxon:637914"
                     /mol_type="genomic DNA"
                     /organism="Methanococcus maripaludis KA1"
                     /strain="KA1"
     rRNA            complement(68..182)
                     /gene="rrnA5S"
                     /locus_tag="MMKA1_r0010"
                     /product="5S ribosomal RNA"
     rRNA            complement(244..3200)
                     /gene="rrnA23S"
                     /locus_tag="MMKA1_r0020"
                     /product="23S ribosomal RNA"
     rRNA            complement(3402..4793)
                     /gene="rrnA16S"
                     /locus_tag="MMKA1_r0030"
                     /product="16S ribosomal RNA"
     CDS             5063..5344
                     /codon_start=1
                     /locus_tag="MMKA1_00010"
                     /product="hypothetical protein"
                     /protein_id="BAP60118.1"
                     /transl_table=11
                     /translation="MTLDRNGKLIEIGSYVRYINTGTHGTVKAIEPKNDEEWVLLEND
                     IYYRPELLELVERRKIEKKESEEELIERITNEDIDLEAAENGCGCSGAG"
     CDS             5375..6439
                     /codon_start=1
                     /locus_tag="MMKA1_00020"
                     /product="hypothetical protein"
                     /protein_id="BAP60119.1"
                     /transl_table=11
                     /translation="MDSLLELNRVNTAREIIRKKIQNTGRTSIYDLTGLCGGFEICEE
                     NLKLIETYVGPAIFSEKLNNAGLSHLSGNSKIHNAVCFNRTSSAILSTIMTLSKSFEK
                     LVHYVPEKPAHPSIPRSCKIFGMEYFESDSLEEILSKIDENSFTAITGATMDHKVVSE
                     EIACKIIDYAKSKNSPVFFDDASGARLRKLYKESPALEMGADLVVTSMDKLMDGPRAG
                     LLAGDKNLVDKIYSEGLKFGLEAQAPIMAAVVTALERFDLNNLKDAFERAEKVDLSVF
                     EAEKIEYKKTPTGFIIKNSSEEKLIETALKLLENYGIVTITAAGMPGASKNIRIDFCS
                     KDAERISDEYVINAVLNSLK"
     CDS             complement(6476..7555)
                     /codon_start=1
                     /locus_tag="MMKA1_00030"
                     /product="pyruvate flavodoxin/ferredoxin oxidoreductase"
                     /protein_id="BAP60120.1"
                     /transl_table=11
                     /translation="MTKVNFMQGNMACVEGAIKAGCKFFGGYPITPSTEIAEGMAKRL
                     PKIGGFYSQMEDEIASIASIIGASWAGTKSMTATSGPGMSLMLENIGYAYMTETPCVL
                     VNVQRGGPSTGQPTAAAQGDMMQVRWGSHGDYEPIALCPSSVQEMYDFTILAFNYAEK
                     YRIPVFVMADEILGHMREKVVLHDDIEILNREKPEEKPYPFDKEVPPMPTFGEGYNIH
                     VTGLTHGENGYPDVSAETHDKLVRRICNKILENKDDIVLYEGKYLESETMFICYGTPS
                     RTVKHTVESLREQGQDVGYIRLKTVFPFPDKLIAGLKASKIIVPEMNLGQISGEVMKY
                     AKCEVVGCGKIGGELHRPEDLKELI"
     CDS             complement(7594..8490)
                     /codon_start=1
                     /locus_tag="MMKA1_00040"
                     /product="putative protein kinase"
                     /protein_id="BAP60121.1"
                     /transl_table=11
                     /translation="MEDNDWKLLKIIEISMKNHEWVPIQDLRRKTGFHEKEIVFRLGR
                     LNKFKFTNKSNYGYRLSHWGYDALAMNAFIKKELIAGIGGKVGVGKEGDVYHVLLTNH
                     REAVLKFHQLGRTCFSMGKRYREYLANKRHISWLYASRLTAAREFEVLNMLFPVVKVP
                     EPIEQNRHAIIMGKLHGEELKRVNLLEINVDPEEFFWKLMAEVKKTYKLGIIHGDLSE
                     FNILIDSEGDFVIIDWPQAIEVGKKGKLDKLPFEEVEYDEEYYLKRDLENLLRYFKKY
                     GIDKDIDKLYNYVIGDINSENI"
     CDS             complement(8572..10155)
                     /codon_start=1
                     /locus_tag="MMKA1_00050"
                     /product="hypothetical protein"
                     /protein_id="BAP60122.1"
                     /transl_table=11
                     /translation="MLSKICKNCAYVMDYFLSKEWFQVLIIAAISAVLAYYSLFYFAW
                     GTGFDENLRYILSTLPQTQGAIVGIVASISIVAIQMVSQQYSTRITHLLLNKTFWGFI
                     IAYIVSMSYEVLILGFMPTARIPVFIGGYEISYHILIGILFFFVYFDFLILLPYMKNT
                     INGLKPENVIDALINSISKDEIKNYRSLDSENKDYKSARKIPKNTLRTVYYIIGKSLK
                     SDHYMTARNGIILLGANYSVLAKKGKFKNKKFFESYIDNLKNLGLTAYGTSFSISREA
                     IISLEKISKFELNRNYDLSLRALRGIKKIGLLYAQEYELKIDKSDEKELIHIVFEKLG
                     NIIKFILSKPKHNEKITSKQVTFKIMMFSEILKIFELILDKLNSREILRNEAAGTLIL
                     DALNNFSKPAIEFIKTNENSEFLSEITIQTSETLKNFVKLISKTNEENESLNEYLTEI
                     LKIYGIILDLICEKTTEKTIDTILSDISEIWKISNGKFEQIFGIGDIVENIDNSEKIK
                     CADSLREQLLEKISKQDNN"
     CDS             10283..11368
                     /codon_start=1
                     /EC_number="4.2.3.4"
                     /gene="aroB"
                     /locus_tag="MMKA1_00060"
                     /product="3-dehydroquinate synthase"
                     /protein_id="BAP60123.1"
                     /transl_table=11
                     /translation="MKFGWIKTTGNDLEERMESVKDALESSIPGIITEKEEISSVREL
                     GNIKIVSDNLDADVVLINKGEDLEILKSAKLSGKETGVYVVINTKEDEVYATDVSKLD
                     FVDYVVLEGSDWTIIPLENIIADLFSEEIKIVSVVTNVKDAEAAYEILEKGVDGVVLI
                     PKDINEVKDFSKLIERMNSESVKLDYATVTKIEPVGSGDRVCIDTCSMMEMGEGMLIG
                     SYSRGMFLVHSETVENPYVATRPFRVNAGPVHAYILCPENKTKYLSDLKAGDKVLVVS
                     KNGETREAIIGRVKIEKRPLFLVEAEYNGENLRTILQNAETIRLVGEDGKPVSVVDLK
                     VGTKVLIKPDENARHFGMAIKETIIEK"
     CDS             11749..12519
                     /codon_start=1
                     /locus_tag="MMKA1_00070"
                     /product="hypothetical protein"
                     /protein_id="BAP60124.1"
                     /transl_table=11
                     /translation="MQIKIGEIESKLNKIIEEEGAAYFVLIDPDEKNYREIANHVKDY
                     ADAIIIGGSIGIINLDEVTKDIKEITGLPIILFPGNVDGVTKEADAVFFMSLMNSKNT
                     YWNMTAPTLGALTIKKYGLETLPMAYLGIEPISKTAVGFVGEVNEIPQKKPEIAGLYS
                     LSASYFGMRWAYLEAGSGAEYPVSNEMVGISKKLSGINIIVGGGIRTPEVAYEKVMSG
                     ADVIVTGTLTEKDPQAVVEMKKAIKKAGLDKLKMLSKK"
     CDS             complement(12543..14300)
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="polB"
                     /locus_tag="MMKA1_00080"
                     /product="DNA polymerase II small subunit"
                     /protein_id="BAP60125.1"
                     /transl_table=11
                     /translation="MINDFLNIQVLLAPESYSRLQNLDSNDFSDLFNKIKEFKSKKDD
                     FILLDSHFLNIFLGNNLKNIFEEYGKFDFLAYYTSNEVASEEQIIEKDDFEPVSEVKL
                     ENEEIIGPKRENKVYDLDFEDIEEEEPELDEIHKKLEEERKERILEVRSIRESVNNKI
                     NYYAKDIDAQIHVYDEYDVTGKSTCEGTLDDFVKYFKDRCSTLRKIIELKNQKKAYPL
                     NQLFRRKKENEVFIAGIVSDVNSTKNGHKMVELEDENGTFRVLLMKDKMEKGDLPSDV
                     LLDEVIGFEGTINDKGDLMFVDRAFRPDITPKPTKTTDEKIYTAFLSDVHVGSREFLN
                     KVFAKFIRFLNGEVNNGLEEKIVSRLKYISIAGDLVDGVGIYPGQEYDLYDVDIISQY
                     AEVAAYLEQVPEHIKVIICPGNHDALRPAEPQPTFDESITSLFPKENVTFVGNPGVVN
                     MHGLDLLMYHGRSFDDIIGQISSAQYTNPPSIMTELLKRRHLCPTYGGRCPIAPEHVD
                     YLAIHTEPDIFHTGHIHINGYDNYHGVRMINSGTFQEQTDFQKRMGIKPTPGIIPIQD
                     LSKREQHMIEWNQGKIEIN"
     CDS             complement(14311..15444)
                     /codon_start=1
                     /EC_number="2.7.7.-"
                     /locus_tag="MMKA1_00090"
                     /product="putative DNA primase large subunit"
                     /protein_id="BAP60126.1"
                     /transl_table=11
                     /translation="MFLDNMASIKDLNLIDEINDSSNLILIKNRLELLFWNKNPEVSE
                     KDNEESVDKRDEKKYLDYLRDYQERLRVYGVGDTELFPDKIDYLTLILAANSKNHNIY
                     IKKLAEEYAEKVPLEEGDSRVNIWDFIDVAANSRNNDLHLERMILEGNVVLLNKKRQS
                     IYNFEKIRLKIKNYVDKVRNAEMPKEIKDLLVKKSEEVFTGIKIDYNIESGIRVSTKE
                     YSGEIPEDWHPPCMREILNDILSGGSPSHYARRSFVVYRFVSQFDPNLRPIEEGIITN
                     RSAQDIATEEQIERFLDEIINIFKSVGDFDVEKTKYYISHNIGYKVANHITHCEYCKN
                     WRDDGGKGLGYYCRPDSTCSRKDIIHPLDYLCHNINRHVKKSE"
     CDS             complement(15471..15896)
                     /codon_start=1
                     /locus_tag="MMKA1_00100"
                     /product="hypothetical protein"
                     /protein_id="BAP60127.1"
                     /transl_table=11
                     /translation="MFIALHNTFSSKQIEEFTKTVFGMGIDSVIFTRATGSAAQNGIP
                     IAQKMAIKLNKNLMFLEDIDDAVEILNPERVILIADSKIAEEKIDFKSIGKRDLVIFS
                     GNSSGFSKKELEKGTGMHILENNIGAIGEVAVFLYKMNE"
     CDS             complement(15939..17006)
                     /codon_start=1
                     /EC_number="2.1.1.37"
                     /locus_tag="MMKA1_00110"
                     /product="C-5 cytosine-specific DNA methylase"
                     /protein_id="BAP60128.1"
                     /transl_table=11
                     /translation="MNFIDLFCGCGGFSRGFVEMGFKPLLAIELDENAANSYALNYNG
                     LVFEKKLNDILEKDVYFKLEDFLVQDDIEEFKKSNNYENLNPVVINEDIREINSKYIT
                     NKIKDTSSSKIDVVIGGPPCEGYTGANPKRERSPFNRLYRDPVGRLVLDYIRIVGDIS
                     PEVFVMENVPGILNYETRENIEKEFSRAGYDELYFHVFDSENYGNPSFRKRVIISNIP
                     LNLEKTDNVDVKTALSNIDRNALNNEKYPLPEKIAKSIHKINVSDSAVKFKACGGVLD
                     NYIRLSMEGNAETVMGKRRFIHPEEDRLLTVREQARLMSYPDTHIFAGGITAQYNQVG
                     ESVPPSLSLAIAKEVKKYFNK"
     CDS             17076..17525
                     /codon_start=1
                     /locus_tag="MMKA1_00120"
                     /product="hypothetical protein"
                     /protein_id="BAP60129.1"
                     /transl_table=11
                     /translation="MNRSNHTNNSNLGKILEGLEIKELLNSSKNIAVIGISKNSENPS
                     YFVSKYLIESGFNVYFVNPNYSGEKILNHVVYSNISEIKERIDIVSIFVNPSRTSAIA
                     KDAVKLGFKAFWFQLETLNKETADYVLKNGFDVVLEKCIMTTNQKFL"
     CDS             17567..19012
                     /codon_start=1
                     /EC_number="4.3.2.1"
                     /gene="argH"
                     /locus_tag="MMKA1_00130"
                     /product="argininosuccinate lyase"
                     /protein_id="BAP60130.1"
                     /transl_table=11
                     /translation="MNILRRGRLGSNVKEDVMKFTTSLEFDKEIFESDILCDIAHTTM
                     LVEQNVISEENGKKIIAELKKIAKRGMENLDLDPSLDDIHMVIESELIKELGEDVAGR
                     MHTGRSRNDEVATDLRLSLRKKVLEIIGHLITMEKNMLTVSDAHKETLTVGYTHLQQA
                     QPVTFGHQILSHVSAIERDISRFFDTYSRINISPLGCGAMATTGFNLNRKRTKDLLGF
                     YGIIENSMDGVSSRDFIVETMANISMLGTNLSKICEELVVFSSAEFNTIEIANEYTST
                     SSIMPQKKNPDVAEITRAKLSTLNGELVTVLTIMKALPNTYNRDLQEISPHLWKSVYT
                     LIDSIQMVDGMISTVKVNKERMKENAEKNYSTATELADTLVRECGIAFRMAHGIVGEL
                     VKRSIEEKVEIKEIISEVLEKNNLSLSQEKIDTALDPFENVKLRNVIGGPAPEEVERA
                     ISSFNEKISAHKDKLDEKISEIKTAEKNLLE"
     CDS             complement(19026..20195)
                     /codon_start=1
                     /EC_number="5.4.99.-"
                     /gene="truD"
                     /locus_tag="MMKA1_00140"
                     /product="putative tRNA pseudouridine synthase D"
                     /protein_id="BAP60131.1"
                     /transl_table=11
                     /translation="MKFRQKHEDFIVNEILDYELNDNGNYSLYTLQKNGIENLKAISY
                     LSKNFEVPTKEIGYCGLKDRHAITTQYVSIPKEYGKLSLDEDNLKLEYVGTIEKPLKI
                     GRLYGNRFEIIARAVDKDEFLKIADNIRNLSSGAPNYYDDQRFGSVFNGKFIAKEILK
                     GNYEEVVKILLTSYTKSEKKQLKDLKRFIAKNWGNWDECLEYIDKKQIRSKMFRNMVK
                     SLTYENDFKKAFKYVDNRLKELFISAYQSYLWNECLKEFLKEVIPKENRIYVDYSCGT
                     FLFYENIEEELFCKLKEMDFPTIVSDVEYSDSEKRIIKAILKKERIKISDFEKLDFGK
                     LKYTKRPIISIPGDVNTGKFKSDELNSKKYKIDLEFSLKKGSYATIILKRVFNIL"
     CDS             complement(20208..21011)
                     /codon_start=1
                     /locus_tag="MMKA1_00150"
                     /product="hypothetical protein"
                     /protein_id="BAP60132.1"
                     /transl_table=11
                     /translation="MESKQLINKILRDIVKNIDEYSRDLLLAESLDVELKGLNLWDEN
                     GKRHSIKNLMDCDELPSFEATDRKYVLRKVNLKHIDDGVMIIHLSSRKADEYSFSVDN
                     TFEVILKTFSTASYEHRERILLWNELSDEELDIKISEFDVNVESIVQKISENSKISSE
                     VLVYIDVFMDLEKIENIMEKEEEKLVLWLHPVFLFSKESTLKGLLAYELSKYDKSLIE
                     GHYQDILEYCKEYRELCGKNLKIIEKIREIAVKRNDYDILKEIDQMNTI"
     CDS             complement(21026..21517)
                     /codon_start=1
                     /locus_tag="MMKA1_00160"
                     /product="hypothetical protein"
                     /protein_id="BAP60133.1"
                     /transl_table=11
                     /translation="MKHRKLEESEISAIKAAISRYIGKKAEELDFNNFLVLRGKSKNV
                     VHVSSQVMKSLKNHKDIYSAGIHIGDLEEISGKEKFLPSLEGITLVSKDIEKNYAVIN
                     EKGEGLFLYSRDVFDSSIIELKGDGKVAVFNENKELLGIGKYNGKLIKNIMDRGWYLR
                     YGG"
     CDS             complement(21639..22691)
                     /codon_start=1
                     /locus_tag="MMKA1_00170"
                     /product="hypothetical protein"
                     /protein_id="BAP60134.1"
                     /transl_table=11
                     /translation="MNSAEILENSIKAFKLTEKHHGNITTLERALFLGWYCNLDDPCK
                     FCFMSTQKEKIKDPLKARRKPESILAESILMKRIGWKLEFISGGYGYKTEELNDTIEM
                     VSYIQQAKQYLNVGIIDFENLNLNNIEGVVGAVETVNPKLHEELCPGKPLSNTKEMLK
                     KAKDMGLKTGITIILGMGETEKDIDLLLNLIEELNLDRITFYSLNPQDETVFQGKTSV
                     TTLEYMNWVSTVRLNFPKMKIITGTWVDKLTNIGPLVMAGSNVITKFPLFSIYGKKEG
                     KTVENEIASTGRELYSTFSDLDVLTGEKTLKNTKYVPEKIDISEKNLELITSLSKQLD
                     KKIESYVKTTIRKSQK"
     CDS             22764..23606
                     /codon_start=1
                     /locus_tag="MMKA1_00180"
                     /product="putative transcriptional regulator LysR"
                     /protein_id="BAP60135.1"
                     /transl_table=11
                     /translation="MNKLSESDLSVTLNINYRGKQITKTQVEILKSVSETRSQNRTAE
                     ILGIPPSTVNIQIKRLENKLDLKLTYSSPAGTMLSPDAERIVSYYNAYLERTSKEKFI
                     ACGFISGEVGRILFDDVLVSSFSNVLRLHRSNLTSVVGIDDPYWSYRLGDPVPVAFDH
                     FVMVSKGDFNFKNLLGVNYSAHRIVWKTLKNEKIDFKVSKVVKNPFYAIDLLEEGYSM
                     FLNTCLLRYVKKDYLIETPDYYDKTKHTINFILNKSIPEDEFEEVLYKKEKEIKLAGF
                     DPLL"
     CDS             complement(23659..23886)
                     /codon_start=1
                     /locus_tag="MMKA1_00190"
                     /product="hypothetical protein"
                     /protein_id="BAP60136.1"
                     /transl_table=11
                     /translation="MIIPKKYERITFALLMSGSMALVMSLVMTMVNRGFSLDVLAFWP
                     KVFLIGYCIAFPTAYFVSPIVGKINSKIIIK"
     CDS             complement(23978..24403)
                     /codon_start=1
                     /locus_tag="MMKA1_00200"
                     /product="hypothetical protein"
                     /protein_id="BAP60137.1"
                     /transl_table=11
                     /translation="MVDMDRISISLPTNLLAEFDEIIEERGYASRSEAIRDSIRDYLI
                     KHKWIHSLEGERAGTISIIYDHHSTDVMEKLTNIQHDYEKLIVATIHMHLDHDHCMEV
                     VLVKGDAGEIKELTDKLTSQKGVKQVKLTVMVPGGNIPQ"
     CDS             24520..25395
                     /codon_start=1
                     /locus_tag="MMKA1_00210"
                     /product="hypothetical protein"
                     /protein_id="BAP60138.1"
                     /transl_table=11
                     /translation="MSVVIGYYGKNGAVIAGDKRNLLFNGIESNRAKLEKVLYSGEIK
                     TDEELFKKASEFDVTVHINDTREKVKSLGNLLSGEVVSIGKDSKRRRMYLTKEKCAII
                     DIENDRITNKSVKTGSGIVVFGNRYIKHFVESEIKKHVQKLLKMSAREIRDLFEKILK
                     NIENATLSDTFEYYVVETGEPEFEKAVNKDLDDLFNYRHDLSIKMAEMQILTMIAEKI
                     VKIGDVGVIKNGTLVLYDEFLAINKICPEPEIYSEIEITGEFIEGDIITIDNESLKVK
                     RTGSPVAVQKIICKK"
     CDS             complement(25400..25735)
                     /codon_start=1
                     /locus_tag="MMKA1_00220"
                     /product="hypothetical protein"
                     /protein_id="BAP60139.1"
                     /transl_table=11
                     /translation="MNPKTLEINGKTYSVNIADNFIKRAFGLMFRDISENEGLFFKYG
                     NRRLHIHTFFMKYSIDVIFLKDDKIVDVATNLIPWKTYNSKVKSNRMFEVKASGITAD
                     LIGKKIKFN"
     CDS             complement(25732..26556)
                     /codon_start=1
                     /locus_tag="MMKA1_00230"
                     /product="hypothetical protein"
                     /protein_id="BAP60140.1"
                     /transl_table=11
                     /translation="MDPSSIIWIFFAFLFFYPQVLFRYRLLQRYKFIKQFEAVRKTRA
                     IVMIHRQEQLALFGIPLYKYITIEDSEEILRAIRMTPEDMPIDLILHTPGGLVLASEQ
                     IAIALKEHKAKTTVIIPHYAMSGGSLIALAADEIIIDKNAVMGPVDPQIGQYPAASII
                     NAINTKYTDELDDETLILGDIARKAIVQVKEFVYDILKDKMGEEKAKYLSETLSTGKW
                     THDYPLTINKLKDLGIEVNTDLPNIVYELFDLYRQPVNQRPSVQYVPVPYKRGTKK"
     CDS             complement(28244..31639)
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="polC"
                     /locus_tag="MMKA1_00240"
                     /product="DNA polymerase II large subunit"
                     /protein_id="BAP60141.1"
                     /transl_table=11
                     /translation="MLHVSASKGMTEYFKNILDDVSNLYNLAEECRKNGYDVTDHVEI
                     PLAKDMADRVEGIVGPKNVAERIRELVSEFGKEPAALEIAKEIVEGKFGEFGREVGAE
                     QAVRTALAVITEGIVAAPLEGIAYVKIKKNSDNSEYLAIYFAGPIRSAGGTAQALAVL
                     VGDYVRKNMGLDRFKPTEDEVERYGEEVDLYQSEVTTFQYQPKAEEIRVAVRNISVEI
                     TGEATDDVEVSGHRDLPRVETNQIRGGALLALVEGVLLKAPKILRHVDKLNIEGWNWL
                     KELKSKKEEVIEELEEENDEYNYEDEEDLSQYEDYEVEAVTKFIGEVIAGRPVFSHPS
                     KKGGFRLRYGRSRNTGFATDGFHPAIMYLVDDFMAVGTQLKTERPGKATCVVPVDSIE
                     GPIVKLNDGSVLKIDTVEKAKQYTDEVQEILFLGDILVNYGDFLENNHTVLPSSWCTE
                     WYEKILKSQNLEYTEEFIKNPGQNEAVNYAKITKTPLHPKYTYFWHDISKENISTLRS
                     WVIGGKYNPSNDSWELNYDPEDEEILNAKRYLELIGCPHTVMEEKVEIFEYYPFLYSL
                     GYDFDEKRDMIDNIDEKLQNTKNNMHFINTIAPFEIRRNAYIYVGARMGRPEKAAARK
                     MKPPVNGLFPIGNAGALVRLINKAVEEGKTDEIEIANVKCSCGKVSLYRTCPFCGNSV
                     EPTGPSRIKLPIKDYWYKTLENLKINKPGDVKCIKGMTSKDKIIEPLEKAILRAKNNI
                     YVFKDGTTRFDCTDVPVTHFKPVEIHVPIEKLKSLGYLKDIHGNPLENEDQVLELKVQ
                     DVIVPESCMDYFLNVSGFIDDLLEKYYKKDRFYNVNTREDLVGHLIIGMAPHTSAGMV
                     GRIIGYSNANVGYAHPYFHASKRRNCDGDEDAFFLLLDAFMNFSKRFLPDKRGGQMDA
                     PLVLTTILDPKEVDGEVHNMDSMWEYPLEFYEKSLEGIAPKEIKKMMETIEDRLDKDS
                     QYEGIGYTHETSKIDEGPPICAYKTLGSMMEKTSAQLAVAKKIRATDERDVAEKVIQS
                     HFVPDLIGNLRAFSRQGVRCKCGAKYRRMPLKGVCRKCGSRLILTVSKGAVEKYMNVS
                     QTMAEKYDASDYIKQRLEIIKSGIDSLFVNDKRKQVKIEDFFK"
     ncRNA           complement(31816..32045)
                     /gene="RNaseP"
                     /locus_tag="MMKA1_rnp0010"
                     /ncRNA_class="RNase_P_RNA"
                     /product="RNA component of RNaseP"
     rRNA            complement(32107..32221)
                     /gene="rrnB5S"
                     /locus_tag="MMKA1_r0040"
                     /product="5S ribosomal RNA"
     rRNA            complement(32283..35239)
                     /gene="rrnB23S"
                     /locus_tag="MMKA1_r0050"
                     /product="23S ribosomal RNA"
     CDS             34535..34780
                     /codon_start=1
                     /locus_tag="MMKA1_00250"
                     /product="hypothetical protein"
                     /protein_id="BAP60142.1"
                     /transl_table=11
                     /translation="MRTCWFPYAYDREDLKLATTIYSPARFSKRTTQPWLYTSYSRLA
                     TVSFRIVAFGAVSYHTYLVSGSFHTRLKVLFSFPSRY"
     CDS             34918..35316
                     /codon_start=1
                     /locus_tag="MMKA1_00260"
                     /product="hypothetical protein"
                     /protein_id="BAP60143.1"
                     /transl_table=11
                     /translation="MTFQSTSAFLNRRKEGPTTPHLPEGIQFALIRVQSPLITESLLI
                     SLPAGTKMLQSPAFPILNGLQSRKSHSEIPGSMTVCVSPGLIAAYHVLHRRSKPSHSP
                     DRVIDNSRHLDNTRYGGLCTTFTKNPVLGP"
     tRNA            complement(35346..35418)
                     /locus_tag="MMKA1_t0010"
                     /product="tRNA-Ala"
     rRNA            complement(35522..36913)
                     /gene="rrnB16S"
                     /locus_tag="MMKA1_r0060"
                     /product="16S ribosomal RNA"
     CDS             complement(35684..35962)
                     /codon_start=1
                     /locus_tag="MMKA1_00270"
                     /product="hypothetical protein"
                     /protein_id="BAP60144.1"
                     /transl_table=11
                     /translation="MVHGHRQLVPRGVLLSQVTSETRALCCYFFLREKGTHRGPLALS
                     QRKERATIGPHAPNLLGYTRATMARTMGRNPEKGRKSPKPSRSSDRGL"
     CDS             complement(35850..36005)
                     /codon_start=1
                     /locus_tag="MMKA1_00280"
                     /product="hypothetical protein"
                     /protein_id="BAP60145.1"
                     /transl_table=11
                     /translation="MMTARLTTLPEALRGGAWPSSARTARRPVKSGNERDPCPMLLLF
                     PPGERHS"
     CDS             complement(37169..38176)
                     /codon_start=1
                     /locus_tag="MMKA1_00290"
                     /product="potassium uptake protein"
                     /protein_id="BAP60146.1"
                     /transl_table=11
                     /translation="MESMEKIKIGIFVLFVVIISFSLMFMYIEGWTLLQAIYFSVATI
                     STVGYGDFYPTSELGQLLTILFIVFGVSTGLYTLGAFAESFIGGYFKRYNRRIKMKKR
                     IEMLENHYIVCGYGRIGRVVIDRLRESGLDYVAIDNNSEILEAEFEKDPNFNYIVGDA
                     THDEYLIDAQIDRAKALISTVSTDSDNVYITLSSKRLNPKLYVVSKADEQVAMDKLLI
                     AGADKVVSPYMIGGLRVAELAMKPGILDFVSTFMSIAKYEYDEDLEIRKILIGKNSKI
                     RGKTLTESQIRYNSRVTIIGIKKENDLLVNPGPEIILEYNDQIYAFGTGEQLDVLESM
                     V"
     CDS             38249..39700
                     /codon_start=1
                     /locus_tag="MMKA1_00300"
                     /product="putative CobB/CobQ-like glutamine
                     amidotransferase"
                     /protein_id="BAP60147.1"
                     /transl_table=11
                     /translation="MEIGLIDIKGTLPCFENFGNLPTKIIHENNISKIKDLEMLIIPG
                     GSIVESGSFTDEFKKQILDFDNYIVGICSGFQILSEKIDIGRKSPIPIIKEGLGLLNV
                     EFSPLICTDLVKFNFENNNLFGEKNQLGHGFHCHTYGNIEITNNSTEKWTISEIEKLN
                     YKIVGKQNILSGVFKNKVYGTMVHNLLDNEFIVENFLKNMKIKDDEREEIFKKNSILK
                     EKLKNRSKISENFKKIESNDKKGIILLATGSESGKTFLSTSICSKLKGKTFVSKIGPD
                     VRDIVPSLYLLREPMTKFNSVKISDRGWSEPSEFLEFVKNSKFNNYIIEGVMGAFTGA
                     LNKKNYSGSEVSKILGFPVYIISSCSKTGIEGSFVECMAYHSLLKEMGVNVAGIILNR
                     VYNTELLEKVKKIADDLNVDLIGVNKLNVNVDNKRGLIPEVEIDYEEFCNATMKLDFE
                     IDIPKINPEKINEDSKTFEEYLKIWSEKLININ"
     CDS             complement(39911..40402)
                     /codon_start=1
                     /locus_tag="MMKA1_00310"
                     /product="hypothetical protein"
                     /protein_id="BAP60148.1"
                     /transl_table=11
                     /translation="MDFERAFKFPTDDPDWIKKVVIGAILSIIPIVNFISFGYALELL
                     KNIIDSKEELPEWSEFGGKFVKGLVAVIIYIIYMIIPAIIMFVFGGTSIMAMANGHDA
                     AIAGGIVGFGITMLLVILLAFVIGFIIPMAIANYIAYDEFGAAFRFSEIFGKIKDNFS
                     DYI"
     CDS             40626..42644
                     /codon_start=1
                     /gene="mcm"
                     /locus_tag="MMKA1_00320"
                     /product="minichromosome maintenance protein"
                     /protein_id="BAP60149.1"
                     /transl_table=11
                     /translation="MDDKQIQNIRPRLTECLKTLNFQDIISEKKKVAVDIDNIYKHGV
                     IDFIEFLEEFPKEGIELLEECYRDAYYSIKTEKPDIVITVKNIPEEFNKSEKKQNYTI
                     EDIKSGTLGKLIEFEGIIVIATKIKSALKKATYVCTQCGEKKIQEVENPFEAYFEPPC
                     PKCAQNMTLIEDESEYIDFQEIKVQQPLDSMGDPEEPPKYITVFLEHSPGIYCGRVKV
                     TGIPIKNQKNKNIPIYDIYVKGINCEVLEDKIEANLNEEDIKNIEKVGKNPKVIDILS
                     ERMIPEIKGYEIIKKAIFLQQVKGVKKGNKRADSHLLLITDPGIGKSVMLRKIAEIPG
                     NLYGSATTASGVGLTAAVIREKTEIGDDTWVIKPGLLVKANKGTACIDELTVNRDLQT
                     FVLEAMESQTIHVSKGGINAKLPSECAIIAACNPRWGRFDPNVSIPEQINIPAPMLSR
                     FDLIFPIKDEADRSKDKDIAQHIINVHRAYLSKEVSKNMKLDHIIVDDVLIDRDFVIK
                     YIEYAKTKSPIISESAEKLLTEFYLNMRKGSVQITARQLEAAIRIAEAHAKAKLKDVV
                     DEEDANEAISIITESLKETAYDPETGQFDVDKISGVGKKDRSKMMGVYDLIKALAEKS
                     DNDLVIIDEIVEAGKSKGIDEEHILLSIKKLKSNGDIDEPKTGKFRII"
     CDS             42660..43742
                     /codon_start=1
                     /locus_tag="MMKA1_00330"
                     /product="hypothetical protein"
                     /protein_id="BAP60150.1"
                     /transl_table=11
                     /translation="MEIIYNKPEIYATNDIWIQPVSRSSVLESDVVGNCKIINDIPIL
                     RVLGSPSLKKTVLNILHVLKDKMTFFKNNFEIKGMDNIFKYLNDVYFDKSVNNYYRAK
                     KAWYRVIGDLFEDINNWNFKKVMGKLITILKVLNPILVFDLHDVSKWNHLKTFQRFIQ
                     FLKNEEISIVLRCPFEAYSYLKNNFENYKTNSVAAVIYYAKNKGHLISEKVSEELLKI
                     SCGNLRIIDLILGNSKRDLKNMRDLKINWKKIIPEVLPKKYKNIVQKIFLLKKFNIKE
                     ISDMLEYSSSTVYNYLNELVGLNIIKKRKVNKNILFKLDVDKKAAFDIIQLNIDFKDI
                     FFEINDFKNINLKKRTEIFNGFLIFG"
     CDS             complement(44375..44896)
                     /codon_start=1
                     /locus_tag="MMKA1_00340"
                     /product="putative transcriptional regulator ArsR"
                     /protein_id="BAP60151.1"
                     /transl_table=11
                     /translation="MEAILKKLVNTKERKLILTKLLKEPRCCEDLSKELNISKGLPAQ
                     FLKLCTSLNLVKRERISHKVYYSINPENYLKIYNAVTIEDKKTEEKKNLKHSLKKDEF
                     QTTLSVENTLKDYDIKKIDNGFGGTTFILNNNDSSFEIFKTNENNYWCVACQSNDCEH
                     VLYLKKASSKKRN"
     CDS             45507..46733
                     /codon_start=1
                     /locus_tag="MMKA1_00350"
                     /product="putative transcriptional regulator ArsR"
                     /protein_id="BAP60152.1"
                     /transl_table=11
                     /translation="MLDPIEFIHNASSISKKSMNRLKLKTNPFSEKPIRGNTKFFVGR
                     TSELSEIADILGAAQYGSVANAAIVGTKGIGKSSILNILYYASKRHNHWVVELEASQI
                     TARQFLIQLMYGIIKDNLFSVDGTLSSDYMKHSQKIIEIYKRLSNYSDKTPVHYPREK
                     IERDLKYLLNEVKEENKLCVILIDEADQFAKRSCLGLLQFFHSFLYEDDILTFLAGPP
                     TMVEDLTKISPAIRDRIPKIINMPPLTKEEAYDLIKRRLEDSQITGAKGYQPFSEQSI
                     EKIIEECDGIPRRIIMTCSEAVSLGLKNGVDEIDDEIARNAMKNLGISVGHQILNHLT
                     PAQSKIIKAMAELGGSSTVTELSGILNNSTGTIGTHLSDIYEMGYIYKERDGYNVYYT
                     LSKELKDVLITKEDIS"
     CDS             46754..47701
                     /codon_start=1
                     /locus_tag="MMKA1_00360"
                     /product="hypothetical protein"
                     /protein_id="BAP60153.1"
                     /transl_table=11
                     /translation="MQCNDVQATEPDIKVSLTRVGVTNLKKLVKLKRKNKRDIVLLPT
                     FEVFVDLPSSQKGIHMSRSPEVIEEVVENILLEKEIYGVEDLSVEIVMKLFEKHEYAT
                     RAEVMLYSDYMMEEKSPVTKKDSQEIGKIIARAYGVKDSNGKIDVKKMVGAEVVGITA
                     CPCAQNMLKENAVVSLTEKGFSTEDIEKILDSVTIATHNQRGIGTVMIEVPNGYTVGI
                     SKIIKIIKDSMSGEVYELLKRSDEAFVVEAAHKNPKFVEDCAREMIKRVVDVFDYLPE
                     DTQVLVRQVNKESIHRHDAFAERNSTIRELRDELKTLTN"
     CDS             47727..48776
                     /codon_start=1
                     /locus_tag="MMKA1_00370"
                     /product="hypothetical protein"
                     /protein_id="BAP60154.1"
                     /transl_table=11
                     /translation="MKALVVGACTRPVVNSLKKLNFEVYSVSHYNPVDLNADHKKYTI
                     NDKFHGHLADKYSEKELLNLSKEYVDLVDYIFVCSGIFESKTSKTPNWDVVGNSPKRI
                     KNISDKYKTVKKLENLGFNVPVTYLVNNKYQFEKCLSELKSVVVKPISGSGGIGVTNI
                     DFQNTDNLDINYPVLVQERIKSESYSASFIGSNFLCFNKQLINNNIYVGNISPYVLNL
                     KNETIQEFEEIIASLDLLGMNGIDFMLKDGIPYIIEVNPRILGTYETIELSSRYNLSK
                     AILENKPVKPKDCFFKKIVFSDKGSSYSIDKNPFLKDIPQKGTYIEEGEPIVTIIGRN
                     MADVREMECGILRGV"
     CDS             48780..49337
                     /codon_start=1
                     /gene="tfe"
                     /locus_tag="MMKA1_00380"
                     /note="protein synonym:transcription initiation factor
                     TFIIE"
                     /product="transcription factor E"
                     /protein_id="BAP60155.1"
                     /transl_table=11
                     /translation="MNLSKDEIFTMLENPLIQQVLFEIMDEDVVGFDVLSVLINTNEV
                     TDDEISRQLDVKLNNIRRILYKLYEARLVDYNREKDEETNWYTYTWKPSLEKVPALVA
                     KKMKNVLNGLKEQLNVEENNMFFFCSDCEIKFTFEDAMDSGFRCPQCGEMMYEYDNKK
                     DISLLKEQIKYLEDEFNKNPLFSTY"
     CDS             49348..49935
                     /codon_start=1
                     /locus_tag="MMKA1_00390"
                     /product="hypothetical protein"
                     /protein_id="BAP60156.1"
                     /transl_table=11
                     /translation="MNIVLNDLLNDATLYEKFSNFKKMQEIPNFNEYLTFLTERCEKN
                     VVLHSIAVADYVYEFGIKLLNKKYDFDLDTAVLGAILHDIGRSKSHNIDHGIIGSEIL
                     LKNNFNEKYAKIAERHIGAGISIKETEDLNLPKKDYIPKTLEEKVIANADNLVSGHIR
                     VDIGFVIDKFKKRTNNEVSNKVYALYLEINKLIGN"
     CDS             complement(49962..50858)
                     /codon_start=1
                     /locus_tag="MMKA1_00400"
                     /product="putative type II secretion system protein"
                     /protein_id="BAP60157.1"
                     /transl_table=11
                     /translation="MDAKKYLDHVYHVLIVRNIKILKKTGRKLDERVFIGILLVITIL
                     PILLKIFLGFTLKTTLILTFVYLGSVLSLPTIMYESKMDKFDKNISKALYVMVLSLDS
                     GRSVVEAINEVIRSGIPEVDVVFSKIVTLMTERKLSFEDAMILVSNSLDSKIFRQVGR
                     LIIENRKYGGELADTLKKLAKTLDDLQNLKSQLLSVTANGLAVGLIILCGVIPATAGL
                     IGGYLTVISQLAPTMPSVEASQISKAIETIQMGSGLFGLFFAVPLFGLKVNRMIITCA
                     VCMTFAIGTFYAVLRLTGLLFA"
     CDS             complement(50863..51921)
                     /codon_start=1
                     /locus_tag="MMKA1_00410"
                     /product="putative type II secretion system protein"
                     /protein_id="BAP60158.1"
                     /transl_table=11
                     /translation="MKRKTEKKQGTFDKLANTLKGVKTPKKRKISRVGRSEYLKKIFE
                     RKTEDIHKDEILEFYEPYIDETPEVSIDLDDLLFEKKEFGALGGYSRSFSYWVTNTSF
                     LPSKRDYQYAGIVDERVYFLKMMIAAITTVVLFIIYGVLTGDVFSGVSNGVLLAVIIV
                     VGSIFYPKLKLTLFRGEIKIQVLMSILHLISMLNSGASVQESLKNIANNPEYGITSFE
                     FRSIIKDINQGGYNFVEALDRAKLRSKIPLMKKLYEQLILAANKGGTQLLLENLYNEI
                     VRESMSKIDSSKFQISNLGNLIFGIGLIIPFSGMIQSALGAQQGFDGIINAIDLVMGK
                     IGLMSTIIFTIFIKMKIE"
     CDS             complement(51933..53582)
                     /codon_start=1
                     /locus_tag="MMKA1_00420"
                     /product="putative type II secretion system protein E"
                     /protein_id="BAP60159.1"
                     /transl_table=11
                     /translation="MGLFDRIQSRDSNPSVAKKNNVSEKVSETPNILDTSEKVKKPEI
                     KVGFSVNERAKQPVEEFERDSTSSILDKYFVKVDDIDFDVIIEKENGVTLYKIPEITL
                     MNTALAKFSDMDIKTIKAELSESTLQKLGQIQGYLKNYSEKNNLHLRDIEILHLSHYF
                     YLIIGKLGLLEIPLNDSKLEEVMVNGVESPSFVFHRKYQMCETNIRLDRHEATRVVES
                     IAYLAGRTIDSRTPMLDAFLPDGSRVNATMSDVTLGGNTITIRKFSEDPLTIVDLINF
                     GTFDLELAAFLWQAVEGYFGSKPANTLIVGGTGSGKTTTLNVVSMFSMYNDRIITVED
                     TPELQIPLTHLIKMITRPGRPGIQGYEITMDDLIKNSLRMRPDRIFVGEVRGSEAHSL
                     LVAMNTGHDGCSGTLHANSADEALIRLINPPMNVPKVMMSSVDFIINQQRIKRNKKTV
                     RRILGVVEIGGSGENITKTELFKYDGISDSVVKTGICMWEEGVCQIAGITRDELMDDR
                     INRKKVLKYMVNNNINDIRKVGDVLKQYQENPENVLKNILE"
     CDS             complement(53592..54611)
                     /codon_start=1
                     /gene="tfb"
                     /locus_tag="MMKA1_00430"
                     /product="transcription initiation factor IIB"
                     /protein_id="BAP60160.1"
                     /transl_table=11
                     /translation="MKVESVTKEDTKKPERKIKIAIAKPEDYSNKNVILEKEEELICP
                     VCGSKSIIKDYERAEIVCEMCGCVLQQNLFDVGPEWRAFDHEQRVKRSRVGAPMTYTI
                     HDKGLSTVIDWRNKDSYGKDISADKRAQLYRLRKWQRRIRVSDASERNLAFALSELDR
                     IASKLGLPRNVRENAAVLYRGAVEKGLIRGRSIEGVAAAALYAACRRCKVPRTLDEIA
                     EVSRVDRKEIGRTYRFISRELNIRLAPTNPVDYVPRFASELKLPGEVESKAISILQKA
                     GERGLTSGRGPTGVAAAAIYIASVLQGTRRTQREVADVAGVTEVTIRNRYKELTEHLD
                     IDVTL"
     CDS             complement(54630..54911)
                     /codon_start=1
                     /locus_tag="MMKA1_00440"
                     /product="hypothetical protein"
                     /protein_id="BAP60161.1"
                     /transl_table=11
                     /translation="MEKIKILHRTPKGKIIGRVKKQPRFNSPVGIKLKDRVKKIGKIY
                     DVFGPVEEPYVKIIPYSEDDAEKTLESDNVFVMNEQSKKQSKPRKKGRR"
     CDS             55415..56482
                     /codon_start=1
                     /EC_number="5.3.3.2"
                     /gene="fni"
                     /locus_tag="MMKA1_00450"
                     /product="isopentenyl-diphosphate delta-isomerase"
                     /protein_id="BAP60162.1"
                     /transl_table=11
                     /translation="MNNNSIEYRKLEHLIVCDHCDVEYKKGTLLEDVELIHSGISNCD
                     LDDIDTSIEIFGKKLNAPLIVAAITGGHPKAKEVNKNIAIAVEELNLGMGVGSQRAAI
                     SKSYLEDTYSVVRDHTSSLIIGNLGAVNFVEDSWDEEIISKSVEMIDADAMAIHFNPL
                     QEAIQPEGDVNFKGLNILKEIISNYNKIHGKIPFIAKQVGEGFSKKDAIFLKEIGFDA
                     IDVGGSGGTSWAAVELYRIKDEEQKNFSNQYFNWGIPTAASILEVNSAFSGPIIATGG
                     IRTGIDIAKSISIGANCCGTALPILKAALKSSEAVTTVLERMIKELKTTMFLTGCNNI
                     NELKSARYILKGDLKNWKDQI"
     CDS             56555..57901
                     /codon_start=1
                     /locus_tag="MMKA1_00460"
                     /product="beta-lactamase like-protein"
                     /protein_id="BAP60163.1"
                     /transl_table=11
                     /translation="MQLEVVAIGGYEEVGRNMTAVNIDGEIIIFDMGVRLDRIMIHED
                     TDISKMHSLNLIEMGVIPDDTVMKNIEGEVKAIVLTHGHLDHIGAITKLAHRYNAPII
                     GTPYTLELVKREILSEKKFDVRNPLITLENGNKLDLTANITLEFVKITHSIPDAAMAV
                     LHTPHGAVVYGNDFKFDNFPVVGEKPDYKALKRIGKQGVIAMVSESTRVDFEGKTASE
                     GVAANLLKNDLLGTDNEDNAVVVTTFSSHIARIKSITDIASKMGRIPVLVGRSMSKYC
                     GIAQDIGLVKFPKETKICWDPSSIDKTFHQIMKDGKENYLMVVTGHQGEEGAVLSRMA
                     TNKTPFRFEKYDQVVFSADVIPNPMNAAQRYLLEARLNLAGVRLFKGAHVSGHAAKED
                     HRDILRWLQPEHLIPAHGDFNLTSAYAKLAEEEGFRLGEDVHLLRNGQSLKFERVI"
     CDS             57915..58868
                     /codon_start=1
                     /EC_number="2.5.1.1"
                     /EC_number="2.5.1.10"
                     /gene="idsA"
                     /locus_tag="MMKA1_00470"
                     /note="protein synonym:bifunctional short-chain isoprenyl
                     diphosphate synthase"
                     /product="isoprenyl diphosphate synthase"
                     /protein_id="BAP60164.1"
                     /transl_table=11
                     /translation="MVFDREILSKIDSELKKYMEKDTKLYGASKHLLLAGGKRVRPYL
                     SILTYLLKKDDLTEIMAPALSVELIHNYTLVHDDIMDNDDQRRGIPTVHTVYGEPIAI
                     LAGDLLYAKAFEALSNIEDSNKAHEVLKVLSKACVEVCEGQTEDMEFEERFPTLDEYL
                     EMISKKTGALIVAPVEIGAVMADCTPEEREALRNYAKRIGMTFQIQDDVLDLIGDQKT
                     IGKPVGSDIVEGKKTMMVIHAMESLSEDKKERLLQILGNQDANQQEVAEAIELLADSI
                     NYAKDTMKNATEEAKDYLKIFDAEKRKNLENIADFIIERIH"
     CDS             58919..59371
                     /codon_start=1
                     /locus_tag="MMKA1_00480"
                     /product="hypothetical protein"
                     /protein_id="BAP60165.1"
                     /transl_table=11
                     /translation="MKIPKIYVEEELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLY
                     QVIYDDLAKYMSLDTLKKDVLIQYPDKHTFTYLKAGTKLISVPAEGYKVYPIMDFGFR
                     VLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE"
     CDS             complement(59376..60485)
                     /codon_start=1
                     /locus_tag="MMKA1_00490"
                     /product="hypothetical protein"
                     /protein_id="BAP60166.1"
                     /transl_table=11
                     /translation="MIGFRMTSKNKYSVSKLYPLIGGTLFKEFGEIIENLDSLDILIY
                     SFMSMQEKEVLSEINELKKLKKDVILIAGGAHPSGCPEDTLNLGFDHVIVGEGEISLP
                     NLINSIKSGKTPEKIIKGKPIENFDDYEKIWPLAPIEITRGCPYNCRFCQTPQIFGKN
                     IRHRSIESIVKIVKTMGDIRFVTPNAFSYGSKTGTKPDIEKLEKLMKSLFEIKKRLFF
                     GTFPSEVRPEFVNFETLDLVNKYCDNRYIHFGAQSGSDEVLKHIRRGHTVSDVINAVE
                     TSKECDLIPKVDFIFGFPDETKDQRKESIDLMKYIIKKNGKVHAHYFMPLCGTYFENS
                     TPELLEKETLDILGKLAKKGQITGSWGYQYSKNLE"
     CDS             60543..60815
                     /codon_start=1
                     /locus_tag="MMKA1_00500"
                     /product="hypothetical protein"
                     /protein_id="BAP60167.1"
                     /transl_table=11
                     /translation="MKKRPTLYIKIHYPGSILEGEYDYEAVVKLKNKYIKYLETGKGT
                     GTLLFNEDKKNFAVVNFQQVCAIEVDKTLMFMDEFEREWDKVYKTR"
     CDS             60854..61309
                     /codon_start=1
                     /locus_tag="MMKA1_00510"
                     /product="hypothetical protein"
                     /protein_id="BAP60168.1"
                     /transl_table=11
                     /translation="MAKIAKNAVVIGDVELGENVNIWYGAVLRADINKIKIDDDSNVQ
                     DNCTVHCSKDYPVFIGKGVSVGHGAVIHGCTIEDNVLVGMNSTVLNGAKIGKNSIIGA
                     NALVSQNKEIPPNSMVLGVPGKVVRTLTDEEINSIKENAKNYLELSKNL"
     CDS             61358..61771
                     /codon_start=1
                     /EC_number="2.5.1.9"
                     /gene="ribH"
                     /locus_tag="MMKA1_00520"
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="BAP60169.1"
                     /transl_table=11
                     /translation="MVNLGFVIAEFNRDLTFMMEKMAEEHAEFLGANVSHKIMVPGSF
                     DMPLAIKTLLQKDDIDAVVTIGCVIEGDTEHDEIVVQNAARKIADLSLDFGKPVALGI
                     AGPGMTRMQAEDRIDYGKNAVEAAVKMVKRLKEIQ"
     CDS             61809..62099
                     /codon_start=1
                     /EC_number="3.6.1.31"
                     /gene="hisE"
                     /locus_tag="MMKA1_00530"
                     /product="phosphoribosyl-ATP pyrophosphohydrolase"
                     /protein_id="BAP60170.1"
                     /transl_table=11
                     /translation="MNVLKEVYATIEKRIEEKPEGSYVAKLTTDDKKTAVNKICEKVG
                     EEAAEVIIAAKDNDKAEIIYESADLIFHTMVLLAKSGITYEELSEEFKKRMK"
     CDS             complement(62101..63012)
                     /codon_start=1
                     /locus_tag="MMKA1_00540"
                     /product="hypothetical protein"
                     /protein_id="BAP60171.1"
                     /transl_table=11
                     /translation="MELTIVQKEILQELISIYREKNKAVKGTEIAVKLSRNPGTIRNQ
                     MQALRALNLVDGVPGPKGGYIPTSLTYRSLGLETEEEITVPIYKRDDLVEGVSVIKIV
                     FDTVTKEKSCSSKIYVNGDTRKFSEGDVVKVGPTHHNKIVILGRVVGRDDINHILLMD
                     VISVASVPGITVGDVGIKEELIYITPEKTIRDAAKLLSDANISGIPVMDGKKLLGVLS
                     LHDVADAVSRGLENENVTKLMAETIHTISKNEKIYDALILMEKHNVGRLIVLDNEEIA
                     IGILTRTDILNLIEGTIFPKILKKYLK"
     CDS             complement(63143..63883)
                     /codon_start=1
                     /locus_tag="MMKA1_00550"
                     /product="hypothetical protein"
                     /protein_id="BAP60172.1"
                     /transl_table=11
                     /translation="MKAFEIIKIIEKFAPKELAVPRDNIGLQVGLNLEKEVETLGIAL
                     DPSLEVIKKAESENVDFLFTHHPILKDPIRNFTGPIYKKLKILTKKDIPLYSAHTNLD
                     ICKNGLNDCLAELYNLKDVKNLYEDGLGRVGTFDGTFEDILKITKENIFAVPQTVVPK
                     SIYDKKQLKVAVLSGYGLSQDSIKYVSNFADVYISGDLTHHSKIIAEELGITVIDGTH
                     YGTEVYGLKSFLKYLEKNIPCKTVSLDF"
     CDS             complement(63880..64488)
                     /codon_start=1
                     /locus_tag="MMKA1_00560"
                     /product="putative methylase"
                     /protein_id="BAP60173.1"
                     /transl_table=11
                     /translation="MIEIIEINGIKIKTHPKVYVPAEDSELLIENLVDVKNKSVLDVG
                     TGSGIQAINAVKQGALKVIGIDINPYAVDCAKINSELNEIDSKKLSFKTGDLFKNIDE
                     KFDVILFNAPYLPTSDEEKLEKYLNYAFDGGKDGREVLDKFLDEVANYLKKDGIIQIL
                     QSSLTDGNKTIEKMEKLGFVAKQTGSLKFSFEELQVITGWKK"
     CDS             complement(64502..64981)
                     /codon_start=1
                     /locus_tag="MMKA1_00570"
                     /product="putative RNA binding protein PUA"
                     /protein_id="BAP60174.1"
                     /transl_table=11
                     /translation="MEIKRRYMLKKKELKELKEELGNIFDVEKIIPKKAVVEKAVTEE
                     GEIILLDGTPLAMVNSGRIFPTLKFLLEMDIENNRVIVDMGAVKFIANGADIMAPGIV
                     GADEDIKEGDIVFVVDVTHKKPLSVGEALMDGKTMVEEKKGKAIKTIHFIGDEIWKM"
     CDS             complement(65089..66168)
                     /codon_start=1
                     /EC_number="2.5.1.-"
                     /gene="cofH"
                     /locus_tag="MMKA1_00580"
                     /note="protein synonym:FO synthase subunit 2"
                     /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
                     synthase subunit 2"
                     /protein_id="BAP60175.1"
                     /transl_table=11
                     /translation="MDLMSFKEKEISKKDCVELFEDTENFFDILKLADSIRKDIVGDT
                     VTYVVNANINFTNVCSGTCKFCAFKAEHGDPNAFFLSPEQVAKKALEARKTGATEVCI
                     QGGLLKEIDTYFQAEILKKVKEITKTYGGIDIHAFSPMEVKSAAENAGLSVKEALKIL
                     KENGLNSMPGTAAEILDDEVRSEICPTKLKTSEWIDVVSTAHKTGINTTCTMMYGHIE
                     ENKHLAEHLSILRKIQKETGGFTEFVPLTFLHENAPLYHMDRVKSGASGMLDLKVYAI
                     SRIFFKDYIKNIQTSWVKLGTKLSQISLNCGANDIGGTLMEESISKAAGGSYGTYMSE
                     EKLKDIVLAVGRIPKQRNTCYEIIK"
     CDS             complement(66283..67359)
                     /codon_start=1
                     /EC_number="2.5.1.-"
                     /gene="cofH"
                     /locus_tag="MMKA1_00590"
                     /note="protein synonym:FO synthase subunit 2"
                     /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
                     synthase subunit 2"
                     /protein_id="BAP60176.1"
                     /transl_table=11
                     /translation="MDLMSFKEREISKKDCVELFEDTENFFDILKLADSIRKDIVGDT
                     VTFVKNTNIETTNVCTMGCKFCAFSVSKNSPEAFKLDSDEIAKKAVIAKKSGLTEVTI
                     HGGIHPDVDTHFQVETINKVNSATSKLGGIYTHAYSPQEILNGAENAGLSIKEALKML
                     NEAGLRTIPGTAAEILDDEVRSDICPLKMSTKKWIDIMKTAHKTGIKTTSTIIYGHVE
                     EYKHIVDHLSILKEIQEETGGITEFIPMSFLHENTPLYKSGRVTDGASGLYELKLYAI
                     ARILFKETIKNIQAPRVKIGTKLSQLILKSGANDLGGTLVEDKVSKAAGSIYEDASVD
                     LMKNAITSIGRIPKERTTLYEIIE"
     CDS             67589..68551
                     /codon_start=1
                     /EC_number="1.5.99.11"
                     /gene="mer"
                     /locus_tag="MMKA1_00600"
                     /note="protein synonym:coenzyme F420-dependent
                     N(5),N(10)-methylenetetrahydromethanopterin reductase"
                     /note="protein synonym:methylene-H(4)MPT reductase"
                     /product="5,10-methylenetetrahydromethanopterin reductase"
                     /protein_id="BAP60177.1"
                     /transl_table=11
                     /translation="MKFGIEFVPNEPITKLAYYVKLAEDNGFEFCWITDHYNNRNVYM
                     TLGNLAAATNKIKLGPGVTNPYVRSPAIAASAMATVDELSGGRATFGIGPGDKATFDA
                     LGIEWTKPVGTIKKAIADFKELTAGKRMAEGAQLAIKPSAKIPIYMGAQGPKMLETAG
                     EIADGVLINASNPKDFEAAVPLIKKGAEAAGRSMSEIDVAAYACMSVDKKADKAKQAA
                     IPVVAFIAAGSPPMILERHGIDPAKVDAIRAGLKEGNFGAAFGNVDENMLEGFALYGT
                     PEEVVEKVKALEKMGVTQVVAGSPIGPNKDTSIKLIGKIIKEFQ"
     CDS             complement(68616..69038)
                     /codon_start=1
                     /locus_tag="MMKA1_00610"
                     /product="hypothetical protein"
                     /protein_id="BAP60178.1"
                     /transl_table=11
                     /translation="MSEERIQFNAKKGKWYVSKKIKIDENTSNEEIARVLASIEETLS
                     IKIKDFLPFDMEKLRAIADEIYEKKKGRVKEEDISGALTKLKSPGTTKKLGTIDDTKE
                     GKEILKRLLTEIVLERLGITSKIEAKMIEKYIEKSKAK"
     CDS             complement(69147..69377)
                     /codon_start=1
                     /gene="rplX"
                     /locus_tag="MMKA1_00620"
                     /product="50S ribosomal protein LX"
                     /protein_id="BAP60179.1"
                     /transl_table=11
                     /translation="MAKIVRIKGEIVGKDEPMVFTKEYNVVKENDALETMYSEIGSKH
                     AVKRANIKVVEISEISVEEIQSPILKKTLEMN"
     CDS             complement(69396..70079)
                     /codon_start=1
                     /gene="eif6"
                     /locus_tag="MMKA1_00630"
                     /product="translation initiation factor 6"
                     /protein_id="BAP60180.1"
                     /transl_table=11
                     /translation="MIMKTYFSGVSTLGVHSLATEDYGFFPLSVDQKTMERMKNVLDI
                     PATQLNISNSSLIGSLCVGNSNGLLVPNITTEKELELIKMFLKENSLDVNLERLKAKN
                     TAFGNLILTNNKGCIISEELSRFRKTIEDVLDVESGVGNYAELPTVGSNGVATDKGCL
                     VHPLTDELELEWIQDILRVDYVERGTANRGVTSVGACILANTKGAVVGGDTSGPEILK
                     IEEALDLID"
     CDS             complement(70116..70367)
                     /codon_start=1
                     /gene="rpl31e"
                     /locus_tag="MMKA1_00640"
                     /product="50S ribosomal protein L31e"
                     /protein_id="BAP60181.1"
                     /transl_table=11
                     /translation="MEEERIYTIPLRDVTNKSPTTKRAPRAIRAIREFLKKHMKSDIV
                     KLDNTINEKVWERSLNKIPAKVRVKVVKEGDVVKATLVE"
     CDS             70462..71346
                     /codon_start=1
                     /EC_number="2.7.2.8"
                     /gene="argB"
                     /locus_tag="MMKA1_00650"
                     /note="protein synonym:N-acetyl-L-glutamate
                     5-phosphotransferase"
                     /product="acetylglutamate kinase"
                     /protein_id="BAP60182.1"
                     /transl_table=11
                     /translation="MEDYTKAEILIEALPYICKFHDQKILIKYGGHAMVNEQAKNWIA
                     KDLVLLKYVGINPIVVHGGGPEINRAMEKMGKTPEFIHGLRVTDEETLDIVKMVLIGK
                     INGDIVSKLERYGGKSVGLSGKSGQLIKAKKKIQYLMKDSQKIEVDLGMVGEVEHVDT
                     KLIDILVEKRYIPVISPIGVDHQGNDLNLNADIAAGDIAGAMDAEKLIMVTDVDGIMD
                     DPNDPSTLHRRLTIPQIEDMIEKGLITGGMIPKIEACINALNKGVQSVHIVNGKTPHA
                     VLLEIFTEDGVGTMVVRE"
     CDS             71738..72076
                     /codon_start=1
                     /gene="glnB"
                     /locus_tag="MMKA1_00660"
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="BAP60183.1"
                     /transl_table=11
                     /translation="MKKIEAIIRIERLDIVKGILSENGFLSLTISEVKGRGVQGGITE
                     RYRGTEYVVDLLPKVKLEMVVDDKDIDEIITIIRENAETGKPGDGKIFIIPVEDAVRI
                     RTGESGIKAI"
     CDS             72103..73329
                     /codon_start=1
                     /gene="amtB"
                     /locus_tag="MMKA1_00670"
                     /product="ammonium transporter"
                     /protein_id="BAP60184.1"
                     /transl_table=11
                     /translation="MATADLFADPTNIVTGLSTLATSGDVMFLVLMGVLVFAMQLGFA
                     LLEGGQVRKKNVNNVMMKNMADWLIGAVSWLFVGSVLAVSLVPGDFFSWWGQIFTTNF
                     ANNGIDLANWFFGLVFAATAATIVSGGVAERIKFKSYLLMSIIITAILYPLFVYLGPW
                     GSGMIPFNDYAGSFIVHGLGGFLALGAIAALGPRIGKFVNKKAISIPGHNIPMSVFGA
                     FVLAIGWYGFNVGSSFAVADISGLVCATTTLAMAGGGIGALLASKDDVLFTANGLVAG
                     LVAICSGTDVVSPIGALIIGLVAGIQVPIVYKIVEKMGLDDVCGVIPVHGTAGILGGI
                     LTGVFGMAALGGAGGVSLVNQLIAAGLTVVYGTGLGFGLGKLVGAFTGGIRVTEDEEK
                     MGLDLAEHKLPAYPDE"
     CDS             73433..73771
                     /codon_start=1
                     /gene="glnB"
                     /locus_tag="MMKA1_00680"
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="BAP60185.1"
                     /transl_table=11
                     /translation="MRKIEAIFRPERLLAVKNALFEEGFISLTLTEVKGRGVQGGIVE
                     RYRGNEYLVDLLPKVKIEIVSNDSDVEKIVKLISENAVTGKPGDGKIFVIPVEDVIRI
                     RTNETGKDAI"
     CDS             73973..74131
                     /codon_start=1
                     /gene="glnB"
                     /locus_tag="MMKA1_00690"
                     /note="fragment"
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="BAP60186.1"
                     /transl_table=11
                     /translation="MKKLEAIIRMERVGLVKNALYKSGHASLTLTEVKGEEFRAELLK
                     DIAEQNMW"
     CDS             74125..74310
                     /codon_start=1
                     /gene="glnB"
                     /locus_tag="MMKA1_00700"
                     /note="fragment"
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="BAP60187.1"
                     /transl_table=11
                     /translation="MVDLLPKVKIELVVNEKDVDSVIKIIAENAYTGKPGDGKIFVIP
                     VEDVCRVRTGEMGPDAI"
     CDS             74339..75574
                     /codon_start=1
                     /gene="amtB"
                     /locus_tag="MMKA1_00710"
                     /product="ammonium transporter"
                     /protein_id="BAP60188.1"
                     /transl_table=11
                     /translation="MVTADLFNNPTNIMDALNTLANSSDVMFLIFTGAFIFIMHLGFA
                     MLEGGQVREKNVNNAMMKNMGDWIIGCISWLLVGSVIARTLNPADFFIWWGKIASATP
                     FLTNNGLELANWFLGLVFAATAATIVAGGIAERIKFKSYILISIVITALLYPFFSYLG
                     PWGAGVIPFHDYAGSLMVHGVGGFLALGLIAAIGPRFGRFVNKKAITIPGHNIPMSIL
                     GAYILAFGWYGFNVGSSLALSDISGLVCATTTLAMAGGGLGGCLFSKNDVLYTANGLL
                     AGTVAICAGTDIVSPLGALIIGFIAGSQVPLIFKIVEKLGLDDVCGVIPVHATSGALG
                     AILAGIFGMTAFGGVGGVSLTEQIIATLICAVYGTGAGFILGKLVGAVTGGLRVKESE
                     EKAGLDISIHKLPAYPKEN"
     CDS             75635..75934
                     /codon_start=1
                     /EC_number="2.1.1.63"
                     /locus_tag="MMKA1_00720"
                     /product="putative methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="BAP60189.1"
                     /transl_table=11
                     /translation="MKTFNEQCYDLIMQIPKGKVTTYKIIAEALNTKAYRAVGNAMKN
                     NPKILTVPCHRVVNSNGYVGGYVNGVEKKIEILKNEGVVISGGKITDLKKYLFVF"
     CDS             76188..77126
                     /codon_start=1
                     /locus_tag="MMKA1_00730"
                     /product="hypothetical protein"
                     /protein_id="BAP60190.1"
                     /transl_table=11
                     /translation="MVFGIFKKKKKAVEDYLNDKNVLELTLNESKDCILDFTYNFIWQ
                     SNFDIKGDVSGGISYEKLVNHIKNPENVVYIKGDVGHRFCSSMGADLKYFGGSGGKIQ
                     TGTVIVDGNIDTRFGISMVSGTVYLNEKFSLKEPIGNIIEVESDISGYKKYISITELI
                     ESKSDEKVLKPNIFKNNELILNDNVIRDTIGARLENGSKITVNGNVDLSTGILMKNGT
                     VLVNGNAGKNTGSVLRGGTVIINGNTGDFTASDMISGTIIIDGNAGKFLGSKKKNGVI
                     YAKDGSAIPPLKKQSLNSKDKELLSKNGFFGEFVKF"
     tRNA            complement(77171..77244)
                     /locus_tag="MMKA1_t0020"
                     /product="tRNA-Thr"
     tRNA            77504..77579
                     /locus_tag="MMKA1_t0030"
                     /product="tRNA-Gln"
     CDS             complement(77647..78720)
                     /codon_start=1
                     /EC_number="2.7.7.-"
                     /gene="priA"
                     /locus_tag="MMKA1_00740"
                     /product="DNA primase small subunit"
                     /protein_id="BAP60191.1"
                     /transl_table=11
                     /translation="MNDNPATDKVFKEVSSLYKQYFEYAILVRKWLEIPDDLSHREIG
                     YGMLKKVDNRNMSFNTERDYLAWVLKESPFHLYKSLSYMEYPDIVGGAAKKGLFKREV
                     AFDIDTHKTEKCTHDDSWICEECLGEARNQVLILIEDFLFPDFGLDEKDLKIVFTGNR
                     GYHIYLKPEDPELLKRIEKWGKNERRYFIEYILGKNLNLRNMGSRWKNILVREFNKNK
                     IATKKFEKTSDWKTEIDNRKDTTRRTVYETIDKVKSRLELDEKVMDDDIRLLRTIGSL
                     HGYTGLMVKEITYNSLKHNQFDPLNHGVFSKFHKKMYNVKIKQELDPLTLKGDTFDHN
                     STEIPASYLLFLFGHGIDFEILE"
     CDS             78835..79815
                     /codon_start=1
                     /locus_tag="MMKA1_00750"
                     /product="hypothetical protein"
                     /protein_id="BAP60192.1"
                     /transl_table=11
                     /translation="MILGIDIGGANTKITELHENGEFKVHHLYFPMWKNNDKLAEVLK
                     TYSKDVSHVALVTTAELADSYETKKEGVDNILNAAESAFGSNISVFDSDGNFISLESA
                     KTNYMKVSASNWCGTAKWVSKNIEENCILVDMGSTTTDIIPIVDGNVVAEKTDLERLM
                     NHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTP
                     DGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKTYYELWKELILENVKKVAEKYGS
                     KKVVITGLGENILKDALGDFEVISVAERYGKDVSLATPSFAVAELLKNEL"
     CDS             79948..81141
                     /codon_start=1
                     /EC_number="6.3.4.5"
                     /gene="argG"
                     /locus_tag="MMKA1_00760"
                     /product="argininosuccinate synthase"
                     /protein_id="BAP60193.1"
                     /transl_table=11
                     /translation="MQEKIAVLAYSGGLDTSCCLKLLEDKYDYKVISVAVDVGQPEDD
                     LKEPEEKAKKFGVLKHYTIDAKEEFAKDYIFRAIKANALYEGYPLSTALARPLIAIKI
                     AELAQEVGASAISHGCTGKGNDQFRFESVMRAKTPEIEIVAPIRDLNLTRTEEIAYAK
                     EKGIPVPVDLEKPFSIDENLWGRSIEGGILEDPMTETPKECFAWTVDPTDAQDKEEYV
                     EIDFEEGVPVAINGDALEAVSLIRKANEIAGRNGVGRVDIVEDRVLGLKSRENYECPG
                     AMLLITAHKALEQLVLTREELVFKEMVDSKYADLVYKGLWHEPLRLDLDAFIDKTQTR
                     MNGKVVLKLYKGSMRIAGRESKDAIYNEEMVSFENKEMDQREIVGMVKFHGLQAAIYE
                     GLTRK"
     CDS             81211..81567
                     /codon_start=1
                     /locus_tag="MMKA1_00770"
                     /product="hypothetical protein"
                     /protein_id="BAP60194.1"
                     /transl_table=11
                     /translation="MNIFTSKGTIKYEKEKIIKLSSEMFPDDLCEQCGRCCIIHVFNS
                     TECGEPEVVYCNHLDTETKRCKIYKNRFKKEKKCLSMLEAIMVSALPKDCPYVKNYES
                     YEEPWFYDCLRSKSKD"
     CDS             complement(81556..82524)
                     /codon_start=1
                     /locus_tag="MMKA1_00780"
                     /product="hypothetical protein"
                     /protein_id="BAP60195.1"
                     /transl_table=11
                     /translation="MIESLIRFFYFFISLVIYWINLIRAFNLELIEKRTLDIIFVFNL
                     SALFFSIYFMSDVNYVFGLSVYAASFLSVLLIRNQGFFKKFTKLLKMDLSFDNSIHKI
                     SVSLSTYILLNPIIAFASGAGLIIILSDFLEILDIAAFQLIILAYAFVGIGFGTRKNL
                     KQSIERLDIKIPSLKYAIFGVILLLMVDKFIWGLFDFFIYVFQSMDPAISEHIAEQAV
                     VENSNVNEVVKTIKTSASTPLKIVFLSIVVGISEELMFRGALQPRFGNIYTSLLFASL
                     HAQYLSSMVLLDVFIISYILGMIKERKSTSTTILIHIFYDILSLIF"
     CDS             complement(82594..82803)
                     /codon_start=1
                     /locus_tag="MMKA1_00790"
                     /product="hypothetical protein"
                     /protein_id="BAP60196.1"
                     /transl_table=11
                     /translation="MAFGKPAMKNVPVEAGKEYEVTIEDMGKGGDGIARIDGFVVFVP
                     NAEKGSVINVKVTAVKEKFAFAERV"
     CDS             82950..83678
                     /codon_start=1
                     /locus_tag="MMKA1_00800"
                     /product="hypothetical protein"
                     /protein_id="BAP60197.1"
                     /transl_table=11
                     /translation="MIREVFSSIMGEGKFIGKRFIFVRFKECPLDCIYCDEPNTPGGT
                     ARVEEISGSGEFMEYLEIEHELIEIIEKLRTPDLFAVSFTGGEPLVYSNKIKEYSEIL
                     KHKGYKTFLESNGMFPERLGSYDYASIDIKLPEHFENKDDDFWYGLYKKELETIERLY
                     LAGTDVYAKIVVFEETSEELIERIAIDLSKIGNITLCIQPVSPTDKIKTTTSKKKIFE
                     LMAICGKYVDVMCTPQIHKWMGML"
     CDS             complement(83694..84539)
                     /codon_start=1
                     /locus_tag="MMKA1_00810"
                     /product="putative sulfite reductase, iron-sulfur binding
                     protein"
                     /protein_id="BAP60198.1"
                     /transl_table=11
                     /translation="MNKNEIANLKMQGFILQNDGKHFALRIKTDAGCMDSEKIDKLSE
                     ISKKYGRNYISFTVRLCVEIPWINYEDIPKIKEELKNSSLISGGTGNTVRPLVACKGT
                     VCTHGLIDSQKICNELDSLFFGKKLPHKFKIGISGCPNNCAKAQLNDVGIIGQRIPKI
                     NEENCNGCTLCLKSCSVDAITIVDKKAVVNYEKCVNCGKCGESCKRKCISLKDGVLIS
                     VGGKFGKKYKIGENIGIYDAPNLEKIVSEIMDYFKENADSHERFGDTIDRTGISSLKE
                     KLKDY"
     CDS             84734..85351
                     /codon_start=1
                     /EC_number="2.4.2.-"
                     /locus_tag="MMKA1_00820"
                     /product="putative phosphoribosyltransferase"
                     /protein_id="BAP60199.1"
                     /transl_table=11
                     /translation="MKKELILKALKLRDMGFPSGDIAEELNISVKTALYLTLNGEELL
                     KAEECPKEDSEKLDIFLEWDNVRASSRRLRNISKIICDMLSDVEFDGVVGISSGGVPL
                     ATLISDELDKNFSIYVPKKHIHTEKEKTTGFIGQNMSSIVGKDVIIVDDVMTSGNSVK
                     ETIKYLKGIANPKKVFVVMDKSGIDEIEGVSIEHLFRTGVVDIKK"
     CDS             85498..86589
                     /codon_start=1
                     /EC_number="1.4.1.13"
                     /locus_tag="MMKA1_00830"
                     /product="glutamate synthase large subunit domain 1"
                     /protein_id="BAP60200.1"
                     /transl_table=11
                     /translation="MCGIIGFMSRTGRLISGDRIATALNCLKERGNGEGSGYVGYGIY
                     PDYKDDYAIHVFLDATKDYDKIRHEVEEVLVKYGYILKDEEIPTEEGIIKKEQVSWRF
                     FYRFDEKYKSVEEDMMVDIVMDINAKIDGAFVFSSGKNMGVFKAAAWPLEVAEYFKID
                     QYKGFQWLSHARYPTNTKGWWGGAHPFNLLGWSVVHNGEITSYGANKRYVESFGYKCK
                     LLTDTEVVAYLFDLLIRKHKIPVEYAMSALAPRFWDEIESMSEEDKKIHEAIRMTYGG
                     ATMNGPFGIVVGTQEGMAFMNGEVEEGNTMVGLTDRIKLRPLVAAEKDDLLFVSSEES
                     AIRKICPELDRVWMPDAGRMVIAKLEKKI"
     CDS             86617..88149
                     /codon_start=1
                     /EC_number="1.4.1.13"
                     /locus_tag="MMKA1_00840"
                     /product="glutamate synthase large subunit domain 2"
                     /protein_id="BAP60201.1"
                     /transl_table=11
                     /translation="MIPSTVPPKYKVFVDPERCMLCERCTTECSWGVYRRQGNKILTY
                     PNRCGACLRCVSLCPRDAITVTLNQSCGREHPVWTPEVKQDVVTQAKSGCILLSGMGN
                     AKEYPIYFDKIVLDACQVTNPSIDPLREPMELRTYVGKKPEKLEFDYVEDEIDGKKVK
                     KAKLKTKIAPNLKLDTPIMIGHMSYGALSLNAHKAMAKAVKECGTFMGTGEGGLHRDL
                     YGYSDNVITQVASGRFGVNSEYLNKGAAIEIKIGQGAKPGIGGHLPGEKVSAEVSMTR
                     MIPQGSDAISPAPHHDIYSIEDLAQLIRSLKEATRWKMPVFVKISAVHNVSAIANGIA
                     TSDADAVVIDGFKGGTGAAPKVFRDNVGIPIEVAIAAVDDRLREQGNRHKISIIASGG
                     IRNSADVFKSIALGADAVYIGTAAMVAMGCTVCGRCYTGQCAWGIATQKPELVKRLEV
                     DDAARRVANLIHAWTHEIQELLGAAGINSIESLRGNRDRLRGVGLSEIELNTLGIKQA
                     GM"
     CDS             88149..88940
                     /codon_start=1
                     /EC_number="1.4.1.13"
                     /locus_tag="MMKA1_00850"
                     /product="glutamate synthase large subunit domain 3"
                     /protein_id="BAP60202.1"
                     /transl_table=11
                     /translation="MASLGERMKELKIDAKDMDYRELNEKIHEVLDENKDLEKLVLEN
                     VLGQRFIGNGVSRKDLTIIVNGVPGGDLGMFMKGPKVVVNGNADHAPGNTMDEGFVVI
                     HGSSGDVTGHSMRGGKVYVQGNVGYRSGIHMKEYKYKFPVLVIGGAAKDFLGEYMAGG
                     IILNLNMDQEDGENIEGRMIATGIHGGVIYVRGIVKSSQLGIAADIKEFTEEDRDKIR
                     PHIEEFCKEFGLSDEIKEKLINSDYTKIAPISKRPFGKLYTPDLR"
     CDS             89388..90470
                     /codon_start=1
                     /locus_tag="MMKA1_00860"
                     /product="coenzyme F420 hydrogenase/dehydrogenase beta
                     subunit"
                     /protein_id="BAP60203.1"
                     /transl_table=11
                     /translation="MKSYLNLKEEVWDKNICSGCGACVAVCPTENIYFKEQSPVKFVC
                     DECACIIAPTQNGEHPISAEFCKVTLYDVPCGACYDACPRTSEGKLSQIENGLDNIIK
                     AVKAKSKLNTKGVQSGGAVTAILANAFDEGIIDGALVMMEDKWTMKPESYLATSKEDV
                     LKSAGSRYNWNAPILEALKEAVMDKKLNKLAIVGTPCVINAVYQMMSSDNDLVIPFRN
                     AIRFKISLFCFETFDYSKMTEKLKSINVDPWEVRKMDIDKGKLIVELLDGTIHSFRLN
                     EVEDVVRSGCNVCTDFTGITADISVGNVGSPEGYSTVLIRNKWGKGLFDRAVINGYLE
                     AEEGVDIKPIESLAEKKARRKDGSEI"
     CDS             complement(90500..91315)
                     /codon_start=1
                     /locus_tag="MMKA1_00870"
                     /product="putative sulfite reductase iron-sulfur binding
                     protein"
                     /protein_id="BAP60204.1"
                     /transl_table=11
                     /translation="MACRNNYKMGVIPKKDGLMVRLSLKPGYLSCEQLIAIGKIAKKY
                     GFGKVHLTTRQGLEFKIKYENLEKVEELLEKEGIKIGSTGTRIRQIVCCIGSECYSSI
                     GDSVSLARKLHDEFEGIWVPKKLKINVSGCPNNCTHHQFCDIGIYFRYILEINKEKCI
                     ECGKCENFCEINAIDWKNKAIKENCIGKGDCLKLCDAINVVDKAISINIGGKGGKFPK
                     AAKHLIDVKTEDEVLEVVDILIEMYSKFGKGRIYDFIKELGIDYVKQKVQAQL"
     CDS             91449..93305
                     /codon_start=1
                     /gene="fsr"
                     /locus_tag="MMKA1_00880"
                     /product="coenzyme F420-dependent sulfite reductase"
                     /protein_id="BAP60205.1"
                     /transl_table=11
                     /translation="MYEWKLNDIVDNGICAKCGTCTVVCPNGILTFEDRPKLTEECLR
                     KGNGMCFEVCPRVSSGKYQIKIREKFKEEYYYGKGDVEGQDGGVVTTFLKYLLKNKKI
                     DGAIVVGDECWKPVSLIVQNEEDLMNTTKSKYTVSTLEALKTAGEMGLEKVAVVGLPC
                     QINGLRKLQYFQYLAKHDGELGKNGKPVKLPKIEYLIGLLCTEKFEYDELKETLAKYN
                     INMDDVEKFDIKKGKLLVYVNGEEHKIPLKEIELSAGCKMCRDFDAEMADVSVGCVGS
                     PDGYSTVIIRTEKGEEIKNAIELKEGVNLEAIEKLRDLKLNRFKKEVERRKAEDEKVS
                     FYWTADYGGVGKRADGTYFIRIRAKPAGWYSIDEAREILEIAEKYDGKIKMTNRGAFE
                     IHGISGFDVEAMVLELMEKGFITGSEGPLVRATLACPGEGNCGSGLINTTELCKILED
                     NFKEHPAPYKFKIAISGCPNKCVRPQIHDIGIAGVKFPVVNEENCNGCGRCAEVCKIE
                     AIDIRGETSYTNYNVCIGCGKCIKACPNEGRDVKEEGFMVYVGGKTGREVIEGVSMKL
                     MSVEEILNLIDKVLIVYHKYAKKPQRERLAAVMARIGKGKFLEEVKELMEQN"
     CDS             complement(93333..93680)
                     /codon_start=1
                     /locus_tag="MMKA1_00890"
                     /product="putative transcriptional regulator TrmB"
                     /protein_id="BAP60206.1"
                     /transl_table=11
                     /translation="MNNLIVARMQKFTIEDLMRCILGLQEIEIRIYFELLNLEEAPVN
                     EIAKKIGRDRTTVQKGLRSLINCGLVEREKVTETFGYKYIYRPVEFEKVKDIMEKLLD
                     DWYMGVKEWLKKQ"
     CDS             complement(93746..94792)
                     /codon_start=1
                     /gene="pelA"
                     /locus_tag="MMKA1_00900"
                     /product="putative translation factor pelota"
                     /protein_id="BAP60207.1"
                     /transl_table=11
                     /translation="MKIIQEIPERNIIKLIPENLDDLWHLSHIIQPYNAIYAVTERRT
                     EDKGDKLRADRGAKKKVFLGIKVEKVNFHEDTNRLRVSGKIIHAPDDIPIGSYHTIDI
                     EPFTDVSIQKNWKKWDLERLKDAENSSKKPKVVVVIMDDSEADIFLVREYGIKELVSI
                     KSGVSKKLDYKQNEQAKLNYYHEIVNAISEFEGKILVAGPGFGKNNFQKYLSEKHRDL
                     VPRVVVESTNHTGRLGLSEILKSGIIDRIYGEARVSKETQLVNKLLEEISKKGLASYG
                     IEDVKNAMNYSAIETLLVTDEFIRKNRRAVEDLMNSVENIGGKVVIISTEHDAGKQLK
                     ALGGVGALLRFPIE"
     CDS             complement(94792..95256)
                     /codon_start=1
                     /locus_tag="MMKA1_00910"
                     /product="putative transcriptional regulator"
                     /protein_id="BAP60208.1"
                     /transl_table=11
                     /translation="MKSGTMESFLTEIQINVLNLRKRGHTQDEIANIMGTSRANISMI
                     EKRARENIEKARNTLSIYNDIIAPSKIKIDKGTDVFSIPKIIFSKSDQEEIHVNYSSL
                     QIMEFVNQNAQRYIKNRMVVEPFVVTILQNGDIFVHDYEESEENEKMPKKEI"
     CDS             complement(95376..96602)
                     /codon_start=1
                     /EC_number="1.1.1.34"
                     /gene="hmgA"
                     /locus_tag="MMKA1_00920"
                     /note="protein synonym:HMG-CoA reductase"
                     /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
                     /protein_id="BAP60209.1"
                     /transl_table=11
                     /translation="MENNINIDEIVEKLLKKEIKVYQLDSKFGERNAVIARRKYVEKL
                     SNVETRHIQEYTLDEKLAMQKNIENMIGAVQIPLGFAGPISINGKYAQGEFNVPLATT
                     EGALVASINRGCSVITKCGGATVRVIDDKMTRAPIIKTNSVVDALKLKEWILDNFAKI
                     KEIAESTTRHGKLIQISPILIVGRNVYPRFTFKTGDAMGMNMVTIATEKACSFIESEL
                     KKEGIIIDTVALSGNVCVDKKPAAINLIEGRGKSVVAEVFLKEEYVEKYLKTTSKAIE
                     QVNTYKNLIGSAISSSLGFNAQYANIVGALFLATGQDEAHIVEGSMGITTAECTGDGL
                     YFSVTLPDLPVATIGGGTRVETQRECLEILGCAGAEKAVKFAEIAGAAVLAGELSLIG
                     ALAAGHLAKAHSELGR"
     CDS             complement(96592..97740)
                     /codon_start=1
                     /EC_number="1.2.1.70"
                     /gene="hemA"
                     /locus_tag="MMKA1_00930"
                     /product="glutamyl-tRNA reductase"
                     /protein_id="BAP60210.1"
                     /transl_table=11
                     /translation="MLVVRADYKKYPIPVLEKMRIDEDEFYKKYDACVVVQTCNRIEA
                     YFDTEVNSDVDCILSDFSGFDILKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQ
                     KARELKKTSRYLDSVFLKAIHVGQRARTETKINEGSVSIGSAAVELAEKNFGLANKNV
                     LLIGAGEIGTLVAKALMEKHIKAVIVANRTYERAETLAKELKGMAVHFDKLKEAINFI
                     DVIICATSSPHYILKKEDLIDVGNKIIIDIANPRDVDDAVREFENIKLYTIDDLRNIS
                     DKNLQKRIEEVPAVEKIIDEEYDVLMKQIEKINVEEVLKDFNNYIEEIRVKELEKAIK
                     LSKTKNPEEIMENFSKAFAKRITHDFVSYSLNTSKEDLMNSAWWKNGK"
     CDS             complement(97745..98350)
                     /codon_start=1
                     /locus_tag="MMKA1_00940"
                     /product="hypothetical protein"
                     /protein_id="BAP60211.1"
                     /transl_table=11
                     /translation="MIPVFLDLGGFNVLIFGFGSVGKRRFEKFLESRAKLTVYSKSID
                     KNDISKYKNAIFFESDVTNLSDEELYSIIKNHDIIITAIDEKNNKRIVSVAKSLKKFI
                     NSSTFEKESNLIVPACCEVDGVSFAVYTGGKSPIIAREIRKNVEEYLKNSEFELDFQN
                     KLRDFLKSEIEDQNERKKVLETVFSDEKFKKELLKLIEKHR"
     CDS             complement(98366..99433)
                     /codon_start=1
                     /locus_tag="MMKA1_00950"
                     /product="glycosyl transferase"
                     /protein_id="BAP60212.1"
                     /transl_table=11
                     /translation="MKILLPSIYYPFIGGVSIHVENLIKNLNKLDDFEFHILNYNFDE
                     SVENSFENVTIHKVPYFSKLRGPSYILNGYKLGKKIIKDEKIDLIHSHYAAPQGFLGA
                     ILGKKCSIPTVLTLHGSDVLNLSKSSLGKYFFNYAVYNSEKIICVSEFLKNNLKSNFN
                     IDSNVIYNGFDEELFNPSDSDKNYGLFVGSLVEQKGIFYFLESIKNIDFNFKIIGGGP
                     LYNKILDFIKVNDIKNVELLGPKTQSEVSEYLKNCSFLVLPSISEGLGMTIIEAFACK
                     KAVIGTSVGGIPELIKDGINGYIVPPKNTKALEDKINMLVNDKMLRKSLGEKSLDTSK
                     NFSWGLSSKKTYEIYNSLLNR"
     CDS             complement(99454..100038)
                     /codon_start=1
                     /locus_tag="MMKA1_00960"
                     /product="hypothetical protein"
                     /protein_id="BAP60213.1"
                     /transl_table=11
                     /translation="MREGHEQNKREFEDYAYVLDFLEYGYPEDTRPLHQKKPIAQAFG
                     EKQFVMMELTFKDNQVADLAEKLYIGKGKREKVEFVSKMLKYDQLTPTAKTELLHVIK
                     EAVKAQEERFVEFLNNCGPITNRMHTLQLLPGIGKTSMWKVIEEREIKKFESFKDFED
                     RVRKNIVDPLAKRIEEELKEPQKHYVLVKWKTTH"
     CDS             complement(100139..100462)
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoF"
                     /locus_tag="MMKA1_00970"
                     /product="DNA-directed RNA polymerase subunit F"
                     /protein_id="BAP60214.1"
                     /transl_table=11
                     /translation="MIGKEIISEKYTTIAHATEIMDERADFDELSYEHGCSLDYLRKF
                     STISKDDADAMFEQLVNLGLTEKMAVKIIDLLPETEEDLKIIFYRVDVPENKDEILEV
                     VSKFK"
     CDS             complement(100511..100804)
                     /codon_start=1
                     /gene="rpl21e"
                     /locus_tag="MMKA1_00980"
                     /product="50S ribosomal protein L21e"
                     /protein_id="BAP60215.1"
                     /transl_table=11
                     /translation="MQKSEGFRSKTRYKLQKHPRQKGMAPLTRALKCYTEGDLVHVVL
                     DPSVQKGMPHPKFHGKTGVVVAQRGSSFLVRVKDGGKYKDIIARPQHLRESKL"
     CDS             complement(100890..102302)
                     /codon_start=1
                     /locus_tag="MMKA1_00990"
                     /product="hypothetical protein"
                     /protein_id="BAP60216.1"
                     /transl_table=11
                     /translation="MNIDYSVLKKYPLCDRCFGRLYGKLIRSSNFERGHALKLAKAIE
                     LEENLRLALEEMKEASENPELKPVDPEKLEEIKELMYCLYKTGISGIKLDLIEDIEKY
                     ETKFKNEAEYEKNEECDELCPWCKGIFEPENIEKVAENVVNALSEYEFDSFLIGTKLP
                     KRFKELEKEIETPFIESIRQEFGRELGKVVVPLVKRRVDKENPDIVVMVNPYNQKVTL
                     QVNPVFIKGRYKKLVRGIPQSHWHCRSCKGKGCEKCNFTGKQYMTSVEEIIAEPFMEV
                     MKGSSEALHGAGREDIDVRMLGNGRPFVIEIKEPKIRKVNLEELASKVNESGNVEIIN
                     VEYGVKKDVHFFKNEPHKKTYLAHVECEEKVSNEEVAELVKKLEDLTIDQRTPDRVSH
                     RRADLVRVRKVYKAWPHMIDDYNFELKIFCDGGLYIKELINSDEGRTTPSVSELLNKK
                     CICKFLDVLDVHDYEDAENI"
     CDS             102324..103505
                     /codon_start=1
                     /locus_tag="MMKA1_01000"
                     /product="hypothetical protein"
                     /protein_id="BAP60217.1"
                     /transl_table=11
                     /translation="MIINADLHIHSKYSMGTSKYMDIEHILKYGPVKGLDLIATGDCL
                     HAKWLEEIEKNVNKPLLLSTEVEDRNRVHHLIYLPHTSQAHDLRDKFSKYSKNIDADG
                     RPRVSLNGMEIIDAVRDIGGLIGPAHAFTPWTSIYKSFTSIYNCYARKPDFIELGLSA
                     DTDMADMVEELRDLPFLSNSDAHSFYSHRLGREFNQMDVDELGGPETNFEEVKKVLKH
                     NKITANYGLDPNLGKYHLTACTRCYTRFTLEDATENNFKCPECKGTIKRGVHDKTLEL
                     SKDKKVIHPDFRPKYHKIIPLAEIISLAIGKNIGTKSVDTIWEQYIEKYGNEIDVLIN
                     EDISELKKINEKVGHIIELFRTGKIYIYPGGGGEYGHISKVPVSVKWFKPKLTLDSWV
                     K"
     CDS             complement(103527..104714)
                     /codon_start=1
                     /locus_tag="MMKA1_01010"
                     /product="aminotransferase"
                     /protein_id="BAP60218.1"
                     /transl_table=11
                     /translation="MALSYSKRMENIKSSEIREILKVTQKPEIISFAGGLPAPELFPV
                     KEIKEISGIVLDEMGPESLQYDITEGYPPLRQQISERMNKVLKTELTENNILIVCGSQ
                     QGLDFSGKVFLDENDVVLCESPTYLGAINAFKSYEPQFKEVPTDDFGMIPEELEKILK
                     TTKNVKLIYAISDFQNPTGKTWTLERREKFMKIIEKYEIPVVEDNPYGELRFDGEILP
                     SLKSMDKKGLIIHLGTFSKTFCPGLRVGWIAASEDILEKYIFIKQSADLHTSSFSQRI
                     ISKMLENYDFDERVSRLKKLYKGRRDLMIKTIAEEFPEGLKYTNPEGGLFTWVELPEK
                     YNAREFLDECIKNNVAIVPGGSFFPNGGHENSFRLNYSNMPDEKIVEGIKRLSKVLKE
                     YLN"
     CDS             104839..105348
                     /codon_start=1
                     /locus_tag="MMKA1_01020"
                     /product="hypothetical protein"
                     /protein_id="BAP60219.1"
                     /transl_table=11
                     /translation="MKDLNKAISKNLKKIRKRKDLSLDALSNLTGVSKSMLGQIERGE
                     VNPTISTILKISNGLKVSFTSLLKNEKPEIDQIPFEELNPVFEGDGHKLYPVIPFEDD
                     KRFETYIVEIKPGHKYYSEGHVKGTEEIITVFEGELALSIGEIDYFLKKMIQSGLMPI
                     NRMFMKIGV"
     CDS             complement(105417..105614)
                     /codon_start=1
                     /locus_tag="MMKA1_01030"
                     /product="ferredoxin"
                     /protein_id="BAP60220.1"
                     /transl_table=11
                     /translation="MVYKVNEDECIACGACVPVCPVQAISENADGKAVIDCAKCNDCG
                     DCSDVCPVECIKQEKTCGCCQ"
     CDS             105757..106908
                     /codon_start=1
                     /locus_tag="MMKA1_01040"
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="BAP60221.1"
                     /transl_table=11
                     /translation="MKEEMKGIYVLWITIFVTMLGIGLISPLLAIFAKSYGLSNFQIG
                     LIFGSFALVRTIFQLPAGTLSDSYGKKVFLVGGTLLYGVTTLFYGFASGFASILIVRT
                     FTGVFSAFVNPVAGSYIAQTSPKSKLGEYMGLFNSAISLGFGVGPLLGGLLADMYGFM
                     VPFYVGGLLGIIASIIAYFKLEDTPKTQEKQKLSWKNLFSLEFLKMRNFSAAFIINIA
                     LTISRGAILAYLAIYAYDYGVSAFKIGVMLAAMNLVLAVTQKMFGRIFDEKGNRIILH
                     GIIIGNLGMFILAMSTSFTTMFISLIISSIGASMSTPGINSIAIRDIPDKRQGEAMGL
                     YTASINVGIFFGAVLLGYISDIVGISNMYKIGAVFSFLISYIAYIAIKK"
     CDS             complement(106928..108106)
                     /codon_start=1
                     /gene="napA"
                     /locus_tag="MMKA1_01050"
                     /product="Na+/H+ exchanger"
                     /protein_id="BAP60222.1"
                     /transl_table=11
                     /translation="MDISWVLFTIGIAIIFGKLGDHLMNKLGFPGVLGEMIMGMILGN
                     LVYFGLVSPDHLTIQNNEIFDFLSRLGIIFLLFLGGLDTDLSVLKKTGKIATVSTVFG
                     VLVPLVMGYLALQYMGYSAAESFAGGVVLTATSIGITVRVMMDMGVLKSEVGAASLSA
                     SIMDDFLGIMLIIFAVGTGSILGLLGKFAIFFIITGFLAMKLVNKFISFSEKLHVEKG
                     ILSLAIAVMFLFSFLAENWFEAAIEGSFMAGLVLSRTAEGKNLIEDVKTIGYSILIPL
                     FFVYTGASLNLTIFGDFDALYLALVLTAIAIVSKVVGRGFGARIMGWNMKKSLQMGIG
                     SIPRAEIALINLMVAIHAGVISESNVGKFIAATMIFITISIISTPPLLKWAFTEEVEN
                     "
     CDS             complement(108121..108606)
                     /codon_start=1
                     /locus_tag="MMKA1_01060"
                     /product="hypothetical protein"
                     /protein_id="BAP60223.1"
                     /transl_table=11
                     /translation="MENLENALGKYHNIKLKHVIPPVDMMPVVCYNDPIIKVMELLRS
                     RHHVWVINCKEEGSLLGVIKYLSVIDFLLPPDKHNLYIGSTRSALKSVIGGAKTAKEV
                     MEKNALTINHNSTVIDALLKMKRYNVQILAVLNDEERLIGEISLKILIDKFLSLCLAQ
                     E"
     CDS             108696..109334
                     /codon_start=1
                     /EC_number="2.1.1.77"
                     /gene="pcm"
                     /locus_tag="MMKA1_01070"
                     /note="protein synonym:L-isoaspartyl protein carboxyl
                     methyltransferase"
                     /note="protein synonym:protein L-isoaspartyl
                     methyltransferase"
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="BAP60224.1"
                     /transl_table=11
                     /translation="MPLNEIIPVIENLISRGYIKKQSVIDALLSVPRHKFISKSMERY
                     AYVDGPLEIGYGQTISAIHMVGIMCEELDLDEGQNVLEVGTGSGYHAAVVSEIVGESG
                     KVTTIERIPELFENSKKTLSELGYNNVEVVLGDGTKGYLENAPYDRIYVTASGPEVPK
                     ALFEQLNDGGILLAPVGAHFQTLMRYTKINGSISKEKLLEVAFVPLIGENGF"
     CDS             109453..110352
                     /codon_start=1
                     /locus_tag="MMKA1_01080"
                     /note="protein synonym:vitamin B6 biosynthesis protein"
                     /product="pyridoxine biosynthesis protein"
                     /protein_id="BAP60225.1"
                     /transl_table=11
                     /translation="MKKLGTDLLKRGFAKMVKHGVVMDVTNVEQALIAEEAGATAVMA
                     LERVPADIRVQGGVARMSDPEMILEIKDAVSIPVMAKARIGHYVEAQVLESIGVDMVD
                     ESEVLTPADEVNHIDKRAFTAPFVCGARNLGEALRRIDEGAAMIRTKGEAGTGNVVEA
                     VKHMRAVNEGIARVIGYKEMGLEAELIQMARNELKVPMELISEVAELKRLPVVNFAAG
                     GIATPADAALMMQMGCDGVFVGSGIFKSGNPAVRAKAIVEATYNFDKPEVIAEVSKNL
                     GEAMVGINIDEIPEEMLLAKRGI"
     tRNA            110510..110583
                     /locus_tag="MMKA1_t0040"
                     /product="tRNA-Thr"
     tRNA            110630..110706
                     /locus_tag="MMKA1_t0050"
                     /product="tRNA-Pro"
     tRNA            110715..110788
                     /locus_tag="MMKA1_t0060"
                     /product="tRNA-Tyr"
     tRNA            110803..110876
                     /locus_tag="MMKA1_t0070"
                     /product="tRNA-Lys"
     rRNA            110917..111031
                     /gene="rrnC5S"
                     /locus_tag="MMKA1_r0070"
                     /product="5S ribosomal RNA"
     tRNA            111048..111122
                     /locus_tag="MMKA1_t0080"
                     /product="tRNA-Asp"
     tRNA            111156..111229
                     /locus_tag="MMKA1_t0090"
                     /product="tRNA-Lys"
     tRNA            111250..111324
                     /locus_tag="MMKA1_t0100"
                     /product="tRNA-Asp"
     CDS             111377..111994
                     /codon_start=1
                     /locus_tag="MMKA1_01090"
                     /product="ferredoxin"
                     /protein_id="BAP60226.1"
                     /transl_table=11
                     /translation="MSHEGEEFNKIFSKGKFLKNIFFNLFRSYKNPEIIGKTTNPELD
                     DCICCGLCVDVCPTNAISVFKFRDIICEHCGACLNVCPVDAIEKNRFSVDPEKCIKCG
                     VCSIFCTIPILKNEIPVLNVPEVTTECNNCKLCIQKCPQKAIYFEDGKISISSKCNLC
                     LKCVEFCPLNALKSPKESLKSKIIKVDLNSCIFCKDCEEICPVKK"
     CDS             112084..112644
                     /codon_start=1
                     /locus_tag="MMKA1_01100"
                     /product="hypothetical protein"
                     /protein_id="BAP60227.1"
                     /transl_table=11
                     /translation="MKYGMLFSGILMFSIGLNVFGTYLESIYLFPLYLDSIGTIFSAI
                     ILGPHIGALVGLITNLITGCLLSVENFLFSVVNVLIGLTTGIMLYKNQINIKNIFFAA
                     IAVSIVSSIMGNLLSIYFFGGITEGGVGHITQTLTAFGESIPTAAFAAGLYTNFADKI
                     ISFTAAFFMIYVLQDKLSIYDLKLGN"
     CDS             112833..113306
                     /codon_start=1
                     /locus_tag="MMKA1_01110"
                     /product="hypothetical protein"
                     /protein_id="BAP60228.1"
                     /transl_table=11
                     /translation="MPIFLDSIGTVLSGFLLGPVGGALVGFFTNVLLGFILDPSYIPF
                     SIVNIVIGLFSGYVAVKHGITLKNSIIVGLVLAIIAPMVGTPIAVYLYGGLVGGGVDL
                     LTAVFLHSGQDIFSSAFLARIPANLVDKLLSCILVYYIIKPFPKDILSELGVKVN"
     CDS             113316..113840
                     /codon_start=1
                     /locus_tag="MMKA1_01120"
                     /product="hypothetical protein"
                     /protein_id="BAP60229.1"
                     /transl_table=11
                     /translation="MKYLKIKIYLIFTLFLLVLVIFNPFYGILASIVVVLLTKRFEVF
                     SKRWILFSLYLVVFYYFIMGQDGLNNAYRLLAYIFTVQWFINSVSIEKLVEFISSYNR
                     DLGIGIWMTFSTLEVAKKEFETTKNAQLSRGLNKKGLINKYRSYYAIISPLIVKLYIS
                     AINRARSLLSKCYD"
     CDS             113980..115011
                     /codon_start=1
                     /gene="afuA"
                     /locus_tag="MMKA1_01130"
                     /product="iron(III) ABC transporter periplasmic-binding
                     protein"
                     /protein_id="BAP60230.1"
                     /transl_table=11
                     /translation="MKNLKGILAIFCVMAVLVFAGCTEQQASNVSQEEQIVTVYVAYG
                     SLDLIADEFEKDTGIKMEYVSLSSGEALSRLKAEQSNPSADVWLGGGIDAFISAQQDG
                     LLEAYKSPNAKDIDPLFVEEDGYWTGVSLVTIGILENTDLLSEKGLPQPQTWDDLITD
                     DYKGELIASNPTVSGTAYFTICGILQMYGEDEGWNYLDKFYQNTPFLTKRGSGPGNLV
                     TAGEYAYGVAPDPHTTLIADSELPVKSVFLNKVIWWPSPVSIVSGAKHPENAKIFVDW
                     CLSKEGQEVLMQASPRVPVRGDIEVIEGVPNPKDLDFLDMDFMYWGENRDRILDEWES
                     RYREISTTE"
     CDS             115044..116681
                     /codon_start=1
                     /gene="afuB"
                     /gene_synonym="fbpB"
                     /locus_tag="MMKA1_01140"
                     /product="iron(III) ABC transporter permease protein"
                     /protein_id="BAP60231.1"
                     /transl_table=11
                     /translation="MKEVFNNEILKKIYPKILENGFYILANVFLLIFIMYPVFTVFLQ
                     SFYGSNGFTLDAYSKFISDSYYFGILKNSIVVACFSTIISIFLGFIFSIIIFKTDFKF
                     KNFFKIAVFLPIITPGFISSLAYVFLFGRHGAVTYGLLGLEPNIYGWKSVVIMQSIDY
                     TTTAFFIISAVLLGISGEFEDAARNLGSNEFQVFKKVTFPLLIPGILSAGLLIFMQSM
                     ADFGTPIIVGGNFNTLATASYFEIIGRYNTQMASTLSVILLFPSMALFYLYSKYHKGY
                     ELKKSKLTKYSLSNIQKVILGLPAVFFSIIAYLLFFAVFVASFTKSFGHNYALTLDYF
                     YEAISAGQLAIKNTLIYALSSSILVAFLGVAYSYIVYRGKFFGRKLMDLVITLPFAIP
                     GTFMGLGYLLAFNNYPLLLTGTSSIIILNCMVRKLPFSFKTGNSVLSQVEESVEEASL
                     NLGASRLKTFYNVVLPLLKPAIIFSMIYTFIATIKSLGSIIFLMTANTKVLSAMVFES
                     TINRQLGVGACYSMFMVILSIIGILGILRLKGDKKWI"
     CDS             116672..117640
                     /codon_start=1
                     /gene="afuC"
                     /gene_synonym="fbpC"
                     /locus_tag="MMKA1_01150"
                     /product="iron(III) ABC transporter ATP-binding protein"
                     /protein_id="BAP60232.1"
                     /transl_table=11
                     /translation="MDLRLENISKNFEEHGVLTDIDFECGEELVSLVGSSGCGKTTCL
                     RIIAGFEKPDAGKIFLNGEDITNVPPNKRNIGLVFQNYALFPHLNVFENIAYGLRLKK
                     FSKLDISKKVKNSIDLVNLGGYEKYPISELSGGMQQRVAIARAIVIEPKAMLLDEPLS
                     NLDAKLRIKMRKELKELQRNFEIPTIYVTHDQEEALAISDKVAVMNKGKIEQFGDPYS
                     IYSNPKTEFVAKFIGIINELPSSILNKLGIESGDKKYFVRPESIEIGKGNFKGKLVDY
                     EFLGSIVRYVIKYGDSLFTIQSNKLVDFKLGTEILFEFDKNSIISI"
     CDS             complement(117644..118183)
                     /codon_start=1
                     /locus_tag="MMKA1_01160"
                     /product="hypothetical protein"
                     /protein_id="BAP60233.1"
                     /transl_table=11
                     /translation="MPNLYSHLVLSKIFLEKERLNVNENFDMNNFYFGACVPDIGYFS
                     GIERKITHFYESDPEDLFENRTFFEKSFLKGYKLHIHLDNIWKYEIRLKNNISIEKNA
                     EIYNYFDSFLENRFDVKIDSFKSYIFKGECKFLKKLNIEENTCKNWKKTAFYTVSDFQ
                     LNEKYQKIIDSYLKILKIS"
     CDS             complement(118191..119471)
                     /codon_start=1
                     /EC_number="5.4.2.1"
                     /gene="apgM"
                     /locus_tag="MMKA1_01170"
                     /note="protein synonym:2,3-bisphosphoglycerate-
                     independent phosphoglycerate mutase"
                     /product="phosphoglycerate mutase"
                     /protein_id="BAP60234.1"
                     /transl_table=11
                     /translation="MRTLLLLLDGLGDRPSEVLKDKTPLEYAKTPNLDAFAKKSVTGM
                     MTPYKKGVPLGTEVAHFLLWGYKLSEFPGRGVIEALGEDIKLKDNSIYLRATFGYVKR
                     NNGFFVKDRRTKNISIEEIKQLINSLPKKIGDYEFNLHYSFDTHCILEISSSNYEISD
                     KISDSDPFYRERHVLKVKPLKNISERIEIENAVKTAEVLNKYLLKCSEILENHPVNIK
                     RKEKNLQLANFLLTKWAGRYREIDSFHDKWGMNAAIIAKSSVFKGLSKLLKMDYYPEG
                     DFQKAFLKGIELKNYDFVHIHTKEPDEAGHTKNPINKVEVIEKIDKCLQKINELNDEL
                     IIVTADHSTPSVGTLIHSGEDVPLAIFKNGIIKDRVEYFNEKECSKGYINIKSKDLMN
                     LILNDTNKTRPYTTRIGNKLLNYIPENNSIEHLK"
     CDS             complement(119481..120290)
                     /codon_start=1
                     /locus_tag="MMKA1_01180"
                     /product="hypothetical protein"
                     /protein_id="BAP60235.1"
                     /transl_table=11
                     /translation="MDIEFKKSFKELTLSKDSLKIIEENGIDLKKIAVGEFSGRDSAA
                     AIIKAFEDEDIDAVLPVLTFTGTDYGEKEIFYRNWNVINKKIKETHENKFLLPLHFIF
                     EPKLWNALNGRFIAHTIQKYGYYTPCIGCHAYLRMIRIPLAKHLGKKIISGERILHDK
                     DFKIDQFKETLETYYKICDEFDVKLCLPVKDIEKGSEIKEIIGEPWEQGKNQYSCIFS
                     GNYRDLDGKVIFEREKIVKILNEFIYPSSIEILKNGYKNNFNYIETVKKFL"
     CDS             121151..121555
                     /codon_start=1
                     /locus_tag="MMKA1_01190"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60236.1"
                     /transl_table=11
                     /translation="MNAIFERRSIRHYTSEDVSEEIVDDLLKAAMSAPSACDQRPWDF
                     VVIRDKNTLSGISKINRHARMLNEAPVSIVACGNMDRVNGSCGQFWVQDCAAATENIL
                     IEAQDRGIGAVWLGFYPVDERVEKNEKSSACA"
     CDS             121512..121673
                     /codon_start=1
                     /locus_tag="MMKA1_01200"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60237.1"
                     /transl_table=11
                     /translation="MKESKKMRKVLHAPENVVPFSVVALGNPAEKPVPVEKFDRERIH
                     YEKWPTGYL"
     CDS             121806..122837
                     /codon_start=1
                     /EC_number="1.2.1.38"
                     /gene="argC"
                     /locus_tag="MMKA1_01210"
                     /note="protein synonym:N-acetyl-glutamate semialdehyde
                     dehydrogenase"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="BAP60238.1"
                     /transl_table=11
                     /translation="MKTVSIIGGTGYTGSELLRLLSNHDEVEVVNVTSRKEAGKNLTD
                     YHPQVRNLSNYNDLKFQNIAPEDIDSDIVFCATPHGASMAIVPTLHEKGINVIDLSGD
                     YRFEDIDMYESWYGLKHSGKIDSAVYGLPELHREKIKKSKTIANPGCYPTGAILSMAP
                     LVANDLVEDRIIFDSKSGVSGAGVEASQTTHFANVNENIGPYKITKHRHSPEIGKELQ
                     YLANKNLKVSFTPHLLPVTRGILTTAHSFLKEDISPIDVIEIYEEFYKDEFFIRIFEE
                     GMPSLTGVRGTNFCDIGGFEIDQYGRIVVVSAIDNLVKGASGQAIQNMNIIMGFDEKE
                     GLGVGGLKP"
     CDS             complement(122861..123529)
                     /codon_start=1
                     /locus_tag="MMKA1_01220"
                     /product="hypothetical protein"
                     /protein_id="BAP60239.1"
                     /transl_table=11
                     /translation="MLAALIPVSPLSNVKSRLKDFLSSGERIELIKNILLDTYETVKE
                     CADACYVVSKDEEILEFSKNLGIIPIREDSNVKGLNEAINFSLNFIKEESILITPADV
                     PLLKEVNLKAIISKSVKNSIVICPSRGGGTNLLLLNPKNCMKTQFEGFSFLKHIEEAE
                     KNDLKVIKCHSFYTSIDVNTVEDLGEIYIHGTDTKTYAYLKSLGVDVLPKHSSAGRFN
                     VIRK"
     CDS             complement(123576..124193)
                     /codon_start=1
                     /locus_tag="MMKA1_01230"
                     /product="beta-lactamase like-protein"
                     /protein_id="BAP60240.1"
                     /transl_table=11
                     /translation="MIYKLNGRGYDSNSYLIVDKKVILIDPGTPGTFEFLKKDILKYT
                     YKIDYIINTHCHFDHAGSDYLFQDEFNAPVLIHELELPHLAEDSNVTVSKLFGMDLVP
                     PKEIFTIKEADSDLKEIGIEIIHTPGHTAGGISIIYKDSLITGDTLFSYGVGRSDLPT
                     GSLIELRESINLLEKIAYKKGILKIYPGHGEAGDLSAFSNAMLFI"
     CDS             complement(124206..124913)
                     /codon_start=1
                     /EC_number="6.3.4.15"
                     /locus_tag="MMKA1_01240"
                     /product="biotin--protein ligase"
                     /protein_id="BAP60241.1"
                     /transl_table=11
                     /translation="MWLKLDFEIISHKNIDSTNTYAYNLGKLGKKNKIVVSETQNRGK
                     GRLDRSWFSKKGGIYFSVLIGIEDIGKLEKINFLGSLCVIETLKSFSDQKFEIKWPND
                     VLFENKKICGILTELNVSKGYLVLGIGLNINNEIDPEIKNIATSLKEIENVEFNVDLI
                     LKKFIDIFVKNLKIDDELLLESYKKCSKTLFNDVNLIMHEKTVTGKVVDISYDGIHID
                     TGKIVEVFNVGDCIHLR"
     CDS             complement(124913..125299)
                     /codon_start=1
                     /locus_tag="MMKA1_01250"
                     /product="hypothetical protein"
                     /protein_id="BAP60242.1"
                     /transl_table=11
                     /translation="MRIPAKKIPINEITSGEFVETEGQWESNYIVTKTSKQVSRVAIY
                     GIIVSKYTNTAKEFCSVTVEDLTGDIRVSGFKGMAKKLETFKKGDVILVVGRLRKDLK
                     ENIYVFPEIVREVEADEFFLNVFENY"
     CDS             complement(125312..125629)
                     /codon_start=1
                     /locus_tag="MMKA1_01260"
                     /product="hypothetical protein"
                     /protein_id="BAP60243.1"
                     /transl_table=11
                     /translation="MYNLQKIGEIDQSLIENKIAIIGTVIGLENDENYDKLEIEDASG
                     KIIISKDKSVKLTTGSRILAFGTLKITPKGLIIFSEAIVDISESSPKLLGKFMEKIKN
                     YEI"
     CDS             complement(125633..126541)
                     /codon_start=1
                     /locus_tag="MMKA1_01270"
                     /product="hypothetical protein"
                     /protein_id="BAP60244.1"
                     /transl_table=11
                     /translation="MLQKDPCLDDILENSEKLENNSNKKNIDSIDTIKLSDIIEKMIE
                     INSIVRIEKIFEEKIVSQNPVVNVVVNDGSARGLLSLWSEQISLLNELNEGDAILIEN
                     AHAPKKYKDRIHLALSKSGKISKIESDLPTIDELLKKSSAQRNDFSRKSISELKEGIG
                     AELRGLIVAIHSKEPYFPVCDKCNKKMTLKKGYAVCKCGNKVDEEDENLKWLFLCTCT
                     LDDGSGTIRVTLNNNTNYLDLEELKKIIIDDEEILDVLNNKLLGLDILTSGFTIYDEY
                     LKDTAFRCNNWNKIDIMEEFNKKLKG"
     CDS             126722..127888
                     /codon_start=1
                     /EC_number="2.1.2.-"
                     /gene="purT"
                     /locus_tag="MMKA1_01280"
                     /note="protein synonym:5'-phosphoribosylglycinamide
                     transformylase 2"
                     /product="phosphoribosylglycinamide formyltransferase 2"
                     /protein_id="BAP60245.1"
                     /transl_table=11
                     /translation="MVGTPLFSNAKKILLLGSGELGKEVIIEAQRFGVECIAVDSYEN
                     APAMQVAHRFHVIDMKDAGALRAVIEKEKPDLIVPEIEAINTDTLKEMESEGYHVVPT
                     ANATKLTMDREGIRRLAFEKLGLRTAKYEFAENLEELKEAVKRIGIPCIIKPIMSSSG
                     KGQSTIKSESDIETAWNYAKSAARGIGTKVIVEEFIKFDYEITLLTARTAEGTRFCEP
                     IGHIQVDGDYHESWQPHPMCAPTKAKAQEMAKKITDELGGYGIFGVELFVLDDEVIFS
                     EVSPRPHDTGMVTMVTQKMSEFEIHARAILGLPVNVDIVSPGASHVIKSEILKWAPEY
                     EIHEASKVKDTKIRLFGKPIAKVGRRMGVALAVSDDVIKARENAEKVAHLVKIK"
     CDS             complement(127916..128590)
                     /codon_start=1
                     /locus_tag="MMKA1_01290"
                     /product="hypothetical protein"
                     /protein_id="BAP60246.1"
                     /transl_table=11
                     /translation="MNWKGHITLGILMGLPFISSPEQIFLLVAGALYPDLDHDVKSEI
                     VQRGLYISGGLILVSILAYLFRPEYFNTGFFIAAILSGVIYITPYYAEHRGITHTFLS
                     LGVMSIILGYLTFKLSVISPIMASLIALIMVTNNKLLGKSVAISVFAWVLYNMISTSF
                     TTFQGLEFYIIPIAIGYLSHLVGDCMTPMGCRTLYPLNYTFHKKEGYFAIAIWVLLVF
                     YVIKLA"
     CDS             complement(128631..130163)
                     /codon_start=1
                     /locus_tag="MMKA1_01300"
                     /product="hypothetical protein"
                     /protein_id="BAP60247.1"
                     /transl_table=11
                     /translation="MKELIKNSLNDLDSAMELRELVINKINSQELTESDIIEIVDTVD
                     DLSFEDTQKLGSIFRRFPLGCDLLEIGVGPCSSSLTLPQFIENCVFTDHMGFPIHLCG
                     YALADIAEKEGLTPIEVMNEVYNNVEVPLDLDHFGRFGPMRFPKEISHCMGDCYYNGP
                     PYKGCPRDRIHKRLITKEREYSNEFGEWIKKSATVCVNVVEEQGGGDHGADISEMEDV
                     AKAAQKFGRGVEGIFHIGDGYEDLITGLKACNDLDVDVLVIEGGPFNRSKDRLKDFAK
                     SVAVSRILVKGGVVATNGAYEDECRVGLRSGLNVILSGFSGNHHGYMCGYNIKEARRN
                     NFGLPRVLKIMKEEAEKINICITNRELLKVLARSSRFLNHKENHLVYPSMIGNYFIGD
                     AHWVSITNSKMYNAPYFGKTLDSLEEELNCDKVGVLGGRYISWGIADALKPEELYVSD
                     VDPWVEHATVKILNDNGINAYACNGNDKKALESAEKSVITTMIPEIVLRIKNKFDAVS
                     LL"
     CDS             complement(130192..131217)
                     /codon_start=1
                     /locus_tag="MMKA1_01310"
                     /product="hypothetical protein"
                     /protein_id="BAP60248.1"
                     /transl_table=11
                     /translation="MIFSKIRGNFQDLKDGKIDVKQGLITKSDAIELFNIKNWKDYLE
                     LFSIASEVRDVFKTEIEITSTVHVTNICSVTPKCKYCGFAAGTSSEGYVKPFRSDDGQ
                     IKSSSVAIENSGIKRVSCSSGHGYNGKEVIRALKAVKSASNLEVLVNAGADLTEECIL
                     ELKKYNIDTICCNLETTNKTVFNNVKPGENLEDRINVCKMVKKHGVELSSGLLIGIGE
                     TYEDRVEHLFFLKELDVEEIPIMGFNPYKETPMETCPKCSAIEQAKTIAIVRLLFPDI
                     RITSPTPTMGPELAQFALLGGASNIATVIPDNHPMNIKGVGNPKTGNLKDVICMIKEL
                     GLTPKLN"
     CDS             complement(131277..132341)
                     /codon_start=1
                     /EC_number="1.12.98.2"
                     /gene="hmd"
                     /locus_tag="MMKA1_01320"
                     /note="protein synonym:H(2)-dependent methylene-H(4)MPT
                     dehydrogenase"
                     /note="protein synonym:H(2)-forming
                     N(5),N(10)-methylenetetrahydromethanopterin dehydrogenase"
                     /note="protein synonym:N(5),N(10)-
                     methenyltetrahydromethanopterin hydrogenase"
                     /product="5,10-methenyltetrahydromethanopterin
                     hydrogenase"
                     /protein_id="BAP60249.1"
                     /transl_table=11
                     /translation="MKVAILGAGCYRTHAASGITNFSRASQVAKEAGIPEIAMTHSTI
                     TMGAELLHLIPEITEVVVSDPCFAEEPGMVVLDQFDYKTVMEAHLAGDAEKVMPEIRE
                     AVKAKAKETPKPPKGCIHFVHPETVGLKVTASDVEAVKDADIVITWLPKGGSQPAIIE
                     KFASEIKKGAIVTHACTIPTPKFAKIFKDLGRDDLNIIAYHPGAVPEMKGQAFLSEGL
                     ADAEKVEEFYCMAKTARGEAFKMPANLISPVCDMGSAVTAPVYAAILAYRDAVTQILG
                     APADFAQMMADEAISQILDLMRNEGIKNMEDKLNPKALTGTADSMCFGPLADILPASL
                     KVLEKHANENKCECGCSIKP"
     CDS             complement(132648..133217)
                     /codon_start=1
                     /locus_tag="MMKA1_01330"
                     /product="hypothetical protein"
                     /protein_id="BAP60250.1"
                     /transl_table=11
                     /translation="MVEERIINLSHEIKNFVYPNDPEFIVKTKKNGKYSVSELNMGVH
                     TGTHIDYPMHVGLTNEKFENVFGKGYCVSLENMNDFFKNAPKNLEILLIKTDFSKYWE
                     DPEYFEKECDIENHIEKLISMNLKAVGIDCCSIGNFSVHEKLLSSKIKIIENMKNLEI
                     LENKTFKFFGFPLNIEKIDGSPINAVAFL"
     CDS             133295..133951
                     /codon_start=1
                     /locus_tag="MMKA1_01340"
                     /product="hypothetical protein"
                     /protein_id="BAP60251.1"
                     /transl_table=11
                     /translation="MRYDFHTHTVFSDGELIPSELIRRASVLEHRAVGITDHADASNY
                     KDLIEKNTLAKEELSNYMDYIEIIVGVELTHIPPKSIPKMAKKCKNEGAEIVVVHGET
                     PVEPVAEKTNYYASISEDVDILAHPGLIDIETAQNALENNIFFEITSRKGHSLTNGHV
                     VSVARELKIPMVINTDTHAPSDLITYEFARKVGLGAGMSFRELENSLTTNPLEILKRI
                     "
     CDS             133967..134812
                     /codon_start=1
                     /EC_number="4.2.1.2"
                     /EC_number="4.2.1.32"
                     /gene="ttdA"
                     /locus_tag="MMKA1_01350"
                     /product="putative Fe-S type hydro-lyases alpha subunit"
                     /protein_id="BAP60252.1"
                     /transl_table=11
                     /translation="MSNISEIVVELFKEASIYLPDDVKSKLKHAEEIECGACKDTLQA
                     IELNNKIAETKQIPLCQDTGVPVIFLKIGTGISSERIIEIIKEIESGVKRATAEVPLR
                     PNVVNPITRENLGTNTGMGAPFINFEFSENLNNEIEISVFPKGAGSENMSALKMLTPS
                     EGLMGIKKFVLETVANAGGKPCPPIVLGIGIGGTADISLKLAKKALLRDIGNRNPEKT
                     IENLEKELLDSINQLGIGTMGLGGKITALDVFIEVNGCHTASLPVGICIQCWADRKAK
                     RKIKL"
     CDS             134957..136111
                     /codon_start=1
                     /gene="mfmA"
                     /locus_tag="MMKA1_01360"
                     /product="L-tyrosine decarboxylase"
                     /protein_id="BAP60253.1"
                     /transl_table=11
                     /translation="MDEQDILNELREYRNQDLKYEEGYILGSMCTKPHPIARKISEMF
                     FETNLGDPGLFKGTSKLEKEVVSMIGGILHNKNAFGYIISGGTEANLTAMRAFKNISK
                     SKGKPQNIIIPETAHFSFDKAKDMMDLNVVRPPLTKYFTMDVKFIQDYIEDSKNEVSG
                     IVGIAGCTELGSIDNICELSKIAVENDILLHVDAAFGGFVIPFLDDKYKLKGYNYDFD
                     FSLNGVSSITIDPHKMGLAPISAGGILFKDNMFKKYLDVDAPYLTEKQQATIIGTRSG
                     VGVASTWGIMKLLGIEGYKKLVNESMEKTTYLVKKAREYGFETAIDPVMNIVALKDED
                     KHETCMKLREENWYVSVCRCVDALRIVVMPHLEIEHIDGFLESLSNTKKY"
     CDS             136161..137024
                     /codon_start=1
                     /EC_number="2.6.1.42"
                     /gene="ilvE"
                     /locus_tag="MMKA1_01370"
                     /note="protein synonym:transaminase B"
                     /product="branched-chain-amino-acid aminotransferase"
                     /protein_id="BAP60254.1"
                     /transl_table=11
                     /translation="MKIYLDGNFVEKEDAKVSVYDHGLLYGDGVFEGIRAYDGVVFKL
                     EEHIERLYDSADSIAMKIPASKVEMEEIVIETLKSNNLKDAYIRLVVTRGVGDLGLDP
                     RKCPKATIFCIAENMKPLLGEDGIKVITSSIRRLPVDVLNPAVKSLNYLNSILAKIQA
                     NYAGVDEAFLLDSEGYVAEGTGDNVFVIKNGKIKTPPLSSSVLKGITRDTVVDLAKEA
                     GYTIIEEKMTLHDLFVADEIFITGTAAELIHVVEIDGRIINNGKLGPVTKDLSDRFKE
                     IRSKIGKKYIE"
     CDS             complement(137099..138601)
                     /codon_start=1
                     /EC_number="1.1.1.205"
                     /gene="guaB"
                     /locus_tag="MMKA1_01380"
                     /note="protein synonym:IMP dehydrogenase"
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="BAP60255.1"
                     /transl_table=11
                     /translation="MVVILFLDKIVSAQRAYTFDDVLLVPNKSFVDPKTTDVTVDIAG
                     LKLNIPIISAAMDTVSEKDLAIALARRGGIAVIHRNMTVEEQLKHVKAVKMAENLVIR
                     DVVTVEPSSSVLDAERIMYEYNVSGLPVVSENKTLVGILTTRDLKFVPDKNVAVETVM
                     TKEVLHVHEDTPYEEILNRLYENKIERLPILDKNTKELLGMVTLRDILKRKKYPDAAR
                     DSDGKLVVAAACGPSDFERAEALVLAGVDAVAIDCAHAHNMQVVENVKKLKEILKGTK
                     TKLFVGNIATGEAAEDLIKAGADALKVGIGPGSICTTRVVAGVGVPQLTAVAEVAEVA
                     KKYGVPVIADGGIKYSGDIAKAIAAGANAVMVGSLLAGTEEAPGSLMTINGRKYKQYR
                     GMGSLGAMCGSSGNVADRYFQSGHMKHSKLVPEGIEGAVPYKGPTSDIVYQLIGGLRS
                     SMGYCGAQNLPEMHEKARFVIITQSGQKESHPHDVLITNEAPNYPINAER"
     CDS             138651..138995
                     /codon_start=1
                     /locus_tag="MMKA1_01390"
                     /product="hypothetical protein"
                     /protein_id="BAP60256.1"
                     /transl_table=11
                     /translation="MDEISMASKELAKGAKMLGKHCSSCGFPMFEKDGLEYCPNCSTS
                     EIEIKGDSKESEKQLKKINENKISKNDDKLRIINRKIEYLFSKLDSEEEIGRIHEITS
                     SIKILLKIKKYL"
     CDS             139266..140480
                     /codon_start=1
                     /EC_number="4.2.3.1"
                     /gene="thrC"
                     /locus_tag="MMKA1_01400"
                     /product="threonine synthase"
                     /protein_id="BAP60257.1"
                     /transl_table=11
                     /translation="MIQKCRVCGKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKES
                     LRERELGVWRYLDYLPVKDPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPT
                     GSFKDRGMTVGVTRANELGVEVVGCASTGNTSASLAAYSARAGKKCTVLLPGGKVALG
                     KLAQAMFYGAKVIQINGNFDEALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICD
                     QLDFEVPDMVILPVGNAGNISAIWKGFKEFKETEMIDRLPKMTGIQAEGAQPIVKAIK
                     EGLDEIVPDENPETIATAIRIGNPVNAAKALDAIKSSGGLAESVNDEEIIEAQKLLAQ
                     TEGIFVEPASASSIAGLIKLINMGLIDKDQKIVCITTGNGLKDPDAAIKASKMPTEIE
                     CDMEVLRKAIEE"
     CDS             140498..141001
                     /codon_start=1
                     /EC_number="4.2.1.33"
                     /gene="leuD"
                     /locus_tag="MMKA1_01410"
                     /product="3-isopropylmalate dehydratase, small subunit"
                     /protein_id="BAP60258.1"
                     /transl_table=11
                     /translation="MKKTVEGKAWVFGDNIDTDAILPARYLVYTTEEQLAKYAMTGTD
                     PEFPEKATVGDIIVGGKNFGCGSSREHAPIGLKGLGISMVIAESFARIFYRNSINIGF
                     PLLECKDISKHVKEGDVLRVDLDKGTVKNVTTGVELTGQNLPDFMMEILNNGGLMPHL
                     KKKISKA"
     CDS             141058..142065
                     /codon_start=1
                     /EC_number="2.5.1.46"
                     /gene="dhs"
                     /locus_tag="MMKA1_01420"
                     /product="deoxyhypusine synthase"
                     /protein_id="BAP60259.1"
                     /transl_table=11
                     /translation="MSDPKNVVFKESEDLNGVFIEGPDFDETIDLKDVLTDYYEKIGF
                     QATHLGKAVKIWKQIEEVRKNEEVVVFMGYTSNMVSSGLREIISYLVKHKKVDVLVTT
                     AGGIEEDFIKCIKPFVLGEWDMAGSDLREKGINRIGNVYVPNDRYIEFETYMTKFFET
                     LLKKQQDENKIISASEFCFELGRFMDENLGQEKEKSIIYWAYVNKIPIFCPAITDGSI
                     GDMLYFFKKNEKGTDLKIDVASDIVKLNDMAIDANKTACIVLGGSLPKHSIINANLFR
                     EGTDYAIYITTAVPWDGSLSGAPPEEGVSWGKIQEKADFVEIWADATIVFPMLVYGVF
                     K"
     CDS             142701..144731
                     /codon_start=1
                     /EC_number="1.2.1.2"
                     /gene="fdhA"
                     /locus_tag="MMKA1_01430"
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="BAP60260.1"
                     /transl_except=(pos:143097..143099,aa:Sec)
                     /transl_table=11
                     /translation="MTEFKVVHTICPYCGTGCGIDLVVKDGKVVDSHPFKRHPVNEGK
                     VCIKGNYCYEFVHSEDRLTKPLIKKNGEFIEATWDEALDLIAGKLKQYSPDEVAFFSC
                     ARGTNEESYALQKFARTVLKTNNVDHCARIUHAPTVVGLGECFGSGAMTNSITDLAQA
                     DVLLIYGSNTFEAHPLIARSIVKAKENGTKIIAIDPRTTHTAKMADLHLKLIPGSNID
                     LINTITNIIIQEGMADEEFIKNRTEGYDELKDVVSKYTLEKTAELSGIPAETILEAAR
                     MYGSAENASIMYCLGVTEYTFGVDNVKSCCNLAMVTGNLGRPGTGVNPLRGQNNVQGA
                     CDMGALPNVFPGYQKVGEAYERLEDLWETADLNREIGLTSPEVLHKAGEQVKFLHIVG
                     EDPMVADADINHVEKALKSLDFFVVQDIFLTETAKLADVVLPAACWAEKDGTFTNSER
                     RVQRIRKAVDAPGEALPDWLIVRKLAEKMGAGEKLKFESASEIFDEMAKVIPQYAGMS
                     FERLGIDGLQWPCKTPEDPGTPILHKEKFLRPNGLGKFTPVEHKDADELIDEEYPLIL
                     TTGRIIFHYNSGTMTRRCDSITNEIDENFIEINTEDAKELGIKPGEKVRVSSRRGTVN
                     ANARVTENVIKGVVYMSFHFLEEATNKLTNSAYDPVSKTAELKICAVKVEKI"
     CDS             144755..145882
                     /codon_start=1
                     /EC_number="1.2.1.2"
                     /gene="fdhB"
                     /locus_tag="MMKA1_01440"
                     /product="formate dehydrogenase subunit beta"
                     /protein_id="BAP60261.1"
                     /transl_table=11
                     /translation="MSYYLVQSTDEDILKHAECGGAVTAFFKYLLDKKLVDGVLALKK
                     GEDVYDGLPYLVNDSKELVETCGSLHCAPTMFGNMISKHLKDMNLAVSVKPCDAMAIV
                     ELEKRHQIDKDKLYTIGLNCGGTVPPQTAKKMIELFYDVDPEDVIKEEIDKGKFIIEL
                     KDGSEKSVKIDELEEEGYGRRTNCQRCELKVPRNSDLACGNWGTEKGWTFVEVGSEKG
                     EELLKNAQKEGYINVKAPSEKALEIRGKIEKSMINLGKKFQKEQLDEKYPSPEKWDEY
                     WSRCIKCYGCRDVCPICFCKECALGEDYLDKGTIPPDPIMFQGIRLSHMSFSCINCGQ
                     CEDVCPVEIPLAKIYHRAQLKIRETTGFVPGIDDSMPFLYK"
     CDS             complement(145925..148240)
                     /codon_start=1
                     /gene="hypF"
                     /locus_tag="MMKA1_01450"
                     /product="hydrogenase maturation protein"
                     /protein_id="BAP60262.1"
                     /transl_table=11
                     /translation="MTAKRIDVKGIVQGVGFRPFVYRIAKKNDLNGYVKNMGNYVEIV
                     VSGKLNNIDAFLSDLKLEKPPLSKIDNISIEDIDENENLNEIYGDFTIKLSDTSKIEE
                     EGTIPPDISICDECLKEIMDKKDRRSDYAFTACTNCGPRFTVIEKLPYDRENTSMNDF
                     PLCENCIEEYKNPEDRRFHAQATCCDICGPEIFITDNFGKIISNDICDAVKFLEEGKI
                     LAIKGIGGTHLVCSINSDETILELRKRLNRPTQAFAVMSREEYLDLFSNANENELNAI
                     KSPKKPIVALKKNELYEKYFSEHVSNLNTIGVMLPYSGLHYLLFENTNQIAYIMTSAN
                     LPGLPMSIDNRQILEKLENIADYFLLHNRKIVNRCDDSVLKEINGKMELLRRSRGFAP
                     EPIEVNYEKIKNNSKNILALGPELNSVACLVKNNKFYLTQYIGNTGKYETFNYLKEAV
                     ENLIKITNTNKIDAIVCDLHPSFNSTLFAKELGEKYKIPVTQVQHHESHCYSLMGDSD
                     IFENNVTIAIDGLGYGNDGNIWGGEVFLFKNGKIERAGHLEEQIQPGADLASKYPLRM
                     LASILNKTNLNVSEIIKGYNYFSEKELKLILFQLTKNINVSKTTSTGRILDSISALVS
                     LCFERTYDGEPSIRLEALANEYSENKLEIEKLAEESIKIENNILDTTSLVVKSLEMLN
                     NNEKIENIAYFIHIAIADGLSRIAIETAKRQGIEYIGVTGGVSYNKIISERIVENIKK
                     ESLKPLIHERIPNGDGGISFGQAIGYLLNSN"
     CDS             complement(148284..149156)
                     /codon_start=1
                     /locus_tag="MMKA1_01460"
                     /product="hypothetical protein"
                     /protein_id="BAP60263.1"
                     /transl_table=11
                     /translation="MSNELFETLTSNIHFNVTEMGRKTWTQNWMVPENLITIVGLKNG
                     KKPVFYYGLTENYRTNFVLKKGTSENGNKYINARVYFRFCKDTIVEKEKYVVANGFNG
                     LLLGIKIGKTEFINTFKSMLLEEYRRGDAHTIEVLERMKDRNVFESVEESAQYIADRD
                     YNWLIGRLKYKGKLFNYSGQGYWLLPLKTQMELTKGFIEEDCDLTIDLENTEVFENYL
                     IYVDTVNSVVRYNGERLCTSGYSLAEELKKHSDENTCPWCGEKLRLIKTKKGEFLGCS
                     SYPKCLYRRFLNKK"
     CDS             complement(149186..150691)
                     /codon_start=1
                     /locus_tag="MMKA1_01470"
                     /product="putative thiamine pyrophosphate"
                     /protein_id="BAP60264.1"
                     /transl_table=11
                     /translation="MKYLDFMIDFFENKGVKSVFAYPGEQILPIYRALHENSKINCID
                     VKHEQASAHAADGYFRITNEVGICLATAGPGATNLTTGIATAFKDSSSVLAITGRCST
                     NYIGKNYFQEIPMDFLNFEKGYFVENPDSKYLINSYNESYNLKKPVSINIPADIYNQD
                     VIDSKINLKNKNTESLENAVSTIKKHKNAKNPVLLLGQGIYGNLKYSEMIKIGEILKK
                     LQIPILTTYPARGVVDENFETAYAMVGRRGILKSNDLILKSDAVFSIGASLSYNTLPE
                     SIRDKILYNVIPLNLGINSTNDIKTIVNTFNENVSSGHFKPSGQNLSRNEFKFGDYPT
                     KIHEILENLPKDTIITTDAGNHTVFVSLLKKCVAPRNIISSHSMGTMGFGLPASIGVK
                     FGCNDYNINREVVSISGDGGFQMNIQELGTVAENNLKILIVVMKNNHLNMFGKINTPD
                     FNKIADAYGIENVYIQNSDEIGENVAYFLKKSIPYVMVVECENEKLPKPFI"
     CDS             complement(150710..151825)
                     /codon_start=1
                     /locus_tag="MMKA1_01480"
                     /product="hypothetical protein"
                     /protein_id="BAP60265.1"
                     /transl_table=11
                     /translation="MNVGIVVHGPEIIDSGFAEKIFAILKNLDENINLQIKLGGTIGR
                     VAVIDSSLDDIIDISEKLVPSKSLQKLENNDILILLNYGKSKITGHTFGKIVVERSDV
                     NKPVIQIERPGEADGTIILWNTTKDDEKLGNIVSKISDKLNLNVEECISKGLNFWVEG
                     SKSFRKINGVDVNESIMLNGIIIGRSSQNDVTIVSENGHIVDIIGGTVKWHGVEKLGN
                     IDLEKVVVKTGLLRRHPSKNQKIAKYNLNSDLGEVLFVNHAGEDVLETIQNKKICAVV
                     TVGDDTTTICGDILSRFGFKIIGITDGDRDDILKNPSILSGSVVFLIKNQKDDDVGEL
                     LERELDNFEKLGNFEKYVETIKQIMKKECIEFEEIIH"
     CDS             complement(151853..152461)
                     /codon_start=1
                     /locus_tag="MMKA1_01490"
                     /product="hypothetical protein"
                     /protein_id="BAP60266.1"
                     /transl_table=11
                     /translation="MEIKPSKIVCAGLNYKDHAKELKMKLPKEPVIFLKPTSSIIYNE
                     EAIKIPKASERVDYEAELAIVIEKTCKSVKKEDAKNYIKGFTILNDVTARDLQEKDGQ
                     WTRAKSFDTFSPIGPKIVSNLDPNNLKIQLRVNGKIKQDSNTNNMIFSVEELVEFVSS
                     IMTLYPDDIISTGTPPGIGKLEKGDIVEIEIENIGILKNFVE"
     CDS             complement(152478..153035)
                     /codon_start=1
                     /EC_number="2.4.2.7"
                     /gene="apt"
                     /locus_tag="MMKA1_01500"
                     /note="protein synonym:APRT"
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="BAP60267.1"
                     /transl_table=11
                     /translation="MSKLLEESLKTCPIVKRGEYHYFIHPISDGVPLVEPELLRDVST
                     RVIKMIDTDVDKIVTAEAMGIPIVTAVSIATDIPYVIMRKREYLLEGEIPVHQETGYS
                     KGELYLNGINKGDKVVILDDVISTGGTLVAIINALKRAGADIKDVLCIIDRGNGQNIV
                     EEKTGYKVKTIVKIEVVDGKVNILE"
     CDS             complement(153073..154479)
                     /codon_start=1
                     /locus_tag="MMKA1_01510"
                     /product="hypothetical protein"
                     /protein_id="BAP60268.1"
                     /transl_table=11
                     /translation="MDIIVVGGGTSGLLSALALEKEGHNVIVFEKESYVGGLCRSEKI
                     DGYSVDIGVHAITMLDNGPLIRLLNKYSRYLPNFRNYGDYYIRTDKLHRIPVSMHEWM
                     TTPVIPNKDKVLITSKIMDLMTMGFTKDASVYDFVKEMGLSSTSVDFFNTIAYFLSGE
                     NLEHTPLWRFFTGAGYIPEDDILPFIYKDMKINPLKSTLVKKFGTERIINILNDGFIS
                     SIKNGSKKYINKFMTEHRYSTQGYPVGGVQSICNCITYSLRNTQIKNEEVKKITKNGK
                     KYTVKTSEGEYTSDIIVYSAPAITLPKVAKINKIQKNKEKLSNIKFTKSTTVWIGDEK
                     NYFPYLGSEIWIDNPCWASTVSNYDESLAPKGKHLMGFSFVNSKKEDALKTIESKLNL
                     NTDKVDMLYVQETVPEQASCSIGQFFVYPKIDDTFFVVGTDSDPRSMGITRAAYSVEV
                     MLSEFKNIYDAQKETAKK"
     CDS             complement(154494..155435)
                     /codon_start=1
                     /EC_number="1.18.6.1"
                     /gene="nifH"
                     /locus_tag="MMKA1_01520"
                     /note="protein synonym:nitrogenase component II"
                     /product="nitrogenase"
                     /protein_id="BAP60269.1"
                     /transl_table=11
                     /translation="MYYIVLLILRESFIFMLNGDILKQIAFYGKGGIGKSTTVCNLAA
                     ALSKSGKKVIVVGCDPKHDCTSNLRSGEDIPTVLDVLREKGIDKLGIETIIRENLLKK
                     EDIIYEGFNGIYCVEAGGPKPGYGCAGRGVIVVIDLLKKMNVFEDLGVDVVLYDVLGD
                     VVCGGFAMPLRMGLADQIYVVTSSDYMALYAANNICSGISQFVKRGGSTLGGIIYNVR
                     GSMDAFDIVSEFANQLNANIIGKVPNSPIINEAEIDGQTAIEYAPEEEISKIYMELAE
                     SIYQNNTGTTPNPLENAQIMQIGKMIKERIKKQKITE"
     CDS             155682..157592
                     /codon_start=1
                     /EC_number="6.2.1.1"
                     /gene="acsA"
                     /locus_tag="MMKA1_01530"
                     /note="protein synonym:acetate--CoA ligase (AMP-forming)"
                     /note="protein synonym:acyl-activating enzyme
                     (AMP-forming)"
                     /product="acetyl-CoA synthetase (AMP-forming)"
                     /protein_id="BAP60270.1"
                     /transl_table=11
                     /translation="MKTGDKYIMLEKYSELQQKALDDPEKFWGEQAKCLEWDKTWDKA
                     LDWNPPYAKWFKGGSLNASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREV
                     NKFANVLENLGVEKGDVVTIYMPMMTEAIVAMLACSRIGAIHNVVFSGFSSDALADRI
                     NDSKSKILVTTNLLYRRGKEIDLKKILDKALLNCNSIKHVVYAKRGIEDLNLVSGKDY
                     YWDELMGGAKSYVEPVPVESEHPLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTW
                     GLNEMDVFWCTADIGWITGHTYVVYGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGV
                     TILYTAPTAIRMLMMYGEKWVNTHDLSTLRLLGSVGGPINPRAWKWYYKVIGKEKCPI
                     CDCYWQTETGGHIIYPPIGIQSVPLKPGSATFPGIGIDVDVVDNEGNPVDANVKGNLI
                     IKRPWPGMLAGLWNNDERYRAAYWDRFKNKFSTSDYAIKDQDGYIWVLGRSDEVLNVS
                     GHRIGTAELEHELVSNKMVAESAVVGKPDDVKGEVPVAFVILNEKYRELPSNEVKAEL
                     IKHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRRILKKLIMGEEIGDVTTLEDNTSLE
                     EVKKELEDFKYD"
     CDS             complement(157616..158671)
                     /codon_start=1
                     /locus_tag="MMKA1_01540"
                     /product="putative RNA methylase"
                     /protein_id="BAP60271.1"
                     /transl_table=11
                     /translation="MLNLKNTKAGFLLSAEHEKLPIAELNALIDIFSLGGNLNCFKNY
                     VILESSISEEIIKKMVKRGGYTNEGHVIFSESSIINQNVDETLDNFFKSSETLDFPVE
                     RDETFAVRVLKLEKESPFNSMEIERKLGGIIKKKTSAQVSLKNPSKTVKVVISNDTMY
                     TGIVIEKRDVEYFQNNRPHLRAYFHPGCIMPKLARCLVNLSRVKEGEIVLDPFCGTGG
                     FLIEAGFLGCKLIGSDIDEQMVNGALLNLNTYDLSKQVISIKHSDAKNVSKYLEDLKI
                     EKIDGIVTDPPYGISTSKKGDMLEIFEKIVDVLKDNDYLVFAAPNRMELDLNLVEFYE
                     MRVHKSLTRYIHVYRKN"
     CDS             158738..159253
                     /codon_start=1
                     /locus_tag="MMKA1_01550"
                     /product="hypothetical protein"
                     /protein_id="BAP60272.1"
                     /transl_table=11
                     /translation="MKLFIYHEKQCDPKRCTALKMGRLGYAKIITNPNKVPRNSLLLN
                     PYSEKTVSVEDREIIEKYGILGLDCSWKQAEIVFKKTNAKNQRVLPFLIAGNPVNYGK
                     PCKLTTLEAIVATLYIANYKNEAVSLLNGFKWGNTFIDVNKELLEQYCGKTSDEIIRI
                     QNEILNNMRNR"
     CDS             159258..159401
                     /codon_start=1
                     /gene="rpl40e"
                     /locus_tag="MMKA1_01560"
                     /product="50S ribosomal protein L40e"
                     /protein_id="BAP60273.1"
                     /transl_table=11
                     /translation="MAFEEAIKRVFMKKICMKCNSRNSWKATKCRKCGYTNLRPKAKE
                     ARA"
     CDS             159783..161123
                     /codon_start=1
                     /locus_tag="MMKA1_01570"
                     /product="putative divalent ion symporter"
                     /protein_id="BAP60274.1"
                     /transl_table=11
                     /translation="MKKALILLVLAVFLIGFTKIAYVDEESADGINSQKAIITLIILG
                     TAAVLFFTEALPLPVTAMLVPVALSFPGIDILSSSRAFADFGNKWVVLFMAAFILGEA
                     VFRTGFADKIGQLTVKAAGKSQLKLMLLVMLAIGTMSAFLSNTGTTAAFIPIVMGICV
                     SASLKPGKLLIPMAYAASLGGTLTLIGTPPNGLVNDALEKSGIAPFGFFEFAKIGILI
                     FIVGILYYGTIGHKLLPESKAKAKDFVSDTLKYRTNKMWIATLVFTFVVLMTATGTIP
                     LVTAFMLGACMVVMTGCITMQEAFNSISWTTIFLFAGMLPLGSAMAATGAATMIANTV
                     ITYVHSPLALLAAAYILTVLITEVMSNTATAALVMPLGIALADAFDVSAKPILMAIAV
                     AASSCFLTPIATPPNMIILGPGGYSFKDYAKSGWPLEILCAVVAIAVIPMIWPF"
     CDS             complement(161619..162785)
                     /codon_start=1
                     /EC_number="2.3.3.-"
                     /gene="cimA"
                     /locus_tag="MMKA1_01580"
                     /product="(R)-citramalate synthase"
                     /protein_id="BAP60275.1"
                     /transl_table=11
                     /translation="MSMDWKAVSPYNPKLDLKDCYLYDTTLRDGEQTPGVCFAGDQKL
                     EIAKKLDELKIKQIEAGFPIVSENERKAIKSITGEGLNAQILALSRVLKEDIDKAIEC
                     DVDGIITFIATSPMHLKYKLHKSLDEVEEMGMKAVEYAKDHGLFVAFSAEDATRTPLE
                     DIIRIHKNAEEHGADRVHIADTLGCATPQAMYHICSELSKHLKKAHIGVHCHNDFGFA
                     VINSIYGLIGGAKAVSTTVNGIGERAGNAAIEEIAMALKVLYDHDMGLNTEILTEISK
                     LVENYSKIKIPENKPLVGEMVFYHESGIHVDAVLENPLTYEPFLPEKIGQKRKIILGK
                     HSGCRAVAHRLQELGLEASRDELWEIVKKTKETREDGTEISDEVFKNIAEKIIK"
     CDS             complement(162829..164334)
                     /codon_start=1
                     /locus_tag="MMKA1_01590"
                     /product="hypothetical protein"
                     /protein_id="BAP60276.1"
                     /transl_table=11
                     /translation="MNVLVNDKPKSGKTLKDVIKDEYYIPGSNIVIVKGTATVIKEET
                     KKYMIKTTKGSFVVGITEENESVDFWNKNYKSFEKKSLIWKSISDVSFGSIEINLPVS
                     SLKQNFKKWDVVLSVSGLDTSEGNLIFVQRDVTELYGLENPKIGILIGGKRVLKALTA
                     DDQIISIEKMRESKENIDYEVTTDLDKEIQDDWKIYTYCKAELNGPSKSTEHALAILE
                     NGTLEISEHTNTYVADCRLQTLLIDEENPENRDRGTITVRNVGNGVGKVYIYQENRAS
                     SLSHTVVGKVTDGIEIVDFSNSGQITVKTSPERLNLIGKTQKDAKLLFEKHGITLKME
                     GNTDDDAVIVEQVPEYTMDILKSKEVTTKGIEPEKLLYVEIFDKEAPTTAWYFRKTTG
                     LTTKRIGTLKIYFKHDDISMFERNWDYSKGLLPENTPKGSVDSEIIAVTNMAKRYKGY
                     MGVRTSSHDKYGPTGETFEGTNIVGKVVKNAEILKSVKQGENIYILEVNSN"
     CDS             164571..164954
                     /codon_start=1
                     /locus_tag="MMKA1_01600"
                     /product="hypothetical protein"
                     /protein_id="BAP60277.1"
                     /transl_table=11
                     /translation="MAENTEVKISSKAKKILRSQSHEIEPVVWVGKEGIEKTIEEIKR
                     QIKDKSLIKIKVRKSALENGDKAEMAEKISKETGAEVISVVGNVITIFKPKEGWKKYS
                     TKKTKKEKYVEEFEEMRSKKALLKR"
     CDS             165184..165609
                     /codon_start=1
                     /gene="rps19e"
                     /locus_tag="MMKA1_01610"
                     /product="30S ribosomal protein S19e"
                     /protein_id="BAP60278.1"
                     /transl_table=11
                     /translation="MVTVYDVPANDLIAKLAEKLKEMGVEEPEWTNFVKTGAHKERRP
                     DDGDWWYVRCAAILRKVYINGPVGVERLRSVYGGRKNRGCAPEKFVKGSGNIIRTAFQ
                     ALEAKELLTKAEKGGRIIAPKGQSLVDNTAKEVADSVAQ"
     CDS             165635..165994
                     /codon_start=1
                     /locus_tag="MMKA1_01620"
                     /product="hypothetical protein"
                     /protein_id="BAP60279.1"
                     /transl_table=11
                     /translation="MNPEEIRQRRLQEMQAKAQAQGAANDPEAQRQMQEQQMQYEMQK
                     QKILRQILSEEARSRLARIKLAKPQFAEQVEMQLIQLAQAGKLPVPLTDEYFKGLLDK
                     IYEMNRPAKKEITIMRK"
     CDS             165995..166594
                     /codon_start=1
                     /locus_tag="MMKA1_01630"
                     /product="hypothetical protein"
                     /protein_id="BAP60280.1"
                     /transl_table=11
                     /translation="MIHMAKAHVLFSGGKDSSLSAIILHNLGYDIQLVTVNFGVLDSY
                     RHAEETAKIIGYPHKVESMDRELIEKSVDMILKDGYPGNGIQFVHKQVLEIISEKYDV
                     IADGTRRDDRVPRLDHSEIQSLEMRKNIQYVTPLMGFGHKTLRNLVNNYFIISEKESE
                     ELLKSDYETEIRELIRQRGIDPLEYFPKHIQSRVIGLKR"
     CDS             166611..166766
                     /codon_start=1
                     /gene="rpl39e"
                     /locus_tag="MMKA1_01640"
                     /product="50S ribosomal protein L39e"
                     /protein_id="BAP60281.1"
                     /transl_table=11
                     /translation="MAGNKPLGKKIRLAKALKQNRRVPMFAIARTKGSVKQHPKMRHW
                     RRKNLKK"
     CDS             complement(166838..168139)
                     /codon_start=1
                     /EC_number="6.2.1.30"
                     /gene="phaE"
                     /locus_tag="MMKA1_01650"
                     /note="protein synonym:phenylacetate-coenzyme A ligase"
                     /product="phenylacetate-CoA ligase"
                     /protein_id="BAP60282.1"
                     /transl_table=11
                     /translation="MIWSKEETWDRKEIEKIQLERLKESVKRAYENVPLYKEKFDSVG
                     LKPEDIKSLDDLKKIPFTVKDDFRANYPFGMFAVPKKEVVRIHASSGTTGKPTVVGYT
                     KKDIRTWAELISRVVTAAGVTDEDTAQIAFGYGLFTGGFGLHYGLENVGASVIPMSSG
                     NTEKQIMLMKDFETTVLICTPSYALYIAEVAEKMGIDPKKDLKVRIGLFGGEACSESA
                     RAEIESKWGILATQNYGMSELMGPGVSGDCEYQCGMHISEDHFIAEIIDPKTGEVLPE
                     GEIGELVITTLTKEALPVLRYRTKDMTSLTYEKCKCGRTTARMLKIRGRSDDMLIIRG
                     VNVFPTQIESVLEGIEEIGPHYEIIVTKNGHLDQMTINIELADGKFLEKFSCLEQISK
                     KVDHKLKTVLGLSSKINIVQPRTLERFEGKAKRVKDLRNVN"
     CDS             complement(168431..169036)
                     /codon_start=1
                     /EC_number="3.1.3.71"
                     /gene="comB"
                     /locus_tag="MMKA1_01660"
                     /product="2-phosphosulfolactate phosphatase"
                     /protein_id="BAP60283.1"
                     /transl_table=11
                     /translation="MKISISFDFFGSSELQKTVDFSDYCVIVIDVLRASATICTLLDL
                     CDKIYITGSIEKAENIENSIKIGERNAKKIEGFNFGNSPVELTVNKNLIKEHFENGGN
                     IVLTTTNGTRVLENIVSDHILIGSITNAKSVAKKAYKLAKENNKGIMLVPVHRKGNFA
                     IEDFIGAGIIADYIFKEYDEKIPDEKFEELIPARMLTKSDG"
     CDS             169055..169699
                     /codon_start=1
                     /locus_tag="MMKA1_01670"
                     /product="hypothetical protein"
                     /protein_id="BAP60284.1"
                     /transl_table=11
                     /translation="MNFTDIGIFDYLGMILLILIVLAAILFVTAIGLGYYLINKNKIL
                     FPKLSLYITNNFYSILLRIFLIIGTEDTFYKVASDFYNKYYCEDFKKAKNKVLILPHC
                     LRDLKCPGKLGPDGVECVFCGKCPIGRVIKVAEENGYKTYVVPGSTFLKRVLKDKKPD
                     GVFAVACHNDMFHGMTFLSRKNVPVQGQLLMKDGCISTLVDVEELISRLKNEPC"
     CDS             169760..170797
                     /codon_start=1
                     /EC_number="3.6.3.16"
                     /locus_tag="MMKA1_01680"
                     /product="putative anion-transporting ATPase"
                     /protein_id="BAP60285.1"
                     /transl_table=11
                     /translation="MVLSKIKESLKGITSKKLEKENGTKYIMFGGKGGVGKTTMSAAT
                     GIYCAEQGLKTVVVSTDPAHSLKDSFEQSFGHEPTKVNGMENLYVVEIDPEVAMSEYK
                     EKLKSQMDENPMMGGMLEDQLEMASLSPGTDESAAFDVFLKYMDNNEFDVVVFDTAPT
                     GHTLRFLGLPELMDKYMTKMIKFKKQMSGFMNMMKKVMPFGGKGEDVDYDKALEEMEE
                     MKARITKARGILANPERTAFRLVVIPEEMSILESERAMESLNKFKIPVDSVVVNQIIP
                     EDVECDFCRARRSLQEKRLELVKEKFGDKVIANLELLRTEAKGLDVLKDIAHKLYGEA
                     KSEEEKEVIVA"
     CDS             complement(170844..171278)
                     /codon_start=1
                     /EC_number="4.99.1.3"
                     /gene="cbiX"
                     /locus_tag="MMKA1_01690"
                     /product="sirohydrochlorin cobaltochelatase"
                     /protein_id="BAP60286.1"
                     /transl_table=11
                     /translation="MEALVLVGHGSRLPHSKNVVMEVAEKIKARNIYDIVEVGMMEFN
                     EPTIPQTIKKVIDAGAKKVIVTPVFLAPGNHTERDIPKILGIYEGDDEGGHHHHHDHE
                     HHHHHHDTETVEIPEGVELVYRKPMGADDRIIDIVLDRANGL"
     CDS             complement(171369..172130)
                     /codon_start=1
                     /locus_tag="MMKA1_01700"
                     /note="protein synonym:putative daunorubicin resistance
                     ABC transporter membrane protein"
                     /product="ABC-2 type transporter"
                     /protein_id="BAP60287.1"
                     /transl_table=11
                     /translation="MDAFSAMFYRQLRRFTRAKSRVLGSLLNPLVWLVFFGIGWSRAF
                     DFPAAREIFGGVDYLTYLIPGVVSMTVFSGSFISGVTVIWDKQFGFLKETLVAPTSRS
                     EAILGRIMGDSITALIQGVLIMVLSLFLVSLNPFGMIPVIFTSFILAVAFASVGISLG
                     LKINSQEGFHLIFGLLMQPLIFLSGAFYPIDAMPTWMKILAYINPLTYAVDSARYFLA
                     GFSRFPIMLDVSILIVLSVFLVVLAMYTFEKAVIE"
     CDS             complement(172140..173522)
                     /codon_start=1
                     /locus_tag="MMKA1_01710"
                     /product="putative multi antimicrobial extrusion protein"
                     /protein_id="BAP60288.1"
                     /transl_table=11
                     /translation="MKTTKGVQNLLGDPKKAIVKISLPMVIAMSFQSLYNVIDAIWVA
                     GLGSDALAAIGLFFPFMFAIMAISNGVGIGGSSAISRRIGQKNKDAADNIAVHSIVLG
                     VIIGILLTGVIPFLGTIFSLIGASGNTVTMAVEYSTILFGGAVAMLFTNIANAILRGE
                     GDTKRAMYAIILGSVLNIVLDPIFIYVLNMGVAGAAWATLLSMTITGILFVYWLFIKK
                     DTFLKISFEKFKLDINIIKEIFSIGLPASISHLTMAFSMFLLTAIVAKAGGNDGIAVF
                     STGWRIVSMGTIPLVGLATGVTVVTGAAYGSANPEKLEISYKYALKMGILVETIIAAL
                     ILIFENQITYLFTYSENSVHILEGLLVFLKYMFLFYPTLPLGMLTAAMFQGVSKGNNS
                     LFISLLRTIILQIPMAYTFGIIFNQGLTGVWFGMILGHVIAVSIAYLLGIYTIRQFKT
                     TLTPETVKFK"
     CDS             complement(173523..174491)
                     /codon_start=1
                     /locus_tag="MMKA1_01720"
                     /note="protein synonym:putative daunorubicin resistance
                     ABC transporter ATP-binding subunit"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAP60289.1"
                     /transl_table=11
                     /translation="MHAIEVKNLVKKFDTNVAVNNVSFSVNKGEIFAFLGPNGAGKST
                     TINILTTLLKATSGSAVISGFDASKDPKKVRKTIGIVFQDSTLDNQLTAYENLYIHGK
                     IYGYKGEVLKNRIDELLDFVELLEFKDKIVRNFSGGMVRRLEIARSLIHEPEILFLDE
                     PTIGLDPQTRSHIWEYIKKMQAKNNMTIFLTTHYMEEAELLADKVAIIDNGKIIAEGT
                     VNELKKIVGNDCISVKFEEIPKNLPFENCELKENGKVIYYTENADLEIPKIFEFAHEN
                     GLKIQEISYKKPNLNDVFIKLTGREIRSEKDKNQKSLLPMGKRRRF"
     CDS             complement(174493..174951)
                     /codon_start=1
                     /locus_tag="MMKA1_01730"
                     /product="putative transcriptional regulator PadR"
                     /protein_id="BAP60290.1"
                     /transl_table=11
                     /translation="MKHGKKVKELIKILILKFLEKENLHGYLLISNIKEITGISVSPS
                     MVYPILSNLKTAGLIEVEKTEDRGKKIYKLTKDGHSFLEKNQVKVEYCMKKSEALYYF
                     HNFGGIELKKALHLAFEEFIDMDDEKRKKIGEIMQKCAKDIRYQIEYGDD"
     CDS             175064..176191
                     /codon_start=1
                     /locus_tag="MMKA1_01740"
                     /product="putative peptidase M50"
                     /protein_id="BAP60291.1"
                     /transl_table=11
                     /translation="MELTSTAVMLFFLIFWTVLYIINHNKDKLGINLDLKTYMGIFGI
                     LRTQVGMNIIKKFGKYKLWQKLAYLSIPVCVVISIYTFYAFILSTVGLFDGTVEKEAA
                     KPIIFLFGSTIPWIPGILAIIIGVTIHELSHGIVAASFGQKIKSSGLLLALGIPMGAF
                     VELGDEFKDSKPKLRGAIAAAGPISNVLVFFIVLFAMPYFTGMNSKLTITDVLEDTPA
                     YGIIFEGDVIYSINGKMVNSLNDFYDAVGDIQPEQSVELVVLRNNEINSYYITTSEEG
                     KMGIVSEPSKTVMYILQTLYWTSLLNMLLGFFNLLPAAPLDGYHIWMALPDAIRDFRK
                     NNWFVSKIANLVGWVISERNLNSISIFVWLAILASMIYSFI"
     CDS             176213..177070
                     /codon_start=1
                     /EC_number="6.3.2.-"
                     /gene="cofF"
                     /locus_tag="MMKA1_01750"
                     /product="gamma-F420-2:alpha-L-glutamate ligase"
                     /protein_id="BAP60292.1"
                     /transl_table=11
                     /translation="MITIACAEGGSTIYSLKKAIEDLGEKCNILLLSSDNLLVDTDFN
                     IETDLIHSRCGIGDYLDRLTLFSWQVLKNLESEGHYFINPLETIYNSSDKFKTTKILS
                     KNGLKTPKTALIRDYADAKHFLDTKNMNYPVILKNSFSKCGMKVQKASADDELKKLSK
                     NSIWESKLIQEYVDFKNGDTYKDMRILVIDGEVVGGYRRVSNNFITNLYVGGQIEPLN
                     VSSELEEIALKCSECMNGYIMGIDILPKDGEYYVVEVNTAPGTKGFRSLGIDVDKRIA
                     ECLIKYKKS"
     CDS             177074..177820
                     /codon_start=1
                     /locus_tag="MMKA1_01760"
                     /product="hypothetical protein"
                     /protein_id="BAP60293.1"
                     /transl_table=11
                     /translation="MIKVFESLLISFSFVLLSLILIFKEKLGIGKEIFIAEIMALIQL
                     VVLGYVIGIVFNLGIYYASIMILFMVSVSAFMVKRNVTKEKNRKIVCAAFLSTITITI
                     ISLIILTVSKTVLFEVRYLIPLMGMVIGNSTNAMSIGLERFLNDLKSEKDVLWGYLAL
                     GATEKQAVNTFVKKAVRAALTPHLNSTKAVGLIFIPGAMVGMLLAGVDPLEAAKVQIT
                     IMWMIMASNIFSVTIACYLLYKEFIHQISS"
     CDS             complement(177823..178107)
                     /codon_start=1
                     /locus_tag="MMKA1_01770"
                     /product="hypothetical protein"
                     /protein_id="BAP60294.1"
                     /transl_table=11
                     /translation="MNIDLFTIVNSLSDLLFNQVYDLCGMFYPMFIGGIVSMFVFFVF
                     KSVNKSIIALIVTAIVIFALPTTPYECRLVAVILAAVSSVFFVILFRKVR"
     CDS             178189..179391
                     /codon_start=1
                     /locus_tag="MMKA1_01780"
                     /product="hypothetical protein"
                     /protein_id="BAP60295.1"
                     /transl_table=11
                     /translation="MLIVDINHGALDLALEYEKSGKVPVIWDIYGKLERDKNFKEENK
                     NILSKFKIISKKETPEFSNYNEVIAPVHCPIDVKFKTFHEAVSEIISKKYPKTVEKMI
                     TVTGVKGKTTTTELLKHILSEKYSVFCHNSSDGSITPVTVLNILNKLNEEKKLQIYDF
                     LIFEISLGIVSSNYSILTNILENYSIAGGRREASIKIDSLKNSKIAFVNEDLKNRFKI
                     FNKNLKVVKNAKIISKYPLKFNYSKNDFEFNESVFGSHFIENSVFAIELCSYFMSFEE
                     IKNSLKSFEIKNRMNVETKNNYAIVKNINPGLDLKAIDYAIFDFLNLFETGTIIVGGD
                     FGCTCEEIDIKKLAYLIKKYDRDGVKFLLSGSVGKSLKEIINLEFVDINNYAVEENTL
                     VIYRSKLC"
     CDS             complement(179388..180764)
                     /codon_start=1
                     /locus_tag="MMKA1_01790"
                     /product="hypothetical protein"
                     /protein_id="BAP60296.1"
                     /transl_table=11
                     /translation="MSKLKIIRDPIHKDIKLNEEEISIVDMPEIQRLRNIKQTGLTCL
                     VYPSANHTRFEHSIGTLHVAGEIAKNLENIDKNLTKIVALLHDIGHPPFSHTLEVAGY
                     DHEEFTKEKIKRMNFENYTSKEVLDVYSSKGLEGSLIHGDVDADRMDYLVRDSHHTGV
                     AYGSIDIPRLIRSIVVIEDTNKLGIIEKGRTTVESLLTARYQMYPTVYMHPTSRISET
                     MIKNATIDAIKDDIFKLRDLSLMDDIDLICTLRRSEGSSNEIMRKIDARDLFKSISVQ
                     RYNELSPKERWNLINLSENELGIIENEMSDFFGSRIFLDIPKPPKMAEHRITVIMGDK
                     KQRLDEISPLAESLKDAYKKSWSVMVYSEPETAKKSSEIVKDKNKFLFDFISDEIIDN
                     NILNVLNEQGTVQGVTKLAGLVKKSPNDTEFHSELQKLIFCGLVDKKVEPVRGTYRYD
                     YTAAQLDD"
     CDS             180907..181371
                     /codon_start=1
                     /locus_tag="MMKA1_01800"
                     /product="hypothetical protein"
                     /protein_id="BAP60297.1"
                     /transl_table=11
                     /translation="MEFKNNSYFVDNVSENISILSLLKEYEERLSGFEKDSFKVKEPY
                     VYVKFCLYTTLLFRILEKEISKITLSEDEEKTVNILKKYKYRDFEAPYEENYIKFTVW
                     KNESGTLVYQLCDLRENESSSENWNKIYSVYMIHPKYFKHIKKIVLKLINEN"
     CDS             complement(181396..183762)
                     /codon_start=1
                     /locus_tag="MMKA1_01810"
                     /product="CDC48 cell division cycle protein"
                     /protein_id="BAP60298.1"
                     /transl_table=11
                     /translation="MVDLMVAEAYQGDVGKGIVRIDPLTMEKLSLKAGDAIEIAGKEK
                     TYATVWRGYLEDQGKGIIRMDGILRQNTKAGIGDKVKITVVEVKEAKKITLAPMQAVR
                     FSTGFESYVGSRLVEQVVDKGSKVVIGVLGTAFPFIVTGTTPKGPVKINEYTQIELKT
                     EPVTELKETKVPNVTYEDIGGLKEEVKKIREMVELPMRYPELFDKLGIEPPKGVLLAG
                     PPGTGKTLLAKAVANEAGANFYTINGPEIMSKYVGETEENLRKIFEEAEENAPSIIFI
                     DEIDAVAPKRDEASGEVERRMVAQLLTLMDGLESRGQLVILAATNRPDSIDMALRRPG
                     RLDREITIGIPDRHARNEILQIHTRNMPLQPDYEKSDVISILNELVGEYDRSKIETLV
                     KLVEKASSEEEIEKILKDGEVEDKVKVKLNQSMVKELADKTHGFAGADLAALSKEAAM
                     KTLRRFLPDIDLEKEEIPREVLDKIKVTKEDFVGGLKEVEPSALREVLVEVPNIKWSD
                     VGGLEDIKQDLKEAVEWPIKNKEMFERMGIRPPKGVLLFGPPGTGKTLLAKAVANESE
                     ANFISVKGPEIFSKWVGESEKAIREIFRKARQAAPTVIFFDEIDSVAPKRGMDFGSSG
                     VTEKVVNQLLTELDGLEEPKDVVIIAATNRPDILDQALLRPGRLDRIVLVPIPNETAR
                     LEIFKVHTKGMPIGKDVNLEKLAKETKGYTGADIEAVCREAAMIALRENINSEHVESR
                     HFDGAFKRIAPSVKDDDMDEYKDLAKEYGQNAGVSEIEKGPENTGYHG"
     CDS             complement(183875..184234)
                     /codon_start=1
                     /locus_tag="MMKA1_01820"
                     /product="hypothetical protein"
                     /protein_id="BAP60299.1"
                     /transl_table=11
                     /translation="MENWKLSHTTKCYSCGKIADQIIEIYPNQALVKCSNCNATRYYV
                     IKKADIEDENSLKEEVGVKRKYDNWVLQKDIDCARCGHFGPQDILITENGIYVRCRHC
                     GFTRYYRYHIHDPVGGK"
     CDS             complement(184370..185179)
                     /codon_start=1
                     /EC_number="6.3.5.3"
                     /gene="purQ"
                     /locus_tag="MMKA1_01830"
                     /note="protein synonym:FGAM synthase I"
                     /note="protein synonym:phosphoribosylformylglycinamidine
                     synthase 1"
                     /product="Phosphoribosylformylglycinamidine synthase I"
                     /protein_id="BAP60300.1"
                     /transl_table=11
                     /translation="MVPKVLVMSGYGINCETETAHAFQKAGAETDIVHINDLIAGKKK
                     MADYEIIMFPGGFSYGDDTGSGNAFANKIKNNLFDDLKEFINSGKLILGICNGFQVMT
                     NLGLFALPSTDYGERISALEANTNNRYECRWVHIKENESICVFTKGINVTHVPIAHGE
                     GRFYCDEKTYHELKENKQIVFSYCDSEGNPANGEYPLNPNGAYQDIAGICDKTGRIFG
                     LMPHPERSLYSISEPEYQLKKEIAKRNGDIIPEFIESNLQIFKNAVEYFNK"
     CDS             complement(185189..188158)
                     /codon_start=1
                     /EC_number="6.3.5.3"
                     /gene="purL"
                     /locus_tag="MMKA1_01840"
                     /note="protein synonym:FGAM synthase II"
                     /note="protein synonym:phosphoribosylformylglycinamidine
                     synthase II"
                     /product="phosphoribosylformylglycinamidine synthase II"
                     /protein_id="BAP60301.1"
                     /transl_table=11
                     /translation="MQTINAENNEKIYRIEIDTKEKSSEAKVIEKKLFELGYDVSVDV
                     SKVYTINYDFSIADVEKIADSLHNPVTEIPRINLPSNNKFDWALELGFLPGVTDNVAN
                     TTTEIINDLLKIDIGLSKVFSSKVVYLSGNLAKHDVEKIAEELINILIERYHIKTYDN
                     YVKDCGMDYIIPKVNLTSEPKVIEISLNVSNDELIEIGKKGILDPETGERRGPLALDL
                     DYITAIKEYYQKEGRNPTDIELEALAQTWSEHCKHTIFASQIDDIEEGIFKKYIRNAT
                     NEIREELGDKDFCISVFSDNSGGIIFDDEWMVTDKAETHNSPSALDPFGGAITGIVGV
                     NRDTVGFGLGALPVANKYGFCVGRPEDTEIIYRGQNKTNPSLLPRRILDGIVHGVNVG
                     GNQSGIPTPNGFVYFDDTYKGKPLVFVGTIGLIPRKLPDGRLSHEKAAENGDNIVIIG
                     GRVGKDGIHGATFSSEAMDEGSPAAAVQIGDPITQKKLSDAVIKEARDKGLYNSITDN
                     GAGGISCSVAEMAEECGGFVVELEEVPLKYPGLEPWEIWISESQERVTLSVPDDKLEE
                     FMDLMKIRGVEAVVIGKFNSTDRAVVNYNGKTIMDLDMDFLHNGLPKRKLITKPYSYR
                     TEEPKITVENQLETFEKILGNHNNCSFEYISKQYDHEVQNNSVIKPLQGKGRVNGTAS
                     VIKPLLSSQKGLVMSQSLFPRLSEISCYDMAACAMDTAIRNCVAVGGNINHIAIMDNF
                     CWCSSDEPERLDQLKDAAKSCYDYAKTYLTPLISGKDSMFNDFKGFDENNNPIKISVH
                     PTLMMSALGVIDNIEHTNSMDLKLKDDLIYVIGETKDECGGSEFYHAFGEVGGKSPKV
                     DAKSARKLYEKMYELSQKGIFSSCASVAAGGLVITLAKMAISGCLGLEADLSKAPNEN
                     ISFEKIMYSETQSRFIVTIAPENEKEFGNLINEFKIGKIGKVTEKEFVIKNNNDIVIT
                     SSLENMDEVYRSRFEDF"
     CDS             complement(188333..188803)
                     /codon_start=1
                     /EC_number="2.5.1.9"
                     /gene="ribC"
                     /locus_tag="MMKA1_01850"
                     /product="riboflavin synthase"
                     /protein_id="BAP60302.1"
                     /transl_table=11
                     /translation="MTVKVGIADTTFARVDMASAAIKKLNEMTSNIKIIRYTVPGMKD
                     LPVACKKLMEEQGCEITMALGMPGGKDKDKVCAHEASQGLMMAQLMTNKHIIEVFVHE
                     DEAVNGKELDWLAKRRAEEHAENVYYMLFKPEFLQKSAGKGLRQGFEDAGAARK"
     CDS             complement(188947..189159)
                     /codon_start=1
                     /locus_tag="MMKA1_01860"
                     /product="hypothetical protein"
                     /protein_id="BAP60303.1"
                     /transl_table=11
                     /translation="MEFILPSNIRSGAMHFKMKHTVQAKKNKTKIRELFSKAGEYKEF
                     YHDAISKIEERENNAKKGRRTKKAKK"
     CDS             complement(189329..190072)
                     /codon_start=1
                     /gene="ribB"
                     /locus_tag="MMKA1_01870"
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="BAP60304.1"
                     /transl_table=11
                     /translation="MTTDSKNARNSEIKIQGDEKISNVEKAIDALKSGKMVLLYDSDD
                     REGETDMVVASEFITPEYIREMRKNAGGLICTCLHPDFCDKLGIPFMVDILDVASEKY
                     PVLKELYPNDIPYDEKSTFALYANHRTTFTGITDNDRALTVKKITELCSEERFNDFGK
                     EFRCPGHVAFLRATDGLVKNRQGHTEMTVALAEMAGLTPITTICEMMGDNGKAMSKDL
                     VKKYAEENDLVRINGQELIEYYLNEFSKE"
     CDS             complement(190193..190576)
                     /codon_start=1
                     /gene="rfk"
                     /locus_tag="MMKA1_01880"
                     /product="riboflavin kinase"
                     /protein_id="BAP60305.1"
                     /transl_table=11
                     /translation="MEIFGQVVSGLGEGKFFVGLTPYKNKFEELTGFTPFEGTLNVKL
                     KHNFNLDEFNPIEFDGFEIDGKTYFGGKVLLIKLFNKHGNFINCAVVAPKKTDHSKKT
                     LEIIAPIQLRKFLSLNNSDVVKLVI"
     CDS             190685..191446
                     /codon_start=1
                     /EC_number="2.4.2.28"
                     /gene="mtaP"
                     /locus_tag="MMKA1_01890"
                     /product="5'-methylthioadenosine phosphorylase"
                     /protein_id="BAP60306.1"
                     /transl_table=11
                     /translation="MIGIIGGTGISSILNKGEERIIDTKYGKSKVLIDKESDVVLLFR
                     HGAEHNTPPHKINYRANICALKTLGVERILALSSVGSLREDVVPGDFLIPNDFLEFTK
                     ARKSTFYDGDDGKVVHVDVTEPYCSELKEVTKEILKKRDYKFNEGVYVCTEGPRFETK
                     TEIQIYKNWGHVVGMTAYPEVVLAREMEMCYTSICNVSNYAAGISKNVLTVDEVLETL
                     KEMEEKILNVVDDFINYEFKERTCFCKSALENAVM"
     CDS             191461..192081
                     /codon_start=1
                     /locus_tag="MMKA1_01900"
                     /product="hypothetical protein"
                     /protein_id="BAP60307.1"
                     /transl_table=11
                     /translation="MKTFEISESNLKNCEKEIETAKKMILGGKIILCGTDTLYGLSTN
                     ALDKNAIEKIYLIKERDPKKPISISLGEKKQIENYVYVDETAKKIIEKFMPGPITVIL
                     KKKDIIPDILGKDDVGVRIPDNDVIRNIAVVPLTTTSANISGKTAPTSLEEVDQIIKE
                     KVDLIVDTGPCKYKVQSTIVKVIDGKIELVREGKIPFEEILKAVNE"
     CDS             complement(192149..193429)
                     /codon_start=1
                     /gene="thiC"
                     /locus_tag="MMKA1_01910"
                     /product="thiamine biosynthesis protein ThiC"
                     /protein_id="BAP60308.1"
                     /transl_table=11
                     /translation="MTQMTDAKSGITTEEMKFVAEEEGMDVETLKNLIAKGYVVIPKN
                     VNRNTKPVGIGDNLRTKVNVNLGTSPDFIDIACELKKVEISNKYGADAIMDLSTGGNL
                     PEIRKEIIKNTNLPIGTVPIYEVGVDAKEKYGRVIDMDEDLIFNVIERQAKEGVDFMT
                     LHCGITKQTVSALNNDPRKMGVVSRGGAFLTAYIMYHDKENPLYKEFDYLLELLKEHD
                     VTLSLGDGMRPGCLQDNTDRAQIQELITLGELVDKCREKGVQVMVEGPGHVPYNNIEA
                     NMKIQKTLCKNAPFYVLGPIVTDLAPGYDHITAAIGGTLAAVSGANFLCYVTPAEHVR
                     LMKEDDVKEGLIASKIAAQAADVAKGHPVAWKLEKEMADARIKHDWERQFEIALDSDK
                     PRKMREEIPSKDEKACSVCGDYCALLMVEELGKR"
     CDS             193519..194448
                     /codon_start=1
                     /gene="dph2"
                     /locus_tag="MMKA1_01920"
                     /product="putative diphthamide synthesis protein DPH2"
                     /protein_id="BAP60309.1"
                     /transl_table=11
                     /translation="MWDLETDRVLNEIKTRNARKVLLQAPEGLKRAVEKEIVFLKTKV
                     DAELMIWGETCFGACDLCDEEVKILGIDLIIHYGHEELSYVHSEIPVVFVHAYFKENE
                     YFLKDVEIILEKMENPTVTTTIQFKKALSKFNPVVILGCRAPVENAQNVLFVGTGRFH
                     PLMMAYKLKKTVKIYNPITREISEISDQEIKKLIKLRIGRVSKLLLNPPKKIGVVLST
                     KKGQCRLKSFENVIELLKKNNIEYIPIILNNLSQSYLFYKVDAYVICACPRIVMDDYQ
                     NYESTLITPEELRMYLSNDFEYKFDEILENNFY"
     tRNA            194533..194617
                     /locus_tag="MMKA1_t0110"
                     /product="tRNA-Leu"
     CDS             194952..195281
                     /codon_start=1
                     /locus_tag="MMKA1_01930"
                     /product="hypothetical protein"
                     /protein_id="BAP60310.1"
                     /transl_table=11
                     /translation="MIRICPKCLKAVVHYDKEYLTGKVRPVFVDTENKCCGYLQTDSV
                     FNNAKCSKLQILKTQAGKISKQLNLSEELKYEFFENLKRFKRTHNEWKDYRVLEEALK
                     VTHFFIF"
     CDS             complement(195306..196010)
                     /codon_start=1
                     /locus_tag="MMKA1_01940"
                     /product="hypothetical protein"
                     /protein_id="BAP60311.1"
                     /transl_table=11
                     /translation="MIKSNITIDGIPAILWGKEQNRVFIAVHGNMSCKDDTVIQMLSE
                     IAVKKGYQVLSFDLPEHGDRKNDKTPCKVDICVNDLEKIMKYAKNHWNKISLFACSMG
                     AYFSLLAYPDENLEKSLFLSPVVDMKRIIQNMMNWFDVTPERLEKEKEIETPIGQKLY
                     WDYFCYVNEHPIKSWNFKTSILYGSKDELCEYDTVNNFVKQFSCNLEIVKSGEHYFHT
                     KEQLNSFENWLKKEIE"
     CDS             196354..197379
                     /codon_start=1
                     /locus_tag="MMKA1_01950"
                     /product="hypothetical protein"
                     /protein_id="BAP60312.1"
                     /transl_table=11
                     /translation="MKKFLVGFILFSMVFSVIPGAVAIDYDIIVGQNGKVGTLALNAV
                     GDTLYFNYAINSPWELCEVHLTALNEVPEADKENIWFTNGYITKTGNPKVGQFEINEE
                     FDPYLTEYSSSLNIGELGNSNLTIAAHALVCRQGDEIMDYGYEPTDYPWAINYSNYIN
                     GSPDSTDSWRYDPLLCLNETDSSNQGTKTFTSLGHGGSIELYFDGSICGDGDNSTPDL
                     EIYEVTYNQNTNWVESIGIEAYYNGNYYLVGNATNNLGSTTGVTNMFINCIYDLPSGV
                     CIEKIRINDTLSTHDYDIDAVKANYKCVPIYNCICESAWANDTCFGGETFPGNNWATY
                     VIYPECD"
     CDS             complement(197591..198745)
                     /codon_start=1
                     /locus_tag="MMKA1_01960"
                     /product="hypothetical protein"
                     /protein_id="BAP60313.1"
                     /transl_table=11
                     /translation="MKKFLILAIIALSMLVSADARDIEYNMTINESGTYVLSEDMLVN
                     YGGIRINTSNVVLDGQNHQIICNNSVGTGIYVGAYEYLIENTTIKNLKLKNWSTGIFI
                     ESNVKNVTITNCEFEDNEYFLNSGAVEQYFYLNTIHEGQLLFGPEDEDDFIMSSPKLV
                     YNYNGKEYTYRLGNYYEGYTGTEIEDEGVYSNIYEITYEYGEGNSTLYDAYPLVSTSK
                     NYEVLETLYPPLESEKRVLIADIFALDSKSKNYIITEAPVTPTTTSSPASGGGGRSYD
                     SDISDEISSKVIKNFVSSATVIYGNEIDENYANQLRERVQNAEGFTISGNAVIVGGPL
                     ANGFAREYNDQFEMPISNDYPGENKGIIQVLKVQDNSGNVVKSYTIVYIA"
     CDS             complement(199004..201130)
                     /codon_start=1
                     /locus_tag="MMKA1_01970"
                     /product="hypothetical protein"
                     /protein_id="BAP60314.1"
                     /transl_table=11
                     /translation="MIKKCLLFLLLLFVVGSVSAVPDYTIDETDFENTTHIGTYDVFV
                     FINESGEYNVTADFVNTSYLDHKIVIMIKDTENVVLNCNDNWINAPSTGLNHAVYIIN
                     STNVTVKNLKSDWSSVECIHIENVNNTVIEDSEITSKNRGISIFNVEDCGIIGNKITS
                     TEYNSDTRGIYLMGNVINSTITENNITSNFTGIYIGSSSENNVISANTINSTSQGMQL
                     VGSKNNLISGCNIYSIDGYTLTLTDSENNLISGCNVTTPDDYGVYLGNSDNTSIINST
                     VNAATNTIDLNSDNCTVMGSTIRADQYSGLEVSYTGNNIIDCTIYAQYEALTLSGSDN
                     NVSNCTLTGNHELVSLSGSDNNILRSNMWATTYNALTVGGTYQNVIDCTITAQNNTLY
                     VNGQNIEINGSDINSNDIAVKCISASYWNRIYLNNINGSVDNQGPSNYFTSKNEVNYT
                     YAGKNYTGILGNYWYLYDEEDAVIENGTWNIPYVININTNDSKPLAGPWDKDTNSIFG
                     KIEYDDGKIHLTQADFATGLYIINKTGIYVLEENINSSMGIAIDSDNVTIDGNGFYMN
                     TSGVSTFMGSYENITIKNLGLNCDNGLNLANADNVTISSCVFLVTNAGIVADGENIVI
                     SSCNFTGIDNGWGINIISMQNGTITGCKFNNLMIGINTQGESAIGNCTITYNEFIENS
                     WGLNLNGEYNWIYLNNFEMENITGFI"
     CDS             complement(201355..201579)
                     /codon_start=1
                     /locus_tag="MMKA1_01980"
                     /product="hypothetical protein"
                     /protein_id="BAP60315.1"
                     /transl_table=11
                     /translation="MVDLSKYDTYELIKKYRVYFKEGEKPAKITIEKYLKTGEYYAIL
                     KLPDGKKFSSHPTKTPEDALNDPVISFNVK"
     CDS             201873..202691
                     /codon_start=1
                     /locus_tag="MMKA1_01990"
                     /product="hypothetical protein"
                     /protein_id="BAP60316.1"
                     /transl_table=11
                     /translation="MSNKKIITSFLLLLVILSSISAYGNQNKGYGQNQGGQVYQLYDD
                     TQVNHQQEIGSYPVEELRQEEIDGLLLMREEEKLARDVYLELYDIWGQQIFLNIANSE
                     STHTNAVKLLLDKYNLTDPVTNDTRGAFTNQDMAELYNVLVEKGSVSLLDALTVGATV
                     EDLDINDLKKLNGISDNQDITAVYNNLEKGSRNHLRSFTRVIEQNGGIYEPQYISESE
                     YNEIISSEMETGTGYSANPAVQTEQSNQYNASSSNNESKNVFERMWQGFMNWFR"
     CDS             202864..203208
                     /codon_start=1
                     /locus_tag="MMKA1_02000"
                     /product="hypothetical protein"
                     /protein_id="BAP60317.1"
                     /transl_table=11
                     /translation="MSKKWRGCDYMSDLIDKELLNYLYGLKTREKTFKVDINEVFEEF
                     NVEKKERLMESIETLSLEKMIYIQGNSIEGFKMGISDNDPIFLIITRKGISNIETNEK
                     MSHDKLSELFKY"
     CDS             203391..204452
                     /codon_start=1
                     /locus_tag="MMKA1_02010"
                     /product="putative iron compound ABC transporter
                     periplasmic binding protein"
                     /protein_id="BAP60318.1"
                     /transl_table=11
                     /translation="MRTYLVLFSILLVFLAGCISTESKVEDTTTAVTFVSVTDFTGET
                     STINSPVERVVSNYGLIPPIIYLFGEGDKIVAGRGVMGADEFIDAVDPEFKTRSKDIK
                     SDNVEEIKSLNPDVIFAPSWGSQQGQYPQLKSLGIPVVFIDIETASNYYKTIEMMGEV
                     FQKEAYAQELIDYYNQSTNDVLKRTASISENEKPRVLFLVYDQRKNSYWTPGGEFYQN
                     NLITMAGGKTVSSDLPTGKAQINVEQAASWNPDVIITSAHTMEYPSTKVKEDVLTDEG
                     WKEINAVKSGNVYAMPFDGESWDTLGPKYVLGLYWTAKTLHPDMYTDVDILNLTSSEY
                     ERFFNVSIDEVTLVGDNIE"
     CDS             204445..205395
                     /codon_start=1
                     /locus_tag="MMKA1_02020"
                     /product="putative iron compound ABC transporter permease
                     protein"
                     /protein_id="BAP60319.1"
                     /transl_table=11
                     /translation="MNKNYVFPFLFAGVFLFSLFVGRYMFDPSLIFTNSLANNIFFDI
                     RLPRAIAVSLAGASLALAGVSFQNIFKNYLAGPNILGVTSGSAFGASIAILFFAYNPY
                     LVQFSAFIFGVIAVYIAYKLSSLLKSGIVGLILSGMAISAFFSAMIGLIKYVADPYEK
                     LPTIVFWLLGSFVGLRWVDLGISVIPMLIGIIGLVMLKWVFNILATGDENAKSLGVDS
                     KKLKNITIFLATLAASASTSLAGMIQWVGVVSPHIARLLVGVDNRKLVPASAFVGATL
                     LLLCDTLARTLTPSEIPISIITSFIGAPILIIILSKRGVK"
     CDS             205395..205595
                     /codon_start=1
                     /locus_tag="MMKA1_02030"
                     /note="fragment"
                     /product="putative iron compound ABC transporter
                     ATP-binding protein"
                     /protein_id="BAP60320.1"
                     /transl_table=11
                     /translation="MLRIENINFNYGKNKILNDCSFKLDSGIGCILGPNGAGKSTILK
                     CISGIVPVKSGSITIDGKKLPK"
     CDS             205592..206176
                     /codon_start=1
                     /locus_tag="MMKA1_02040"
                     /product="putative iron compound ABC transporter
                     ATP-binding protein"
                     /protein_id="BAP60321.1"
                     /transl_table=11
                     /translation="MKYKDRSRLISYSPQEFSINFPYTVFEVVLMGRNPHVNFLAGPS
                     KKDEQKVTEILNLLKISHLKDKEFISLSGGQKRLVMIATALIQDAKLMIFDEPTSFLD
                     YKNQYLVLSVIEKISKEMNKTVLLSLHDPNLAFLFCDNLFLMKNGKILSEIADKNSVC
                     PENFQELYGINTKFADIFGQKVVLPDKDYLKTMI"
     CDS             206206..206982
                     /codon_start=1
                     /locus_tag="MMKA1_02050"
                     /note="Belongs to the Protein of unknown function DUF364
                     family (IPR007161)."
                     /product="hypothetical protein"
                     /protein_id="BAP60322.1"
                     /transl_table=11
                     /translation="MIVDDLADKTLEILKNGDKLTLKEYSIAIPYAYVIVEGEKGVKM
                     GVSMVLDSKCHYRRDFEETSLESIIECAKGYNLTERTLAMAAINAVSQYYIDFTESKN
                     EDVLDLIVSDKDIKKIGFVGNIAPVVNELREIDGKNYEIYVFERNSSSCGAELLDDTF
                     EYRLLPEMDAVIITGTTLVNDTIDVVLERSKNAKLKILTGPTAQINPDFLKNSGITHT
                     ASTRVINIDKTVTDLKHGSSFGIFSRNSSKYSMKVKDNNE"
     CDS             206991..207584
                     /codon_start=1
                     /EC_number="1.2.99.5"
                     /gene="fmdE"
                     /locus_tag="MMKA1_02060"
                     /note="MM1_Con085_0013 and MM1_Con113_0015 are similar to
                     each other."
                     /product="molybdenum containing formylmethanofuran
                     dehydrogenase subunit E"
                     /protein_id="BAP60323.1"
                     /transl_table=11
                     /translation="MKKMNDVLSKVTDKEYLKQIEDVIKFHGHLSGGAFIGIQMYNIA
                     KKVLDIKDTDRVYANCETRNCMPDAFQVLGNCTTGNKRLSIKDYDIMAVTVNKIIPEN
                     EVGTGVRIVFDHKKAEKYPALYNWFMNIKKVPHEEVISDLIDAGDSIYSWKSVEIHVS
                     EKKPKFSAVCGLCGESFIKKGTDDENICPNCAEKSAE"
     CDS             207611..208738
                     /codon_start=1
                     /gene="moeA"
                     /locus_tag="MMKA1_02070"
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="BAP60324.1"
                     /transl_table=11
                     /translation="MKTADEVQNILNGFTCNREVSVEIYESYGRVLFDDVYSKVDVPL
                     CDKSTVDGYAITNEGLNNDFLVISDEIHAGDPADMLINPGKCIWVATGSNIPKNTDRI
                     IPFENTINSENTIRIVKMTKNSNIFKKGTDIPKNTKVLDKNTLIDEKAIGILASIGMD
                     KINVYDTPKVAILSVGSELSEINEVNSKTLTAIVRKAGCEPVFLGVVEDSIEKITSAI
                     KNAVLQYDIVVTSGGTSKGKKDYMFEIISSIGDILFHKVKSIPGMPIFAGKVSEKPII
                     CLPGNVASCLVCGYAYLLPMFLNAAHKTFKRELVTADLSEEFNSELGIKHYFPVKLKD
                     GIAYPAFRGSNMITSIANADGLVDVSENEVKVRKNVKIWLI"
     CDS             209574..210530
                     /codon_start=1
                     /locus_tag="MMKA1_02080"
                     /product="hypothetical protein"
                     /protein_id="BAP60325.1"
                     /transl_table=11
                     /translation="MFGWLDYGARYIVENILNMSMDTAIGSSVHFFIYDSLKIVILLS
                     IMIFSISYIRSYFPPEKTKKILERYSGVSGNIMASLLGTVTPFCSCSSVPIFIGFIEA
                     GVPLGVTLSFLITSPIVNEAAFAVLLASFGWQIAMIYVVSGVLIGVVGGLIIGKLGME
                     NQVEEYVYSIRSRARKIKELTQKERLKFAYDSTRDIVKRVWLYILIGIGIGAIIHGYA
                     PEEVLAKYAGPENPLAVIFATIIAVPLYSNALGTIPIAEALIGKGVGIGTALAFMMAT
                     TALSFPEAVLLRNVIKPKLIAVFFGITSIAIVITGYLFNIIL"
     CDS             210571..210804
                     /codon_start=1
                     /locus_tag="MMKA1_02090"
                     /product="hypothetical protein"
                     /protein_id="BAP60326.1"
                     /transl_table=11
                     /translation="MKITILGMGCKKCVEVYDNVKKAIEELKIDAEVLKITDAAKIAE
                     YVMSTPGVVVDDEVIFEGKVPSVEEIKNELSKL"
     CDS             210874..211404
                     /codon_start=1
                     /locus_tag="MMKA1_02100"
                     /product="putative flavoprotein"
                     /protein_id="BAP60327.1"
                     /transl_table=11
                     /translation="MFKDKNIVVGICACSPAIKTLDLIGQLRERGAEVDVIMTPNSVN
                     FVSPLMVQREAKRPVQIEAFELPKMYDPNHKSLSQKADLLILAPVSANTLGKAANGIA
                     DNLLATTIMSTKAPIIAAMHINPMMYSNPAVQRNIKQLKEDGFIFVDNGNEETPSKFP
                     EISQIMSTVEQALNQK"
     CDS             211930..212733
                     /codon_start=1
                     /gene="modA"
                     /locus_tag="MMKA1_02110"
                     /product="molybdenum ABC transporter periplasmic-binding
                     protein"
                     /protein_id="BAP60328.1"
                     /transl_table=11
                     /translation="MAKKSSGIITGLITAILLSAMLLFAGCVSDSSSAEETTTITVSA
                     ASSLTDAMTDIAAAFEEDNPNINVELNFAASGSLRQQIEGGAPVDVFASASKKHVDIL
                     EDENLTSAGSRTNFASNSLVLIVPAGNPSNISSVENLTSDAVTKVSIGNPETAPVGKY
                     AKESLTDSGLWDELEEKMVYGENVRQVLTYLETGDVDAGFVYMTDAKIAKENSIEIIT
                     TVPIVTEIIYPVCIIDSSENKEEAQVFLDYLTSETGKQILTDYGFTAEN"
     CDS             212743..213408
                     /codon_start=1
                     /gene="modB"
                     /locus_tag="MMKA1_02120"
                     /product="molybdenum ABC transporter permease protein"
                     /protein_id="BAP60329.1"
                     /transl_table=11
                     /translation="MDSIVFPLVLTLKISFISTFFVVIFGVILSYILARKRFYGRDIL
                     KNLVTLPMVLPPTVLGYLLALQLGKNGFIGSLIYKFTGSGILFTWQAAVIAAFIVSFP
                     LMVKTTTAAISAVDRELEYVSYTLGKTELQTIYKITLPLSKKGIVAGAILSFARAVGE
                     FGATLMVAGNLPGKTNTMSLSIYQAFQTGNYDLANVLVVLLIIMSFLTIFLTGRFVEK
                     WKF"
     CDS             213418..214560
                     /codon_start=1
                     /gene="modC"
                     /locus_tag="MMKA1_02130"
                     /product="molybdenum ABC transporter ATP-binding protein"
                     /protein_id="BAP60330.1"
                     /transl_table=11
                     /translation="MILEIDIEKNYYESKKLKKNKTPSFNLKSKFSIDSGSIIVLFGR
                     SGSGKTSTLGCIAGLLDPDNGRIIVNNEIYYDSDKNINMSPQERNLGYVFQNYALFPH
                     LTVKENIEYGIKHLSEEETERRVSDLLTLTQIEGLENRYPDQISGGQKQRVALARALA
                     PNPKILLLDEPFSALDMISRMRLRESLRSIQKELKIPVVFVTHSFEEAFVMAEKVVTF
                     HNGRIQQIGTPEEIFYNPINASVAELVGYINIFSNAEIDYNENSSDFSILDYQDMKMS
                     IKKFNKSMNEVSFGIRPENIKLIDINSEKTENVFECIIKDVVNEGSTSLVYLEVIQNG
                     LRLMSKTQNDKFKKLNYAVGEKCKIELLKDKITILMTQSVKKIDLN"
     CDS             214715..215944
                     /codon_start=1
                     /locus_tag="MMKA1_02140"
                     /note="MM1_Con037_0005 and MM1_Con085_0021 are similar to
                     each other."
                     /product="putative aldo/keto reductase"
                     /protein_id="BAP60331.1"
                     /transl_table=11
                     /translation="MQYREIKKNGDKISALGFGAMRLPTKNGSIDKERAKKQIYYAID
                     NGVNFIDTAYPYHGGASESFLGEILSENYRNKIKLSTKLPQWQVKKYEDMEMYLDIQL
                     KKLKTDFIDYYFIHSLSKDSWAKMKDLGVLKFLDEAKKSGKIKYACFSYHDNTETFKE
                     IIDAYDWDACLIQYNYLDEQNQAGIEGLKYAASKGIGMFIMEPLRGGNLSKKVPKEAE
                     EIFNSYKVKRTPADWALRWVLNHLEVTCVLSGMNEEVHVKENLKVASETNPNSLSNEE
                     LEIYDKVKEVYRKLMKINCTGCGYCMPCPFGVDIPACFSMYNEKSIFNDKKTGFLYLA
                     RLGGVMGGEESHAGLCTNCGKCVKACPQNLDIPVLLKDVSTELGGKGFNLKIKLAKIA
                     MSIYSSFNSLKQKISKN"
     CDS             complement(215960..216514)
                     /codon_start=1
                     /locus_tag="MMKA1_02150"
                     /product="hypothetical protein"
                     /protein_id="BAP60332.1"
                     /transl_table=11
                     /translation="MENPSHVISKNLKKIRNENGLSLDAVSKLTGVSKGMLGQIEREE
                     VNPTITTILKIANGLKISFTSLLSEKEADVKTVELKKVSPIYDDSQKWRSYPLFTFED
                     SRPFEIYHVEADSGMVMSSEGHIKNSEETITVYEGELTLSIDENTYTIPKGNSIRFKA
                     DVPHKYENNGSEMTKMHMIIYYPK"
     CDS             216653..217552
                     /codon_start=1
                     /locus_tag="MMKA1_02160"
                     /product="hypothetical protein"
                     /protein_id="BAP60333.1"
                     /transl_table=11
                     /translation="MKKLLKKYELFLLIIPAVFFGAGAFITGKIGILELSWDELTFLR
                     FLIASAIILPLVLKTEHKNLKLKKNDAYIVILAGLFGMFGYHALFFMSLEYITAINSA
                     LLMATTPMVTSIIAAVVLGEYFGIKRIFAVFIAFFGVLLTITNGNLEVLKNLSFNIGD
                     VIMFSAVLCMALYAVLSKKVAQKYSPSVILTYGYILTVVLLIPYMILKNPINVILNAS
                     LETWLSIIYMAVFASVLAQLLQQISLKYHGASKTMLFYQFVPIIVIGLSAIFLKEPFT
                     KITAISTLFIMGGVYINSTIKRD"
     CDS             217648..218316
                     /codon_start=1
                     /locus_tag="MMKA1_02170"
                     /product="hypothetical protein"
                     /protein_id="BAP60334.1"
                     /transl_table=11
                     /translation="MNSFFETYRDLKYLLNRNYRKKSALDFVSNHYGLNAFERNFFGR
                     CVFSDDHLEVVNKKVTDLTKDFKTKSIAIDGFNVLITLESLIEGVAIFCEDNVIRDLK
                     YQKGYKLTEKSEEKIEIILKTMLKLNLNNFDVYFDEPTSKSGEISKITRNLMEKYSIS
                     GEVILSKKVDFELKHYEFVATSDFHIIKNVTGFLDIPKIVSKNYNLDVKNFLEIIKKG
                     KLEF"
     CDS             complement(218318..220042)
                     /codon_start=1
                     /EC_number="6.1.1.14"
                     /gene="glyS"
                     /locus_tag="MMKA1_02180"
                     /note="protein synonym:glycine--tRNA ligase"
                     /product="glycyl-tRNA synthetase"
                     /protein_id="BAP60335.1"
                     /transl_table=11
                     /translation="MDKYDKIIDLTKRRGFLWNSFEIYGGIAGFFDYGPLGAILKNNV
                     INTWRKHYIVNEGFYEIDSPTVTPYEVLKASGHVENFTDPLVECKDCLESFRADHIIE
                     ENIDVDTEGKTLQELQEMIEKNNIRCPKCGGEFKEVSTFNLMFATSIGPGGKRAAFMR
                     PETAQGIFIQFKRISQFFRNKLPYGAVQIGKAYRNEISPRQGVIRLREFTQAEGEFFI
                     DSRKKENFEKFESVKDMVLPLLSGKNQEDESLSAEEKIVRMSLSDAVKNGIIAHEAIA
                     YYIAVTKKFLMEIGIDESKLRFRQHLPNEMAHYAADCWDAELYTDRYGWIECVGVADR
                     TNYDLLAHMKNSGDDLSVFVELDEDKEVEAYEIELNYKLVGRTFKGDAKVLEESLKEL
                     DDKKMEELVEALETEGKYVLKTCKRDFEILKEYLTAKKVKKIVKGEKIIPHVIEPSYG
                     IDRITYCVMEHAFKEEEDRTVMGFSNAVSPIKVGVFPLVNKEGMPEIAMDLKNKLREN
                     GLIAEYDDSGAIGRRYMRMDEVGTPFCITIDGETLKDRSVTIRERDSREQFRIPINEV
                     VPYIKDKL"
     CDS             complement(220054..220935)
                     /codon_start=1
                     /locus_tag="MMKA1_02190"
                     /product="hypothetical protein"
                     /protein_id="BAP60336.1"
                     /transl_table=11
                     /translation="MKAFDIMKASQIACCFEVGSFKPGNVHKNRDYDDIKYHHFISSG
                     IAFGDVIHQACLEKNNIGNFIKKGVIESKKWSPTNANLGIIMLHMPIAIAASNLDKFS
                     ESQLKKETEKIIKNTTVQDAIDVYGAIEIALAFVNAPENGPDLKSKDAKDELIEKNLT
                     LYDVFKISSTWDSISNEWTENFKISYKGYNLIKEYYEKYNNINIAVTKTFINLLSNYP
                     DTLIARKKGIDVSKMVSEKAKEVLNNFNEESVLEFDKFLSKEGNKLNPGTTADLIASS
                     LLIFLLDRISNEKTILY"
     CDS             complement(220947..221498)
                     /codon_start=1
                     /EC_number="3.6.1.15"
                     /locus_tag="MMKA1_02200"
                     /note="protein synonym:nucleoside triphosphate
                     phosphohydrolase"
                     /product="nucleoside-triphosphatase"
                     /protein_id="BAP60337.1"
                     /transl_table=11
                     /translation="MKIYFATGNQNKVDEAKIILKEANCEIEQIEIPYAEVQGRLEEV
                     SAFGVLEVFEKFNRPVIVEDSGFFVEKLNDFPGTYSRFVQESIGNEGILKLLENETNR
                     NAYFKTVIGYYDGDNIKLFTGIVKGTISTEIKDGGFGFAYDSIFIPEGKTKTFAEMTT
                     EEKSEISHRKRAFYELKNYLENL"
     CDS             221614..222024
                     /codon_start=1
                     /locus_tag="MMKA1_02210"
                     /product="hypothetical protein"
                     /protein_id="BAP60338.1"
                     /transl_table=11
                     /translation="MAKPETGELNRFQLNLLSAFEGSVLSLDEIEKLYIEHKLKHYGE
                     DRESVKELIFDLEKGFFKLNDEVIKEYVEILYNVYNSPCKESIDRYEMILEDIGFKKV
                     EKYLEELEKSAYISKMGDGYNITEKGSEMLKHKK"
     CDS             complement(222047..224122)
                     /codon_start=1
                     /locus_tag="MMKA1_02220"
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="BAP60339.1"
                     /transl_table=11
                     /translation="MQKYILKGLWCAGCASKIEKLLKEQGYPSAVINMATSELILTEK
                     EIDLEKITKIVTSIEPGVIVIPKQSEIKITNEIDYKELKKIVISSVFFILGIFSSYFG
                     YSLSIQLLFFIVSYILVGQKVLKKTFQNIKRLNFFDENFLMSIATIGAFLIGEYPEGV
                     AVMLFYSIGEFFQNIAVTRSRNSIKSLVSIKAEYANVLENGETIKVKPENVQIGQIII
                     IKPGEKVPIDGIVLNGKSSLDTSALTGESTPKSINRGEEVLSGMINLSGLLTVQTTKN
                     FSDSAVSKILNLVESASINKTKTEKFITKFAKVYTPIIVFIAVLLAVVPPIIFNEPFV
                     PWFYKSLILLVISCPCALVLSIPLGYFAGIGRLAKEGILVKGSNYIDVLSKTTYVSFD
                     KTGTLTEGKFKVTKVVSKNEFSGKKLLEIAKMVECNSNHPIAKTIMDFGTISCKTSLD
                     DFEEFSEVLGKGIISRINGSEIIAGNEKLMEEKNINFEKLDVYETAVHFAVDGVYAGY
                     ILISDKLKKDSKETVLELKKLGIKKVSMLTGDKKDIAEKIASELNLDEYYSDLLPEDK
                     VKIIEEIEANKSKKETIAFVGEGINDAPVIARADVGISMGTLGSDAAIETADVVIMND
                     KPSKLISAIKISKKTQNIAFQNIFVILIVKIAFISLGIFGETTMWQAVFADVGVALLS
                     VLNAVRILK"
     CDS             complement(224125..224469)
                     /codon_start=1
                     /locus_tag="MMKA1_02230"
                     /product="putative transcriptional regulator ArsR"
                     /protein_id="BAP60340.1"
                     /transl_table=11
                     /translation="MSDLCSEYSVRNEKIKDIMEKLPSNEDIVNISNIMNSFGDPNRL
                     KILLALKESELCSCELSNIADTSISAISHQLRILRDRKLVKFRKEGKFVYYELYDEKI
                     RDFLEEIVELRK"
     CDS             224616..225299
                     /codon_start=1
                     /locus_tag="MMKA1_02240"
                     /product="hypothetical protein"
                     /protein_id="BAP60341.1"
                     /transl_table=11
                     /translation="MDFCISSVYFNDYLSIINSFFGKIAFVPIQVFLITVVISGILSD
                     MEKSSRLEKLNILIGTFFSETGTKSLKYFSKIDSLIDEIGSKLKVTDSWSDEDFKNAL
                     NYAKDRDYTLNASKEDIIEIYEFLSKNKEFLMRLLENPNLMEHEHFTELLRAVFHLLE
                     ELESRENLHESSENDIMHLNGDMVRSYRLITIEWVNYMKYLKNNYPYLFSLAMRRNPF
                     DKTAKTSLK"
     CDS             225669..226592
                     /codon_start=1
                     /EC_number="3.6.1.1"
                     /gene="ppaC"
                     /locus_tag="MMKA1_02250"
                     /note="protein synonym:pyrophosphate phospho-hydrolase"
                     /product="manganese-dependent inorganic pyrophosphatase"
                     /protein_id="BAP60342.1"
                     /transl_table=11
                     /translation="MMYVVGHKNPDSDSICSAIALAYFLDAFPARLGELNPESQFILK
                     RFGLMEPELIKTAEGKELFLVDHAEKSQNLDDFDKGKLIGIIDHHKIGISTTEPIIYL
                     SKPVGSTASVISELYFRGILDIIGGKNKELKADIAGVLLSAILSDTLLFKSPTATPLD
                     KELAEKLAKIAEISDITAYGMEMLTAKSTVGKMTPEEILNIDYKPFDMSGKKVGIGQA
                     EVIDISEVASKKEAIQNLIDEMIEKEGYDMVLFLLTDIMKEGSEVLVAGNKSAFETAF
                     KLKLDGKSVFIDGLMSRKKQVVPPLEKYYSN"
     CDS             226738..228207
                     /codon_start=1
                     /locus_tag="MMKA1_02260"
                     /product="Na+/solute symporter"
                     /protein_id="BAP60343.1"
                     /transl_table=11
                     /translation="MWHYLFLAVYVVMIIGIATITKKRIKGVSDFLLGGRNVNPWMSA
                     FSYGTAYFSAVIFIGFAGKMGWSFGIPTMWIVVGNTIIGSFLAWQVLGKKTREMTQRL
                     GASTMPSFLEKRYKSKNLESLTAFIIFFFLVPYSASIYKGLNFLFEGFGISPMNAYIL
                     MAALTAIYLYFGGFIAATLADFVQGCIMVIGVLLMVFFLGSNPEIGGFSGMLSNLSSI
                     DPMLVTPINEASFIPIIGLALLTSIGSWGLPQMIHKFYTIKSEKAAVSAKWVSTAFAF
                     IITFGAAYIGTVSRLFYPDAASKAAAGLTSPDMIVPKIMEIALPDWVAALILVLVISA
                     SMSTLASLVLASSSVVSIDFVKGRLKTDLSDRNTMILMRLLCVLFVVLSFILAIVPNS
                     YVLSLMALSWGLVSGCLLAPYFLGLYWKRTTKEGVWAGITSALAIMFGGAYYFGINSV
                     YMPAVGSLAMIAPIFVVMAVSLITKPFEREHIDYIFNKK"
     CDS             228404..229882
                     /codon_start=1
                     /locus_tag="MMKA1_02270"
                     /note="protein synonym:Na+/solute symporter"
                     /product="sodium/proline symporter"
                     /protein_id="BAP60344.1"
                     /transl_table=11
                     /translation="MISENLSIVLVFILYLLVVMGVGMYFYRRNETISDYVLGGRKLN
                     SWVAALSAQASDMSGWLLMGLPGVAYLSGMSEIWIGVGLAIGTYLNWKFVAERLRRYT
                     EIAKDSITIPVYLENRFRDQSKLLRIVSAFFIMLFFLLYTSSGLVAGGKLFNLVFGVD
                     YTLAVTIGALVIIGYTFLGGFLAVSWTDFIQGSLMFIAIFLIPIMGISQVGGIDATMN
                     AWNSISPDYLNPFTNLDGESLGIMGLASALAWGLGYFGMPHILVRFMAIKSADKVPKA
                     RKIATTWVVISLFMAVLVGMVGAVALGAPLDDPEHVFMAMAQGLFPSLIAGLFLAGVL
                     AAIMSTADSQLLVTASAITEDIYALLNKNASQKELLWISRFAVIVVAAIAYYFAIVPG
                     SSVMALVSYAWAGFGGAFGPVILLSLYWKRMTRNGALAGLLSGGFMVILWKNLSGGIF
                     DLYEIVPAFLLASVMITVVSLMDKEPSLEIQEEFDRAVSEMK"
     CDS             229961..230200
                     /codon_start=1
                     /locus_tag="MMKA1_02280"
                     /product="hypothetical protein"
                     /protein_id="BAP60345.1"
                     /transl_table=11
                     /translation="MHYSMIKPVFKEEELLIDKGSLKTKRKFAFLLDINDRVLINRNF
                     YVNDEVDVVLDYTYTNSKRPKEKIKSYVLSDISKE"
     CDS             230210..230488
                     /codon_start=1
                     /locus_tag="MMKA1_02290"
                     /product="hypothetical protein"
                     /protein_id="BAP60346.1"
                     /transl_table=11
                     /translation="MKLDAKVSIFHAIFGAAFGYLTNYVYMFGLGMFSGVASFVFMLI
                     TLVITGNLASMIFGRESMNQKEWMGSGVVPFFFIWLVFWIMTYNGVFY"
     CDS             230498..231781
                     /codon_start=1
                     /EC_number="5.4.3.8"
                     /gene="hemL"
                     /locus_tag="MMKA1_02300"
                     /note="protein synonym:glutamate-1-semialdehyde
                     aminotransferase"
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="BAP60347.1"
                     /transl_table=11
                     /translation="MELNIKMDRSKELFEESKKYLVGGVNSPVRLFKPFPFFVKSAKD
                     CFLYDEDGNEFIDYCLAYGPMVLGHANENILNAVKSQMDLGTAYGVPSEKEITLAKEV
                     INRIPCAEMVRFVNSGTEATMGAIRLARGVTGRNKIIKFEGAFHGAHDYVLVKTGSGA
                     LTHGAPNSPGIPEDTTKNTLLIPFNDEDAVKKVISENKDEIACIILEPVMGNVGCIPP
                     KDGYLQFLREITEENGILLIFDEVITGFRLSKGGAQEYYGIKSDLATVGKILGGGFPI
                     GAITGKKEYMEQFSPNGQIYQAGTFNGNPISVTAGIETLKNLDDKFYKETTKKAGILS
                     NCLRETAEKYNIPAKVYNVASIFQVYFNDKEIVTYEDAKSSDTEKFMKYFYTLLENGV
                     FVAPSQFECCFTSIKHNDEVLEKTMNAIDIAMKKL"
     CDS             complement(231829..232833)
                     /codon_start=1
                     /EC_number="1.1.1.261"
                     /gene="egsA"
                     /locus_tag="MMKA1_02310"
                     /note="protein synonym:sn-glycerol-1-phosphate
                     dehydrogenase"
                     /product="glycerol-1-phosphate dehydrogenase"
                     /protein_id="BAP60348.1"
                     /transl_table=11
                     /translation="MIVIPRYTIIKEKASFRIQEILDNLNLKNPLVITGKNTQKYNKD
                     FDFIYYDEIETSDLENIKNYANDYDSIIGIGGGRPIDIGKLIAHKSKKPFLSVPTTAS
                     NDGIASPIVSLTQPSYMTEAPIAIIADIDIIKKSPKKLLSAGMGDIVSNITAVLDWEL
                     GKIEKSEKYSDSSGIFSKTIAIELMDYVLNSNLEEYPKKLVKALIGSGISIAIAHSSR
                     PASGSEHLFSHALDTMKEKYSIDTNSLHGEQCGVGTLATAQIYLEEGKLEVETFEMLK
                     TSLKVVDAPVTAKQLGFDEEIVIEALSSAHALRNRHTILRNGISKEKAREILEKSEII
                     "
     CDS             complement(232849..233550)
                     /codon_start=1
                     /locus_tag="MMKA1_02320"
                     /product="hypothetical protein"
                     /protein_id="BAP60349.1"
                     /transl_table=11
                     /translation="MKAICVLSGGLDSAVTSMFAKSKNYDISTVTFNYGQMALNQEIK
                     SAKKISDILNADHHVIDINFVKEFSESGLNTGNIPEPEKEDLDDFEKSEKTMKAVWVP
                     ARNMIMFSIASGFAEGIGAEKIFSGLNKEEGVTFPDNTPEFIERFNKSLEYGTLNKVK
                     MVAPLYELNKPEIAKLGKELELKLDLEVLKYSYSCYKDNGKDYLHCGTCESCMRRKRA
                     FKEAGITDPTKYIVE"
     CDS             complement(233680..235992)
                     /codon_start=1
                     /EC_number="1.17.4.2"
                     /gene="nrdD"
                     /locus_tag="MMKA1_02330"
                     /product="anaerobic ribonucleoside-triphosphate reductase"
                     /protein_id="BAP60350.1"
                     /transl_table=11
                     /translation="MISNSKYVDFKINIVKRSGNEETFNINKLVKSLLNSGVDYENID
                     EILSEIYGKVYNGMSTDDLKSILYTTLKEYDKKTGKSYSKKYMSENCLKIRTSEKEFE
                     PFNKEKIVKALIQEAGADLKTAERIATEVESEVKNLNVTYLTAPMIREIVNTKLIEHG
                     LEEFRHKHTRLGIPVYDIVKLIERGSKDNANLMHNPESIHKWVADETMKQFALLNVFP
                     KYIADSHMRGDIHLHDLEYAAVRTVCCQHDLRNFFKYGLKVDGTGRHTSVSKPAKHPD
                     VALQHAAKVLSAAQCEMSGGQSIDEFNIWIAPYMRGLEYNEVRQLMQLFIYEMNQIYA
                     ARGGQVVFSSINLELEVPEYLKGKDAIKAGQVVGAYEEYDYEVKMIAEALVDVLMDGD
                     AYGKPFLFPNVIFKLRENAFKDENKDLLVKIHELSAKWGLPYFINMFADYQHGNTNAM
                     GCRTRLSGEWGNSIEESSLRTGNMQWYTINLPRIAYEADGDDGRLFEILDEKLAIAKQ
                     ALEIKHEISKRRLYHDNVLPFLTQEFDGEQYYRYDSTTKTFGFVGLNELLKYHVGSEL
                     HESPEALAFGVKVISHIRKYADDLKKETGLRWTVTQTPAESTAGRFAKFDHKYYPEET
                     KSVVNGNLNDLSSIYYTNSSHVRVNADVTLGEKVGIEEKFHELCNGGHIGHFWNAEAY
                     ADPEVLMDITKKMTKTDIGFWTYTKNLSICEKCSLAMSGLKDNCTGCGSDHIEKFSRI
                     TGYLQNVSNWNKAKQQELLDRKSTLPGRRI"
     CDS             236223..237344
                     /codon_start=1
                     /EC_number="2.1.1.32"
                     /gene="trm1"
                     /locus_tag="MMKA1_02340"
                     /note="protein synonym:tRNA 2,2-dimethylguanosine-26
                     methyltransferase"
                     /note="protein synonym:tRNA(guanine-26,N(2)-N(2))
                     methyltransferase"
                     /note="protein synonym:tRNA(m(2,2)G26)dimethyltransferase"
                     /product="N(2),N(2)-dimethylguanosine tRNA
                     methyltransferase"
                     /protein_id="BAP60351.1"
                     /transl_table=11
                     /translation="MKIISEGETKLMVPEESTLSKKDTVFYNPVMETNRDISVSVVQS
                     FLDDFKRDEFLMCDPLGGSGARGIRYAKELKFNGDLKVSIGDINPSAVKMIKENLKLN
                     ELENVEVFHEDANVLLSKNFKVFNVVDLDPFGSPVPYLDSGIRASLTKGGLLCMTATD
                     TAVLCGAYRKTCIRKYNAVPLKGDKELAVRLMIGYAVKMASKYDIGLKPIFSHVTDHY
                     ARTFMVTERGAGKADSAIENIGYIRQDSEQKSFKTFEEGSEKGYAGPFYLGDISDKNI
                     VQNALNTAKTRNYSKRAVNILELISRESEINQVGCFDIHELCSFIKKLVPPVNDIMEN
                     LKENGFKVTRVHYNPYGLKTDAELSDLVVLISEYHSKKY"
     CDS             complement(237378..238109)
                     /codon_start=1
                     /locus_tag="MMKA1_02350"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAP60352.1"
                     /transl_table=11
                     /translation="MIEMVNIHKKFKEAHILKGVDLKVAKGEVLVIVGPSGSGKSTLL
                     RCINGLEKTTEGHIFFEGDDITDKKVNINKIRQKIGMVFQQFNLFPHLTVLDNITFAP
                     RKVLNVSKKEAEELARELLKKVGLEGKENQYPIQLSGGQQQRVAIARALAMKPDAMLF
                     DEPTSALDPELVKEVLDVMKQLAYEGMTMVVVTHEMGFAKEVGDRLIFIDDGQILEDG
                     NPSEVFSNPKNERTKNFFGKILSHN"
     CDS             complement(238150..238836)
                     /codon_start=1
                     /locus_tag="MMKA1_02360"
                     /product="hypothetical protein"
                     /protein_id="BAP60353.1"
                     /transl_table=11
                     /translation="MKDLIALAEEIKDEKLRKKVIEYINNPLPKHPEIESTGITIENS
                     PASVKRHHKYPGGLLEHTIAVTKMAVKMAEALEETYGIELNRDLLISGGILHDLMKPQ
                     NYQLKDGKFDHLSDFHLDHLTLGIAELYRRDFPLEVIKVVASHHGDHGPVSPDSIEAW
                     LIHHADNVDAAINDIGIRICQARSREFGIDDSQIYKIITPLKLYEMRKKLGKDKVKEF
                     LKEKLEIKDE"
     CDS             238918..239286
                     /codon_start=1
                     /locus_tag="MMKA1_02370"
                     /product="hypothetical protein"
                     /protein_id="BAP60354.1"
                     /transl_table=11
                     /translation="MIDLAKDHLKKVLSLCGANRDCEYYPCHYENQSCLWCYCPFYPC
                     EDENLGEFVKRKDGSLIWSCMKCNWIHNPEIASEVLKEITELTKDKKINDSIEFIDNH
                     EILMNIKRRVEEKLGKDNSV"
     CDS             239301..240341
                     /codon_start=1
                     /locus_tag="MMKA1_02380"
                     /product="putative peptidase A24A"
                     /protein_id="BAP60355.1"
                     /transl_table=11
                     /translation="MFGFDNLILGVYLFNFLLILTATYTDIKERIIPHFVIILMLIVN
                     LPIGYYFFGFDAITSFFATLILCLILGVGMGGGDVKMFTALSPLFAAETIYFVPKDIL
                     ILIGLSALFAAIFPMTKILKNYWKDIIPSSAYLAMLIGIIVSITEIYSIGNTKTILWI
                     YIILSIFISRKIPKYRIISNKLGYITPIYLVGFYLLNPAYFVSENVLISFFVYIGQLS
                     LISLVIYALTGAEISSKKQISDLKEGDIIRDIVTIKENGEVTVENANILKRFKHMIYG
                     EMGKLEGKSLMTDGEGLSNENLELLNKLQNEGKIGGELNVLTTYPFVPFVLVAYCVIT
                     ILNMGFINYLVG"
     CDS             240343..240732
                     /codon_start=1
                     /locus_tag="MMKA1_02390"
                     /product="hypothetical protein"
                     /protein_id="BAP60356.1"
                     /transl_table=11
                     /translation="MFKRSNRGQISFEFSIIVLSILLISTITITYFLTSSFDEGTRAL
                     DKIDLGAKTAVSLVNSGYNGTQAEGTLIYAGMTWDNAGNNYENITVYISNTTPVPVNT
                     RVFVKNYTIESQGIDTTKYDFNIAWSG"
     CDS             240859..242007
                     /codon_start=1
                     /locus_tag="MMKA1_02400"
                     /product="hypothetical protein"
                     /protein_id="BAP60357.1"
                     /transl_table=11
                     /translation="MPAEEYSGKLKSLKSKSKKSSRIPPKQLRMALVIVVSVIVIFEV
                     YNIYFTAKNRELEELENNRAVAIDTIDKLFFEYPNDPQKIAYVIKLQQSQDEENRVRI
                     LDDAQKYLEIKQYKTLAINQIKDMYGEYYGSSIKANELERKINSANSTSEVDELFKQS
                     NVEEEVKEILEKSLEKTISSGDSYFYVEMSGQEYFMTKDDVLEITDSMGIMQLKEFRV
                     TPVSNLNKLTVVVSSRQCGKIPLSGDSILVYNKNTPEAPIAYAVIDSSYVILPDIGYS
                     EERSVSNVVNDEGSESTVESTSSISYTLNNVPGVLHATAADKLDIGTVIDKFGSYGER
                     LNKIEDNTQIFDENVNYLLIVAVPTEKVSNLVAVNSEDLFIVKAAGGN"
     CDS             242007..242900
                     /codon_start=1
                     /locus_tag="MMKA1_02410"
                     /product="hypothetical protein"
                     /protein_id="BAP60358.1"
                     /transl_table=11
                     /translation="MKMLNIKYLTIFLFLISIIPNAHSETTVATMDTYWSLTGEITNE
                     YPYSVFITIPEEIEYIEKDLKSSKNFMELTNGESDDDEDEESTDPVTFDITPKSELNG
                     QEGFWIPPYTTANIKMYSTRVDVLTTKEDDEEEDDEEVVRTMEISGPAAYPKTKLIDL
                     SELIPASKKDKIELDNFKLYVKGSIVKNDTDVLSILIPAPIVLKDYSTCDKFISKYSV
                     NTWVDSYSDWVTDHNELSSYGSTMLDNTLVPVFDLGPGFYKTFDVPALVYTTSSNQEL
                     SFSYKMYWYAEEEDTKDIWML"
     CDS             242934..243350
                     /codon_start=1
                     /locus_tag="MMKA1_02420"
                     /product="hypothetical protein"
                     /protein_id="BAP60359.1"
                     /transl_table=11
                     /translation="MSKGQVSVEFIVLFLALLVAVVVSTMTPGIFGLNKSVELSSASL
                     AHAALSKVKSSVELLSVSDPGSSKLVYVKSPVSKWGINNRSISISGDGYNISTNTTVT
                     LKNNLGSTSFTHETNSLKILTVNLTRMDEYVQIDIN"
     CDS             243322..243777
                     /codon_start=1
                     /locus_tag="MMKA1_02430"
                     /product="hypothetical protein"
                     /protein_id="BAP60360.1"
                     /transl_table=11
                     /translation="MSMFKLTSTKKGQVSFDFILAMLFLLLIFAFTGQNVLNMAKSFK
                     ESETVERGHAILDNFENYAITAYSKDVTINATFKPVGNLNYTIMISNKTIGVNSTTNI
                     LFSPDPDNNGVVNISSSNVNNSANSIPLTTVNISFGDFYVSKKLQISIQ"
     CDS             243743..244261
                     /codon_start=1
                     /locus_tag="MMKA1_02440"
                     /product="hypothetical protein"
                     /protein_id="BAP60361.1"
                     /transl_table=11
                     /translation="MFQKNYKYLFNNLFFVFSVFLLISSVYSYSDYYKVNVDEKSKTE
                     TFNIDKVENYTYKLSYVHYGNLQEGMYVKIFVNGNNIHEYSKDLSNTGSGAYKKSENK
                     TDITNYLVNGSNELKIESNIWKTENSSPYYVLENFEITEHEVSTIKLPISQNVNFFVF
                     ILCLICLIIRKG"
     CDS             244263..246155
                     /codon_start=1
                     /locus_tag="MMKA1_02450"
                     /product="hypothetical protein"
                     /protein_id="BAP60362.1"
                     /transl_table=11
                     /translation="MTLKSKLSSKKGYIFTYEAVAVVILFVAVFYMGYFTFTHVNLTN
                     QEQKRDLENFEKANLVSDMLFKMHEFPSNSYVPDYLRFLDSVAKRYSGLETIPGTFDP
                     YSMNQEFIYNESWYYEINITNPGTQDLTDFQVLVTLNPSNFNFDYSSDGSGLSFWQGN
                     TQLHYWIETWEYNDEARVWVKVDSLPDETTTQILLKRNQGGSYSSDGDDTFVFFDDFE
                     RTSFGGDKWNVVSGSWEIIADSELSYYNGGLGTNHVAHLEASDTEDRRAVSKYSLNLN
                     DGDIYILEGDSKGHTGVSGGSADSPDTMLGFYSNGGGTTYYNTFDGFYQVFGICTAGD
                     SNEKLSSIFTKDNVWYVKKLILEQKSDYSNRIVKSSIWEFSNGYRGDPNPNNNVNSMF
                     DVSAEARIWTFWGWVNYINPLDCDHILIGTGQGSHSEEYWFDNIKVRKYAPNILVNVN
                     EMLGYNAGQNAIDVSEYHFDGMPSTLSSNVNLVEINYSYDLAPNTYVKTRNLYVPVKT
                     WKYSNSESITENITSGEIMYFGIRRPSTLTNITATSDVETTALFLVNGVPFEISLDTS
                     DKPTDFEKVISTHGWEYYEPNEIKLLDTNPTANVDLTITYDESSTIYVLKLKQYNISC
                     ILNMDS"
     CDS             246166..246690
                     /codon_start=1
                     /locus_tag="MMKA1_02460"
                     /product="hypothetical protein"
                     /protein_id="BAP60363.1"
                     /transl_table=11
                     /translation="MIFDSDLVIAIVILTIGMAFFTTSLVEHSSAYQDVIKSNMLHDK
                     ASYDLKAIITDGTAEAALMLINNNEDSTADALIKSRLHVKNYDFIVGNETIVSNGNKN
                     DQNMVIVSSVVIMNRSEGWYGVAWNEGGSITITGPETSELQAYQSVSGDYKKAIYYFN
                     NSKPVEVSLKVYGN"
     CDS             246702..248501
                     /codon_start=1
                     /locus_tag="MMKA1_02470"
                     /product="hypothetical protein"
                     /protein_id="BAP60364.1"
                     /transl_table=11
                     /translation="MYLSQSTTTLVLLLLLTATLTYNTLDLQKNQVLTEMEASSIDLK
                     SSSLEHIIESSLPTVFNRVLNDAELEVIDNYNNNPSGDPFFESTNYTLAYLKNGTEDI
                     IVKDYLENVSEEYSNLGYTIDYNFSMTNITMVDGFTFKLDYDLYYKIQGNKGVIKEEN
                     ISSFQYSTVKTVLDAYHYIKPTYVGVINVSNPNAETLYDFQVKVVFNDSNFDYSIEPT
                     GEGLRFYDENGNYIPYWVEVWDYSDDDNDRTSVLWLKVPILDANTNTSVYILSTYPKI
                     SESNGNRVFEMFDDFEDSNSIYSKWNVYQGSWTYSTTSNIFLSATYNTKMVQCLSAEP
                     VSRMISTDNTTLDSYTIEVDARGTSSNTDTPNTMLGYFADPQYLAETTTHPDAFYTFE
                     LGGREDDGSLTSLETYDGTQLYWDPEEYATYADLAIVNQYPVDYYNVHRADLDYSSQN
                     PSEIWYRLKLNVIEDTVYGMYFTQLDYINNNEPDWMITESIDDHYGSYFELGTSFGDH
                     SSYTQNIYFDNFRVRKYASIEPTTNIYSLSKTVGINYITPPRAEGTKYVLGSDYNLYY
                     EEADTYPSIIDMLAGEDSKSWEYGYGLKLKGYQ"
     CDS             complement(248511..248780)
                     /codon_start=1
                     /locus_tag="MMKA1_02480"
                     /product="hypothetical protein"
                     /protein_id="BAP60365.1"
                     /transl_table=11
                     /translation="MKVAVPMDMDTISDADSAKYFLIFKIEEKEVVDTKTLLTLEEML
                     KEKPNAIILNKREKFNGKMENYFCEKNDVDACILEFIEGNLEKIE"
     CDS             complement(248793..249167)
                     /codon_start=1
                     /locus_tag="MMKA1_02490"
                     /product="hypothetical protein"
                     /protein_id="BAP60366.1"
                     /transl_table=11
                     /translation="MSEKSLEKNEIFDSYFKNLSDRERAVFEGGISLGALFHQFVGTP
                     VSKKTKKSLEIAMSESLKNQPFIEDVSVSIVGIIEDGKYVSLTGEMLDVSLTVKTEKN
                     RALLRLKYIKELDYPLMYVEKI"
     CDS             complement(249160..250155)
                     /codon_start=1
                     /locus_tag="MMKA1_02500"
                     /product="hypothetical protein"
                     /protein_id="BAP60367.1"
                     /transl_table=11
                     /translation="MKDYLKNDDIIFLCHHNADPDAVGAAIGLKQLANSFSKKKSKEK
                     NLKISADSVSKLSRSILKELNEKIEIIEYPKLPKTVFLVDTSSINQVTVNSEELTNSD
                     VILIDHHKKTDLINFCKFYIVDENSTSTCEIVANLFREMKIYPPKNIRIGLLCGILYD
                     TKHLKIAKESTFNIISWLMKDVSFQKVLYLLSQESDPSKRIAHLKACSRMELMELDSY
                     TIAISHASSHEASCAKTIVSIGADIAFVVAARKRDREIRISVRSRKAISKKIHMGALM
                     EKVAKILDGQGGGHAEAAGLNAPWNKEKTKEEAVDSVLSVCIKSLEEELSGVENV"
     CDS             complement(250216..250557)
                     /codon_start=1
                     /gene="pfdB"
                     /locus_tag="MMKA1_02510"
                     /product="prefoldin beta subunit"
                     /protein_id="BAP60368.1"
                     /transl_table=11
                     /translation="MELPANVQNQLMQFQQLQQQLQMIMYQKQQFETQLKEMEKAIEE
                     MEKSDSEEVFKMAGGILVKRNKAEVKEELSEKIETLQLRVTTFEKQEEKMQKRYTELQ
                     ESLQKVMGQGQ"
     CDS             complement(250615..250866)
                     /codon_start=1
                     /locus_tag="MMKA1_02520"
                     /product="hypothetical protein"
                     /protein_id="BAP60369.1"
                     /transl_table=11
                     /translation="MTYPKFTLKLTFETPKKARIIYESVYPEHVASQVRSKCKMDLFE
                     NSIIISCISDELSILKASIYSYIRWIKVAESIYKLTEDE"
     CDS             complement(250874..251368)
                     /codon_start=1
                     /locus_tag="MMKA1_02530"
                     /product="hypothetical protein"
                     /protein_id="BAP60370.1"
                     /transl_table=11
                     /translation="MIITTSRKPSQRTRSLVNDLARVFNFKILNRGKIPLSELIENKD
                     DMIIVEELKGNPGRLKIFNFENNKILSMNLSLKLQREVSGKAFKNSGKLGSKFDKNTE
                     HLKEFFFEYLFKKLSNYKEEDSEVVITFKTVDESTFYIEVHKGSENMGPSLKIKTVKI
                     LDIE"
     CDS             complement(251368..251508)
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoP"
                     /locus_tag="MMKA1_02540"
                     /product="DNA-directed RNA polymerase subunit P"
                     /protein_id="BAP60371.1"
                     /transl_table=11
                     /translation="MAEYRCSNCGKIVTLDEIGLKAKCPHCSNRVLIKLRPKIVKKVQ
                     AR"
     CDS             complement(251563..251853)
                     /codon_start=1
                     /gene="rpl37ae"
                     /locus_tag="MMKA1_02550"
                     /product="50S ribosomal protein L37Ae"
                     /protein_id="BAP60372.1"
                     /transl_table=11
                     /translation="MVEFSHTKKIGSAGRFGSRYGRKIRVRLRDVEIKQNKDYKCPVC
                     AFPKLKRAGTSIWVCEKCGAKIAGGAYTPETGAGKVVTKAIRRVIESKSREI"
     CDS             complement(251883..252587)
                     /codon_start=1
                     /locus_tag="MMKA1_02560"
                     /product="hypothetical protein"
                     /protein_id="BAP60373.1"
                     /transl_table=11
                     /translation="MVSLDNAVIARLQSHGEKFEILVDPYLAAKFKEGQPIGISEILA
                     AETVYKDSGKGEKVPEDVLLKIFETLNPLEIAEQILKKGTVQLTANQRKEIQELKRKQ
                     IVSIISKNTINPQTDTPHPPKRIENAMEEARLSVDIYKSAEEQIPKIIKELRKLLPIK
                     FEKRDVAVKILGEFAANAYHTLHEYGATKQEEWLGDGSLVLVIEIPSGIENEFYMHLN
                     KLTKGTVQTKVLKRYD"
     CDS             complement(252686..253465)
                     /codon_start=1
                     /EC_number="3.4.25.1"
                     /gene="psmA"
                     /locus_tag="MMKA1_02570"
                     /note="protein synonym:20S proteasome alpha subunit"
                     /product="proteasome alpha subunit"
                     /protein_id="BAP60374.1"
                     /transl_table=11
                     /translation="MQQMVPASGYDRAITIFSPEGRLYQVEYAREAVRRGTTAVGIKC
                     KDGVVLAVDRRITSKLIDVSSIEKIFQIDDHIVAATSGLVADARVLIDRARIEAQMNR
                     VSYGEAITVEALAKKICDIKQAYTQHGGARPFGLALLITGIDRHSARLFETDPSGALI
                     EYKATAIGSGRPIAMEVLESKYDENMTVNEGMELALYALSKTTEELKPENIDMAIIKD
                     SGKLVEKISVDEIEKIVKAVYEKVKAEEEEAEKNKGEEDSE"
     CDS             complement(253998..256106)
                     /codon_start=1
                     /EC_number="6.2.1.13"
                     /gene="acd"
                     /locus_tag="MMKA1_02580"
                     /product="acetyl-CoA synthetase (ADP-forming)"
                     /protein_id="BAP60375.1"
                     /transl_table=11
                     /translation="MNTLEGIFNPKSVAVIGASEIEGKVGQSVMKNLLNFKQHGGKVY
                     PVNKKYNEVYGIKCYGSVSDIPETPDLVIISIPAEYAVDAMDECGKKGVKAAIIITAG
                     FSETNNHELEERLEAIIKQYGIRTIGPNCLGVINLHNHLNASFSKEFSKMGNIAFISQ
                     SGAIMTALLDIANYYNLGFSKIVSMGNKIDVQEYELLNYLENDPHTKVVALYIEGLKD
                     EKFISAAKKISRKKPVIVLKSGKSEEGAKAASSHTGSLAGNNAVYDAAFKKSRVFNVE
                     SFEDLVNLLKIFSVQPPMRSKKLAVVTNAGGFGVLAADSVEKCGLELADFSATTVSEL
                     KKYLPDTSGISNPLDLIGDADVNRYKHAFELVENDPNVDGLLAILTPQGMTDALGVAR
                     ELVKLKNYMICKKDKIPIVASFVGGTSVLEARSYLQEKGIPSFICPDLAVHALACLYR
                     QSHLMDKYDSPEYLNEIRSEIAEAKANNPEKIDELLANANESNSKEFLKLNGFAIPEK
                     FVATTKEEAKEYAENLGKVVMKVVSADILHKSDAGCVIIDPSDASEAFETIMKNGEKY
                     LFDRKIDGIIDGVLIEQFVTGKEIIIGAKRDPVFGPVVMTGLGGIFIEVLKDVSFGIT
                     PITKEYAGEILHSLKSYKILEGVRGENRSDIEFLKELIVRVGVLMETYDEISEIDINP
                     AFIKEEGQGGFVGDALIITK"
     CDS             256255..257781
                     /codon_start=1
                     /locus_tag="MMKA1_02590"
                     /product="hypothetical protein"
                     /protein_id="BAP60376.1"
                     /transl_table=11
                     /translation="MKDIKCVQKTGNILEFEQLREKLGIIDKKDVSSLEIKVIDENSE
                     QYGISKEKLMENAGRAVYEEIVNLNFDFSKAYVLCGTGNNGGDGFVIARHISNNFATF
                     VVLVGNERKIRTAETQKNFNILKNMEAFGNLEYINILENENAIDLIKTLENELKNENV
                     LVIDAMLGTGFTGNLKNPYSTIVDYLNDLKSKYYENLKIISVDIQTGNLKSDLEVILH
                     KRKVENKNKNFVVKNIGIPKYIENMVGKGDFYLLNKRKLNSHKGQNGKVLIIGGSKEY
                     HGAPVFSGLAASKFADIVTVASVSNVIDTVRNYPELMPHELNGEYISQKNTDELLDLS
                     KNYDCTVLGSGLSLNSDTKEFVNSYLNETNGKVVIDADAIKLIDYGNFEFKNNFIFTP
                     HKKEFGYMKDYVKKYAKNQGFNSTVVLKGSIDIVFDPDNIKMNITGNQGMTVGGTGDI
                     LCGIIGAIYACNDAFPSACCGTYINGYCGDLLEKEYGYYYNSTDIIKILPKALNELLY
                     "
     CDS             257802..258701
                     /codon_start=1
                     /locus_tag="MMKA1_02600"
                     /product="hypothetical protein"
                     /protein_id="BAP60377.1"
                     /transl_table=11
                     /translation="MENDVFKADMHIHTKYSGMMKYMGLKFPDSVEEPLKVMKCAKAN
                     NMDVIAVTDHNSIKGALEVKKLEKEFGIEVIVGSEIMSSEGEILGLFLNEDIPARLSP
                     EETIERIHEQGGLAVCPHPYSPICEAIGDKVFELDFDGVEVYNAFHRDGIVNNIALDK
                     VLKNYHKSPFAFLGNSDAHLARMIGNGNTKFEGNSADDLFNAIKHRKTTYEGTPTPLS
                     DIILWSYNVIYASEKALLKSMVKKDDNIVNYNCSKFKKGIAAFGGLMYIGTPLPLVAG
                     VLGNIYLKKKAKQKLKEVIQEVI"
     CDS             complement(258737..259348)
                     /codon_start=1
                     /EC_number="2.4.2.-"
                     /gene="hisH"
                     /locus_tag="MMKA1_02610"
                     /note="protein synonym:IGP synthase glutamine
                     amidotransferase subunit"
                     /note="protein synonym:IGP synthase subunit hisH"
                     /product="imidazole glycerol phosphate synthase subunit"
                     /protein_id="BAP60378.1"
                     /transl_table=11
                     /translation="MIAIIDYNAGNLRSIEKALELYTKNIVVTSDPETILSADKLVLP
                     GVGNFGDSMKNISQKTGDCSLNEIINKCVQKVPFLGICLGMQLLLEKSEECPETPGLG
                     VIKGDVIKFKHSEKIPHMGWNTVNQVQDIPLFEGIANNEYFYFVHSYHVNPSKKDVIS
                     GTTNYGYEFPCILNKKNVYATQFHPEKSGKNGLKMIENFVELI"
     CDS             complement(259360..259905)
                     /codon_start=1
                     /gene="tbp"
                     /locus_tag="MMKA1_02620"
                     /note="protein synonym:TATA sequence-binding protein"
                     /note="protein synonym:TATA-box factor"
                     /product="TATA-box-binding protein"
                     /protein_id="BAP60379.1"
                     /transl_table=11
                     /translation="MEPEIKVVNVVVSTQIGTDIDLEYAADILDNAEYEPEQFPGLVC
                     RLSEPKVALLIFRSGKLNCTGARCKEDAVIAINKIVKELKEAGMDLIDNPEVKVQNMV
                     ATTELGMEPNLDDISTLECTEYEPEQFPGLVYRLSEPKVVVLIFGSGKVVITGLKVIE
                     DAYIAFDKISKTLKELEEELY"
     CDS             complement(260037..260336)
                     /codon_start=1
                     /gene="rpl12p"
                     /locus_tag="MMKA1_02630"
                     /product="50S ribosomal protein L12P"
                     /protein_id="BAP60380.1"
                     /transl_table=11
                     /translation="MEYIYAALLLNSAGKEITEDAVKAILVAGGVEANEARVKALVAA
                     LEGVDIAEAIEKAAIAPVAAAAPAAAAAAPVEEKKEEKKEDTGAAAAAGLGALFG"
     CDS             complement(260424..261416)
                     /codon_start=1
                     /gene="rplP0"
                     /locus_tag="MMKA1_02640"
                     /note="protein synonym:acidic ribosomal protein P0
                     homolog"
                     /note="protein synonym:ribosomal protein L10"
                     /product="50S ribosomal protein L10E"
                     /protein_id="BAP60381.1"
                     /transl_table=11
                     /translation="MIEAKSEHKIAPWKIEEVNALKELLKSSNIIALIDMMEVPAVQL
                     QEIRDKIRDQMTLKMSRNTLMKRAIEEVAEETGNPEFAKLVDYMDKGAAIIATEMNPF
                     KLYKTLDESKSPAPVKGGAIAPCDIEVKAGSTGMPPGPFLSELKAVGIPAAIDKGKIG
                     IKEDKIVVKEGEVVSQKLAVVLSALDIKPVTVGLNVLGVYEDGVIYTESDLKIDEEEF
                     VGKIQKAYTSAFNLSVNAVIPTSATVETIVQKAFNDAKAVSVESAFVTDKTADAILGK
                     AYAQMIAVAGLAGDDALDEDLKGKISSGAAAPVEEKKEEKKEEAAAPAGLGMLF"
     CDS             complement(261430..262071)
                     /codon_start=1
                     /gene="rpl1p"
                     /locus_tag="MMKA1_02650"
                     /product="50S ribosomal protein L1P"
                     /protein_id="BAP60382.1"
                     /transl_table=11
                     /translation="MDSEKILNAVKEARTLAKPRNFTQSVDLIVNLKELDLSRPENRL
                     KEQIVLPSGRGKDVAIAVIAKGDLAAQAEDMGLTVIRQEELEELGKNKKTAKKIANAH
                     GFFIAQADMMPLVGKSLGPVLGPRGKMPQPVPANANLAPLVARFQKTVAINTRDKALF
                     QVYIGTESMSDDELAANAEAILNVVSKKYEKGLYHVKNAFTKLTMGAAAPIEK"
     CDS             complement(262249..262539)
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoL"
                     /locus_tag="MMKA1_02660"
                     /product="DNA-directed RNA polymerase subunit L"
                     /protein_id="BAP60383.1"
                     /transl_table=11
                     /translation="MNYVKIIEKNKNFIELELVNDDHSLSNLVKEILLSKDGVILASY
                     GVEHPVLDPDTGRYISNPTIMLKTDEKTDAETVLKEALKDIVDLCNKTLEDL"
     CDS             complement(262536..263153)
                     /codon_start=1
                     /locus_tag="MMKA1_02670"
                     /product="hypothetical protein"
                     /protein_id="BAP60384.1"
                     /transl_table=11
                     /translation="MKRIISIKGTEEEIIEICERISKLGIDYSFDAKANYAENRAYNS
                     ARIKIFGDEKYKLVEDHKNILTIIDTVHNKYNADTKGLFEYKLNDLKYPVNKDLVLDT
                     LSALKINFKYLKDENVIKCERKIEEINRILKDILDIYSELNFYNIGSKPVKNVLTLAV
                     YITGRDIDELIEEGLEKELFREEDEKIVLNKDINLTRKELLSVKK"
     CDS             263822..264019
                     /codon_start=1
                     /locus_tag="MMKA1_02680"
                     /product="hypothetical protein"
                     /protein_id="BAP60385.1"
                     /transl_table=11
                     /translation="MVNVSYSSVNEMLDHWKFKKSMRNRIKKSFNLERLFKTHEKYRD
                     LESTVYNKIKKREEKEKKSKK"
     CDS             264251..265180
                     /codon_start=1
                     /EC_number="6.1.1.1"
                     /gene="tyrS"
                     /locus_tag="MMKA1_02690"
                     /note="protein synonym:tyrosine--tRNA ligase"
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="BAP60386.1"
                     /transl_table=11
                     /translation="MLESILKNTSEIVSIEELTELLKKEEKIAYIGFEPSGRIHMGHY
                     LQIRKMIDLQKAGFKIVILLADLHAYLNQKGTMDEVRALGEENRKVFEAMGLVADYVY
                     GSEFQLKDEYTIDVYKLALSTTLNRARRSMEVIAREDENPKVASVVYPLMQVNDIKHL
                     NADVAVGGMEQRKIHMLSREILPSMGYKAPVCIHNPVLTGLDGEGKMSSSKGNFIAVD
                     DDEATIKKKMKNAFCPMKEVSGNPVLEIAKYYLKYPATVKRPEKFGGDLILESYEALE
                     NAFVEGLHPMDVKNLVSEQLIEILRPIREKMNK"
     CDS             265195..266253
                     /codon_start=1
                     /gene="mscS"
                     /locus_tag="MMKA1_02700"
                     /note="protein synonym:putative mechanosensitive ion
                     channel"
                     /product="putative small-conductance mechanosensitive
                     channel"
                     /protein_id="BAP60387.1"
                     /transl_table=11
                     /translation="MMALDQLYFGNTLYSYMIFLIFIFFGVFFGKVMYIFLNKYVRVL
                     AGKTKTKLDDVVLDAVEIPLIIVVFVLFFKYGLNNLVLPDNLALWLNESLTVAITFAG
                     VLFLLKIVDDIIVNYVVPIVEKSENTLDDQLVPLMRKLVKFLILIAGLMLILSNVGYN
                     ISALLAGLGIGGLAVALAAKDTIENLIAGFIIIVDRPFKLGDWIKWGGKEGIVEEVGI
                     RSTRVRSFGDTLITVPNVNIVQTEIENFSERRKRQVKATIGLTYDTPVEKVKRAKEII
                     ENVLNDHHGVVDPIRVSFVEFGSFSLDLRVEYFVRDFGFDFFLNTKDEINIKIKEEFE
                     KENIEFAFPTQTVYYKKE"
     CDS             266289..266732
                     /codon_start=1
                     /locus_tag="MMKA1_02710"
                     /product="hypothetical protein"
                     /protein_id="BAP60388.1"
                     /transl_table=11
                     /translation="MDKTWALIFAIIVGFVASLQPIINSKLGDHIGSKNAVFVNFIIG
                     LVLIGLIILISDPSSIKQLSKVPAINPVYLLGGIMGVVIVLLSLIVVPELGALSAFSI
                     FVGVQLISGALIDHFGIFGIQKSPITLLKLFGISLLLLGMRILIK"
     CDS             complement(266771..267412)
                     /codon_start=1
                     /locus_tag="MMKA1_02720"
                     /product="hypothetical protein"
                     /protein_id="BAP60389.1"
                     /transl_table=11
                     /translation="MDVQFIILAFTSLFSILNPFGVIPTYLVLTSQYSKVEKIKIIRK
                     SMLAAFALLMMFALLGNQIIGFFGISIPAIKITGGVLLFLIALDMIQGNTSKVEKSPK
                     LESHLKSHSEEIEEMDEIAIVPLTVPLLTGPGSISAVIAMMAQTSDFDGKLSVIIAIS
                     LCIIISYFVLKFSKDLEKMLGKIGFKVLTKMMGLVLTAISIQMALDGILMVFG"
     CDS             complement(267432..268148)
                     /codon_start=1
                     /locus_tag="MMKA1_02730"
                     /product="hypothetical protein"
                     /protein_id="BAP60390.1"
                     /transl_table=11
                     /translation="MKYISSISVDISSNDVETSEVVNEKIERELQLEMSKIGVKSTIT
                     NVTGDDIVISSFVSEDRIEEVNNIVFKLLYKHAEGFEDLEGVSNDPKTAGEGVSYAFS
                     KTPSEYGDSIIIGFDTYCGESFVNEAALFVEEIGKKFGYDSSSSVSDVPTKIPGIGYS
                     GVSTDDPVVVITLENVKDLQKIAGMIYGGLLGFENVYFVKRGSPTNILPPGVIYTMTA
                     FLNGNAIDLYDGIKRKNNLL"
     CDS             complement(268162..268950)
                     /codon_start=1
                     /EC_number="5.4.99.12"
                     /gene="truA"
                     /locus_tag="MMKA1_02740"
                     /note="protein synonym:putative tRNA pseudouridylate
                     synthase I"
                     /note="protein synonym:putative tRNA-uridine isomerase I"
                     /product="putative tRNA pseudouridine synthase A"
                     /protein_id="BAP60391.1"
                     /transl_table=11
                     /translation="MYIFKIAYDGKLSFQTQPHGETVCDKISNALLDCGYLDNEDRVP
                     LYHGGRTDRGVAALGNYVVYEMDKKPVLPRVQSKLKWDGIWVLGCKEIEIFPEIEHRH
                     YQYTLPNKNHDVELMKKASEKLIGTHYFQNLSKRDKTKVKDPVRTLYDIKISSNDYFI
                     TIDIFGESFLWNMVRRIIRLLSDIGKHKIENPEKFIELILSEDYKKGYPPSPAEGLIL
                     VDVKTNIDIDLDSYVIRNLKNSWEKSLNNSLMRLGLCKTVLSKT"
     CDS             269203..270417
                     /codon_start=1
                     /locus_tag="MMKA1_02750"
                     /product="hypothetical protein"
                     /protein_id="BAP60392.1"
                     /transl_table=11
                     /translation="MTKVLVIDPKIAGMSGDMFVSSLLELTNSYDLMDEVIAELEKLN
                     SCNSFNAVLMDEKVNGISAKQLKIEIDEEKIKNPDELKEIIINTSKNLMSEKGVKICE
                     NIINDLIEAEEKLHGDHFHLHEISSLDTVFDIVLPVLILEKNGFLDGKIYSTPPALGN
                     GRISMDHGIIPSPAPSTLEILCKHEIKCSKVDSNVELLTPTGAAILSNVTDEFIDSYP
                     EIVLLKTAYGAGTKRMEHVPNVLRLVEGKTDEKIIEKTVILETNIDDISSEVLAYAVE
                     RLLNEGAPDVFITPVFGKKNRPSSMISVICPYHVHEKFAKILIEETGTLGVRINHYDK
                     IRAKRRMEKLTLDINGVNFGFDVKISDLNGEIVNIKPEFEDLKKIAKNLNIPLRDVLR
                     HANNKINEKYGF"
     CDS             complement(270427..271086)
                     /codon_start=1
                     /locus_tag="MMKA1_02760"
                     /product="hypothetical protein"
                     /protein_id="BAP60393.1"
                     /transl_table=11
                     /translation="MENLKEIVKLLPGYNCKACGFKRCDLFAEKILEGENPENCPLLF
                     KEEFKGNIEKIKEIASTLKPLEIKKTCNSTTGLVGLLDGYEADFLLDPLPEEHSCRET
                     LIILSKNPIKKGDHIKYRPLGCPIPHFAEIIDDAHGMYVVHLEGPCNRFNSEKIDYIE
                     VGIALIAAFEGVYNGKTPEVGKTVRFIPTHCMMQKVHSGVVVEVEGNRVLIEGIDLKV
                     W"
     CDS             complement(271088..271786)
                     /codon_start=1
                     /locus_tag="MMKA1_02770"
                     /product="hypothetical protein"
                     /protein_id="BAP60394.1"
                     /transl_table=11
                     /translation="MIIVAGTPGAGKTSVMTHTIKQLLNKGNKPAVVKIDCLYTDDDT
                     RYGKLKIPTLVGLSKDMCPDHFAIYNLEEMAEWAEKEGVDTLIIETAGLCHRCAPYTE
                     NSLGICVIDATSGPNTPRKVGPFLTSADVVAITKGDIISQAEREVFRERVLEMNPKCT
                     IYDVNGLSGQGCAEISEEIMEAKDIVDLENEELRHNAPLCVCTLCVGETKVSKKHHRG
                     VLRRIDGFTKYVGE"
     CDS             complement(271812..272603)
                     /codon_start=1
                     /locus_tag="MMKA1_02780"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAP60395.1"
                     /transl_table=11
                     /translation="MNIEEIKIMGGFNKFGESEKVKELVVKRGEIFGVVGPTGSGKSN
                     LISDIEQLAQGDTPSNRKILVNGNVPDTEMRRDPRKRRIAQLSQNMNFLADMTVEEFL
                     IMHAKSRGMNSEGIVDKVIKLANNLTGEPIEKDYNLTILSGGQSRSLMVADVAVISDS
                     PIVLIDEIENAGIKKHEALELLAGCGKIVMVITHDPVLALMTTRRVVMRNGGMTEIIE
                     TTEEEKEVSQRLSEIDSWMLSMGEKVRHGKKLNLKDIETPAVSGN"
     CDS             complement(272622..272825)
                     /codon_start=1
                     /gene="comA"
                     /locus_tag="MMKA1_02790"
                     /note="fragment"
                     /product="phosphosulfolactate synthase"
                     /protein_id="BAP60396.1"
                     /transl_table=11
                     /translation="MKKEELEILAENVDMDKIILEAPQKNQQVEFILRFGNDVNLGNI
                     SFEEVISLETLRRGLRGDTFGKI"
     CDS             complement(272971..273378)
                     /codon_start=1
                     /EC_number="4.4.1.19"
                     /gene="comA"
                     /locus_tag="MMKA1_02800"
                     /note="fragment"
                     /note="protein synonym:(2R)-phospho-3-sulfolactate
                     synthase"
                     /product="phosphosulfolactate synthase"
                     /protein_id="BAP60397.1"
                     /transl_table=11
                     /translation="MNAFSFLNLEKGTENTMIIDKGLSPDFINDYLKVCGKYITFAKF
                     GWGTSAVQSRELVKEKIENYKKYGIKTYPGGTLFEVCFSKNLFEEYLKECKDLGFECV
                     EISDGSMELKPEDKDYAIKQAKKSRFYRSFRSW"
     CDS             273590..274594
                     /codon_start=1
                     /gene="hypE"
                     /locus_tag="MMKA1_02810"
                     /product="hydrogenase expression/formation protein"
                     /protein_id="BAP60398.1"
                     /transl_table=11
                     /translation="MNITRMHGAGGTVMQKLIKETILGNLENTKIEGGIGLESLDDAS
                     TIPIGDKEIVFTVDGHTVHPIFFPGGDIGRISVCGTVNDLSVMGAKPVALSLSIVLPE
                     GFDIEKLDKIMKSINEACKEAGVAIITGDTKVSNVDDIIISSAGIGIVDSGKAVRDCG
                     MKEGDVIIVSGNIGEHGLTILLSREGFEFESELKSDVAPVNGLVQSVLNAGFEINAMK
                     DPTRGGLADSLNEMAEKSDLGILIHEDKLPISDEVQAIGEALGIDPLTVANEGKVVMS
                     VKAEDSEKILEILKAHPLGKNAKIIGNVTSEHKGVLMETIVGKRIVDTPMGDPIPRVC
                     "
     CDS             274846..277599
                     /codon_start=1
                     /locus_tag="MMKA1_02820"
                     /product="hypothetical protein"
                     /protein_id="BAP60399.1"
                     /transl_table=11
                     /translation="MKIFKVFLVMVILGAISGVCAEDTTIYVNNTHYWYQSGAFFESN
                     NSIQDAVENVPENGLVEITADLKVSNGIEVNKSNIIIDLKGNKLSGNYEGRGISLSGN
                     NVSLKNGLVSNFDYGIVLENAENCKISNNEVFGNTYDGIYILNSKNNEISENLVYENG
                     VIGIVTSGIFLDGSEFNNITKNTVNNNIYNGIELLNSKNNLISGNNVFENEDNGVFVW
                     NSKNNSIIFNELYQNENNGILTRESEFNTIESNNIFENDDSGIYSWKSFENTISKNKI
                     SKNSEGIILWNSDLNVLFKNKLLNNVKSGISIEFGTKYNTIYDNLFNNSLNVRFEDSG
                     KNYWNAPVINESNILEGEFTAGNVWYTPEGTGFSQKAMNQDSNGDTLSETYYELNSEN
                     IDNIPLAPDSVPPVVSIVSPRENAFFGENETILVDVSVTDNSEIHSVMLEVDNSYKEI
                     MVQNGTTYSKSLDNLDYGAHTIKIYAEDAVGNVNFFESRVFSISTPDSTPPEVRIISP
                     VSKSYAEGSEVSIKVQITDESDIYSAYAKIDDYTVDLIESNGYYINILDNLEWGAHTL
                     WIIVTDAAGNSNYNEKVTFDVNEGDITPPEVEIIEPEIGDSFEENVSIKVSATDDSGI
                     DSVKVMLDEKVSFTLTKNSEYYTGILNDLSYGIHTLRVYAEDNEENINSDEVIQFEIE
                     VPDYSYTKPITDDIKEPAETSNTENKTTDTPLNNETGEITPNEPENESNGEIENNTDE
                     SQNSETQNNTDADDGGNISDNPSENDSPLEPEDSGSADSGDTSDTEPDNNDEGSEDSG
                     DINSETGDATGEEPTETSPDDETQSNDETCESETSDDEQSETPSETEDTTGDESSETS
                     PDDNSGGESESNSETEDSETSDDESSDSSSESESNSDTSSEDNSDGETSDNSPEESGD
                     SVA"
     CDS             complement(277624..278658)
                     /codon_start=1
                     /locus_tag="MMKA1_02830"
                     /product="hypothetical protein"
                     /protein_id="BAP60400.1"
                     /transl_table=11
                     /translation="MRKIVVFLTVILVLLMAGCIGDQKSKSYNDKGLELYNQGNYVDS
                     ISEYNLALLENPKSAEIWVNKGNSLLKLGIYGESRECFNKALLIDSENSEAFNGLGTV
                     LSKTGNYQKALEMYDKSLNINSENSEAWKNKGITLTNMQSYSEAIECFDKSISINAKN
                     SDVWYNKGEAQFKLGQYEKSIDSYNKALLIDEKMETALLGKRNSYLKLQNYESAIECF
                     NTAETINPKSEYPPYYKADAYRDTENFEDALKYYDEALEINPSNADVLINKGICFDKM
                     KNYSAAISNFDLAIQIDPKNVQIWILKGNSYVGLKDYESSISCYKKALEIEPKNENAK
                     ENIDIIEKII"
     CDS             complement(278788..279930)
                     /codon_start=1
                     /locus_tag="MMKA1_02840"
                     /product="hypothetical protein"
                     /protein_id="BAP60401.1"
                     /transl_table=11
                     /translation="MYIRVNNGVTECNIRLVGTAHVSDDSVKEVENAIIETDPEIVAI
                     ELDKDRFVAMFQNKKNNVDLKSVIKQGKVGIYIVHSILANFQKNIGEQFGIKPGSEMK
                     KATDLAIQHGKPISLIDRPINVTLSRTVNKMTLKEKFDFLMGLLTEQNLELDKKAVND
                     MVSNADDLILLLKDISPSIYETLVDERDRYMAKNLFEASKGKENIVAVVGAGHVPGIK
                     NYLKKMEIGEDIDLKSLMEIKKKSNILGKIISIAILLIILYGFYTASSNLEALKTLTM
                     EWVLINGCLSSLGVILARGKIHTIIAAFLAAPVTSLIPVVGAGYVAGLVELKFRDVSF
                     NDIGKMMNTENFKELMENQAMRVLLVAALANLGSAIGTFYFVPRFL"
     CDS             280006..280467
                     /codon_start=1
                     /locus_tag="MMKA1_02850"
                     /product="hypothetical protein"
                     /protein_id="BAP60402.1"
                     /transl_table=11
                     /translation="MIFVKDVMKRPITLNKDDNIEKAISTFRENKISGAPVVEGEKLV
                     GILSESDIIKALTSHDDRFSLVLPSPFDLIELPLKTAIKIEEFKGDMENALKTEVFEA
                     MTEKVVSVSSETPITNAAEIMVKNKIKRLPVVEGEKLVGIVTRGDLIEAMI"
     CDS             280480..281457
                     /codon_start=1
                     /locus_tag="MMKA1_02860"
                     /product="beta-ribofuranosylaminobenzene 5'-phosphate
                     synthase"
                     /protein_id="BAP60403.1"
                     /transl_table=11
                     /translation="MKLNSPSRIHMGLIDLNGELGRVDGGVGVALDYPNFQIEGKESS
                     EIEIDFRIEIDEKDKENLESRIKNAAKNVLDIIGESGISLKVNDAILSHSGLGSGTQV
                     SLSTGKITSLVYGIDLNAETLAKITGRGGTSGIGVAAFETGGFIVDGGHTFGEGKDKI
                     DFRPSSASKDVKPSPVLFRHDFDWDIVLTIPKGEQVCGDREVDIFRKFCPVPTEDVQK
                     ICRLVLMKMMPAVIEKDFDSFGKVVNELQNLGFKRAEVGLQKESLKGLLSKLQEVSYS
                     GISSFGPTIYSLGDKDTITEISNEFFDKFGIEGEIISTKANNSGYEIIK"
     CDS             281478..281867
                     /codon_start=1
                     /EC_number="3.5.4.19"
                     /gene="hisI"
                     /locus_tag="MMKA1_02870"
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="BAP60404.1"
                     /transl_table=11
                     /translation="MDKNIKEIIKNMDLKFRNIDGKKLLLAISTDKQKNVLMTAFMSE
                     ESLEKSIETGYMHYYSTSRDKIWKKGEESKNVQKIIDVYRDCDGDALLFTVEQTGWAC
                     HEGYMSCFHNKIDLNTGDSTVIGTKLD"
     CDS             281928..283820
                     /codon_start=1
                     /locus_tag="MMKA1_02880"
                     /product="hypothetical protein"
                     /protein_id="BAP60405.1"
                     /transl_table=11
                     /translation="MSIEEINQNLNENKKFKECKITVDTCVVIDGRITELILDGRIEK
                     CKIIVPEAVISELEAQANKGREIGYFGIEELKKLVTVAKENEILLEYYGERPSTGEVS
                     LARAGEIDAMIRKVAKDTDSILFTSDKIQYNLAIAQNIDAHFLKVHEEKVDLKLIEYF
                     DEITSSVHLKENCLPYVKKGRPGKVRLIPFADEIMNRTEIKVIIDNILKYTEQNHGLV
                     EIERRGATVIQLGNLRISIARPPFSEALEVTAVRPITKISLEDYNLSEDLKVRLDSAE
                     GIFVSGAPGSGKSTFVSALAERYKNMDKIVKTMESPRDLQVDAEITQYAPLEGSMEKT
                     CDILLLVRPDYTIYDEVRKTKDFEIFADMRMAGVGMVGVVHASKAIDSIQRLIGRVEL
                     GIIPQIVDTVVFIENGKIGKVYEVEFNVKVPHGMKEADLARPVIEVVDFLTKTPEYEI
                     YTYGEQVVVMPIKETIESRGAVLAYAEEKIAEVLKKHLPKKSRPDIRVVNKDTVEVKV
                     LEKFIPVIIGKGGKEISKLEEITGLRISVREKDEVVENEKDFETYEFINEYESTKLSQ
                     TGKHVIVELGEDYIGANIKIYIDGEYACTATVSSNGTVNISKKTAIGKDLASAMKKGK
                     DIYVEF"
     CDS             complement(283822..284298)
                     /codon_start=1
                     /EC_number="4.1.1.21"
                     /gene="purE"
                     /locus_tag="MMKA1_02890"
                     /product="phosphoribosylaminoimidazole carboxylase
                     catalytic subunit"
                     /protein_id="BAP60406.1"
                     /transl_table=11
                     /translation="MITIIMGSKSDVKIAEKAVSILKEFEIEYEVRVASAHRTPELVE
                     EIVKNSKSKVFIAIAGLAAHLPGVVAAMTTKPVIAVPVESKLDGLDALLSAVQMPPGI
                     PAACVGIDRGENAAILAAEMLSISDERIEKKLTEFRENQKEKIFSDDLEVSSLFKN"
     CDS             284487..284906
                     /codon_start=1
                     /EC_number="2.7.4.6"
                     /gene="ndk"
                     /locus_tag="MMKA1_02900"
                     /product="nucleoside diphosphate kinase"
                     /protein_id="BAP60407.1"
                     /transl_table=11
                     /translation="MVCENEVERTFVALKPDTVERKLVGRVIQRFEDRGFEIVEMRML
                     TLTMEMAEEYYGEHKGKEFYERLIKFMTSGRIVAMVIKGERAISTVRKMLGNTCPCDA
                     EPGTIRGDFGLYTPANIIHASDSLESAEREIDLFFGR"
     CDS             285066..286862
                     /codon_start=1
                     /gene="infB"
                     /locus_tag="MMKA1_02910"
                     /product="translation initiation factor IF-2"
                     /protein_id="BAP60408.1"
                     /transl_table=11
                     /translation="MALRCPIVSVLGHVDHGKTSLLDKIRRTRVTQREAGGITQHIGA
                     SEIPINTIKKVSKDLLGLFKADLSIPGILVIDTPGHEAFTSLRKRGGALADIAILVVD
                     INEGFKPQTIEAINILKQCKTPFVVAANKVDRIPGWNSSEGPFILNFNEKNQHPNAMT
                     EFEIRLYENVIKHLNELGFDADLFSRVKDTTKTINVVPVSAMTGEGIPDLLVIISGLA
                     QKFLEQKLALNVEGYAKGTVLELKEEKGLGKTIDAIIYDGIAKTGDFLVVGNPDGVLV
                     TKIKALLKPKELDEMRDPKDKFKPSKQISAATGVKISAPDLDNVIAGSPLRIVPKDQV
                     EAAKEEVLEEVEEFTILTDDEGIIIKADTMGSLEALANELRKVNAKIKKAEVGDISKK
                     DVIEASSYASTNPLNGLIISFNTKVLADAKAEIEKSDVKLLEGKIIYKLVEEHEEWTK
                     EMEELMKSDEINRLTKPAMIKILPNCIFRQKEPAVCGVEVLYGTLKIGSPIMSEDGKK
                     LGYVKEMRDNQQENIKEAKVGMQVPVSIDGNIVLGRNAKENDILYVEVPEPEARKLHH
                     EFKDELRGDEKEALSRYMELKQKIENNIFWGM"
     CDS             286997..288457
                     /codon_start=1
                     /locus_tag="MMKA1_02920"
                     /product="hypothetical protein"
                     /protein_id="BAP60409.1"
                     /transl_table=11
                     /translation="MILVIGYGSLGRKVVNNAKNIDKVTVIDKNEAVFESLENGDFNY
                     VIGDASELDVLERAKVKEADTLLVLTNDYELNRKIVEITSELNSKAYIIARGIIKYPE
                     LYNGLDINKIIYPLESAAKDAVNEIEKSKLRRKLAELKEVANNAKKSFNEHYSEKEDE
                     TQENHKAPFLILMHRNPDPDAMASAMALKTIFDKWGVNSEIAYGGKIGYDENKAMVNL
                     LSIKLNQIDEINLSRYCSIAVVDSSSAKTLPIDIEGSKLAVIIDHHNDSDIVAKYMDI
                     MPEIGATATILTNYLLGLDITPNRDLATALYYAITSDTNYFKRKTSKKDFEAASYLQG
                     LMDPKVLEMIENPDMDTETMEILGKAIMNRKIIKGNLALSYVGTLKNRDALPRAAEFL
                     LKMEGISTTYIFGIAENEIHISSRTKDLRVDVGNIMKTAFGGGGHQSSAAASVELGIF
                     QSVSDKQSLRKLVEEAIQAKIFETMGIEEEEPAGQD"
     CDS             288467..288697
                     /codon_start=1
                     /locus_tag="MMKA1_02930"
                     /product="hypothetical protein"
                     /protein_id="BAP60410.1"
                     /transl_table=11
                     /translation="MLKELINKLLWHPDYNPEDYIINYLHRGAENDEKSVPLKNIVIE
                     DSFLVFDETHIPFHRILEIVNTKTGEIIYKKR"
     CDS             288703..289497
                     /codon_start=1
                     /locus_tag="MMKA1_02940"
                     /product="hypothetical protein"
                     /protein_id="BAP60411.1"
                     /transl_table=11
                     /translation="MVYAEEYMTKKVHSITPDATVSDIIKLVKETTHDTFPVVVNSKV
                     KGIVSVHDLIGKDELDEVSEFMTPRDDMIVTKPHTKIMDVGRIMFRTGFSKLPIVDEN
                     NNILGIITNTDVIRSQIEKTTPKKLKKIVNSYINLGYEVTTKRETIQIDDLIPTQANV
                     YEDELYGRAYELKRGLAEPIIVIKTNVNEKYILVDGHHRAVAACLSNIKELEAHVLEI
                     NTDKTMGIEKTAEKQGLKSLKDIKILDEEKMNCSSAYKLRANILEL"
     CDS             289535..290275
                     /codon_start=1
                     /locus_tag="MMKA1_02950"
                     /product="hypothetical protein"
                     /protein_id="BAP60412.1"
                     /transl_table=11
                     /translation="MQKTGRFLEIDFFRGLAIILMVISNFVTDLKYFLGYSEYLLFWS
                     FFALFVASSFVFISGVSFNVSFSKKVASKNLTYKSYFNRFLKLSVIAVAITAVTAYFL
                     TSGTIYFGIMHFLAISGILGIIFYRFKKLNLFFSVIFLFLGVLFSEIVLDTYWLLPFG
                     ILPTNFYTLDYFPIFPWFGVYLLGMSFSEKYYKNGVSNNSFEIFKTGFFNKICILGQN
                     TLIIYIIHQPVLVGLLILKYGIFSKIAP"
     CDS             complement(290300..291382)
                     /codon_start=1
                     /gene="hypD"
                     /locus_tag="MMKA1_02960"
                     /product="hydrogenase expression/formation protein"
                     /protein_id="BAP60413.1"
                     /transl_table=11
                     /translation="MDAKIMNINNKELIKKSIQTIQKLSEKLDEVKIMHVCGSHEHTI
                     CKYGIRDVLPDNITVVPGPGCPVCVTTQKEIDKAMYLAEQGYTIATLGDMYRVPGSKK
                     SLMQLQSEGADVKIVYGIGDAVKLAKKQDEKVVFVAIGFETTAPTTAAELLNKPENFY
                     ILNSHRQTPPVMGFLLGGGTSLNLDGFICPGHVSTITGLKPYYDPCKTYHAPMVVAGF
                     EPIDVMASIVMILKQLVNGDAKVENEYTRGVREEGNVIAQKIMNKVFEPADVAWRGFP
                     VIKDGGMKLREEFKKYDVHENIDVPDIKETINKACICSEILRGEKLPHDCKLFGKTCD
                     PMNPVGSCMVSDEGTCRIFYKYSKFR"
     CDS             291629..292009
                     /codon_start=1
                     /locus_tag="MMKA1_02970"
                     /product="nascent polypeptide-associated complex protein"
                     /protein_id="BAP60414.1"
                     /transl_table=11
                     /translation="MFPGGGKFNPRMMKQMQKMMKDFGMDAEDLKAVKVTIELEDKLL
                     VFEKPKVQVMDMLGNKTYSITGKAKKVAKEEEKIEDVEVKVEVTEEDIEMVSSQCGVS
                     KEEAKKALEEVNGDLAEAILKLGN"
     CDS             292082..293425
                     /codon_start=1
                     /locus_tag="MMKA1_02980"
                     /product="hypothetical protein"
                     /protein_id="BAP60415.1"
                     /transl_table=11
                     /translation="MDIERYVRKCLKKGISESKIIEDGFKKVIEVKDTDEGWARRFVE
                     AVVEEVKTTEKYRESEDKNLKYILDCPESGITMGKMGVGSRGEGDFFVHREIARIIES
                     TNQDTEVDSTEQDDAGVVRANAEHVVVAVDGTHSRLSDFPFIAGFHVARAALRDVYVM
                     GADAVAVISDVHLADDGDVSKIFDYTAGICAVSEAIDVPLVAGSTLRVGGDMVLGDRM
                     VSAVGAIGTIEKGEPTARKRAEVGDVILMTEGSGGGTISTTALYYGMFDVINETINVD
                     FLKSCKNLIENDLLKHIHVMTDVTNGGLRGDAFEITNTAKVSLEIYKEKVNELVNPKV
                     LEMLQKLNIDPLGVSIDSLLIIVPKDKAGEIMEKTGAKQIGVVKEGEVSYLIDENGEK
                     ELLIPKFREAAYTPVKKVVGEQKPDNFEEMKEKVRKTCDMAIEKKDFVVKEMFKN"
     CDS             complement(293422..293607)
                     /codon_start=1
                     /locus_tag="MMKA1_02990"
                     /product="hypothetical protein"
                     /protein_id="BAP60416.1"
                     /transl_table=11
                     /translation="MDMEMILGLIDTLEQKGVGIQLSVENQKTVEISIKNKNVDINIV
                     DPSKIGKLIKELNIKTD"
     CDS             complement(293619..294545)
                     /codon_start=1
                     /EC_number="4.1.2.13"
                     /gene="fba"
                     /locus_tag="MMKA1_03000"
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="BAP60417.1"
                     /transl_table=11
                     /translation="MVKKITFEDVLIPMETPESMHEEYVQNYMKLTRHTGNLMLFAGD
                     QKIEHLNNDFYGENISKDDADPEHLFKIAKNSKIGGFAVQFGLLSRYCRDYKDINYIV
                     KLNSKTNLVDVDQKDPLSLALLDINDILEFKKNSGVNIVGVGYTIYLGSEYESEMLSE
                     ASKIIYEAHKGGLVVILWIYPRGKAVQNEKDPKLIAGATGVASCLGADFVKVNYPKSE
                     NPAESFKEAVMAAGKTKVVCAGGSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSL
                     SDAVAMCNAIYAITIDGKTVSEALNIYSERKS"
     CDS             294704..295672
                     /codon_start=1
                     /locus_tag="MMKA1_03010"
                     /product="putative pyrrolo-quinoline quinone"
                     /protein_id="BAP60418.1"
                     /transl_table=11
                     /translation="MLRGGVNDCKIKWEFLIGNSIDSSPILAKNGTIYLGSSNKNLYA
                     INPDGSVKWFFKSGEIIECRPSIGKDGTIYFGSDKVYAINPDGTEKWRFDTKKAIVSD
                     FTIFEDILYVTSLDGHLYAINPDGTEKWRFKTKKAIYATPIVSEDGTIYVGSNDNYLY
                     AINPDGTEKWRFKTNDSITSAASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTVT
                     RPAISEDGTIYVTSLDGHLYAINPDGTEKWRFKTGKRIESSPVIGNTDTIYFGSYDGH
                     LYAINPDGTEKWNFETGSWIIATPAIDENGTIYFGTRNGKFYALFN"
     CDS             295796..296701
                     /codon_start=1
                     /EC_number="2.7.1.39"
                     /gene="thrB"
                     /locus_tag="MMKA1_03020"
                     /product="homoserine kinase"
                     /protein_id="BAP60419.1"
                     /transl_table=11
                     /translation="MKKVKVCSPGTSANLGPGYDIFGLALSNPYDIVEVEKTENGITI
                     SVEGEKAEEIPTNVDENTAGVVAKKMIQDFKIESGIHIHIIKGIKPGSGLGSSSASCA
                     GIAFALNELFELKLSKLELVKYSSLGEAVAAGAPHADNVAPAIFGGFTLTTSYEPLEV
                     LHIPINLEVLVALPNIQVSTKTAREILPKEIPIKDMVNNVGKAAGMVYALYNNDLDLF
                     GRYMSKDCVVEPCRANLIDGYAEVKEKVKDMVYGITISGSGPAIITIPKKEHVIDIEN
                     IFKDVWNCPVYYTKVGPGCYVEEIE"
     CDS             complement(296738..297826)
                     /codon_start=1
                     /locus_tag="MMKA1_03030"
                     /product="hypothetical protein"
                     /protein_id="BAP60420.1"
                     /transl_table=11
                     /translation="MKGFCYRCGHEGELLDGLCKICYTHMNPLIEVDNEVHVEVCHMC
                     GSYKRKLWQDPQKRETYEIMEEIAYFGVKDNLKKANKSIDVEIMPQEPRQLPGGKRSR
                     VEIPTVVFAKGRLVGEDNDREEERHITVYLDMVQCPRCSRCMSNYYEGTLQVRAMNRF
                     LNDKERIELDDFVRDEAGKRLNKDRMAFISKYIPQKEGLDYQMGSMGAIRNIASAIKA
                     KYGGKSIETAKLVGVDKDTGKDMYRITVAVRIPEFKIGDILEHNEKIYVVSSLNESRV
                     YMEPVELGDKIALVWNEIDKSAKLIKKGEDCETATVISITPDTITAMDDSNYEIYEYN
                     NSIENVKEGNKIRIFKNEEINRILEIIE"
     CDS             complement(297884..298300)
                     /codon_start=1
                     /gene="eif2b"
                     /locus_tag="MMKA1_03040"
                     /note="protein synonym:aIF2-beta"
                     /note="protein synonym:eIF-2-beta"
                     /product="translation initiation factor 2 beta subunit"
                     /protein_id="BAP60421.1"
                     /transl_table=11
                     /translation="MVDYFDYSSLLTRAREQLPEEVFKDVRFEIPSADSFVEGNRTII
                     KNFKDIAKFMERDPQEFAKYVMKELGTAGDMEGVRLILQGKFGWRMVNEKIQNYVNEY
                     VLCPECGKPDTKIVKEGRIHFLKCTACGAMKPVKTL"
     CDS             298527..299111
                     /codon_start=1
                     /gene="rpl15e"
                     /locus_tag="MMKA1_03050"
                     /product="50S ribosomal protein L15e"
                     /protein_id="BAP60422.1"
                     /transl_table=11
                     /translation="MSMYNYVKEAWKVPANSYVKELQWARMQDWRKEPSVLRIERPTR
                     IDRARNLGYKAKQGIVVVRVSVRRGGLRKPRPKHSKKPATLGINKITMAKSIQRIAEE
                     RAAKRYPNMEVLNSYWVGQDGKQKWYEIILVDPCHPSIKNDKSYSWLSTGNHKGRANR
                     GLTSAGKKGRGLMYKGKGAEKARPGVRANGKKTK"
     CDS             300087..300335
                     /codon_start=1
                     /locus_tag="MMKA1_03060"
                     /product="hypothetical protein"
                     /protein_id="BAP60423.1"
                     /transl_table=11
                     /translation="MNQDEKQFKKILLDSLFISCIIIAIPAILCLFGAGHCTLGLFFG
                     AILTFLVGIMVLFRKDEIISLILGGRCRYHIKKLKSED"
     CDS             300595..301056
                     /codon_start=1
                     /locus_tag="MMKA1_03070"
                     /product="hypothetical protein"
                     /protein_id="BAP60424.1"
                     /transl_table=11
                     /translation="MVNNITISTIANATEDEEKVLDSIVFFLPEIIEEDDLETETVET
                     EGNFGNPIEIHTVKISGKKAKLVFNYIIDLIKSDERNVNRLKKELDSRIEKNKLYLRF
                     DKQKAYLEECKLFDGDDTVRIVVNFKIFVPSGKEEKVKEMVLERLDKRGVF"
     CDS             301056..301436
                     /codon_start=1
                     /gene="hypA"
                     /locus_tag="MMKA1_03080"
                     /note="protein synonym:putative hydrogenase nickel
                     incorporation protein"
                     /product="putative hydrogenase nickel insertion protein"
                     /protein_id="BAP60425.1"
                     /transl_table=11
                     /translation="MHELSYATSVLNAILDAVKQQEELGRKIIKVNDINLEIGDLTLI
                     SLDQLQFVFEVISEDTACKGAELKAEMVKPKIFCNDCEFEGNLDTKDELEVVCPKCES
                     RNIKLKGGKEFNIVNATIEFDDEE"
     CDS             301635..301994
                     /codon_start=1
                     /locus_tag="MMKA1_03090"
                     /product="hypothetical protein"
                     /protein_id="BAP60426.1"
                     /transl_table=11
                     /translation="MKKEIKLKELSNNIVKSLLENPDKPVHEIMDELDIYSMNLDDED
                     LDLAKSLVCELLSRIDVVSMNLDDEDIAHTMSMISLRFHMHDKYNKFEIMDVPHLQAR
                     IKDAAKYIKYVKKSNKA"
     CDS             complement(302008..302145)
                     /codon_start=1
                     /gene="rub"
                     /locus_tag="MMKA1_03100"
                     /product="rubredoxin"
                     /protein_id="BAP60427.1"
                     /transl_table=11
                     /translation="MSVWKCTICGYVYDEEKEEKKFSELPDDWACPICGAKKSAFVEQ
                     K"
     CDS             complement(302211..302969)
                     /codon_start=1
                     /locus_tag="MMKA1_03110"
                     /product="hypothetical protein"
                     /protein_id="BAP60428.1"
                     /transl_table=11
                     /translation="MRNLEKINELLEIFGHFDVNFAKYMEEKIDTQYFVLENLKNSMK
                     NDEMFIKLVILNSIVSYQLCTTGELWWEEFSKYWSKHDANNENLGESYVNFLENSKGN
                     KRLLNVKIKRIERIIPFLENLNLLDFKTYYSDMGKLLENLSKYLNSKKNSKTVVFAVK
                     MFGYASRIVFNEFFPYPMNIEIPKDSRIEKYTLKFTDENPIKFWNEVSKTTNIPPLHI
                     DSIIWPILGRNFDFKTCENKLDENFRYLLKLTEL"
     CDS             complement(303016..303876)
                     /codon_start=1
                     /EC_number="1.2.7.3"
                     /gene="korB"
                     /locus_tag="MMKA1_03120"
                     /product="2-oxoglutarate ferredoxin oxidoreductase beta
                     subunit"
                     /protein_id="BAP60429.1"
                     /transl_table=11
                     /translation="MENSLFQRTEKLDISWCPGCGNFAIKASLSNALTELNLKPENVA
                     IISGIGQAGKMPHYIKVHGFHTLHGRAIPAATAVKATNPNLTVIAEGGDGDMYAEGGN
                     HLIHAIRRNPNITVLIHNNQIYGLTKGQASPTTLISTKTPTQPWRVFEEPLNPIALAI
                     SLNASFVARTFSGNLEKTKEIIIKAINHKGLSIVDIFHPCPSFNKLNTLQWYKENTYF
                     LEDHDITNRKKAFEKSLETEKYPLGIFYTCEKPVFEEVVPPYISEKTPIWKREPNLEK
                     IEEIINLKRS"
     CDS             complement(303882..305594)
                     /codon_start=1
                     /EC_number="1.2.7.3"
                     /gene="korA"
                     /locus_tag="MMKA1_03130"
                     /product="2-oxoglutarate ferredoxin oxidoreductase alpha
                     subunit"
                     /protein_id="BAP60430.1"
                     /transl_table=11
                     /translation="MNLEKEVSIVLGGAAGQGIQTIEESLTKILKLSGYNVFATKEYM
                     SRVRGGINTTEIVISSEKQRSFLKRLDLLVTFKKGVLNHLKDRISDETIILGEKENID
                     EEFMNNKNIIDIPIQEISKNIGNVLFSNTVGSGIILGIFEGNLKLFNKYLEDKFSKKG
                     KEIVDKNIEAAEKGYELGKKILKDLDLSLNIEKNEKINNEIILSGTEAVALGAAKAGC
                     NFVSFYPMTPSTGVSTFLATHSKDLGIIVEQVEDEISAINMAIGAGYAGARSLVTTSG
                     GGFSLMCEAVSLSGMTETPVVIYLAQRPGPSTGLPTRTAQGDLELALYSGHGEFPKII
                     YAPGKIEEAHKISQIAFNMADKYQVPVFVLSDEYLADTYYNLSDNELESLKKENHVVK
                     TSLDYKRYEFNENIVSKRGIPGFGEGIVLSCGNEHDEFGDITEDIDLINKMTKKRNKK
                     LDLIKKEAIEPEFIGNETYKNLIVSWGSTFYPIKDALEKLNLKDTAFLHFSQVYPISD
                     SAEKCLKNAEKVINIELNYTGQLGRLLKREFGIEMNDSILKYDGRVFAVEEIIEKIEK
                     VLRE"
     CDS             305667..306356
                     /codon_start=1
                     /locus_tag="MMKA1_03140"
                     /product="hypothetical protein"
                     /protein_id="BAP60431.1"
                     /transl_table=11
                     /translation="MNDDIYDEMVRERGREYFLKNMVKYCVKRGNTLHGTVYGSDKYI
                     TKVDLKTKTGICTCPYQYNCKHAYALLESYKSGKYVDGDELFLNFSKLDKLEILKIFE
                     NMIEKHNLWDEFITEDKTLLDTAKNMLELTKIEKKNVFTFTSFLRNQFLKNAKNEELL
                     LIIPDVIKYIQERKKLEEILFLIVDELFERGKTDKDILKKLIELSRKYRELWMVKDNI
                     LDYEYFELLEY"
     CDS             306513..306725
                     /codon_start=1
                     /locus_tag="MMKA1_03150"
                     /product="hypothetical protein"
                     /protein_id="BAP60432.1"
                     /transl_table=11
                     /translation="MELDVTGTVCPMPVLKTKKALDSLTSGDELTVTGDYKPALQNIV
                     RFVEDKGHEVLSTEESSDGFKIVIKK"
     CDS             306735..307079
                     /codon_start=1
                     /locus_tag="MMKA1_03160"
                     /product="hypothetical protein"
                     /protein_id="BAP60433.1"
                     /transl_table=11
                     /translation="MKFTVIIGDAPYGKERAYSALRFALTALLEGIDVNIFLLEDGVY
                     VGKKDQNPAGVPKYSELLENAIEAGAVVKACGPCGKARGISDEELLDGIAFGTMHDLI
                     AFVKEADKTINF"
     CDS             307203..307787
                     /codon_start=1
                     /locus_tag="MMKA1_03170"
                     /product="hypothetical protein"
                     /protein_id="BAP60434.1"
                     /transl_table=11
                     /translation="MFNDDKEFTLKKLQEALDNGFVDLEVMYLVDKINEFKDYYTTSS
                     CIGRCGIIEFPKDKNPKINSRWLGKWHHYANYDEIDEALLKKSENFEKISFVLNSPIL
                     HVASRNADTSKKLLELAYHNGLKASSIKSISSKRYIVEIMTTAKMDAPIAYDGKMVVN
                     REYLDILLDEGNLKLKHARKSLKRFYEKLNELQD"
     CDS             307842..308225
                     /codon_start=1
                     /locus_tag="MMKA1_03180"
                     /product="hypothetical protein"
                     /protein_id="BAP60435.1"
                     /transl_table=11
                     /translation="MLDLKGTSSKDIFPLAYSIHILVNKSPVTMRSRDKPGVRIEKGK
                     LLDDNYEGYVLKQVLDYGEILRVTPICGPYAGVPVVVVPVKEEDEISGAVGIVDLTAG
                     IFEEIHSITRRKELAKFLPDEAFPR"
     CDS             308246..308686
                     /codon_start=1
                     /locus_tag="MMKA1_03190"
                     /product="hypothetical protein"
                     /protein_id="BAP60436.1"
                     /transl_table=11
                     /translation="MKKVFIFPSNSLILADLVERFGHKPLMINNAIGDKVRNLEIDTP
                     PLNITDEDPKKGLKYAAIEVPSGVRGRMSLIGPLIDEAEAAIVMVHAPIGFGCVGCER
                     TNELTKYLIRRKEMPVLNIEYPENDEDAKVVVKKIALFLESLEK"
     CDS             308695..309150
                     /codon_start=1
                     /locus_tag="MMKA1_03200"
                     /product="hypothetical protein"
                     /protein_id="BAP60437.1"
                     /transl_table=11
                     /translation="MKKTAFMLLLVFSLVLSSVSGEIINLSENTDLFSEMKTIAMAHS
                     KDLDKIPFATNIAKNERINLNVKTNESDSFVSVIVEDGIITSFEKGSLENATMNMYAD
                     ESTVREILDSDDPVSSAQSALKADKIRMEGVGIVNSIKVSVVNVLMSFF"
     CDS             complement(309439..310683)
                     /codon_start=1
                     /EC_number="6.2.1.30"
                     /gene="paaK"
                     /locus_tag="MMKA1_03210"
                     /note="protein synonym:phenylacetyl-CoA ligase"
                     /product="phenylacetate-coenzyme A ligase"
                     /protein_id="BAP60438.1"
                     /transl_table=11
                     /translation="MNNKQLETYALVKKLLQHVSEGSEFYKNKFSKAGITIEEINSLE
                     DFKKIPFTEKEELRSAYPLGLQAVPDEKIVRIHSSSGTTGSPVIIPYTQKDVDTWSEM
                     MMRCYQMAGVTNKDRIQITPGYGLWTAGIGFQLGAERLGAMAIPMGPGNTEKQLQMMV
                     DLKSTVLTSTSSYALLLAEEIRKKGIQDKIHLKIGVIGSERWSEKMRNRIESELGIKS
                     FDIYGLTEIYGPGIALDCEYHEGMHYWSDHLLFEIIDPVTGENLPDGELGELVITTLT
                     KEGAPLIRYRTRDLTRIIPEKCKCGSEYPRIDRILGRADDRIKIKGVNIYPGQIEDLI
                     HKLNGVSSEYQIVLSRFEGRDSMLFKVEVDVSEKDFEETKLAIIKAFKTYIGISPDVE
                     CLKVGELPRSEKKSRRVFDNRD"
     CDS             complement(310676..311275)
                     /codon_start=1
                     /EC_number="1.2.7.8"
                     /gene="iorB"
                     /locus_tag="MMKA1_03220"
                     /product="indolepyruvate oxidoreductase subunit IorB"
                     /protein_id="BAP60439.1"
                     /transl_table=11
                     /translation="MNFSVIICGVGGQGVVLASRLLAITAMNSGFHVNTAETLGMSQR
                     EGSVVSHLQFGDSIKSSLIPEGGADLIIGLELSEVARNLHFLKKNGKILTNCKMILPS
                     ARSSNEKYDSEQIINFINKYVKSTICIDFSKIAKIAGNPKSMNVSVLSAAFYTGFLPL
                     EYNDFLKTIESEIPEKYRAINLNAAKLSAETIMLEGNNE"
     CDS             complement(311272..313089)
                     /codon_start=1
                     /EC_number="1.2.7.8"
                     /gene="iorA"
                     /locus_tag="MMKA1_03230"
                     /product="indolepyruvate oxidoreductase subunit IorA"
                     /protein_id="BAP60440.1"
                     /transl_table=11
                     /translation="MGNEAIAYGAIAAGLQFGAGYPGTPSTEVMETLIKNAKKYNYYV
                     EWSTNEKVALETAIGASFSGASSIVTMKQVGLNVASDPLMSLTYLGIKGPLVLLVTDD
                     PGPHSSQTEQDTRSFGLFSNIPVLDPSNSQEAYEMTKYAFKISKSYETPVILRTTTRV
                     SHRCDDVVLEELKPSDENIEGFSKSPRWAIFPKLTAERHPILEKLQKTLSNEFSDSKF
                     NFKTGTGKIGIITSGASYHYVNEAISNNKELFSVLKIGTPHPFPENKVIEFTNEVDLI
                     LVVEELDSYLEDQLLQLLGKQSILKPVYGKKNNIFPCCGEYSINIVKIGINKVLDSLK
                     IQKLEISEKLIDKTDIISLPVRPPNLCAGCMHRTVFYAFKEVSKELKKYNIQTIFSGD
                     IGCYTLGNAPPLELIDTCLCMGAGISIAGGISRTTKNSKNVAFIGDSTFFHSGIPAVI
                     NAVYNNADVTIAVLDNRTTAMTGHQPHPGTGKTALGNPTKLIDIEGILKSCGVEFVKT
                     VSADDFSACKEISKEAIEYNGPSAVVFRGNCVSLVKSDKKCIIDKNKCINCKICVERL
                     GCPAITMNDEIPEIMDNCTGCGLCNAVCPADAVIEVTKQ"
     CDS             313478..314629
                     /codon_start=1
                     /EC_number="3.1.3.11"
                     /gene="fbpA"
                     /locus_tag="MMKA1_03240"
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="BAP60441.1"
                     /transl_table=11
                     /translation="MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDETLI
                     DYYVTNCGDDIDMIMTHDKGTDNEEVHKLAWDALEAATEVAKELKLYGAGQDLLSNSF
                     SGNVKGLGPGCAEMEFVERPSEPVVVFCCDKTDPAAFNLPFYKMFADPFSTAGLVYDP
                     SMTSGFRYEILDVFAHKRVFLDAPEEMYSLLALIGNTEKYAVKRVYRRKDNEIAAVCS
                     SEKLNMIAGEYVGKDDPVAIVRAQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPV
                     AEEDAMPARFDGPARVMALGFQLSKGRLVGPNDLFADKSFDKAREKALDMAEMMRSMG
                     PFMPHRLPESMMEYTSVPKVLAQLKDRFLEMDEGCECKLDEIRERGDME"
     CDS             complement(314718..316370)
                     /codon_start=1
                     /EC_number="4.2.1.9"
                     /gene="ilvD"
                     /locus_tag="MMKA1_03250"
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="BAP60442.1"
                     /transl_table=11
                     /translation="MISDNVKKGVIRTPNRALLKACGYTDEDMEKPFIGIVNSFTEVV
                     PGHIHLRTLSEAAKHGVYANGGTPFEFNTIGICDGIAMGHEGMKYSLPSREIIADAVE
                     SMARAHGFDGLVLIPTCDKIVPGMIMGAIRLNIPFIVVTGGPMLPGEFQGKKYELISL
                     FEGVGEYQVGKITEEELKCIEDCACSGAGSCAGLYTANSMACLTEALGLSLPMCATTH
                     AVDAQKVRLAKKSGSKIVDMVKEDLKPTDILTKEAFENAILVDLALGGSTNTTLHIPA
                     IANEIENKFITLDDFDRLSDEVPHIASIKPGGEHYMIDLHNAGGIPAVLNVLKEKIRD
                     TKTVDGRSTLEIAESVKYINYDVIRKVEAPVHETSGLRVLKGNLAPNGCVVKIGAVHP
                     KMYKHDGPAKVYNSEDEAISAILGGKIVEGDVIVIRYEGPSGGPGMREMLSPTSAICG
                     MGLDDSVALITDGRFSGGSRGPCIGHVSPEAAAGGVIAAIENGDIIKIDMIEKEINVD
                     LDESVIKERLSKLEEFEPKIKKGYLSRYSKLVSSADEGAVLK"
     CDS             complement(316443..317360)
                     /codon_start=1
                     /locus_tag="MMKA1_03260"
                     /product="hypothetical protein"
                     /protein_id="BAP60443.1"
                     /transl_table=11
                     /translation="MGEFCENTLNMKNKEYMLVNQTLLEELSNGGFFEKNDFYIYFVC
                     SCPKIQIIPEKFKFIEHTAYFYFKIWNKDNYSIEELKWKFDEEISLTSKYPYNELTLT
                     NQNHETHTNFSTLFYNKFAEKTLDFEVLYIGQSFGKDGCRNVDQRLLSHSTLQKIYSE
                     ILLNDPNKEIWLLLLSFDEPYQYILLTNKSKQMDSKNWVENRKAGNSIPLNQRINYTE
                     AALINYFKPEYNEKFKENFPDPNHKSYTSCFEYNMDRIGFELITGPDFPINLYSKEIK
                     SDYYHTGIYSLEDLKRKYMIFDYGNLLDK"
     CDS             complement(317381..318067)
                     /codon_start=1
                     /EC_number="2.1.1.130"
                     /gene="cbiL"
                     /locus_tag="MMKA1_03270"
                     /product="precorrin-2 C-20 methyltransferase"
                     /protein_id="BAP60444.1"
                     /transl_table=11
                     /translation="MVDKIYGIGVGPGDTDLLTLKAVNVIQNADTIFVPISKEGKASV
                     AYDIIKTIIPENKKVVELLFPMSKDVEFLQKHWNNAAEKVMEENGTVAVVTIGDATLY
                     STFSYVWHIFNENKIDVEIINGISSPFAAAGVLNIPLVEGDEKLAILPQGKDLERYLE
                     EFDTLIVMKTNDLEEKLKNLKDKKDNYLVGVVNRVTSKNQKTALGKIDEIDFKPFKDY
                     LSLAIIKKLK"
     CDS             complement(318087..318938)
                     /codon_start=1
                     /EC_number="2.7.1.71"
                     /gene="aroK"
                     /locus_tag="MMKA1_03280"
                     /product="shikimate kinase"
                     /protein_id="BAP60445.1"
                     /transl_table=11
                     /translation="MRCSAVSLGSGTIINAIATGFGSAFGVDLKIKADVELIDNGKKI
                     VNGISIDNPTLKPSLVERCVKNVFDHFEVDYSAKISTIGDIPIKSGLSSSSAASNAAV
                     LATIGALGEKVDSNLVLDLAIKSSFEENLTVTGAYDDATASYFGGITVCNNMERKILK
                     KDKFKEDIKVIVLMPEFKKNVDVNRMKLIKDYVDMAFEKCMNGDYYKALFLNGLLYSS
                     ALNFPSNISVDALEAGAITAGLSGTGPSYVALCYPEDEKNVENALKKHGETIITKPSN
                     DGAKILY"
     CDS             319071..319616
                     /codon_start=1
                     /locus_tag="MMKA1_03290"
                     /product="hypothetical protein"
                     /protein_id="BAP60446.1"
                     /transl_table=11
                     /translation="MKYEVVITSGNSNQAPIGAFFKGDFVTLHLYGGSHTFENLQKDG
                     FYILNTCSPYLIAKSVLDDAGDYEYLDKEGIKIPYLKDSYKIELIEIKSRKIVETKNE
                     FGSSKLMIVEGKPIFEKILNCNTSAYNRADGAVVEMAVLYSRKNMISKEEMNEEMNRL
                     MKIIKKVGSKNHIELAKKLGV"
     CDS             319617..321077
                     /codon_start=1
                     /gene="rfcL"
                     /locus_tag="MMKA1_03300"
                     /note="protein synonym:clamp loader large subunit"
                     /product="replication factor C large subunit"
                     /protein_id="BAP60447.1"
                     /transl_table=11
                     /translation="MEEWVEKYRPKSLNDVAGHNKTKQALIEWIESIIGGQNQKPILL
                     AGPPGSGKTTLAYAIANDYAFDVIELNASDKRNKDVISQVVGTAATSKSLTGRRTLIV
                     LDEVDGLSGNDDRGGVAEIIKVLKTAENPVILTANDVYKPALMTLRNSVNLINVGSVH
                     TNSIPPVLRRIALKEGFEIDEKIIKMIASHSGGDLRAAINDLQSLATGGSIEIEDAKE
                     LPDRDSEKSIFDAMRIIMKTTHYDIATSATRDVKEDIGTIEEWISENLPKEYLKYKDL
                     AEGYDYLSKSDVFLGRVYRRQYFGLWRYASALMTAGTALAKEEKYRGFTRYGPPAIFT
                     KLSRTKGSRQKMKDILKKIALKTHTSTKRARNTVDYLTVIFESNAEVSAELVEYYELT
                     KDEIEFLTNKTITKKILSVIAGKKPKVKKETPKKKEKPKEVMPIIPKRPRISEPPKEP
                     LKEVIEETLEKSVEKADTKEEKKKDPKKQATLDSFF"
     CDS             complement(321087..322115)
                     /codon_start=1
                     /locus_tag="MMKA1_03310"
                     /product="hypothetical protein"
                     /protein_id="BAP60448.1"
                     /transl_table=11
                     /translation="MVFCIKVNFKLGEKTRKIMLDNHLLSKNYKLKKEGEFLYIPLTS
                     SDFDKKIFEDENIEFEISEIDENKISKINSEKKTSFKDYLLNNFKNEVDENLIAHAYD
                     IVGDIVILQISEEIVPEIRKKIGENALKLIPSVKAVFRRESDVKGDFRVRDLEHLAGE
                     EKTLTLYKENGYRLLVDVAKVYFSPRLGWERKRIMDLVTFDDIVVDMFCGVGPYSIAC
                     KNAEKIYSIDINPDGIELLKQNIVLNSLENKIVPILEDVRNVDVKGTRVIMNLPKYAH
                     EFVDKALEIVEEGGTIHYYTVGADFDEGIELFKSKCECEILDKRIVKSYSPREYVFVI
                     DFKILKKN"
     CDS             complement(322166..322546)
                     /codon_start=1
                     /locus_tag="MMKA1_03320"
                     /product="hypothetical protein"
                     /protein_id="BAP60449.1"
                     /transl_table=11
                     /translation="MKYLRGHSFEEFVEKIENLDAEEDAIYINTELSKNIIIEILESC
                     EVKKIILPESKFKRTNKKVLGALKEIGIEVKSIKPVTGRPTSKKEIVEKYIEKTPKEI
                     SEITQIPLKTVEYHYYKIKKAISQ"
     CDS             complement(322613..323635)
                     /codon_start=1
                     /EC_number="1.2.1.59"
                     /gene="gap"
                     /locus_tag="MMKA1_03330"
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="BAP60450.1"
                     /transl_table=11
                     /translation="MANVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEAKMAV
                     EKGYKLFAAIPERKHLFEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKH
                     GVKAIIQGGEKAGDAQDSFNSLWSYDRCYGKDYIRLVSCNTTGLCRSMYAINSVADIL
                     KARIVLIRRAADPNDIKTGPVNAIVPNPVSVPSHHGPDVVSVIPELDGKIMTSAVIVP
                     TTLMHMHSIMVETSGTNRDEIIDALAKTPRILTVKASEGFDSTAKIIEYARDLGRSRY
                     DLNEIAVWEESVNVVDNEVYLMQAIHQESDVIPENVDCIRAMLEMESDNLKSIEKTNK
                     ALGLIK"
     CDS             323853..325844
                     /codon_start=1
                     /EC_number="6.1.1.10"
                     /gene="metG"
                     /locus_tag="MMKA1_03340"
                     /note="protein synonym:methionine--tRNA ligase"
                     /product="methionyl-tRNA synthetase"
                     /protein_id="BAP60451.1"
                     /transl_table=11
                     /translation="MRHLVTTALAYTNGPLHLGHARSTYIPADIFTRYLKLKGEEVIH
                     IGGTDNHGVPITLTAEKEGVKPIDIVDRYHNAIKADLDSLNICFDNFGRTHSDIHIET
                     AQEFYSKLKENGYIYEKEIEQFYCEKCDMYLADRYVEGICPFCEGEARGDHCEVCGRH
                     LEPTELVNPYCIHCNSKPEIKRTTHYFFKLSAMQDALKEYIENSPEMPEHVKNMALRW
                     IEELHDWDVSRNIKWGVPIPGCDDQVMYVWIEAPIGYVSFTKQLGDIWKSYWLENTDE
                     SKISHFIGKDITVHHAVFWPGILKGIGGYKMPNAVVSGGYLTLENKKMSTSKNWVVWV
                     KDFVENFSSDYLRYFFMINAPLNRDTDFSWDDFQKRINTELIDIIGNFTHRTLVFTER
                     KFGSTPIVDLNQLKDEDKKLISKCEDTEKLVDSLIREYNFKDALMEIIHLAKEGNGYF
                     QGMAPWAIKDEERLKEVMYTCSVVLKYIIYLLSSFMPEKTALLLDYMNEELDLKVRGN
                     ALKKPKVIFTKVSDEDISRMKENLLKATKKAETKSDEKSKKVKSGEKMDIIDIDYFGN
                     IDLRVGQILEVEEVPRSKKLYKIIADLGDEKRQIVSGLKGAYEAEELVGKKVIIICNL
                     KPAKLCGVESQGMLLAAEDDSIVSLLALDRDLPVGSKIH"
     CDS             325980..327497
                     /codon_start=1
                     /EC_number="2.4.2.4"
                     /gene="deoA"
                     /locus_tag="MMKA1_03350"
                     /product="thymidine phosphorylase"
                     /protein_id="BAP60452.1"
                     /transl_table=11
                     /translation="MLFLNAKFIDLDLGENAVIVNEEDLKGTSYYPQDRVLIESHAGS
                     VIGNIYSTKTMVQKGEVGMLVSELAEISISEGEEVKLRHAEKPESIPFIKKKMDGQVL
                     NPHEIRTIIDEIVSKKLSNIELSAFVSSTYINGMNMDEIGEMTKRIAETGDMISWEKN
                     LVVDIHSIGGVPGNKYALLSIPILAAAGITIPKTSSRAITSPAGTADVMEVLTNVELK
                     EDEIKRIVKTTNGCLVWGGGVNLAPADDIIINVERPVSIDPQPQLLASVMAKKIATGI
                     KYTVIDIPVGKGVKIKNEAEGAKLARKFIELGELLNIKVECVLTYGGQPLGRAIGPAL
                     EAKEAIEALQDPKNAPKSLIEKALSLAGILLELGGAAQIGEGQNLAWEILESGRALEK
                     FNQIIIEQGGTPKKPEEIELGDYIEEIIAPIDGYVTDINNTGITNVVKEAGAPRDKKA
                     GLLLNSKIGNKVKKGDVLYTIYSGSEERLVSAVNLARRVYPVKVEGMLIERISKF"
     CDS             327607..328413
                     /codon_start=1
                     /locus_tag="MMKA1_03360"
                     /product="hypothetical protein"
                     /protein_id="BAP60453.1"
                     /transl_table=11
                     /translation="MNGMLLIREFIYRYYIYPIDTKQGYNLIQEITYGILLFVMVYTF
                     YRMCLKLKIAIDRRFAEVTVFYVILITLMRALVDAGLFPRLYYTVTPGIVVAVGIYYM
                     ISIIISGILLKNRYYLLSIAMAVVPILYMLFEFSSRITHPEAIVYVSGILVLSYYLLI
                     YIVEKLKKAKIERIDKYAIFSQLVDASATSVGIGVFGYWEQHPVPRFFMDYFGPYSII
                     PLKMLVVLLVLDIFNKEVKDDNLRNILKITVMALGLAPGLRNLFRTVMGV"
     CDS             328428..328718
                     /codon_start=1
                     /locus_tag="MMKA1_03370"
                     /product="hypothetical protein"
                     /protein_id="BAP60454.1"
                     /transl_table=11
                     /translation="MAEPEYNEEINMEVTEEKMREYMDNEVDEGDYIEVYFGRCHVEG
                     TIDAKEGTHYRVDTDNKTFGLMEFDIENISRDVLEVAHIPENSNKKIILSVL"
     CDS             328727..329365
                     /codon_start=1
                     /EC_number="5.4.1.2"
                     /gene="cbiC"
                     /locus_tag="MMKA1_03380"
                     /product="precorrin-8X methylmutase"
                     /protein_id="BAP60455.1"
                     /transl_table=11
                     /translation="MFMGAVTKDGKDIADRSREIVKTKISEVLGKNVILYSNDEMGII
                     ERVVHATADPEYSKLVKFDNKPIENGLKAINDKSPIIADISMVKAGIRYENVLCTISE
                     KKVFDVAKKEQVTRAVASIRASKEIIDGGIVVIGNAPTALLEVIRLNKEEGITPKLVI
                     GAPVGFVKAAESKELLRTTKIPSISTLGPKGGTPVAVSAINGIIALSKNERI"
     CDS             complement(329367..329759)
                     /codon_start=1
                     /locus_tag="MMKA1_03390"
                     /product="hypothetical protein"
                     /protein_id="BAP60456.1"
                     /transl_table=11
                     /translation="MCIFCDIVKRDIPARIIYEDDKFLAFMDAFPRAVGHTLIIPKEH
                     FETFDELPKELACEMMEVIHKIVKKLEKLEMDGYNLLNNNKQVSGQEVPHVHFHIIPR
                     YENEGYPVYVLKDPINVDLDSIYDRIME"
     CDS             330193..330933
                     /codon_start=1
                     /locus_tag="MMKA1_03400"
                     /product="hypothetical protein"
                     /protein_id="BAP60457.1"
                     /transl_table=11
                     /translation="MDMLLKIIYSAAITGLLAALIYKKKYLDKWGVFGSSVMAFTILF
                     LADLKWLLLLISFLVLGSLVSKMGYGFKKTIKMAESRRSLKNVLANGLMAILFVLAYS
                     SGFITEEIALVGYVGAIAAANSDTFSSELGMLSRETPRLISNFKTVKTGTDGGITVCG
                     TFAGLLGSFLIGLLAYALFNDILMFWTATISGMIGNFADSFLGAFFERKGILNNEHVN
                     FMATLSGGTFAVFKVRLGIVRFNNLLCL"
     CDS             330950..331663
                     /codon_start=1
                     /locus_tag="MMKA1_03410"
                     /product="hypothetical protein"
                     /protein_id="BAP60458.1"
                     /transl_table=11
                     /translation="MDMLLKIIYSAAITGLLAALIYKKKYLDKWGVFGSSVMAFTILF
                     LADLKWLLLLISFLVLGSLVSKMGYGFKKTIKMAESRRSLKNVLANGLMAILFVLAYS
                     SGFITEEIALVGYVGAIAAANSDTFSSELGMLSRETPRLISNFKTVKTGTDGGITVCG
                     TFAGLLGSFLIGLLAYALFNDILMFWTATISGMIGNFADSFLGAFFERKGILNNEHVN
                     FMATLSGGTFAVLFYQLVL"
     CDS             331823..332527
                     /codon_start=1
                     /locus_tag="MMKA1_03420"
                     /product="putative tRNA/rRNA methyltransferase"
                     /protein_id="BAP60459.1"
                     /transl_table=11
                     /translation="MKTVVILVNPKYGGNLGAIARNMMNFDVEELRIVGTPEILDDEA
                     YIRAVHAKNILNNAKFYSKLEDAISDIDFTVATTGAVCGDRNVNRVPITPRELAKKHS
                     SISGTLGIVFGREDDGLKNEDVELCDILVSVPTSNKYPILNLSHAVSVILYEIYFESF
                     SEDIPYDLNMKNASVDEKNALLRFFNEFVDRSKDVPDYRKDICKTIFKRIVGRAFISG
                     KEANSLICVFKDKCPK"
     CDS             332598..333011
                     /codon_start=1
                     /locus_tag="MMKA1_03430"
                     /product="hypothetical protein"
                     /protein_id="BAP60460.1"
                     /transl_table=11
                     /translation="MSISGAQGKSLVLKYENNEIIFNLSNEEEGLLDTVSMDLETSAL
                     FVTLLNHGVVSAEEINRKFKKEGIKLQKIQDVGTCFANESRVSIAILPADEKRTASIL
                     IGIHKEDEHSSIIIKPKRAAYLSISITKMLINTME"
     CDS             complement(333066..333467)
                     /codon_start=1
                     /gene="hjc"
                     /locus_tag="MMKA1_03440"
                     /product="holliday junction resolvase"
                     /protein_id="BAP60461.1"
                     /transl_table=11
                     /translation="MAHKYQKGSTFERELKKKLESHGFAVIRSAGSHGVDLVAGKKGK
                     KPIIIECKSTSKDKYYIPNEDVEKLLEFSKTFDGIPFIALKINRKCLFINPHLLTSAG
                     KNYALDYEKLCPIALDIKDVAEDSIQKKVGF"
     CDS             complement(333484..333930)
                     /codon_start=1
                     /locus_tag="MMKA1_03450"
                     /product="hypothetical protein"
                     /protein_id="BAP60462.1"
                     /transl_table=11
                     /translation="MKSKVIVLAEDSKTSPSRLFRYLNSLEYDINVKETCFGAFIEGE
                     DGVVDEVVKLVRDLEKNKIFCKDRGFPIWDQRRCRAFRKGGPREGFHQLEAEQKILDR
                     ISKALDAVENEEISEEKIEEEFKNLKNKKLKVDAFEKIADEVLKEN"
     CDS             complement(333960..335012)
                     /codon_start=1
                     /locus_tag="MMKA1_03460"
                     /product="hypothetical protein"
                     /protein_id="BAP60463.1"
                     /transl_table=11
                     /translation="MPIISINENGFLDKLKGTNGLFSCVISSIETTKYVGISGVNKSV
                     IDYTPAADMELVTTGESLSLNHPPIDATGCPSPATITRAAVDILKIPVMTVDAGSYIK
                     PKIPYISVDQRPTGDIQKGLGMDNSKELLNLGKIIGNNNIYDSLVIGESVPGGTTTAL
                     GVLLGLGYDARDKISSGSVENPKDLKLSVVESGLKNSKSKDVFDVLNAVGDKMMPVVA
                     GMAISAVSKGKPVLLAGGTQMASVLAAIKEISPKTLKSGLLGISTTEFVLNDKNADLK
                     DIIEQIGDIPLYASKFGYENSKIDGLKAYCNGSVKEGVGAGGIATYCYSNGLNPKDIR
                     EYVEKNYEIWYSKLIQ"
     CDS             335132..335647
                     /codon_start=1
                     /EC_number="3.6.1.13"
                     /gene="nudF"
                     /locus_tag="MMKA1_03470"
                     /note="protein synonym:ADP-ribose diphosphatase"
                     /note="protein synonym:adenosine diphosphoribose
                     pyrophosphatase"
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="BAP60464.1"
                     /transl_table=11
                     /translation="MEYNLLLKIKDESMEKEVLDELLNFLDKKYAGKVVAEPYRRINL
                     TVDILIKYNFGIVLIKRKNEPYKDYWAVPGGFVEYGERVEEAAKREAKEETGLNIDNL
                     TLIGVYSDPNRDSRGHTVTVAFLADGIGTLKSGSDAKDARIFNLDELNGVDFAFDHKK
                     LIDDSIHYIFD"
     tRNA            335758..335835
                     /locus_tag="MMKA1_t0120"
                     /product="tRNA-Arg"
     tRNA            335863..335937
                     /locus_tag="MMKA1_t0130"
                     /product="tRNA-Glu"
     CDS             336150..337859
                     /codon_start=1
                     /EC_number="6.4.1.1"
                     /gene="pycB"
                     /locus_tag="MMKA1_03480"
                     /product="pyruvate carboxylase subunit B"
                     /protein_id="BAP60465.1"
                     /transl_table=11
                     /translation="MVKITDTSFRDAHQSLMATRLRTEDMLPIAEKMDEVGFYSMEVW
                     GGATFDSCIRYLNEDPWERLRELKGKIQNTPLQMLLRGQNLVGYRHYPDDVVDKFIQK
                     SIENGIDIVRIFDALNDIRNVEYSIKAVKKYGAEVQGAISYTTSPVHTTEQFVELAKQ
                     FEELGCDSLCIKDMAGLLRPFDAKELVGMLKEELSIPIELHSHCTAGIAPLAYMSSVE
                     AGIDILNCAMSPLSMGTSQPPVESIVAALKGTKYDTNLDLVLLTEIRDYFDEIRNKYK
                     CLINPISERVDARILRYQVPGGMLSNLVSQLKEQGALDKFEEVLNEIPNVRKDLGYPP
                     LVTPTSQIVGTQAVMNVLTDERYKIITNEVSNYLKGYYGKSPAPISKDLVKRALQDGE
                     KQITCRPADLLEPEYELMEKEAFAKGIVSKEEDILTYALYPQVAVKFLRGELKAETIP
                     QEKDVSKFMEIPNEYIVEVDGDSFNVKVEPVYSSGIKKEEKKEIITAETEGAVTSPFR
                     GIVIKIKVSTGAEVKQGDQILVLEAMKMENPVECPVDGTVEKIIVKEGQSVNVGDILM
                     IIK"
     CDS             337905..339410
                     /codon_start=1
                     /EC_number="6.4.1.1"
                     /gene="pycA"
                     /locus_tag="MMKA1_03490"
                     /product="pyruvate carboxylase subunit A"
                     /protein_id="BAP60466.1"
                     /transl_table=11
                     /translation="MFKKVLIANRGEIAVRVIRACKELGIKTVAVFSEADEHSLYRNI
                     ADECYPIGEPPASKSYLNMERILKVAEKAGVDAVHPGYGFLSENVKFADECHKRGIEF
                     IGPPTNAIDVMGSKINAKKAMKTAGVPVLPGREEAIESEEEAIEVADEIGYPVIIKAS
                     AGGGGIGMNVVYNKEELVDTIQSTKSIAQSAFGDSTVFIEKYLEKPRHIEIQIVADKF
                     GNVIHLGDRECSIQRRHQKLIEESPSPIMTEELRERMGNAAVKAAKAINYHSVGTVEF
                     LYSKGEFYFLEMNTRVQVEHPITEVVTGVDIVKEQIKIAAGKKLSYKQDEITFRGHAI
                     ECRVNAEDAINDFVPAPGKIKYYRSPGGPGVRLDSGVFGGAEIPPYYDSMVAKIITYG
                     LTREEAIERMKRALSEYMVLGIITNIPFHRAVIEEDNFLKGNLSTHYVEDNLCSFRKA
                     MVNYALEAKDREKIFSEKVFHGNKKVIAIAGGLNAYITSLSNKNKDKYDKN"
     tRNA            339516..339592
                     /locus_tag="MMKA1_t0140"
                     /product="tRNA-Val"
     CDS             339703..340137
                     /codon_start=1
                     /locus_tag="MMKA1_03500"
                     /product="hypothetical protein"
                     /protein_id="BAP60467.1"
                     /transl_table=11
                     /translation="MGFSEIYGVAFLSIILLISITVIYGTVDSNLNNILSANDDHAYN
                     LLKKSKENLTVQYEGIDSDSGILNITVVNNGNILEDASKWTVIFEGDVVNNLVIEKTY
                     IEPLSRTQIYIETIYNSTTIDDKRVVVSGEFGTTFLKTIDVH"
     CDS             complement(340138..340809)
                     /codon_start=1
                     /locus_tag="MMKA1_03510"
                     /product="hypothetical protein"
                     /protein_id="BAP60468.1"
                     /transl_table=11
                     /translation="MKIASLYSGGKDSAYALFWALNQGWDVNYLVNVASKNKESYMFH
                     IPNVELTDLVSESTGIEMIKVITKGEKEKEILDLQKNLEKLDIDGIVSGALASEYQRA
                     RIDHICEEIGIKSFAPLWHKDQELILRDTSKFFDFRMVSVAAYGLDKKWLGKRVDETN
                     IEELLKIMEKYQINKAFEGGEAETFVFDAPFFEKKIEVLDYEIIWDGISGSYNIKDAE
                     LVSKK"
     CDS             complement(340862..341740)
                     /codon_start=1
                     /locus_tag="MMKA1_03520"
                     /product="hypothetical protein"
                     /protein_id="BAP60469.1"
                     /transl_table=11
                     /translation="MVKKIVIGVFCMISLLLLCGCTETDSGDQALDEVDSGDENIVSD
                     DAEYIGTFYAAKTDDSLKFTLIFNDAENKLVTATGTAKLNIYDDYDNKIFEKEYVVDP
                     SKAGTNSKYTLIVSLDDIEKGMTESGYAEVVFTSKTGNVINKITNSIQIPYYTEEEIL
                     NIAEQEFLENAVESGDSYELDDIKITALRSGFYTIPGEKSKKIFRVDLKIENKYGQPK
                     DFTPSEVMVYSGTKEYPFTSGGSLNNVSKIPALGSVEGYWLFEDIPDNIEEPRVYFKN
                     GRDSNGEWRLFDLNLE"
     CDS             complement(341874..342158)
                     /codon_start=1
                     /locus_tag="MMKA1_03530"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60470.1"
                     /transl_table=11
                     /translation="MVASNGEMKSKVSSDANGIGYVSIGYVDESINTVQFNGVEPTQK
                     NVKEGLYTIYRPLNLLTKGEPDENVKKFIEYVLSEKGQEIVKNDGFLPVN"
     CDS             complement(342248..342445)
                     /codon_start=1
                     /locus_tag="MMKA1_03540"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60471.1"
                     /transl_table=11
                     /translation="MAGRNLKSEEKELYNDITVYKIGLDGIAIITSNENNISDLTTQQ
                     VQKFILAKLQTGKVLVEVTAL"
     CDS             complement(342454..342699)
                     /codon_start=1
                     /locus_tag="MMKA1_03550"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60472.1"
                     /transl_table=11
                     /translation="MNFQKIALFLVLLISISCFSGCMDNSGEVSEPVTIKMAGGTALI
                     PIIEDISKEYMLENSNVQIEVTGGGSGFGVKETGEGH"
     CDS             complement(342742..343863)
                     /codon_start=1
                     /locus_tag="MMKA1_03560"
                     /product="putative 2-hydroxyglutaryl-CoA dehydratase"
                     /protein_id="BAP60473.1"
                     /transl_table=11
                     /translation="MEELKSIKKISEAFAGRKNELYGQKDEGRKVFGLFCTFVPTELI
                     LAANAVPVGLCGGKESTIPSAEEILPRNICPLIKSSFGFKKDKACPYIEASDVIIGET
                     TCDGKKKMFEHLAEMTRLHIMQLPHFRDDRSAKLWLAEVEELKKLIEEETGNKITEEK
                     LKEAIDKVNNVRKLFYKIYELRANNPSPINGKDSLKLFQLSYLLDINTIESVLEDLVE
                     ELEERVKKGEGYSGKRILIAGCPMVAGNTKIPELIEDTGAVVVGEESCTGTRQYENYV
                     EGYTIEKLADRYFKIPCACKFSNEERIERIKELVKEQNADGVVYYTLQYCHTFNVEGA
                     LIEKELKKAGIPIIRVETDYSESDKEQLKTRIEAFVEMI"
     CDS             complement(344089..344403)
                     /codon_start=1
                     /locus_tag="MMKA1_03570"
                     /product="hypothetical protein"
                     /protein_id="BAP60474.1"
                     /transl_table=11
                     /translation="MNGELFLILIISQLVLWIFVTKIGLGKSVSFVFGSILIILAYYR
                     LLFMDPNIELVCSANNFGIIKNGIINCSLSSKELFLVAIIPWVGYLCNAYVLKAKQFT
                     KF"
     CDS             complement(344494..345087)
                     /codon_start=1
                     /locus_tag="MMKA1_03580"
                     /product="hypothetical protein"
                     /protein_id="BAP60475.1"
                     /transl_table=11
                     /translation="MQEKYTTIFDTSANPAPLGLMGFGMTTVLLNLHNIGLFELSSMI
                     LAMGMCYGGLAQVIVGIMEWKKGNTFGTLAFTSYGLFWLSLVVILTLPKLGLANAPEP
                     IEMAFYLGLWGLFTLGMFFGTFKTNRALQFVFGTLTILFLLLATGDITGNLTVTRVAG
                     LLGIICGSSAIYTGFAEVLNETYQKTVLPIFPVTKKP"
     CDS             complement(345214..345954)
                     /codon_start=1
                     /gene="hadI"
                     /gene_synonym="hgdC"
                     /locus_tag="MMKA1_03590"
                     /note="protein synonym:(R)-hydroxyglutaryl-CoA
                     dehydratase activator"
                     /product="activator of 2-hydroxyisocaproyl-CoA
                     dehydratase"
                     /protein_id="BAP60476.1"
                     /transl_table=11
                     /translation="MILSIDIGSTTTKFVLMENDEIIDYKIKDLGVVIEESDVLKMVE
                     EFKKGRNVKKTVATGYGRHKISFADKVVPEVIALGKGANYFFKDADGLIDIGGQDSKV
                     LKLKDGQVIDFILSDKCAAGTGKFLEKCIDILNLDKELNEYSSENYAKISSMCAVFAE
                     SEIISLLSKKIPKEEIIMGIYDSISNRIVPMVKRMKLENIVFSGGVAKNKILIQVLEK
                     HLGKTLLIPEEPQIVCAVGACIMAFEKP"
     CDS             complement(345979..346152)
                     /codon_start=1
                     /locus_tag="MMKA1_03600"
                     /note="fragment"
                     /product="putative UDP-glucose 6-dehydrogenase"
                     /protein_id="BAP60477.1"
                     /transl_table=11
                     /translation="MFNVDGIIVATEYDFDKEDWSEIKNLVNNPVIFDGKNVMDSKTL
                     KSLGYTYFGIGKN"
     CDS             complement(346170..347303)
                     /codon_start=1
                     /locus_tag="MMKA1_03610"
                     /note="fragment"
                     /product="putative UDP-glucose 6-dehydrogenase"
                     /protein_id="BAP60478.1"
                     /transl_table=11
                     /translation="MKISVIGTGYVGLIQSVGLSKLGFEVTGIDIDERKIKKLNSGIS
                     TLHEEQLEEELKLFINENLKFTSSYESVYDSDIVFLCVGTPQDDFGNADLKFLYSAVE
                     SLKKYIGDKYKTVVIKSTVPVGTCRKIKKILKDYPVEVISNPEFLREGIAFKDFFEPE
                     RIVLGFENPENIESTKLLKRVYSHFEKKGVPFVISSWETSELIKYASNAFLATKISFI
                     NEISKFSDIVGADIKTVGEAMGMDDRIGPKFLNAGIGYGGSCFPKDVKALAKQFESFE
                     LESKLINATESINQTQNIWFFENKIKKYYGDVSGKTFAVLGLAFKPFTDDLRESKAIE
                     LINILLKNGAIVKGFDYIEKARENTINKYALSDSKSLGYSFIY"
     CDS             complement(347303..347851)
                     /codon_start=1
                     /locus_tag="MMKA1_03620"
                     /product="hypothetical protein"
                     /protein_id="BAP60479.1"
                     /transl_table=11
                     /translation="MKNITLTSLIAAIIGGIYFKTFFPIILIIFYMMNNQLKNSFLFL
                     FTCYLLIFGYFFNPSDFSIFLIINMIVIPHLIILFELLHDIKQKYDKIDIIIILCLIS
                     GIVHPEIYIFGIVLLLIKRFNNFLNKKIGIILIPIIISLLIFIKHLDMLNQNLIYKIL
                     VLTGLGVILYAIYSFLNKSQEI"
     CDS             complement(347848..349149)
                     /codon_start=1
                     /locus_tag="MMKA1_03630"
                     /product="hypothetical protein"
                     /protein_id="BAP60480.1"
                     /transl_table=11
                     /translation="MEKQDFLAYVSILLFLEGYLFVNILPTLFGITILLFILLLKFSF
                     DPVFESLIQNSEFEVIENESFEITLNIKNNSKCPLNFKIKENNDNFTWKSDDVLILPK
                     KSANIKVSLTPKSKGSFLIENMVLTVSDAFEIFKKTCEIRNSVHIEVYPSNESIIEGI
                     KINKNKKLGKESLLSSKTGQSTSEFDYLRDYNLGDQFKHIDWKSSLRSGRLISKEFLR
                     EVEGEITVIIDSSKNFLKDFNGGTLKTDYVSILSFQIIYYLIKNHKSANVLFFDESGQ
                     ITLKNSIKTKESLKKCMKNKLTSEKGIPYIPTSKSIISEKTAFLDILKPFLKNSPEKC
                     LSILKYVKPNITAIIITDISNYNEIITLNSELAKKNSKLIIISPNPFLFGLEELNIEK
                     IPEIYNSYLKREKNMIKLNKICPTVDVSPNDLADHIIGEFK"
     CDS             complement(349149..350102)
                     /codon_start=1
                     /locus_tag="MMKA1_03640"
                     /product="hypothetical protein"
                     /protein_id="BAP60481.1"
                     /transl_table=11
                     /translation="MIIMDGKEFLSKIETEMSKCVVGKEDIIKLLLISILSKGHVLLE
                     GIPGLAKTTIVKNFAKTFGLSFSRIQLTPDTMPSDIIGVYYYSEKTKDFAIKKGPIFT
                     NILLADEINRTPPKTQSAMLEAMQECQATVEGTSIKLPEPFILLATMNPLESEGVYSL
                     PEAQMDRFMFKITLEYPKKDEEIAMLKKKYEGSFETVNSVIPPEDLKEAFEKVLEIKI
                     SDEILEYIYEIVKMTRTDDRLLYGASPRTSEQILYASRALAFLNNRNYVIPDDVKEVS
                     KYILVHKIKLKIDYEIEGISNKNIVNEILDKAVVFKKTGDN"
     CDS             complement(350068..351066)
                     /codon_start=1
                     /locus_tag="MMKA1_03650"
                     /product="hypothetical protein"
                     /protein_id="BAP60482.1"
                     /transl_table=11
                     /translation="MEKYFKYILIALLGVIFVSLPAGVPMIKSFSEYSSFNTDWNGCS
                     KFTKMLYDSEIIVTPIYSPYDDYNFDKNGVLFIIGPEIDFSNSEIQKIGNFVKCGNTL
                     IIADDFGTSNQILEQLNLTDKFTKKRLNDIFYATNENLLEYKVPKEYGSGYIVTNIPT
                     YTSKTGFVTASNFSNSNLKNQNPALISKVSYENGNIILIGDPDIFTNGLYNYNKNFLK
                     DFTQKLNSNHIYIDEIHHKDFGYEISVFYVHKSVPKELILIVLLLIVCSFHVQNKKVF
                     NNATKKLISKFSKKRSENDEKVLKNISEKHDIDFDDLKRVINNIKDDNNGRKRISK"
     CDS             complement(351066..352901)
                     /codon_start=1
                     /locus_tag="MMKA1_03660"
                     /product="hypothetical protein"
                     /protein_id="BAP60483.1"
                     /transl_table=11
                     /translation="MSPFKSKILFIVFIISFLSFLAVAAENINLENLKSDDTYVYSYF
                     NTFLGDYDTTINKMIQNNITYINDSKSSFEKTAYLNSEINVYKEYGMDTPAISVIPYF
                     YDFSENLEDLSGLCQEFNKNLELNTTSSKYFAKLIGADIVEKIHLMKSNLRDIKDISE
                     LKKDNETLNFDTSNVEKSLDYLELKFSKNIENIGNVTPSSNLTIFISPKNPLIYENTT
                     IYGTGLNGNGKIIITGPENITENIVLKNNHYSTQYLFKKSGIYTLKLTQYGRESEDID
                     VNISKIPTKIISESYFEFLVLKENNISGKVIDFYGNSINSGDIIFENENLNLENGTFN
                     ISLYADYEKIENYTLKFSESEKYLSSEKNIEINFSKPLLNIQIYSEIGKINKNEPLTI
                     TGTFEKGQDLNLKLWVGNNSIEYFNSNGTFKKEILFEKPGNYEVFVTFDGNDYYDLSK
                     SNVLMINVTDDDKDINLFTAFISQAAEINWKILILILLIIAFGIKFSDLYNIFKNKTQ
                     EKTVKKYPDNILPKSSEKSAVIEKTVLLEYQELYNKIMKKYNINVEFTPNELLKYLKK
                     INPKIYYDLKIITKIHEKAVYGKEKLDNNTLKQFHDLTKRVLENL"
     CDS             353092..353682
                     /codon_start=1
                     /locus_tag="MMKA1_03670"
                     /product="hypothetical protein"
                     /protein_id="BAP60484.1"
                     /transl_table=11
                     /translation="MIDYSVHEALNASNNEFLKKIFENLNLCGKPIYLPPYENLENGG
                     IFIPSSKKFTLNLSAFTENSIFLANKNASSEMGVLINPPLGLGLLKKFEENLGESILK
                     MDTNTAFSVIQSALSSMDLLSDIDLEEKNGKISVKIYKNKEIEVFEEFYYLSPIISSI
                     FLALSKSMNVPVIIEEFLESDEYMEFTAAKYKLGEY"
     CDS             353694..353933
                     /codon_start=1
                     /locus_tag="MMKA1_03680"
                     /product="hypothetical protein"
                     /protein_id="BAP60485.1"
                     /transl_table=11
                     /translation="MKKINLMVITISLWAILTALLSPSIGLYITLLLIGTLIFFEIGD
                     FFISKNNKDSLKIMIYILAGIFTTIVLNKVYTIIK"
     CDS             353952..354497
                     /codon_start=1
                     /locus_tag="MMKA1_03690"
                     /product="hypothetical protein"
                     /protein_id="BAP60486.1"
                     /transl_table=11
                     /translation="MDKEKINKVLTGFLLLILIISIMGVVYIIKHPKQSEYFSEFYIL
                     GKNGMAYDYPTELYSGEQGNLKIGIVNHEGRNVTYYGETWLIISNTTNYSKIDGGNAV
                     MLDNYSVRLEPKPLIVEGDWESQFQKNYSFSINTSGGYQMWFFLFKDNVSNNNISKKL
                     QDANNNTILSLKLNIAVLNWT"
     CDS             354581..354982
                     /codon_start=1
                     /locus_tag="MMKA1_03700"
                     /product="hypothetical protein"
                     /protein_id="BAP60487.1"
                     /transl_table=11
                     /translation="MKIIHFIIPILLLLSAIPLGFASSSGTVVIASTPADAILAAQYA
                     KAMGYKFVYTPGGELSADAKNAVKYSDKVIMIGGPDAISENVENQLNEQVSSVERVWG
                     ADGVDTSLALLKRLIIEILSLKLNIAVLNWT"
     CDS             355066..357099
                     /codon_start=1
                     /locus_tag="MMKA1_03710"
                     /product="hypothetical protein"
                     /protein_id="BAP60488.1"
                     /transl_table=11
                     /translation="MKIIHFIIPILLLLSAIPLGFASSSGTVVIASTPADAILAAQYA
                     KEMGYKFVYTPGGELSADAKNAVKYSDKVIMIGGPDAISENVENQLNEQVSSVERVWG
                     ADRVDTSLALLKRLIIEKPEALNNIVLAEGFNEDITPVALDFDAPILYFAPDNYEKIA
                     EFMGTLNVQNAVVMGSSVPTDLRNVVTKVSQTTNLALGSAETVIKTALSVASNLNPSI
                     LGSVAALVYSEYSEDPLMDAITSYSTGSVGLVVPLPNDDEDTIDEIVSKVTTVTSDIS
                     ISSDSTGVSDSISEAVSDEGAIVTSVSSSSSTGGGGGSSSSSSDSPSTTSEPDCYFTG
                     IVYDTNTDKIIAINQITPSSVPDSYLGDTVLPTNYTVISVNGGAQYIQFADMGSSKDV
                     GNHVELIGEDRIILPKITINTDIINKSYNDVTITQLGNGNGLNLVYPIISGAITYGTP
                     VNATYYGNSNFISDGQNVTLHVVSDRQQFRDAMNSLLDGSTSEFIAMLNNADKYSADF
                     NSTSNAAEFTVLPKTNGENIVIVTMGNGIIDGDDNVTVLGLSGFEYPKYQLNMTKTYI
                     PTSTTYDFNIDMDLNETPLDDVRYGVIGITKSGYAFTLNINGTDPNNKNFDVLFVGNG
                     ASSKLIDNSELVSLNSDKVKDILTTAFNSKTTGVAFNSLSKSNSSSLKIVIDH"
     CDS             357148..358551
                     /codon_start=1
                     /locus_tag="MMKA1_03720"
                     /product="hypothetical protein"
                     /protein_id="BAP60489.1"
                     /transl_table=11
                     /translation="MLKKILMIFSLLFIISSVNAVSNVAVSPENPEVGDTIILTGKTN
                     PNEEVSCSAWFEINPIISQPYYGALLYDVSIPEPPNNFKVTASNVQNLDVSIKMGVWV
                     TISDDADSSGNAVVSKSKVPEGVYDIKIGGKIKDTSKPVTLKVYASTKIKADENGNFE
                     YQYNTDAIEEGTTIYLTIGGVSKEVTVQGTTPAPVVTPVTNTTTTEDTTPPIIKVLAP
                     LKSEYGVNSVEFNIVVTDDSDYDIKIYLDDKEQTYGQNGNYFTGSIYLSEGKNELKIV
                     AEDEYDNKNTKIVYLTYSEDFVENSDSNEIEGTDDLETSENSNEDVSTEEYKNIVVGT
                     MIFNVGNALLTANDGTEISTSGDLEIEEIKIPETALAYVIYPENSEFSIPLTLEIDVS
                     NLSGNLKAMYYDSEKGWINKNYVLKDGVMNINVTNSGYYAIKETETVEENESVIDTIK
                     NFFNAVKIIINAILDRI"
     CDS             358651..360090
                     /codon_start=1
                     /locus_tag="MMKA1_03730"
                     /product="putative polysaccharide biosynthesis protein"
                     /protein_id="BAP60490.1"
                     /transl_table=11
                     /translation="MKQISKNLIIIGAGSAGEYVSSEILNKNIFNYNIIGFLDKNNKK
                     HGKTINGKLVFGNYNNLDEFIGKYNIDEIIIATTEINNLEVEKIYKIAKMDGVTVKIL
                     PRYEELLLKDPFNKQLREVSLEDLLGRTPLRVNDNCIREYIQNRKILITGAAGSIGSE
                     LCRQIVKYGPRKLVLLDMNENDLYLLGLFLKRNYSVDINMEICNIRERAKLDYLFNNY
                     KPEIVFHAAAHKHVPLMEKNVDEAIKNNVFGTKNLVDLSDIHDVQQFVLISTDKAVNP
                     TNVMGATKRLAEFLIENKNGTSKTKFMAVRFGNVLGSSGSVVPIFKDLIKEKKNLTVT
                     HPEVTRYFMTIPEAVELVLEAGYLGEGGEVFVLDMGKPVKILQMAEKMIELSGLKIGT
                     DIDIDIIGLRPGEKLYEELLYDVNCCEKTQNDKIFIAKIKNETLDLLDFEQKLMELKK
                     ILNTYDPNKMKQKLMELVPTYKEVNYGDE"
     CDS             360092..361264
                     /codon_start=1
                     /locus_tag="MMKA1_03740"
                     /product="putative aminotransferase"
                     /protein_id="BAP60491.1"
                     /transl_table=11
                     /translation="MDSNIPLSVPNLSLDILDNIKECIETGWVSTGGQFITEFEEKFA
                     KYVGVDEAVGVQSGTAGLHLGYSILGVKQNDEVIVPTVTFIATVTPITYLGAHPIFMD
                     CDDTLNMDLNKLEEFLENNTEKTVDGLKNKTTGRIIKVISIVHVFGNPIAMEKVMYLA
                     DKYGLKVIEDAAESLGSFYASGKYSGKHTGTIGHLGIFSFNANKIITTGGGGMIVATN
                     PELLSKARFLSIQAKTDPLYFVHDEIGYNYRLTNINAAFGVSQIDKVEEFVKVKCNNY
                     NLYQEKLEKIAGLKLLPFNSGTRPNYWFYSVIVDKAEYGIDRDELLKKLNDVGIQARP
                     LWGLMTDQKPFKECYTYKIEKAKYYVKNLINIPCSSNLTEEQILYVVSKLKEFKRD"
     CDS             361266..361907
                     /codon_start=1
                     /locus_tag="MMKA1_03750"
                     /product="putative transferase"
                     /protein_id="BAP60492.1"
                     /transl_table=11
                     /translation="MNIYIIGAGGHAKVVIDIILKRREFLNEEWDIKGILDDLYDPNL
                     KKELFNIPVVGKICHVLELKNDDENYFVIAIGNNNIRSELSKKYPLKYCSIIHPTSVI
                     GNDVKIGAGTVMMANSVVNSGSCIGKHNIINTAAIVDHDCFLGDHVHVSPNSAIAGGV
                     KIGDRSWMGIGCCVIPGVSVGEDTIIGAGSVVLRDVPSNTKAFGNPCRGIERV"
     CDS             361904..362899
                     /codon_start=1
                     /EC_number="2.5.1.56"
                     /locus_tag="MMKA1_03760"
                     /product="N-acetylneuraminic acid synthase"
                     /protein_id="BAP60493.1"
                     /transl_table=11
                     /translation="MRTFIIAEAGVNHNGSIELAKKLIEKAAESGADAVKFQSFVTEN
                     LVSKTVKKAEYQIANTGAEETQFQMIKKLELTPEDHRVLIEHCKKNSILFLSTAFDLN
                     SIDLLADLGIYIWKIPSGEITNLPYLKKIGSMGQKIILSTGMANLSEVNDALEVLFES
                     GSTDITLLHCSTEYPAPIDEVNLNAMITLKNAFKLNVGYSDHTIGIEVPIAAVALGAK
                     VIEKHFTLDKNMVGPDHKSSLEPFELRSMVNAIRNIEKAMGDGIKKPSKSEIKNKPLA
                     RKSIVAISPIKMGDVFTEDNIGIKRPGYGISPMNWELILGKHSSRDYAEDDLIEL"
     CDS             362914..364083
                     /codon_start=1
                     /EC_number="5.1.3.14"
                     /locus_tag="MMKA1_03770"
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="BAP60494.1"
                     /transl_table=11
                     /translation="MKKICVITGTRAEYGILRPLMQRIKNNEHFDLQIIATGMHLSPE
                     FGLTYKYIEKDGFEISEKIEILMSSDTSIGVSKSMGLSLISFSEVYQRLNPDVVVILG
                     DRYEAFSAMASAVVAKIPVAHIHGGELTEGAYDEFFRHAMTKMSHIHFTASEDYRKRV
                     IQMGESPDLVFNVGAMGLENARTIDLLNKPELEKKLDVTLGERYCLVVFHPETLGSGA
                     DPEFQMQQLINALNNLNDINIVIIKGNSDTNGRTINLLIDSYMQEDNVFGFTSLAIED
                     YLSLLKNSDLIIGNSSSGIIEAPYFKIPTVNIGDRQGGRVQAKSIINCEPSDDKILTA
                     IKKAFSLEFKESLKDLRNPYGEGNTSEDILDILKEFLLNNKFNSKKKFYDIKFEM"
     CDS             364080..364787
                     /codon_start=1
                     /EC_number="2.7.7.43"
                     /locus_tag="MMKA1_03780"
                     /product="N-acylneuraminate cytidylyltransferase"
                     /protein_id="BAP60495.1"
                     /transl_table=11
                     /translation="MNMRKILGIIPARSGSKGLKDKNILQLNGKPLIAYTIEAALKSG
                     IFKDVIVSTDSEKYAKISRKYGAKVPFLRDCNLSSDHATSMDVILDVIEKMQKLGKTY
                     DYAMLLQPTSPLRDEKDIINAYKILVEKNANSVVSVSEADHSPLLCNTLPEDLNLDDF
                     LNMKNISRRQDLPKYYRINGAIYVFKIDYLIKYKIFYHDKCYAYVMDKISSVDIDDIV
                     DFKLAEVLLVENLKIDK"
     CDS             364978..365331
                     /codon_start=1
                     /locus_tag="MMKA1_03790"
                     /product="hypothetical protein"
                     /protein_id="BAP60496.1"
                     /transl_table=11
                     /translation="MGADSYIGEHSTIQSVDGHQVIAGKKCSISHNVRIYTSSNIANQ
                     DFSKELKKYSKDVVIEDYVWIGANVFINPECKIGKNSIVGANSVVTKDIPENSIYGGV
                     PARLIRKKDFNVKNI"
     CDS             365315..366742
                     /codon_start=1
                     /locus_tag="MMKA1_03800"
                     /product="putative polysaccharide biosynthesis protein"
                     /protein_id="BAP60497.1"
                     /transl_table=11
                     /translation="MSKIFKKMKSSSFLNHSKNYLIAEFFNKGLMFLTIPIFTRLLTP
                     NEYGILAVYGSIVTIFTIILGLNFHGSVARYYYEKSNDFNGFLKTNILFLVVFNGVLI
                     PIFYISRNFFGEFFQIGGNLFVIAVIVSILSSFFNIFLASLQASQNSHNYAKTSVFVN
                     SSTIIIAVIWTYFLVENRYYGNVYSQFLVLFSFIIFLLFRFKNIFLNNSNKEYLKYAL
                     FFGVPLIPHALSGIVLAQFDRIMINQLIGSFETGIYSFAYNVGLIMNVIVIAMNNSWV
                     PIFYEHLKNNNYYKIQNLAENYSKLIFTIAFALILFGNEIVTLMADNDYFEALSIVPI
                     IIVSYVFVFLYMLYGNYSFYHKKTGLISFNTFLAGFVNIGLNYLFIPKYGYMAAAWTT
                     LVSYVLLFVLHYCNSKYILKENVIGLKNISKSFATFGIFLTVYYTFVANVSFLISEIL
                     KIGLCAVLAFIYFKKDMLTKNLKSK"
     CDS             complement(367652..368722)
                     /codon_start=1
                     /locus_tag="MMKA1_03810"
                     /product="hypothetical protein"
                     /protein_id="BAP60498.1"
                     /transl_table=11
                     /translation="MKTDQTHDIYLTATPYHILLAIGHSSDNKKSDNKKILVLRPDFL
                     NYKLMIKSLELWDKCPFYKIILLNGNFSQNSFKIKHKRLSYILSSIDNIPKIKKLVDS
                     LKDCGKNIFIFNDTIPEFQYICYENKINNNTYIEDGSAAYSSNKTIKNSQKLKTIVSK
                     FLFGNWYTPTYHNLGTSKYISNCKVFYPDLANSNLKNRNIGELSKTILNQIDKNYLDI
                     VKKLYDLPELPGNTLIILEHSEFISANIEYIKLIKELISKKIKNNEKILVKYHPRETD
                     HYMGEIINNNVSYINQSIPMELIYLTLDTPNIEIYGGASTALLTAKILRPNSKVFSFA
                     NTLNLKDEQLKNTFKAIEITLI"
     CDS             complement(368727..370400)
                     /codon_start=1
                     /locus_tag="MMKA1_03820"
                     /product="hypothetical protein"
                     /protein_id="BAP60499.1"
                     /transl_table=11
                     /translation="MFGLNFKNIDEKNKIKICLIILLTSNIIFLLSIHECFESNINPI
                     DTEYGMFEILPNTYYISCFLLVVAFVYNLFYIQNKKISVILTLFLILYLYLTPALIYD
                     IPRFSTVYKHYGYVDYIMTYGHINPSETSIQNNYHCWPNAWILGDYLLSIFGVSDHLI
                     MLAIFPFIAEIMFLPLLYVFLKKIFGEFNIIWMGIWTYYLFNWINQDYYSAQFFAYYL
                     YFIILYVVLFVKKYEFPVKITSAIITLSLIGYHIITPIMLLFTLIMIYVMHKDLRRKV
                     AYFLSIVLVLYIIWMIYIAYPYFQPRISMVFNAVLNSLHGNVGIKTISQKTWVNPTYK
                     TIVNIRMFCTSLMLLLAGIQVIKLFIQNKGDCNLKIKNLKYLIIGFFQYFMVILPGYA
                     FEGMMRGIYFSMPLIIGYSAKSIIEFSKNRKILLVLFLLLLFPLHIFSHYGDDSINTI
                     QKSSIYQTNFIYNHVNLIEKTKIASYYLLYSYKHVDKIPVSPSTNLIEKMENIGKYEY
                     IAYSNPSANLKYFNGESGLKKFENLTNTLNMNYSKIYTSGNYTDLFITR"
     CDS             complement(370415..371362)
                     /codon_start=1
                     /locus_tag="MMKA1_03830"
                     /product="putative glycosyltransferase"
                     /protein_id="BAP60500.1"
                     /transl_table=11
                     /translation="MEVSCDNVEVSIVISAYTLERMNDIVDLLYSMERQTCQNFEIIF
                     VVDGTYELMNEIKKQVCDVNITNMKFICVGENKGLSNARNLGIANSVGDIIAFIDDDA
                     IADPKWLEKTIESFYKNPEVWGVTGHNEALWVDVKPQKLPKILYWMIGDSSYMFDNQN
                     KVEVRNPCGCNMAFKKFVFDKIGLFSLEFGKKGNLWLFGEDSEIGIRIWKNNGKIIFD
                     PSIKIQHKVYKYRTTFKNILKRTFYEGFSKAYMKKIHGSVLSKETDYLKKLIFEDMPR
                     EFQYLFKRPIRGSKNIIIVLCAVFSVGSGYVYGSKIYKK"
     CDS             complement(371363..372496)
                     /codon_start=1
                     /locus_tag="MMKA1_03840"
                     /product="putative glycosyltransferase"
                     /protein_id="BAP60501.1"
                     /transl_table=11
                     /translation="MDIYEIYKKTERLLCNSLINIVSKACAKSTLNQPPKKILLIKLF
                     GFGNFILLSPLMNILKNHNMEVHVLTTQQNENIVKAYSDLISKSHIVRYNKMWQLPIN
                     SLLLLKKIRDEKYDVTVDLEHVICFTSVLSVFSNSKNIFGFKMPNNPKYKICDQFVIN
                     NDDKHIVYQFLDFLELFGINNNSKNIQLIPPKSEEPGEYLTKLELTIFPEDLLIGINP
                     FVGFQNRLRKWDKFSELIIKLLYMDNRIKIFLIGGPSDGSDVNDFVKINPERIHPVIG
                     IDLKELTQLFKKLNIFISCDTGPIHLAAASGCFTIGLYGPTDPAVYGPFTHNKKVIYK
                     KLKCSPCTTNKNGKKISCNENMCMMDIDVENVLEIVNNHIEAN"
     CDS             complement(372737..373654)
                     /codon_start=1
                     /EC_number="5.1.3.20"
                     /locus_tag="MMKA1_03850"
                     /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
                     /protein_id="BAP60502.1"
                     /transl_table=11
                     /translation="MKVLVTGGAGFIGSNISIELESKNYDVTVLDDFSSGNFKNLLGF
                     SGDILTSSIKDLDLKNIGEFDVIFHQAAITDTTVHNQKLMMEINTEDFKKLLKFSVEN
                     EIKFVYASSAATYGNASSPQKEENAGYPNNIYGFSKWICDCIAKKYMAKNPDSHIVGL
                     RYFNVFGPREQYKGKMASMIWQLLKQMQNGEKPRIFEFGEQKRDQVYVKNIVDINLLA
                     MKSKHNCIVNACSGNAVSFNEIISTLNESLGYNYEPEYIKNPYFEFYQDHTEGSLDLA
                     NKFLGYTPKWNFKEGVIDYINWLKENKYV"
     CDS             complement(373660..374151)
                     /codon_start=1
                     /EC_number="3.1.3.-"
                     /locus_tag="MMKA1_03860"
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="BAP60503.1"
                     /transl_table=11
                     /translation="MNKAVFLDRDGVLNKKLENDYVKSVFEFEILKGVRETLQQLKKL
                     GYVLIVITNQQGIGKGIMSEKDLESIHNYMLKELPEIDDIFYCPHLNGTCDCRKPENK
                     MLLDAKEKWNIDFSKSWMIGDSESDITCGKSVGCKTVLICNDLQHDEFTCKNLDDCLK
                     VIR"
     CDS             complement(374144..375067)
                     /codon_start=1
                     /EC_number="2.7.1.-"
                     /locus_tag="MMKA1_03870"
                     /product="D,D-heptose 1-phosphate synthase"
                     /protein_id="BAP60504.1"
                     /transl_table=11
                     /translation="MITVLGEVMLDKFTYGKVERINPEAPVPILSVITKKYAVGGAGN
                     VANNIASLKVPVNLISSANLNDEFGKKIVEMCSNNNISCKFVSDGRPTILKHRFVALG
                     YNQQLLRADYEEKKPFSETIIDEILLYFKNLKDESDILVISDYNKGLLNRKLVEGLKH
                     EFKGKIIVDPKPENIELYSDVYLIKPNIFEASKILGKEILNTDESVESAGIELVEKLN
                     SNIVITRSEKGVSAFTKNGKIEHISTNVRDVHDVSGAGDTFIATLSYAIDRGYDLIDA
                     VKLANSASSIVVSKLGTSTVTLEELFGDNHE"
     CDS             complement(375064..375537)
                     /codon_start=1
                     /EC_number="2.7.7.-"
                     /locus_tag="MMKA1_03880"
                     /product="D,D-heptose 1-phosphate adenylyltransferase"
                     /protein_id="BAP60505.1"
                     /transl_table=11
                     /translation="MIITNKKLLINLIEELRKNNLKIVFTNGCFDILHKGHVKYLSEA
                     KKFGDVLIVGINSDSSIKKIKGNKRPIIPLESRIEVLDAVNSVDFVIPFEKETPLELI
                     SLIKPDIHVKGGDYTVENLPESKLILEYGGEIKIINLVNGFSTTNVVNSILEMNK"
     CDS             complement(375542..376096)
                     /codon_start=1
                     /EC_number="5.3.1.-"
                     /locus_tag="MMKA1_03890"
                     /product="phosphoheptose isomerase"
                     /protein_id="BAP60506.1"
                     /transl_table=11
                     /translation="MKTYFKESSDLKMKFIDDNEENLINSINILTNALENGNKILICG
                     NGGSAADSQHFAAEIVGRYKLERKGYPAIALSTDTSILTAIGNDYGFEKIFERQIEAL
                     GNNGDILIGISTSGNSENVINAVNIAKNMGIYTIGLLGKDGGQLNNLVDLPLVVPSNN
                     TPRVQECHLTIYHVICEEVEKKLM"
     CDS             376354..376983
                     /codon_start=1
                     /locus_tag="MMKA1_03900"
                     /product="hypothetical protein"
                     /protein_id="BAP60507.1"
                     /transl_table=11
                     /translation="MITENIFFIMNIIGLLAFAVVGALKGIKKGLDLLGIIVLGIMTA
                     LGGGITRDLLVNTIPYALRSPNDMGVALIGVWCAIVIFKVFNEDVSNKYIIQIPDAVG
                     LSAFTTTGAMIAYNFDVSFFGIIILATLTGVGGGIISDILLQKTPSALTEDFYASCSI
                     IGAIAFYLAILSNLSLEMSAVICSIVVLMIRIVAILCKWSLPKFYSEQK"
     CDS             complement(377063..377896)
                     /codon_start=1
                     /EC_number="1.5.99.9"
                     /gene="mtd"
                     /locus_tag="MMKA1_03910"
                     /note="protein synonym:coenzyme F420-dependent
                     N5,N10-methylenetetrahydromethanopterin dehydrogenase"
                     /product="F420-dependent methylenetetrahydromethanopterin
                     dehydrogenase"
                     /protein_id="BAP60508.1"
                     /transl_table=11
                     /translation="MVVKIGILKCGNIGMSPVVDLCLDERADRNDIDVRVLGSGAKMG
                     PEQVEEVAKKMVEEIKPDFIVYIGPNPAAPGPKKAREILSAGGIPAVIIGDAPGIKDK
                     DAMAEEGLGYVLIKCDPMIGARRQFLDPVEMAMFNADVIRVLAGTGALRVVQNAIDDM
                     VFAVEEGKEIPLPKIVITEQKAVEAMDFANPYAKAKAMAAFVMAEKVADIDVKGCFMT
                     KEMEKYIPIVASAHETIRYAAKLVDEARELEKATDAVSRKPHAGAGKILNKCKLMEKP
                     E"
     CDS             378100..378348
                     /codon_start=1
                     /locus_tag="MMKA1_03920"
                     /product="hypothetical protein"
                     /protein_id="BAP60509.1"
                     /transl_table=11
                     /translation="MDDFEKIINSLSDKEVILRVDLKQNIKVINFKIGSMDINGELGI
                     SFRSINPEKKAEEIPENIIEVPEEVSEAAEKVEEKLKI"
     CDS             complement(378387..378917)
                     /codon_start=1
                     /locus_tag="MMKA1_03930"
                     /product="hypothetical protein"
                     /protein_id="BAP60510.1"
                     /transl_table=11
                     /translation="MIKILDASAFIHGYNPSIEEGEHYTTNGIVSEVVSKEDIVKLAI
                     EYGKLKILDPKPETIEKVVKTSIETGDTISNNDIEILALAIDLGGTLYTDDYGLQNVS
                     KKLKIKYGNIVSAGSKDDFVWKKICKGCKKMYPINYQDDECEVCGSPLYRKMVKNRLK
                     KGKKFYDKKKKPKKLF"
     CDS             379002..380375
                     /codon_start=1
                     /locus_tag="MMKA1_03940"
                     /product="hypothetical protein"
                     /protein_id="BAP60511.1"
                     /transl_table=11
                     /translation="MTRNANKNNTECEKCWIFDLNQFRMITDSILDENTLVLEINQNY
                     EVSVLMDYDVSLENGILTFKDFVNDNSKSATVLTGSLKTGILNKMSQSISEGLLNKTT
                     NRRTYYITEPTPLIGHTAFGLIDRGTNVIQVRGLSGCNINCPFCSVDEGIHSKSRKND
                     YYVDKDYLVSEYEKIADFKGYKKLEAHLDGQGEPSLYYPLPDLVQNLNEITSKNKGIV
                     SIQSNGVHLTEKLIDDLEVAGLHRINLSINAMDEKFSKGLSGNKNYDIERIMEIAEYI
                     KNSKIHLLIAPLLLPNYNDEEFKRVLDFAVELEQKTPQTTINPITNKKNPIVGPQLCL
                     TYQFGRKIPKMRVWDFPKFYNLLEFYEKEYLKDGINVNLEVPLHGFFGSHSRKRLPCP
                     FKLNETISVTVLMDGRVNGEVIGASKNRVIQIIDCKTDVNKLNGKRVNVKVLRVKDNV
                     IVGSMVK"
     CDS             complement(380841..382025)
                     /codon_start=1
                     /locus_tag="MMKA1_03950"
                     /product="hypothetical protein"
                     /protein_id="BAP60512.1"
                     /transl_table=11
                     /translation="MDRTYFSEDILNFEEFIVDASKKLNIDEDTLKNGFKRKLITKYE
                     YNGRKYLCFKKKLKHIERGTILFLNDNLDFIIGYPKIRRAMVLESSVKKYFNGKIAVE
                     EKLDGYNIRIVKMHDEIIAITRGGKICPFTTKKVKKYLNTKFLDDFPELMLCGEMVGL
                     NNPYVNHYYPEADKNHENLGFYIFDVRNKKTNLALSTYEKEKILDEYNIPYVKPIKII
                     DNNEIDELWNILDDLNENHREGVVLKDPEMIKNPIKYTTHSTQCGDLSIAFSYVYDLG
                     IDFMFSRLVREGYQSFEKCENEEERKKRAHELGESILLPMVETITEISKESVAKECFE
                     LYFDSEEEFIEFINYLKTMHINFAVESKGYIKKDIFKAKINRIYNSTSDKIKSHLDGN
                     LW"
     CDS             complement(382031..382675)
                     /codon_start=1
                     /locus_tag="MMKA1_03960"
                     /product="hypothetical protein"
                     /protein_id="BAP60513.1"
                     /transl_table=11
                     /translation="MIKIDMHVHTNTSRCSMNFLEMLKKMCSRKHILPIITDHNAMTK
                     VDFGIPGEEISTEKGEFCGIFLTEEIQEKNIFEAVDKVKEQGGLIYLPHPFDWRRRKS
                     LCKYGELENPEFIKNVDIVEVYNSRCVEQRPNDEAYSFAESKNLLMGVGSDAHFPWEV
                     GNAYLNVEDFDLDNPKEFLKVLKKADKNGFYCKRSHPSNMLVCSKLSKRIKKLI"
     CDS             complement(382704..383987)
                     /codon_start=1
                     /locus_tag="MMKA1_03970"
                     /product="amidohydrolase"
                     /protein_id="BAP60514.1"
                     /transl_table=11
                     /translation="MILIKNVSYYIDNNLNVHENCDILIEKVENSEIKLTTGKNLLEK
                     LNLNQNDLKIISGEKKCAMPGLYNAHTHIPMTLLRGIADDMILQDWLNQKIWPNEAKL
                     NKNDVYYGSLLGCLEMLRFGVTSFNEMYFFSEEILKATKEIGLNAQISYPIIDFGTPE
                     EQSIDKLLTSAESFVKNNVGEKNIKVGIAPHAPYTCSEETYQKCSEISNDYNVNMHTH
                     VSETRYEVVELENKIGMRPVEYLEKIGVLNEKLHAAHCVWITKDEAKKLAKNNVKVIH
                     CPTSNMKLASGGVMPLFELLEYGADISVGTDGPASNNNLDILKEMKMTSLLHKAHRWD
                     PTVAGIDTVLKMGINSESIGIKNNDIILIDLDSAHLRPFNNIKSNIVYSAFGNDVDTV
                     IVGGNILLDNKKYKFSETFISNIYKNIQKITEKFE"
     CDS             complement(383993..384316)
                     /codon_start=1
                     /locus_tag="MMKA1_03980"
                     /product="hypothetical protein"
                     /protein_id="BAP60515.1"
                     /transl_table=11
                     /translation="MDYFNIFAYGELMKDEILFELINRVPEKNLGKIYNFEKFFDEKI
                     GYYGIKPKENSSVSGIILFNINSTELEIFDDYEDEGTYYSKNKTICYDLNGKGYESYV
                     YVRLE"
     CDS             complement(384321..386675)
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="pol"
                     /locus_tag="MMKA1_03990"
                     /product="DNA polymerase"
                     /protein_id="BAP60516.1"
                     /transl_table=11
                     /translation="MESLIDLDYNSDDLCIYLYLINSIIKEKDFKPYFYVNSTDKEQI
                     LEFLKDYEKKHKIDSEISKMIENIETVKKIVFDENYQEKELSKVTVKYPNNVKTVREI
                     LMEFERLYEYDIPFVRRYLIDNSVIPTSTWDFDNNKKIDNKIPDFKTVSFDIEVYCNK
                     EPNPKKDPIIMASFSSKDFNTVVSTKKFDHEKLEYVKDEKELIKRIIEILKDYDIIYT
                     YNGDNFDFPYLKKRAESFGLELKLGKNDEKIKITKGGMNSKSYIPGRVHIDLYPIARR
                     LLNLTKYRLENVTEALFDVKKVDVGHENIPKMWDNLDETLVEYSHQDAYYTQRIGEQF
                     LPLEIMFSRVVNQSLYDINRMSSSQMVEYLLLKNSYKMGVIAPNRPSGKEYQKRIRSS
                     YEGGYVKEPLKGIHEDIVSMDFLSLYPSIIMSHNLSPETIDCTCCANEENGENEEILG
                     HKFCKKSIGIIPKTLMDLINRRKKVKKVLREKAEKGEFDEEYQILDYEQRSIKVLANS
                     HYGYLAFPMARWYSRDCAEITTHLGRQYIQKTIEEAENFGFKVIYADTDGFYSKWADD
                     KEKLSKDELLEKTSEFLKNINNTLPGEMELEFEGYFKRGIFVTKKKYALIDENEKITV
                     KGLEVVRRDWSNVSKNTQKNVLNALLKEGSVENAKKVIQDTIKELKDGKVNNEDLLIH
                     TQLTKRIEDYKTTAPHVEVAKKILKSGNRVNVGDVISYIITSGNKSISERAEILENAK
                     NYDTNYYIENQILPPVIRLMEALGITKDELKDSKKQYTLHHFLK"
     CDS             386856..387341
                     /codon_start=1
                     /EC_number="4.2.1.33"
                     /gene="leuD"
                     /locus_tag="MMKA1_04000"
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="BAP60517.1"
                     /transl_table=11
                     /translation="MKITGKVHLFGDDIDTDAIIPGAYLKTTDEYELASHCMAGIDEN
                     FPKMVKDGDFLVAGENFGCGSSREQAPIAIKYCGIKAIIVESFARIFYRNCINLGVFP
                     IECKGISKHVKDGDVIELDLEEKKVILKDTVLDCNLPTGTAKDIMDEGGLINYAKKQK
                     N"
     CDS             387420..389192
                     /codon_start=1
                     /locus_tag="MMKA1_04010"
                     /product="RNase L inhibitor"
                     /protein_id="BAP60518.1"
                     /transl_table=11
                     /translation="MSRLAILDYDRCQPRRCSMECMKYCPGVRMEEETIVMDENLGKP
                     IISEELCSGCGICTKRCPFGAIRIIGLPEELTDDRIVHSYGQNRFRLYGLITPRDGVT
                     GLLGPNGVGKSTIIKALSGEMVLNLNDLTETPDMKKVLDYFSGTELQNYFEKLKNNGI
                     KPIHKPQYVDVLPKVVKGKVGELLKKVDEKGEFEKITNALELSNLLDRTFDQLSGGEL
                     QRVAIAAACLREGDIYYFDEPTSWLDVKQRFSAAKVIREVAEGKKVVAVEHDLIVLDY
                     LSDYIHIMYGIPSAYGVVTHPRGTRVGINTYLDGFLKEENIRFRKSPIVFEKRPPQDS
                     TNRPLLLDYTDISKKLGDFSLNVNGGQIYQGEVVGILGPNGIGKTTFVKALAGVISPD
                     SGEVTGDVKVSYKPQYISSDFEGTVEDLLMSITAIHTSYYKSEIIKPLALENILDSSV
                     KDLSGGELQRVSIAACLSQDADLYLIDEPSAFLDVEQRLTTSRVIRRMADEKEAAMFV
                     VDHDILFQDYISDRFIVFSGIAGSNGTGSEPLQKRAGANKFLKEMGITFRRDPDTGRP
                     RVNKEGSQRDVYQKEIGEYYYLDE"
     CDS             389612..391213
                     /codon_start=1
                     /gene="sla"
                     /locus_tag="MMKA1_04020"
                     /note="protein synonym:cell surface glycoprotein"
                     /note="protein synonym:surface layer protein"
                     /product="S-layer protein precursor"
                     /protein_id="BAP60519.1"
                     /transl_table=11
                     /translation="MAMSMKKIGAIAVGGAMVASALATGAFAAEKVGDVDAFAADVVA
                     DGNANVDIVVGSNAAALDVVSAANIAAKIGSLMFTEGTVENGAATVTVSASAESDDVM
                     LYNGTADNVSLPVTLVTSADKDYNTLFDSKITLTNYQSLGKLDTLVEVDDVDPSEWYS
                     GDENNAAELVYAVVGAGKEDGKYDINDSDVAYISAVTNDTIESGYLALKPGMRIPFLG
                     EEYVFVKADSDDDYVVMGKEVFDGVIKEGESYDLGNGYTVKVDSVLSPLSGSDDPKVN
                     IKILKDGKTVAEKFDTTQIKMVYGDIAVVVNSAWENVGSDYGYAELVIVDNVVKADLG
                     EEFIPDWELDLFNSNTASLDNIFEDDVSKSGLVASGLALKYIGDDEEDVESGDDFDIA
                     DYVTFELEDDDDETNALFNMDQAKEVSLAIGQTVNVLNAEIKLSEIDAEAKEAVVMTA
                     PIAVLDSEASLDAADKGLILVGGPVVNELTAELADAGLVAIDNESPATLAVAAGAANG
                     NDVLVVAGGDRAATEEAAEALIDML"
     tRNA            complement(391501..391579)
                     /locus_tag="MMKA1_t0150"
                     /product="tRNA-Met"
     tRNA            complement(391741..391819)
                     /locus_tag="MMKA1_t0160"
                     /product="tRNA-Met"
     CDS             complement(391930..392112)
                     /codon_start=1
                     /locus_tag="MMKA1_04030"
                     /product="hypothetical protein"
                     /protein_id="BAP60520.1"
                     /transl_table=11
                     /translation="MEKHKHCVNCGLSIPPEESFCSQKCKEEFVQKRKKMMRSQQIFF
                     VAMLVILAVYAYTAFF"
     CDS             complement(392316..392993)
                     /codon_start=1
                     /EC_number="2.7.4.22"
                     /gene="pyrH"
                     /locus_tag="MMKA1_04040"
                     /note="protein synonym:UMP kinase"
                     /note="protein synonym:uridylate kinase"
                     /product="uridine monophosphate kinase"
                     /protein_id="BAP60521.1"
                     /transl_table=11
                     /translation="MDVVFALGGSVLMPKEGASTENIQNYAKAFKKLKEMGHRVSVVV
                     GGGNTARQYISVAREFANESFCDEIGILATRMNSMLLISALGKDAVKQVPENFKDAEL
                     ILNMDKILVMGGTHPAHTTDAVSATLAEFIDADLLVIATNVDGVYNKDPRCNEDAVKL
                     DKINTKELLEITGSASMSAGSSGVVDPLASKIIDRAKLKTIVVKGIPEEIISSVSGKH
                     NGTTITP"
     CDS             complement(393231..393434)
                     /codon_start=1
                     /locus_tag="MMKA1_04050"
                     /product="archaeal histone"
                     /protein_id="BAP60522.1"
                     /transl_table=11
                     /translation="MAELPVAPVVRILKKAGAERVSEDAAKMFVEALEEIAMDIAKEA
                     ADLSKHAGRKTVKVEDIKMALKM"
     CDS             393724..394245
                     /codon_start=1
                     /locus_tag="MMKA1_04060"
                     /product="signal peptidase"
                     /protein_id="BAP60523.1"
                     /transl_table=11
                     /translation="MVPVMTRGDFVVVENSLFEFDPESVSVGDIIVYSAHWTNAGENK
                     IINQDLSINGRNLNYYELNSRESMIYNLPIISSYSPTTPVIHRVIDTWTDSEGNKYYI
                     TKGDNNPTYDPELIRAEQVRHRVVELNDEPFIIPYLGHISIILKENLIIFVILLVIWM
                     YYDYRKEKVAKNN"
     CDS             complement(394277..395449)
                     /codon_start=1
                     /locus_tag="MMKA1_04070"
                     /product="putative geranylgeranyl reductase"
                     /protein_id="BAP60524.1"
                     /transl_table=11
                     /translation="MKALNDSYDVVVVGAGPAGSMASYNASKNGAKTLLIEKSQEIGT
                     PVRCAEAVPRLEDFGINPDPSFVKSYIRGGYLIAPNGKKIVVKGGKTDGYVVERKVFD
                     KFLAIRSGQAGTQIAVKSRVTKIEKTDDGYNVFVNYLGDEYIVKSKIVIAADGVESNI
                     AEYAGLKSKKNPKEICSCAEYEMTNVKLLNNEMMEFYFGDICPKGYIWLFPKGDTVNV
                     GIGVIDSKKRAIDYLDEFLTNPLVEGRLDNAVPVEFKVGGDPVGGPIKKTVADNIMVV
                     GDAAGHVSPLTGGGIGLSMDCGLMAGNVAAQSIKAENYSEEFLDLYEKKWKEKYYKLL
                     MNDLKYKNILQKLSDDELNAIANSIPENLEEVDVGKLAIKIVAKAPSLLRHFKELL"
     CDS             complement(395452..395616)
                     /codon_start=1
                     /locus_tag="MMKA1_04080"
                     /product="ferredoxin"
                     /protein_id="BAP60525.1"
                     /transl_table=11
                     /translation="MKVNYSKCGYCGACVGVCKSMAIELIENKLYIEEEKCNNCKLCT
                     VVCPVNALEE"
     CDS             complement(395703..396362)
                     /codon_start=1
                     /locus_tag="MMKA1_04090"
                     /product="hypothetical protein"
                     /protein_id="BAP60526.1"
                     /transl_table=11
                     /translation="MFESRFCDICGKPAKTYQFGSLLCEDPECLKKAQKLRGGPAGHK
                     LRVISVGSTNPVKVSAVEKAIEKTVGTMLVSSVDTKSGVSDQPQGFEETFKGAYNRAK
                     GAFEKVNCVYGIGIEAGMIEIGEKKLDIHICVIYNGLDYSVGTSQAFQIPKEISDKIN
                     EGIECGKVAEETYRVKNIGQKNGIIGVLTDNNILREQLCIDSVVMAMIPKYRRNSQIR
                     F"
     CDS             complement(396428..397576)
                     /codon_start=1
                     /EC_number="2.6.1.1"
                     /gene="aspC"
                     /locus_tag="MMKA1_04100"
                     /product="aspartate aminotransferase"
                     /protein_id="BAP60527.1"
                     /transl_table=11
                     /translation="MKQMDTEKLLMIPGPTMVPSRVLNTMALPIIGHRTSDFGDLTGD
                     TVDMMKKVFQTENDTYIITGSGTAVMDMAISNTLDKGDKVINITNGNFGERFYKISSV
                     YKADTIKYEPEWGDLADPKKLRELLEENEGIKAVTVVHNETSTGAKNPIEDLGKVVKD
                     FDAIYIVDTISSLGGDYVNVDKFNIDICVTGSQKCIAAPPGLAAITVSEKAWDVVSKT
                     ETKSFYLDLNAYKKSWDAKKETPYTPSVSLTYAMNEALEMVLEEGLENRFKRHDLLAR
                     ATRAGLEAMGLELFAKERARSVTVTSAKYPEGIDDKKFRGLLAEKYNIRVAGGQSHLA
                     GKIFRVGHMGSAKEYQVLGTLAAIELAFKELGYNAEGGVAAAKKVLSN"
     CDS             complement(397675..399009)
                     /codon_start=1
                     /EC_number="6.3.4.13"
                     /gene="purD"
                     /locus_tag="MMKA1_04110"
                     /note="protein synonym:glycinamide ribonucleotide
                     synthetase"
                     /note="protein synonym:phosphoribosylglycinamide
                     synthetase"
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="BAP60528.1"
                     /transl_table=11
                     /translation="MKVLLIGGGAREHAIAMALKKNELVELYTLMKNKNPGIYALSEE
                     VSFNSETDVPAIKEFAEKIKPEIAVIGPESPLGVGASDLLEEMGILTVGPKKLPAQIE
                     TSKEFMRNLFKKYEIDGSLKYAAFNDYGTELEGFIDEMTSLGKDVVVKPAGLTGGKGV
                     KVVGEQLKDNEEAKIYAKEVFDKSIGGGKIIIEEKLVGVEFTLHGFVDGENIVFMPAV
                     QDHPHSYNNDEGPITGGMGSYSCPNHGLPFLSEEMLDKAEKIMEKTVNSINLEVGPYK
                     GFLYGQFMLTADGPKIIEYNARFGDPEAMNLLPILKTDFLNVCFAIAEGKLDKLNIEF
                     ENKATVCKYVVPNGYPIDPVRNKELAVDEKAIEDANAILFYASINEENGKLYITGSRS
                     AAVVGISENIEEAEKIAQKAIENFKGEVYYRSDIGTLDLIKKRVERVKKLAK"
     CDS             complement(399210..399725)
                     /codon_start=1
                     /EC_number="3.1.4.-"
                     /locus_tag="MMKA1_04120"
                     /product="phosphodiesterase"
                     /protein_id="BAP60529.1"
                     /transl_table=11
                     /translation="MKIGIMSDTHDYLPNIRKAIAVFNDEKVDMVVHCGDFVSLFVIK
                     EFENLNSKIVGVFGNNDGEKTLLKEWLKEIDPDNELENYVSFETDGHKFFILHGTHAP
                     ILEAVIQSKEYDVVIHGHTHERQFEEIDGVLVINPGECCGYLTGKPTVAILNTKDKEY
                     QEIDLDEVSEI"
     CDS             complement(399784..400518)
                     /codon_start=1
                     /EC_number="4.2.1.75"
                     /gene="hemD"
                     /locus_tag="MMKA1_04130"
                     /product="uroporphyrinogen III synthase"
                     /protein_id="BAP60530.1"
                     /transl_table=11
                     /translation="MKVVITRPAEKGKDFSNLLEKNGFETVILPTLELVFKKAQINLE
                     NYSWIVFTSPRGIEGFFRNLDLEDAKKVLTKKIGAIGTETAKEFERTFGKAVDVIPQQ
                     YTAENLLEALQKQVKNGEKVLVPTTPSTRDVLKEGLNADLVFVYSSEEPANIPEKLTE
                     LEKLVISENSQDKKVILTFTSGLTAKNFFKHCSPEFLEILKEQHIVSIGPITKKNVDS
                     FGFDSLMPEKNYTVEAMVPVIKALNI"
     CDS             complement(400534..400812)
                     /codon_start=1
                     /locus_tag="MMKA1_04140"
                     /product="hypothetical protein"
                     /protein_id="BAP60531.1"
                     /transl_table=11
                     /translation="MKGTGNLITVDDKTIVNSMEKVFKEELEDMEKDLELLYKKYDVP
                     NSRLLADKVSAGIYMGEEILRDLEDMEYFEENIEKLRAYIRDLNMKKI"
     CDS             401054..402346
                     /codon_start=1
                     /EC_number="4.2.1.11"
                     /gene="eno"
                     /locus_tag="MMKA1_04150"
                     /note="protein synonym:2-phosphoglycerate dehydratase"
                     /product="enolase"
                     /protein_id="BAP60532.1"
                     /transl_table=11
                     /translation="MLRNMDDSFDIYEIKARQVLDSRGNPTVEAEVLTAGGGYGHTIV
                     PSGASTGTFEAVELRDKSEKYGGKSVLNAVSNVNDIIAQELIGEDARNQRLIDQIMIT
                     LDGTENKGNLGANAILAVSLAVAKAAADTASLPLYKYIGGSNAYVMPAPMMNVLNGGQ
                     HAGNALDFQEFMIMPVGADSFAEAVRMCSETYQSLKKVVAEKYGKDAVNVGDEGGFAP
                     PVKTIDEALAVLLEGVKKAGYEDEIVFTIDSAASEFYDEKSRSYMIAGEKVSTDKLID
                     IYKEMVAQYPIVSIEDPLFEEDFEGFKTATKELKGIQIVGDDLFVTNTKRLKKGIEMG
                     AANSLLLKVNQIGTLSESIDAANMAFRNGYSLVVSHRSGESEDSTIADLAVALNAGQI
                     KTGAPARGERTAKYNQLMRIEEELQISKYAGKDFKIPF"
     CDS             402546..405224
                     /codon_start=1
                     /EC_number="6.1.1.7"
                     /gene="alaS"
                     /locus_tag="MMKA1_04160"
                     /note="protein synonym:alanine--tRNA ligase"
                     /product="alanyl-tRNA synthetase"
                     /protein_id="BAP60533.1"
                     /transl_table=11
                     /translation="MEINHDYRVKLFDELGFERKQCTECNQWFWTLDKDRTTCGDSPC
                     DEYSFIGNPITSKKYTYNEMVKEFTNFFDEKGHTPVKRSPVVAKRWRDDILLTIASIA
                     VFQPWVTSGLVKPVKNPLVIAQPCIRLNDIDNVGRTGRHLTCFTMGAHHAFNSKDDYK
                     YWTDKTVEYCFELMQRLGIDGKTITFIESWWEGGGNAGPCYEVITHGVELATLVFMQY
                     KKIGNDYEEIPLKIVDTGYGIERFAWASQGTPTVYESLFSEIIEKLKEDAGIPEVDEK
                     IMAESATLAGLMDIENVGDLRVLRQKVAEKIGMDVDELDKLISPLEYIYAIADHTRCL
                     SFMFGDGIVPSNVKEGYLARLVLRKTLRYMEKIGISMSIKDIISMQLENMKEIYPELS
                     AMKEYIMDVLDAEEKKYIQTVNRGRGIVERMAASKSEITLDDLIELYDSNGLPPEIVK
                     DVVDELNKKGKKTIAITVPDNFYTIVAERHEEEKPEEVVSTKKELPELEVSKTELLFF
                     KHPTQVEFEAKVLKIVEKYVVLDKTLFYAEGGGQKYDIGQLNELEVVDVQKKNGIVFH
                     KVSDISKFKEGDTVKGAVNWDNRLKLMRNHTATHVINAAATRVLGKHVWQTGSNVDTE
                     KGRLDITHYERISREQVKEIERIANEIVLSKMPVNSTFMDRNDAEQKYGFTIYQGGVV
                     PGDTLRIIEIEGTDVEACGGTHCSNTSECGYIKVLKTERIQDGVERLEYSTGMGSVSE
                     IASLEDTLIDSAEILGIPNDQLPKTVKRFFEEWKEQKKTIEELQKKVGELVKYELADK
                     FENVGNYEVLVEQVSGTPNELMSIADNLAVGNKLIVLMNENDYLLCKRGENVELSMKD
                     LIRNIGKGGGKDNLAQGKYSENKEQIMEKIIQILNK"
     CDS             405266..406138
                     /codon_start=1
                     /locus_tag="MMKA1_04170"
                     /product="hypothetical protein"
                     /protein_id="BAP60534.1"
                     /transl_table=11
                     /translation="MFIPSHITGFFKITRHENLLKTGSTGAGITLNRGVSTKLVEGPG
                     NVYFNDEKIDLCPSKDVIHYLGLKNELKHDITYISDFPLGCGMGTSGCCALGAAYELS
                     STYNFKNMQNDIDRSNLYNKNESDISELVKIAHKAEVRCNTGLGDVIAQHTKGFVIRK
                     SPGFPIGVESVDIKNMDDYSVLVDIFGKKETDTVINDPSWIEKINNTSDELLGKLLKK
                     PTLENFMELSYYFAKNTGLASEEIIEICDDLRFTAGASQAMLGNAIFCICKDEELNDA
                     VSILSNPVVCKIYK"
     CDS             406148..407005
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /gene="htpX"
                     /locus_tag="MMKA1_04180"
                     /product="putative protease"
                     /protein_id="BAP60535.1"
                     /transl_table=11
                     /translation="MMSTVKVLLLMALLTGMIYGICYMLGFPPIFAILLALIPNLISY
                     FYSDKIVLSSYGAKIVDENEAPNLHRIVESIANRANIQKPKVAIINTDTPNAFATGRS
                     PKNGVVAVTTGILQLLNEQELEGVLAHEIGHIKHRDILIGTMVATMAGAIMYIANFLQ
                     WGMLFGYGRDDDGNPLQIVASLLFIILAPIAAMVVQFAISRQNEYNADENGAKYSNPI
                     YLANALTKLEKGVKYHPLRNGSPATAHMFIVNPFKAGNVARLFSTHPSTEERVKRLME
                     MASNPKYLR"
     CDS             407015..407668
                     /codon_start=1
                     /locus_tag="MMKA1_04190"
                     /product="hypothetical protein"
                     /protein_id="BAP60536.1"
                     /transl_table=11
                     /translation="MQLGLTVIAEDRMGILYRLTGIISELNANIVYTQQFIVGENTGL
                     IYMELDGVEDEENLAGKLEKLEFVKKVETHKTMKKIFGKRVLIFGGGAQVAQVAMGAI
                     SEADRHNIRGERISVDTMAVVGEENLADAILAIKTLPRAGVLVLAGSLMGGAITKAVE
                     EVKKDTNIPVICLNMFGCLPKLADLIVTDPLQAGVIAVMTVADTAKFDITKVRGRIL"
     CDS             407704..408642
                     /codon_start=1
                     /EC_number="2.1.1.14"
                     /gene="metE"
                     /locus_tag="MMKA1_04200"
                     /note="protein synonym:5-
                     methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase"
                     /note="protein synonym:cobalamin-independent methionine
                     synthase"
                     /product="methionine synthase"
                     /protein_id="BAP60537.1"
                     /transl_table=11
                     /translation="MIKTVVGSYPVVKGKPDSMPDKIKKFFGKYDKYEYSIKKALDDQ
                     LNVGIDILSDGQVRGDMVEIFVSNMYGFEGRRVVNRVEFVKPITLNDIKYSLKYISKK
                     DPEKGVKGIITGACTLASSIRVENYYSDNKDENLIYDLAGALNKEALSIQNHVKMIQF
                     DEPILSTGLYDLEVAKKAMDIITSGINVPVAMHVCGDVSKIFYKLNEFNVDILDHEFA
                     SCRKNLEILNEITKKVGFGCINTKLKSVDSVDEVKALISEGIEILKNNSKFEGSINDS
                     VIIDPDCGMRLLPVDVAYSKLNNMVTAANEIEKDLI"
     CDS             408661..410022
                     /codon_start=1
                     /locus_tag="MMKA1_04210"
                     /product="hypothetical protein"
                     /protein_id="BAP60538.1"
                     /transl_table=11
                     /translation="MSKPILNNYKLYLLVALMFCSISAVDSYRFDEYSVIYSIDQNDN
                     FYEEIDLKIYNNNSDDLYEISYTIPQETSNLTFNSSKEIDSYSITTDDAGVTEVSVRL
                     TEPIGPWQTGDLLVSFTGEVSDIGGKKQVYIIVPAFDSTFKLSVQLPEGAAIVSPVKD
                     VLSISPRDYTVGSNGKSIFVEWEKELTSEEKYFEVTINYVLTGVITPSTTGENNEDLY
                     RAISIVLGVLVVALIFFIYRNYNKVKMINELQNEINGLNKGLEISHLNLQNKNKELQR
                     LEELNEHVLKELDLSKNTLRDYELKINELNDEILQCRAQVGNHTKLKEELNSKDAVIK
                     SLNDYKKLSEELKLKINELTGLISEKEKCIIKLKEKIGDYESHKSETLMNILTDDEKQ
                     LIELIREHGSISQKEIVDITGLTKPKVSRMISDLEQRGMVRKVKIGRINKIALSDDLD
                     GSI"
     CDS             410320..411405
                     /codon_start=1
                     /locus_tag="MMKA1_04220"
                     /product="putative glycosyl transferase"
                     /protein_id="BAP60539.1"
                     /transl_table=11
                     /translation="MKILISICGEGFGHTTRCIAIGNELSKKHEVKYAAYGKSKDFVE
                     MSGGDVFETYPEIRLSGKNGKFDVKKSIFNSDYHPVRAIKKEMDIIKDYDPDMVISDC
                     KYSSVVASKVLKKPYYIITNQNCTKTDKKEKYIVYPVMEILNVINKSAEKVIIPDFPL
                     PYTVCEYNLKLLENLSFIGPLIRYDVVPEEISDEGYILCVIGGFEYRYKILELLNKIS
                     AKKGLKVKMVCGSYDVAEKLEKIKSKNVEVIPLTTNMDELLKKCSFVVCHGGHSTLME
                     ASCFGKPVITIPDLDHPEQENNAKKISDMECGIALSYNTIDSNLEESIEKMFSTTKYY
                     ENSKKLMNLYLKNSGTDKVMDIVENGL"
     CDS             411423..412352
                     /codon_start=1
                     /EC_number="2.7.8.-"
                     /gene="cofD"
                     /locus_tag="MMKA1_04230"
                     /product="LPPG:FO 2-phospho-L-lactate transferase"
                     /protein_id="BAP60540.1"
                     /transl_table=11
                     /translation="MKITILSGGTGTPKLIQGFKEILPNEDISVIVNTGEDTYIGDIY
                     LSPDIDTVLYTFSNLINDETWYGLKGDTFFCHEQLKNFGFDEVLRIGDKDRALKMHKT
                     SLLKKGIPMSEIVDIERKSLSINSKIYPMSNEKIESKVLIEENNEKILLKFHDFWVSR
                     RGNAKVLDIFYENSNYAKAADGVLKAIQKSDFVIIGPSNPITSIGPILSISEIKNALK
                     EKLVFAVSPIVGENPVSGPAGTLMHAKGYPVNAVGVYEYYKDIVDVLVLDNNDINKKK
                     EINCEVLYANTIMKTIDDKITLARNIFDYYKSR"
     CDS             412458..413258
                     /codon_start=1
                     /EC_number="3.5.4.29"
                     /gene="gch3"
                     /locus_tag="MMKA1_04240"
                     /product="GTP cyclohydrolase III"
                     /protein_id="BAP60541.1"
                     /transl_table=11
                     /translation="MIQITVVQIDNYGPWTVTPNPRRESDLQALQSRLYCDMNLQFGA
                     HKGLAFYTRFDNIIAITNGIDLETHKRIQNSVKNRYPFTVSMAVASAETAYEAQKLAT
                     KTIQEYGSAQDDVRKEVLDVANEFVSNGYVQLAHVDINDITGKLTDLETAYDTYLSVQ
                     KTKLKLMEELKKYDSLGFFIGGDNFMCPCNGMNEKDFLCMFEDIKDSCGIELKAGIGI
                     GKTAEDASNLADIGLEVIREGKTDSQVYTLKQEIDEQKNVPYNYMCPI"
     CDS             413286..414056
                     /codon_start=1
                     /locus_tag="MMKA1_04250"
                     /product="hypothetical protein"
                     /protein_id="BAP60542.1"
                     /transl_table=11
                     /translation="MKKLDKIYTIPKKIVLAPMAGITDGDFCLKYNDTFGIVCLGAFN
                     LDFDTDLASKKIQNRGRKEFIYELSEIDQKISSEIEKAKKINSLVSVNIRFNDFFKAK
                     SHIVKISKNADILELNCHCRQPEITDLNLGQNLLKFENESKLINFLENIQKLNLEIPI
                     FLKLRANFLKAEELIKSLDKVRGYFDGIHIDCFNPGKNHADLEYLKKIRENFPEKIII
                     GNNSVNSVESAKEMLEYADFVSVARCVLSNNIEWINKM"
     CDS             complement(414071..414484)
                     /codon_start=1
                     /locus_tag="MMKA1_04260"
                     /product="hypothetical protein"
                     /protein_id="BAP60543.1"
                     /transl_table=11
                     /translation="MEKIKEIIVKNIMSSDVVSVSPESGVVEAFEALLKNKISCLPVV
                     NQNNETIGIVTTTDIGYNLIIDEYTLETTIADVMTKKVVTIKQDESAVDALKKMDLYG
                     DGREIINQLPVINSENKLVGILSDGDILRAISKLC"
     CDS             414643..415563
                     /codon_start=1
                     /locus_tag="MMKA1_04270"
                     /product="hypothetical protein"
                     /protein_id="BAP60544.1"
                     /transl_table=11
                     /translation="MKRANLSHHDKVANGIRLFGNTLIDELNYDTFIWTKEILGPDDV
                     KIWKKTIEEEIKKGNNIYNMARLCRVGENDYLKELASKYNVKYYDSSDPKKYDELRVF
                     AKTGLEGINTKVMTIMGTSRQSGKFTTCMILKKELEKRINIGIVGTEPQSLICGIDEM
                     VVPQTIETCHCASTIFGAVKKLDTKNRDLIIVSSQTGIFADTLEVGTGRGGGLISIAV
                     LFGSKPDFTILASDTLDAEIIKKNISAIELLSGKPVIAVTLNSRRMDEEKLEESIEKI
                     SKDLNLPVVDVLKRINLDRLVDEIILKLKN"
     CDS             complement(415591..416751)
                     /codon_start=1
                     /locus_tag="MMKA1_04280"
                     /product="hypothetical protein"
                     /protein_id="BAP60545.1"
                     /transl_table=11
                     /translation="MEDIIVIGSGVGGSTVFKELKEAFPNQNIRLIESGSDPFYVSEG
                     ENVEVIYANSFGGTGVYSVANAVRIDLKEFNISKKDSVYEKIEKELSISDVPDDYLGK
                     NSKKLLESGFSKTPKFINFELCKNCGLCAHDPCDAKWIPCDFLRKYSDDIVTETIVMK
                     LAKQNGIFSIVALDKKSGELRVYKSKQVILSAGAINSPRILKTILNNEEIGKNLYIDT
                     FVTVGGILKGSNLKSEVSMAINKKYDEFILATHYSELLHKRISEFEEVNKNDIFSLMV
                     KIKDENTGEVFENSVKKEMSMNDTRNLCEGVSKASKYIYNLGVENIYSTVPRGSHPGG
                     TCAVGKVVDKNLETEIEGLYVCDASVISKAPGAPPILGIMAISNKFVENLKK"
     CDS             416883..417746
                     /codon_start=1
                     /EC_number="2.7.6.1"
                     /gene="prs"
                     /gene_synonym="prsA"
                     /locus_tag="MMKA1_04290"
                     /note="protein synonym:PRPP synthetase"
                     /note="protein synonym:phosphoribosyl pyrophosphate
                     synthetase"
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="BAP60546.1"
                     /transl_table=11
                     /translation="MIIIPGLNSQNLAKEVAKLTNSELARVESKQFPDGEIYVRVHNE
                     LKGKDAVIIQTQNTQNDSIVEAILMCEALRDEGVKSITLVAPYLAYARQDKKFNAGEP
                     ISIKALAKVYSSICDRIITINPHETHIKEFFDIPFIYGDAIPKLAEHAGVKLVKPLVL
                     SPDKGAVALAKRAAEELNCECDYLEKTRISPTEIKIAPKNLDVSGKDVLIVDDIISTG
                     GTMATAISMLIEQGARTVIAACVHPVLIGDALNKLHLGGASEIVGTNTYPSEVSKVCV
                     STIIADILNGE"
     CDS             complement(417817..418320)
                     /codon_start=1
                     /EC_number="4.1.1.79"
                     /gene="comD"
                     /locus_tag="MMKA1_04300"
                     /product="sulfopyruvate decarboxylase alpha subunit"
                     /protein_id="BAP60547.1"
                     /transl_table=11
                     /translation="MNASEAVYKAILDSGVDFVTSVPCANLKTVLNYLNDDKDIQHIP
                     VTREEEGIGVCAGAYLGGRKTALLMQNSGLGNSINAIGSLVKVYKIPILIIISHRGDL
                     KEKISAQIPMGQWTKKLLETVEIPYFSPKTPDEAYKLIKDASELSINMEYPVAILLDA
                     LYWEHDK"
     CDS             418355..419632
                     /codon_start=1
                     /locus_tag="MMKA1_04310"
                     /product="hypothetical protein"
                     /protein_id="BAP60548.1"
                     /transl_table=11
                     /translation="MKIYIEGYGCTLNTADTQIIKNSVNEFEDFELTDNVDDSDIIVI
                     NTCIVRQETEHRMISRIEYFKSLDKKVVVAGCMAKALSKKIENLADVLIMPREAQHSG
                     NILKDKLLKDCSEKNNESTQNLNFEDKLNEKIKKVSSQGLITALPICEGCLGSCTYCI
                     VKRARGNLASYDRDLIVKKAEELVKSGTKCLLVTAQDTACYGLDNSDSLPNLINDISE
                     IPEKFAMRIGMMHAKFAEPILDELIESFKSEKVVKFLHLPIQSGDDQVLKDMNRNYTV
                     DEYISVLNEFKSKIKNLNFTTDVIVGFPTETEEAFENTLEIVKKIKPDFTHAAKYSQR
                     KYTKAAILKQVDTKIRKERSEILNELRRELSYENNKRHIGETFEILVTKDNMGVTDNC
                     KNVIFEEPAKIGEFKRVKITGAKTFGLSGKLIN"
     CDS             419784..421979
                     /codon_start=1
                     /locus_tag="MMKA1_04320"
                     /product="putative chemotaxis sensory transducer"
                     /protein_id="BAP60549.1"
                     /transl_table=11
                     /translation="MKLGTKKIGTKLLIFSIITVIIPIAILGIVSNNTITQDMKEQSA
                     DKLESSNEMANTIMDSRFTELCTLAEYASYTQGVKTSIKTGNVDDLELRAETLKSASN
                     ADLVIFTGNGGSTIASSSGEGITLDSTILKVSKSSEKSGFEKIPEQTALKFSDADVTG
                     TDSALSIVVAYPIYDDAGTLGYVAFIDVLNNDHTLVDSIKASTGDESTLFLENYRIST
                     SVVSGNSRAVGTTASDVVYNTVVKENTEFMGSANVVGQSFLTKYVPLKDSNGATIGMV
                     FVGTPEAQFTQLVNNARNNTIIIALFGLLIAVVISLVSSRSITKPINQLEDGVHKFGS
                     GDYDHTINVKTGDELEELANSFNKMAKDIKELHSMLDADKLSLAKTLKEIFDIMDHLA
                     EGDFSVRADENRHKNKLQKTINHAIENVSKMMENLKSEITVLSGELEDVSEGLKRAKE
                     TSEQVTDAANQVATAAADQSAKLQDTSDELEKTAKAADMVYNDAEKSVDSAIEVKDNS
                     ETGVKKVENAIDTMQKITNVIDELGKSIQELGEESKKINEVTVLIKDVAEQTGLLALN
                     ASIEAARAGDAGKGFAVVASEIKSLAEEIKKSVEDINRTINGINKKVETTIDLGLAGR
                     DEVDRGVVAIDEVNSAFMKIKESVETSAKMIAQIKDNAKNASNNTQEALRNVQDIASI
                     SEEFAATAEELTASSEEQNRAVEEIDASAERMMEISRKLAEDADEFKTK"
     CDS             complement(422041..423909)
                     /codon_start=1
                     /EC_number="6.1.1.3"
                     /gene="thrS"
                     /locus_tag="MMKA1_04330"
                     /note="protein synonym:threonine--tRNA ligase"
                     /product="threonyl-tRNA synthetase"
                     /protein_id="BAP60550.1"
                     /transl_table=11
                     /translation="MKTLLIHSDYLEFEAKEKTKVAEKTDVLNGKMDECLTVFIAVEK
                     DDESDPNAVVKNAVEEIIKTADNLKVKNVVVYPYAHLSSDLGSPATAKEILAEIESEL
                     SNNYEVLRAPFGWYKSFKISCKGHPLSELSRKITTDRKEEVKKEEVVSKFYIIDGESQ
                     NLTEVNDEIISKMDDKRLLALLKHELEIKEEATERGEPPHVKYIKEKEICDYEPSSDA
                     GHFRWYPKGKLIRDLLSDYVYNLVVERGGMPVETPVMYDLQNNAIREHADKFGERQYR
                     FTQGGKDLMLRFAACFGQFMMKKDMYLLPKHLPLRLYELSTYSFRYEQRGELVGLKRL
                     RAFTMPDMHTVCMDMKQAMEAFEDQLWMGLKTGDDFKTPYAIIFRFTQDFFDENKEWF
                     FAMAKEYKQKYGKDAILEILSGRKHYWVGKVDMAVVDSFGRPIENPTVQIDVESAERF
                     GIVVHDGDKKVHPIILHCSPTGSVERVLCGLLENAYLSTLENKPPALPTWLTPIQARV
                     IPVGDKHEEYALEVVNKLRASGIRADFDDREESMGKKIRNAGTDWVNYVVVIGDSEME
                     SGKLTVTVREESELKKPKKESLSVKELIEKISSETIGAPKRPLPLPMKCSVQPIFR"
     CDS             424082..425725
                     /codon_start=1
                     /EC_number="3.4.24.57"
                     /gene="gcp"
                     /locus_tag="MMKA1_04340"
                     /product="putative O-sialoglycoprotein endopeptidase"
                     /protein_id="BAP60551.1"
                     /transl_table=11
                     /translation="MDNSKDLICIGFEGTAEKSGVGIITSKGEVLFNKTIIYTPPVQG
                     IHPREAADHHAETFVKLLKEALNEVPLEKIDLVSFSLGPGLGPSLRVTATTARALSLS
                     INKPIIGVNHCIGHVEIGKLTTDAVDPLTLYVSGGNTQVLAYTGKKYRVIGETLDIAI
                     GNCLDQFARHCNLPHPGGVYVEKFAKDGNKFIKLPYTVKGMDLSLSGLLTSAMKKYDS
                     NERIEDVCYSLQETSFSMLTEITERALAHTNKAEVMLVGGVAANNRLKEMLDIMCEEQ
                     NVDFYVPEKQFCGDNGAMIAWLGILQYLNGKRMDLKDTKPISNYRSDMVEVNWIHGES
                     KNLNGGNIKSRKIPKHLIGKGAEADISKGRYLEFESITKERVKKGYRILKLDELIRTR
                     RTVKEARFLAAVKECGIHAPSIYDIDKENKKITMSYIHGKIAKDEIEEGNIEFCKSLG
                     ETIGKMHCNGIVHNDLTTSNFIISKNPYIIDFGLGKYSDLIEDKAIDLIVLKKSIMSI
                     HYDKFDLVWNKIIEGYKTYELAESVLECIKEVEKRARYL"
     CDS             425814..426410
                     /codon_start=1
                     /locus_tag="MMKA1_04350"
                     /product="hypothetical protein"
                     /protein_id="BAP60552.1"
                     /transl_table=11
                     /translation="MKRLNHSRCRINDCAYVVAISLGLNILGSQAVTYLQLPAFLDST
                     GTILAAVLLGPLFGSLVGLLTNLIEGFFIYSGLYYFAIVNILIGLVTGVIFKKYPFNV
                     KYVVITTIILALIGTIVGNIIAYYLFGGITGSPIDDVTRYLVSSGMSVYNAVFVSGFI
                     INLFDKIISFVLVFVIIGFFQKYVDKCYLNIKFDDKTN"
     CDS             426618..427343
                     /codon_start=1
                     /EC_number="5.3.1.16"
                     /gene="hisA"
                     /locus_tag="MMKA1_04360"
                     /note="protein synonym:phosphoribosylformimino-5-
                     aminoimidazole carboxamide ribotide isomerase"
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino] imidazole-4-carboxamide isomerase"
                     /protein_id="BAP60553.1"
                     /transl_table=11
                     /translation="MLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVNEGA
                     EMLHLVDLDGALDGKRVNDEFIEEIIKTSGVPVQIGGGIRSIEDAEYLVEKGAKKVII
                     GTIAVENPEIIKELSKRIDSEKIMVSLDAKDGKVVIKGWKEKTKYTPVQIGKILEEMG
                     AGSILFTNVDSEGLLKGINIEPTKELVDNLKIPIVASGGVTTIDDLLKLKEIGVYGVV
                     VGSAIYKNLINLKEAIDAVNKSN"
     CDS             427363..428271
                     /codon_start=1
                     /EC_number="2.7.1.15"
                     /gene="pfkB"
                     /locus_tag="MMKA1_04370"
                     /product="putative carbohydrate kinase"
                     /protein_id="BAP60554.1"
                     /transl_table=11
                     /translation="MDKIGKITAVGHIALDYIFNVDKFPELNTSMQIPTAKKYYGGAA
                     CNVAAEIANLGLNSEILSCVGTDFKASGYGEYLEKLGVSTKSVFVSEEEETPKAWIFT
                     DPQNNQITYFLWGAAKHYPEIEVPEFDSEIVHLATGDPNYNLKCAQKASSKGILVSFD
                     PGQDLTLYSKENMENIIENVDFLFMNNHEFQRTLDLLNISEKELISRVKVLIVTYGKQ
                     GSIIYSEDDAIKVPAVLTQAKDPTGAGDSYRAGFLTAYLKGHDLKNCGLAGSCVASFV
                     VEQVGCQTNLPSWEMVIERLNENNLL"
     CDS             428414..429925
                     /codon_start=1
                     /locus_tag="MMKA1_04380"
                     /product="putative sodium-dependent transporter"
                     /protein_id="BAP60555.1"
                     /transl_table=11
                     /translation="MAREQWASKMGFILAAVGSAVGLGNIWRFPYMAYENGGGAFLIP
                     YFVALLFVGIMVMVLELALGHSTKGSAPLALRRLGKNFEWIGWLAIATAFIITTYYTA
                     IIAWALVYLVKLFMVGFPTDFGGFFFSDILALSSGHGDLGGFNLPILVGLALIWGVNY
                     IVVNSGVRKGLEKANEILMPVLFFLILALVVRSITLPGGLMGIEYYLTPNFAVLLTPK
                     VWIDAFSQIFFTLSLGFGIMVAYSSYLPKKSDLTASAFTISLMNCGFSFLAGFAVFGT
                     LGYMAMTQGVPISEVVTQSIGLAFVAFPQALSLMPGGIILAAIFFIALFVAGISSSVS
                     LVESTASAVIDKFNLPRHKAASAVIATSFFASLIYATNAGLYWLDSVDPYINWFTIPL
                     VAVLEIIVSIWIFKGSKLEKYIDNLSEYNLGSFWKFFAGIFSPLFLIYMILNGAWTEL
                     TLGYEGYAPIFLLLSFGIPVFGLVVSLIMPMIPWIDKGREIEEWDEFVKKDEE"
     CDS             430234..431199
                     /codon_start=1
                     /locus_tag="MMKA1_04390"
                     /product="hypothetical protein"
                     /protein_id="BAP60556.1"
                     /transl_table=11
                     /translation="MLFRKLSTIERVYNIGMEHDSINYVFNYITNFIKESERDLVKLY
                     DLKVLDKIVINDIMTKDLVVLDEEESIDELGKLIKQYRHMGYPVFNSNKELVGIVTFD
                     DLRTKKSSMSRLKKLKIKDIMTKKDEIVSISPYSSASEAQKIMVEYDIGRVLVVDDGK
                     LKGIVTKGDIVRTSEIYNPEPKINKCSHITNIYFYGDNPKKVEELAEEIIVLMGARGY
                     IISEKEDFIEISDREWEPIAKIMKRNGKIDHISIDTKLINILELNIIKEVLKLIEKPK
                     FEEVIITDHITLVDEKSAIQRIITDVTMFEKSMKTFGTITVRIDF"
     CDS             431217..432131
                     /codon_start=1
                     /locus_tag="MMKA1_04400"
                     /product="hypothetical protein"
                     /protein_id="BAP60557.1"
                     /transl_table=11
                     /translation="MYQIIRYEGGVYKNNILKEWIEDVGGFIIQEHVMQLDVYMTIAI
                     PQNEIENFKEEAKKYKGKIVETPLAGIEIAIVSPSLSRHHLPHIACDVSEYVRKFGAK
                     PNMIGLAHGAGKSISEIREKEKRLIQEHDIAIYVMGNFESCILDKTHLFKVDIPLVVT
                     GGPETLDIPYTYVGNLGRRAQRLRKGEEIRALRQMIDEVTKKINDKRMELSYDPPIIP
                     PVVLKDEIEKRIDEVRGILAPMPIVTQLDGLRIKMDYDRNHKEIENVKIGKYLLKDIA
                     YVTRSEMKNYILIKLKSTSELKTDENKA"
     CDS             432162..432614
                     /codon_start=1
                     /locus_tag="MMKA1_04410"
                     /product="hypothetical protein"
                     /protein_id="BAP60558.1"
                     /transl_table=11
                     /translation="MEIDRTIENETEIENEESEQIIEVPLPPGLPQSVIGRLTCVCDI
                     GYEIKKDEMMDKEYPIIKGTQEQIDYVKDYIFLFTELKLALREISRLARRFKTDVKLF
                     TEDDELQYVLGFAVQDVSGRDRFEVLMEKPEGEGEKIVILEREFYVYL"
     CDS             complement(432791..434413)
                     /codon_start=1
                     /locus_tag="MMKA1_04420"
                     /product="hypothetical protein"
                     /protein_id="BAP60559.1"
                     /transl_table=11
                     /translation="MVNEDFENNLKKYNELFNLDYSDLEFNEFLPNIARLSDLSNDLR
                     KIEGIDKVIKENEIFLEKKLEDYQSMYIYYILGSTYETLKRLTIINDLKNEKDSTSWD
                     FKEYNEKEIIYLRKALLIHDNLNHPDEELKNRALTNLGNLMCDLGRYVESLDYYERLL
                     KENNSFGMALGAKGMTLYYYASILYDNGHQFLFLKESYQYLKDSLTNESTEKHAKPVF
                     EKYKKDIESEIPSEKLNKNLKYLNIKKYFGGSKKEIKYRKWCLENCLFINPLNDLFKK
                     PIACSDVLSLPNMRFKEINGIEYSKPYFWGIYNQLKQEFITARYLYYEGTTFEKNHFS
                     DKERNLLDTMDYSMYSMNIEKIKIAYKNVYSILDKIAYFLYLYFAEEFAELNVNPKTI
                     YFKTVWYNKNNHRKFKEFIRKTDNKALLGLYWLSRDIYANNLRNNDEYIECLEPDAQN
                     LDDLRNFLEHKHTRIHMFDYDPKSDKLFNEPENIAKDISLKEFTLKTLKMLKLVRNAL
                     IYLSCAVCIEESKKMPSNVDLEIPFYMGKIED"
     CDS             434577..435137
                     /codon_start=1
                     /locus_tag="MMKA1_04430"
                     /product="hypothetical protein"
                     /protein_id="BAP60560.1"
                     /transl_table=11
                     /translation="MFNKLKSAVSSTFSKLADALKPKSRSEKIDEIREEIKKDPTSFE
                     KGTAFELCCLDIFPEKDFDLLEMTHNPDSANGRFVKSDLNPDLQFKDKKTGNNFSVEC
                     KYRSSLFKGAFSWAKNKAQADRYREYEKENEIPVFIAMGLGGTPEKPEQIFLMPLKEI
                     KYNSLFPSVLKDYEIKEAKDVFKILK"
     CDS             435387..435728
                     /codon_start=1
                     /locus_tag="MMKA1_04440"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60561.1"
                     /transl_table=11
                     /translation="MQEVHKWHNDLTGKKLVENLKKNLFEAYYFEDESEVSKYIMNYV
                     GTGTKIGFGGSVTVQSLNIAEQAMEKGAVILDHNDASLTQEEKMDIMRQQLRLIYLFQ
                     VQMQLRLQGNL"
     CDS             435764..436027
                     /codon_start=1
                     /locus_tag="MMKA1_04450"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60562.1"
                     /transl_table=11
                     /translation="MFGPKKVIIVVGLNKLCKDVETAFERIKMQAAPKNMKRLGFLNP
                     CIKTGYCVNCDAETRACRIYSVIKRRPMLTDMTVIVVGKSLGF"
     CDS             436041..436610
                     /codon_start=1
                     /locus_tag="MMKA1_04460"
                     /product="hypothetical protein"
                     /protein_id="BAP60563.1"
                     /transl_table=11
                     /translation="MNQVLETIKNRRSVRKFKKEQITDSELEAILEAAIYAPTALNEQ
                     PWQFTVIQNKELLDEINTVSKKTLAENPDSMKNLPESLINAMSNPKYNILYEAPTLIV
                     VSGNKNAHAAIVDCSAAIQNMLLAAESMNIGSVWLGLVRPYFTTENVKKLNIPENFEP
                     FYGVAFGYKLIEKSKPAPERKKDVVNYIQ"
     CDS             complement(436679..437626)
                     /codon_start=1
                     /gene="rfcS"
                     /locus_tag="MMKA1_04470"
                     /note="protein synonym:RFC small subunit"
                     /note="protein synonym:clamp loader small subunit"
                     /product="replication factor C small subunit"
                     /protein_id="BAP60564.1"
                     /transl_table=11
                     /translation="MQKPWVEKYRPETLSEVVGHHEIIKRLTNYVEKKSMPHLLFSGS
                     PGVGKTTAALALAKDLYGETWRENFLELNSSDERGIDVIRTKVKDFARTKPIGDAPFK
                     VIFLDESDALTSDAQNALRRTMEKYSDICRFILSCNYPSKIIPPIQSRCAIFRFSPLK
                     TEDLVENLKDISEKENLNLEKGGIDAIIYVSEGDMRKAINVLQTAAAVSDEITEEIVY
                     KVASKARPDEIKKMTQLALNGKFVEAREQLYNLMIDWGMSGEDILIQVFREVPNLDIS
                     EKEKVHLVEAIGECDFRIVEGSNERIQLSALLAKMGILE"
     CDS             complement(437716..438816)
                     /codon_start=1
                     /locus_tag="MMKA1_04480"
                     /product="hypothetical protein"
                     /protein_id="BAP60565.1"
                     /transl_table=11
                     /translation="MILHPRPSPIAAAMYQLRDIGVDAIILHGPSGCCFRTARLLEID
                     GIRVFTSAMGENDFIFGAMDKLRDVIAEVLEYLKKETPKSEKYKIGIVGTCASMIIGE
                     DLESLIDDFDDTIIPVDIHSGLVDNTVGAIRAMDGALNAGLIDYSEYERQKKMLVCAT
                     DVEKKRGMAKNRYLKPTYEDDLEKVIDILKETDAKIKQGKDVKIACVLNAKKETAYLF
                     SDPILELNKHFNCINIANLDENIGFDKVRADAKNILEEFSKCGFKIDYITGGLDEYPI
                     TGEKALDCLKEINPDIVVVSGVPHALLIENLKEINPKVITVGISDGPRLYHPIKEVYN
                     YGIIELDAHAKVLGKKNIVKSRFGEILSFMKF"
     CDS             439078..439371
                     /codon_start=1
                     /locus_tag="MMKA1_04490"
                     /product="hypothetical protein"
                     /protein_id="BAP60566.1"
                     /transl_table=11
                     /translation="MTKLRRMVLDVLKTHEPKLTDLAVKLCSVDGIDGVNVTVYEIDK
                     STENIKITIEGFNLDYDAIKAIIESMNGVIHSIDEVAAGKKIIDEVKTPQDRY"
     CDS             439427..440125
                     /codon_start=1
                     /EC_number="3.1.26.5"
                     /gene="rnp3"
                     /locus_tag="MMKA1_04500"
                     /note="protein synonym:RNase P component 3"
                     /product="ribonuclease P protein component 3"
                     /protein_id="BAP60567.1"
                     /transl_table=11
                     /translation="MLEGIFDINHIFDEEGIKTLKRFGWDGSVAVQNHNEYSEEKINA
                     AVEYGENCEFKVYSGVKISTKNQNEMEKAVKKYRNKVDILLVEGGDVKINRRVLEMND
                     VDILSTPELNRMDNGLDHILARLGSTNRVAVELNFGNLLKSKNYDRSKILWAFQRNLK
                     LSKKYDTPVVISSGANDIYGIKAPGDLRGFLNTIADSLYSKKIIETTSKIIDYRLYLK
                     NKNVLMPGLEIVEE"
     CDS             440275..443916
                     /codon_start=1
                     /locus_tag="MMKA1_04510"
                     /product="hypothetical protein"
                     /protein_id="BAP60568.1"
                     /transl_table=11
                     /translation="MIKKFLLFLLLFAVGSVSAETYYLNNDSFDALTDTGVYNTDSGS
                     YISAYVIINAPGEYILNYSYANYTMPESGVFIFVNNTENVSLDCNYNWFNSTASYDAV
                     RPVYVYNSTNVTVKNLKCNGFYSAVEFENSVDCVLTSSNFTSIQEDGIYLKNTNNTEI
                     SDCIITSLYGETVFLTNSYGNTISGCTMTATDNDDYAVLTLDYSENNLISDCVVTAVD
                     YYAIGIYDSNNNTVLNSVADAYGNAIDLEYSNNCIIRGCTAKATNAENAIAITWHSDY
                     NTVSNCTAISVLDGRAIYVGDSSSHAIIVNCNATAYDETIYLSGSDYNNIVNCNATTT
                     SGDYAYYMASGSDYNNITDCNATAVRYAIYLSGSDYNNIVNSNAVATLYYAYEIVSSD
                     YNNIVNCTATAVERGIRLGTSNYNNIITCNISASDWFGVEFSSSANYNNISNCVVTSQ
                     NRAIYTSYSYNNLITGSTLNSDNSAIYRYYSYDNRFYMNNINGPIVNDGSGDSYFISE
                     TELNYIYNGELYTSILGNYWYDYNETELNASNINGIWNVSYAVAGGGLDSYPLFGVSG
                     KDIFVFNGDFVSYVFTEISENLTSKGILNNLNEVNSTNYESFEGLYFGMNDLGNITFT
                     GSLNLSDLETQEFLLGLESKFNLTDGRIAFNVTDSELSGIGAEIEFYNIDDITYSANV
                     TADDIYEYLVAFSDNGTSLDVSELVTGYELDGTTFRFNVTHFTIYEVDYDDGMYHITE
                     ENFTSTTSYSDGRNAYVMITEPGYYILECDFVNESSSDDFIVINSDNVTFDGNGHWLN
                     SSNGYIVYSSEETPVANITVKNLMSDGDIYLYASNSIISSNMIYYMDIEGDYNTLFNN
                     TVEDGIYTYGLYTTISSNNVTDSSGYAIDFDGEDGEGAYATIFNNTVLSSEYGICLDD
                     CGESYSNISYNTVYSSEYPLIIGEEVTGCNIYLNNFIYTGTSTNISDITPDETGNNSF
                     LSPFKIEYKYNGNIYSNFLGNYWSDYNGTDADGNGIGDNYYLYGCDDEADYLENDTAP
                     LMGLWGIDLTPYTAPVTPTTAPSRSSGGGGRSYDSDISDEIGSKVIKNFVSSATVIYG
                     NEIDENYANQLRERVQNAEGFTISGNAVIVGGPLANGFAKEYNDQFEMPISNDYPGEN
                     KGIIQVLKVQDNSGNIVKSYTIVYIAGSDRYGTLAALEYFKTLDELPEGPIMIEWTAN
                     GSVVVEELI"
     CDS             complement(443958..445259)
                     /codon_start=1
                     /locus_tag="MMKA1_04520"
                     /product="beta-lactamase like-protein"
                     /protein_id="BAP60569.1"
                     /transl_table=11
                     /translation="MELYFRGGASEVGRSCVELKTEKSTVLFDCGVKLSHEESEYPIL
                     DNLNADCVFASHAHLDHTGGIPLLIRKGMVPAIYATEVTKAISKELLRDSIKIAGAEG
                     QDIPYDKADVNKSLNLFRKARYNHPKNFKDFEFEFFNAGHIPGSSTISLNYGGKRVVY
                     TGDTKVSDTDIVKGADLSYTKEDIACLIVESTYGDKNQENREDAEKNFINKIKETLER
                     GGIPLVPVFAVDRSQEILMILNKHDFGVPVYFDGMGRKITRIMLQYPKFLNHPDDLKA
                     AFLNVIEVESKDRPKIIKDIKQNGGIIVSTAGMLEGGPIIPYIHEFMEDPKNSLIFTG
                     YQVEETAGRKLLETGKIEIGEFDIEPKLEIASYQFSAHGERDELREIVKKANPEVLVI
                     QHGEEEVVKIFKEWAVSQGFNENSVFTPKIGDKINLTEFLK"
     CDS             445430..446191
                     /codon_start=1
                     /locus_tag="MMKA1_04530"
                     /product="hypothetical protein"
                     /protein_id="BAP60570.1"
                     /transl_table=11
                     /translation="MIDSHVHADTRPYEDFELMATVFDCVITHAHDPLKMRSFDVALD
                     YFDKILINEIGKARKNGLNMKACIGIHPRAIPPKIDYDVLKEYLKKENVVGVGEIGLE
                     KCSKEEIEVFEKQITIAREMNLPAVVHTPRTNKEAVTKNIIEVLDTMDLPIDFKKKIV
                     IEHVTKETVPIIWENDYKLGITVQPQKLTPNDAVEILGEYCEKRFLLNSDSSSAPSDI
                     FGVPKTVLKLKMAGFDEKVITAVSHNNAADLFKIN"
     CDS             446210..446704
                     /codon_start=1
                     /locus_tag="MMKA1_04540"
                     /product="putative flavodoxin"
                     /protein_id="BAP60571.1"
                     /transl_table=11
                     /translation="MDEKKLVIYYSLFENTEYVANLISENTGADLLKIETVTEIPKKG
                     LTMFLELGRFLMFRKMPEIKEISVNLDEYDTIFIGTPVWAGNMAAPLKTFFSKYKFDG
                     KKVAVFCTAGKTIGHTLENMKKELIDNELIGGTVFLDVLNNKAETENYVKEWLTTMYR
                     SKED"
     CDS             complement(446743..446991)
                     /codon_start=1
                     /locus_tag="MMKA1_04550"
                     /product="hypothetical protein"
                     /protein_id="BAP60572.1"
                     /transl_table=11
                     /translation="MEGEHHIEKRPSIVSRTHSRKDALDWVSIVLVIIGGLNWGLVGA
                     FNIDLIQVVFGSFPSVARILYILVGLSAIYMIYYASKT"
     CDS             447259..447864
                     /codon_start=1
                     /locus_tag="MMKA1_04560"
                     /product="hypothetical protein"
                     /protein_id="BAP60573.1"
                     /transl_table=11
                     /translation="MSHTIIKDGIDCVISKDYFYKTESYYKLISKEISGKNKVFPSSN
                     DVLDAYIVPVALKRAELAGIPILQWEISSGDVPNPSIVYSVNYFSDPSTYYIVKNREE
                     SRKISKHVTNCGKYPLCYQKVPENFEMVNFSIFFGEVCTENENIKQIANKIYQTFKIP
                     LINALFVIMDDKIYLSSLSPVNVSKLSKEEKSMIEKTLLVD"
     CDS             447865..448815
                     /codon_start=1
                     /locus_tag="MMKA1_04570"
                     /product="hypothetical protein"
                     /protein_id="BAP60574.1"
                     /transl_table=11
                     /translation="MGKFGVFVDRQTLSSSNQLQSLIRFRDIAESMGHEFYFLFPNEI
                     HKIKTLNGLFIRSKTDPMNISYVASRIAELNGVKVIDDSKSIQICADKINMYLHMMKN
                     NVPLPKTKFLRKSENNIENLKSIVEEIGLPLILKEPSTSFSMRVEKVNSLEEFSKVAS
                     RFLRLSDVLVAQEFIETRFDWRVGILNGEVIYACKYLIPKETFKIQDCVDGHRVYCMV
                     ESVMFDEVPKEVVNTALKAANAVGTGLYGVDLKEKDGSIYVIEVNDNPSLETTEDEFY
                     PEAYSKIVSYIMDDSRQKFSGGKMKFSEVIDPDGVANDRN"
     CDS             448802..449905
                     /codon_start=1
                     /locus_tag="MMKA1_04580"
                     /product="hypothetical protein"
                     /protein_id="BAP60575.1"
                     /transl_table=11
                     /translation="MIGTEHEYSINNHDLKAMPVSDLIIEEISGKIQNEFFFETVGIS
                     KELQKHVIEFKPISPSESISNLENQIFTGLKSFYERTNNKYKLMGLGMHPTLNLSETS
                     FWNHDEREVFDTYDRVFNLRQHGWMNIQALQVNVEYSTEEDLVRKHNKLRTLLPYLVA
                     VTASSPIVEGNLTGYMDNRLLYYKKNQKEIPEICGNLIPEKLEKSSDYEKLLEKMYLE
                     LRKKDAEVLCEEWVNSRALIVRRERKCVEIKIMDEQESIYADMAVSAFINCLLRVNDL
                     KVAENDETILELTDIAIKSGTKKLKAELESLYKKAVSVATEEEKSYLIHIQNRIQNGN
                     LSEVILKKYNSEKDISKILNEAESCLRENKTMF"
     CDS             complement(449902..450699)
                     /codon_start=1
                     /locus_tag="MMKA1_04590"
                     /product="hypothetical protein"
                     /protein_id="BAP60576.1"
                     /transl_table=11
                     /translation="MENLIENLIIEFVKNYSKEHNTKTKWLTPIVGFADSCDPEFLEL
                     KQVIAEKHLTPKEVLSESESVICYFLPFEKEINLGNVHPGLASETWAISYVETNKMIE
                     DLNDYLSEKLGEMNHTCSKIPPTHNFDKEKLISYWSHRHVAKIAGLGTFGINNMLITE
                     KGCNGRFGSLITSAKLKPSEKPDYEYCLYKYNGSCKLCIEKCEKEALKINEFDRKECY
                     KVCLTNQKVYEKYGVADVCAKCLCNVPCSFKNPAKNLNDKLKSENKS"
     CDS             450793..451707
                     /codon_start=1
                     /EC_number="1.3.3.1"
                     /gene="pyrD"
                     /locus_tag="MMKA1_04600"
                     /product="dihydroorotate oxidase"
                     /protein_id="BAP60577.1"
                     /transl_table=11
                     /translation="MLKTKLWDIEFKNPVFLAAGVMGETGSALKRMAKNGAGAVCTKS
                     VGIEKKPGHNNPTMVEVEGGFLNAMGLPNPGADEYVGEIERIKDEMKRMNVKIIGSIY
                     GKNDSEFQKAAEIIGNYVDVLELNISCPHAGGGYGSSIGQDPYLCKNVVSAVKDVSDI
                     PVIAKLTPNVTDIKEIANAVVNAGADGIVAINTLGPGMVIDIESGVPILGNRVGGMSG
                     KAVKPIAVKNVYDICSAVDVPVIGVGGITTGADAIEFMMAGASAVQVGTGVYYRGYDI
                     FQKINNEIEEYLLKKDLKMSDIIGIAQK"
     CDS             451863..452426
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoE1"
                     /locus_tag="MMKA1_04610"
                     /product="DNA-directed RNA polymerase subunit E'"
                     /protein_id="BAP60578.1"
                     /transl_table=11
                     /translation="MYKILKISDTVRIPPKMFGNPLSENVKRVLMEKYEGILDKDIGF
                     ILSIVDVDNVSDGSIIYGDGAAYHETEFNVLTYVPELQEVVDGEIVDVVEFGAFVRLG
                     PLDGLIHISQIMDDFVSFDPKREAIIGKETGKVLEKGDKVRARIVAVSLREEKKRGSK
                     IALTMRQNGLGRLEWLEDENETLSEEN"
     CDS             452474..452650
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /gene="rpoE2"
                     /locus_tag="MMKA1_04620"
                     /product="DNA-directed RNA polymerase subunit E''"
                     /protein_id="BAP60579.1"
                     /transl_table=11
                     /translation="MNACLRCKYITKEDTCPICGFDTSDNVRGLLIVLDPHNSEVAKK
                     AGIDIKGKYALSVK"
     CDS             452683..453159
                     /codon_start=1
                     /locus_tag="MMKA1_04630"
                     /product="hypothetical protein"
                     /protein_id="BAP60580.1"
                     /transl_table=11
                     /translation="MYLLNDKVAHELKKPFGKVYKELPSIEGKVVSIGDVTTKHLLSN
                     GIIPDLSILDFKTKRNIPVDIPHKFKTIFEVENPQGCISDEAIERIKYLSTIHDRDMA
                     LIIKGEEDLLTIPVIKYFPEDTSVIYGQPDEGMVLLKITDELKQKIEKLLKEMEER"
     CDS             453166..453474
                     /codon_start=1
                     /gene="rps24e"
                     /locus_tag="MMKA1_04640"
                     /product="30S ribosomal protein S24e"
                     /protein_id="BAP60581.1"
                     /transl_table=11
                     /translation="MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLN
                     ANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATIETKSVLEKNKIEEEAEAEVAEE
                     "
     CDS             453476..453679
                     /codon_start=1
                     /gene="rps27ae"
                     /locus_tag="MMKA1_04650"
                     /product="30S ribosomal protein S27ae"
                     /protein_id="BAP60582.1"
                     /transl_table=11
                     /translation="MAAKKGAKTSTKKSDYYKVEGNTVERLKKVCPKCGAGVFMAEHL
                     NRFACGKCGYMEYKKNEKTESEE"
     CDS             complement(453777..454013)
                     /codon_start=1
                     /locus_tag="MMKA1_04660"
                     /product="hypothetical protein"
                     /protein_id="BAP60583.1"
                     /transl_table=11
                     /translation="MELINVICHWAMYEDAIDLKKPPNWILEYFNHKYPEESLEFSMD
                     FLCILGKFQKYPETKVYVPIKNVGKIADVFGLLD"
     CDS             complement(454220..454546)
                     /codon_start=1
                     /locus_tag="MMKA1_04670"
                     /product="hypothetical protein"
                     /protein_id="BAP60584.1"
                     /transl_table=11
                     /translation="MKIAVPVFENKICEHFGKTALFLIFELDENCEVVNILRVQNIPC
                     DGNGGGSPAEKLLLENPDVIIYNTMGEKRIETLKDRVKLYHTKNQDIKSALKECIDDI
                     LKTNNK"
     CDS             complement(454758..455117)
                     /codon_start=1
                     /locus_tag="MMKA1_04680"
                     /product="hypothetical protein"
                     /protein_id="BAP60585.1"
                     /transl_table=11
                     /translation="MKIAIPILDEKTVCSHFGKTPFFMIFEVNENNEIIGSKKVGNSP
                     CHGAAHETEQGHGGQGPGSTVQTLLSEGVNAVVFVNMGQRSVNALASVVELYQTSLED
                     VDAVLKEVLSGNLTKLN"
     CDS             complement(455151..455435)
                     /codon_start=1
                     /locus_tag="MMKA1_04690"
                     /product="hypothetical protein"
                     /protein_id="BAP60586.1"
                     /transl_table=11
                     /translation="MDYRLHRNCICRKLLGTTEYVGLGIRRFFRMGLTNEEIKNIIKR
                     ETGNDISDEEVTNLSKGISEEDVIDARGRRNFFGAGRGGRMGRGMGRGRF"
     CDS             complement(455594..456439)
                     /codon_start=1
                     /locus_tag="MMKA1_04700"
                     /product="ferredoxin"
                     /protein_id="BAP60587.1"
                     /transl_table=11
                     /translation="MKQIVIISGKGGTGKTTISSSFSELMDKRNIADCDVEAPNLHLM
                     FENEIINTKEYIGSQTASIDTEKCIKCEKCLECRFGAITPEIKVNPLKCEGCGLCEYV
                     CPADAVKMVDNVTGHIYSCKIKDGYLSYAKLNIGAEGAGKVVTEVRKNSLENQGFENL
                     LIDGSPGIGCVVIASLTGCDYAVVVTEPTTSGLDDLSRVLELTQFFDIQSYVIINKYD
                     INEEKTSEIIDYCKKSGFEILGKVPFDNTVNKAIQNECPIVNYDCPAGNEIKRIWDDF
                     YDKLK"
     CDS             complement(456436..457293)
                     /codon_start=1
                     /locus_tag="MMKA1_04710"
                     /product="ferredoxin"
                     /protein_id="BAP60588.1"
                     /transl_table=11
                     /translation="MNISILSGKGGTGKTTISTNLSILLSENHENVSYFDFDVEEPNG
                     FIFLKPDIEIENKVFKKVPKIDKELCTNCGECSKLCKFNAISITPNNSTVFEKLCHDC
                     GLCYIACPVQAISEILREIGKIESGKSKDIPNLNAFRGVLNIGEPSGVPVISALKKFL
                     DVDSINILDAPPGSSCSVINTVEDSDYSILVTEPTKFGLHDLKTAVEVLRYLNIPFGV
                     LINKSDEFDFIIENYCENEKIDILGKIPFSRNIANKYSKGDILINSDAEFTENLQNIA
                     SELEKRLIL"
     CDS             complement(457303..457662)
                     /codon_start=1
                     /locus_tag="MMKA1_04720"
                     /product="hypothetical protein"
                     /protein_id="BAP60589.1"
                     /transl_table=11
                     /translation="MKLCITSTGNTLESTFEQRFGRCPYFIIYDTDSKEFDAIENTNG
                     DSAHGAGIGSAQEVVSKNIDVVISGNMGPNAKQVLDGENIKVYKGTGSTVLENIELFE
                     KNELSEITQAGKPHQGM"
     CDS             complement(457841..458113)
                     /codon_start=1
                     /locus_tag="MMKA1_04730"
                     /product="hypothetical protein"
                     /protein_id="BAP60590.1"
                     /transl_table=11
                     /translation="MKSDEQMLRDLQKITISFGVMFIVITAYLELTKNWDSMLLILPT
                     SGFLLIIAGLHKQIHENDDFRSYFLLGITLLIIAVAVLFILLLYFA"
     CDS             complement(458156..459169)
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /locus_tag="MMKA1_04740"
                     /product="putative zinc metalloprotease"
                     /protein_id="BAP60591.1"
                     /transl_table=11
                     /translation="MQSFKIARVMGIPIELHITFILLLIVVFYFWGIEGLILYMFLFT
                     SVVLHELGHSYVAKKYGVKIEKILLLPIGGMAMMSEISKEGEFKIAIAGPLVSLALGT
                     VLLGISTVTDYTLAEYPLFQTVGGLNILLGIFNLLPAFPMDGGRVFRALLSKLTNMSY
                     IKATKLASTVGQYFALALLIFGLINFNVILVLIAIFIYFGASQEYRALVADTLFQDVP
                     AKDIMSKNIVYVNSEDTVDDVLNLMLENRFLGYPVLENGNIIGTITMNEISSTTAKTA
                     KVKEIMSPPVMVSPEAALNELIKGMANTDRVYVVDNGNILGIISKTDIVRTLSILGLK
                     NNR"
     CDS             complement(459297..459818)
                     /codon_start=1
                     /locus_tag="MMKA1_04750"
                     /product="hypothetical protein"
                     /protein_id="BAP60592.1"
                     /transl_table=11
                     /translation="MSEKYKTYHTSKYLSKEDVEKLIKEGVDEVTMPKSIYEYMEKKN
                     KGALNRLLIFGVDVSITDQVGRPKKVEGDIKKKIIEEIINGKSIRKVAEEYDLKKSTI
                     WDNIKDDMAKIKQEKFRKMIYDYKELLIEKERYTEYIETLFCELDMNISNDNLKEAEK
                     ILLKIIEYSKRKD"
     CDS             complement(459934..460275)
                     /codon_start=1
                     /locus_tag="MMKA1_04760"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60593.1"
                     /transl_table=11
                     /translation="MGKKIGVVDDTIHETKAKSLQKSMDFEIIEYETPIELYNDLNNG
                     KIDATISEMDNFKVSSYMDQLELIDTLEVLYSGIAVNKNNKELLHEMDRVLLELETEG
                     YIEELKQKWSN"
     CDS             complement(460250..460693)
                     /codon_start=1
                     /locus_tag="MMKA1_04770"
                     /note="fragment"
                     /product="hypothetical protein"
                     /protein_id="BAP60594.1"
                     /transl_table=11
                     /translation="MSKTMKKICFLMAIVLILAISACISLPSEQITIKTGTLSVGVFK
                     HAPPAVYEQNGELIGFEVELVSEIAKRMNLNVEFKEYMFSNLLNAVANNEVDCAISDI
                     SISPEREKIVSFTRAYSHTELVVLVRKESGIQTITDLNGKKNWRC"
     CDS             complement(460785..461333)
                     /codon_start=1
                     /locus_tag="MMKA1_04780"
                     /product="putative phage integrase"
                     /protein_id="BAP60595.1"
                     /transl_table=11
                     /translation="MTRHYCKDWLTKDELKLFIDTVDSKEHKLFFKMLYGMALRVSEL
                     LTIEVKNINLNEGVCKLLDTKTENFQICVIPEWLNEDIFGHIVDNNLKDDDRLFKFKN
                     RTYAWELVKKYTKDAKIHKEFSTHTFRRSRALHLLNDGVPLEKVSKYLRHKSINTTMH
                     YLKITVDDIKKELVKIGDWYDL"
     CDS             462446..464062
                     /codon_start=1
                     /locus_tag="MMKA1_04790"
                     /product="ATP-dependent RNA helicase"
                     /protein_id="BAP60596.1"
                     /transl_table=11
                     /translation="MESFKNLGLSDEILEALEKKGFTNPTPIQEQAIPILIEGKRDIV
                     GQAQTGTGKTAAFGIPILETIDEHSRNTQALILAPTRELAIQVAEEIDSIKGSKRLNV
                     FPVYGGQSIDRQIRELRRGVQIVVGTPGRILDHISRRTIKLENVSYVVLDEADEMLNM
                     GFIDDVEEILKSVNTDKRMLLFSATLPDSIMKLAKNYMREYDIIKVKRQQLTTTLTDQ
                     SFYEIHSRDKFELLSRIIDTEKEFYGLIFCKTKADVDEVANRLNEKGYAAEGLHGDMT
                     QAQREKTLDKFKGKKINVLVATDVAARGIDINDLTHVVNFDIPQNPESYVHRIGRTGR
                     AGKQGYAITFVEPSEFRKFKYIQKIAKTEIKREEVPDVKDIISAKKIKIISGIKEVLE
                     SGKYADCEKMASDLLEDADPQEVLSAVLKYSLKDELSESNYKKIGRGSQRSERSGRND
                     SRGRRSFAPGENVRLFVALGKLDKMNPKKLVDHISRKSDVKGRDIDDVKVFEKFSFVT
                     VSSSDAEIILDSFKNERRGRRSIIEVASGN"
     CDS             complement(464182..464376)
                     /codon_start=1
                     /locus_tag="MMKA1_04800"
                     /product="hypothetical protein"
                     /protein_id="BAP60597.1"
                     /transl_table=11
                     /translation="MVSLLPILAGSCLVIATITTLFIRKIKKEIQTIKEGNSNRADSS
                     NYDTECCHNHHQDCDDCDND"
     CDS             464545..466191
                     /codon_start=1
                     /locus_tag="MMKA1_04810"
                     /product="hypothetical protein"
                     /protein_id="BAP60598.1"
                     /transl_table=11
                     /translation="MDAYDFDINLQKVFYSYFKDIKSSNWKKWLDISSVEEYEDAIFK
                     NSGLSDDIITDTYSKKTDPKEFSLNPKTFLKENLEKDDINNLFSKDTAIVTHTSGTSG
                     GDITKLKWFLISDDFLKRVWVPGMQAIFESSGLSKNKSAVIFVPSRIKVDGLSKVDDL
                     NLIRLYTSEFSQRVVLSHIRPSSYLIDEYKNALNLLTISKILTLDDISVISAPAATII
                     KWANIDKLRTGLEKSIKSIDWETIKEENREAFELKKLYDRIGLKNFAEEIQNRLSEAL
                     KDSTLIFSITSLSKDEWAKIRKFMGWKVGEEKFTNLYVGSEIGPFAGSINKEDNYRMY
                     TFPLTYPVIERKGKKEFISKTKDKYGVLLVSRPGSNPLINIDTGDVITILNQEGIPKI
                     SGEILRSGFKLKLEMKLEGFPENTEFFAGDYFDIGGIEVFNPRKMVSCMGQRFGLEKD
                     NPVLLVSSDSYKMVLPLENNKNVLIDKIKEEMLNCSIGEDIEKALKNEKISLEMGNTN
                     VKTAIDHTELLEKVKMGDLPKGVIKKWPFYILNVPENSGI"
     tRNA            466264..466348
                     /locus_tag="MMKA1_t0170"
                     /product="tRNA-Ser"
     CDS             complement(467428..467718)
                     /codon_start=1
                     /locus_tag="MMKA1_04820"
                     /product="hypothetical protein"
                     /protein_id="BAP60599.1"
                     /transl_table=11
                     /translation="MRKKSSDSIILTILLIGLLFILALSQNFNVLIIVIGALVLSIIL
                     QGKVDFVTTVLAIVSVLLLKSFWDSQSAPEEIVQTIIPVALGLYLLYILGKK"
     CDS             complement(467890..468231)
                     /codon_start=1
                     /locus_tag="MMKA1_04830"
                     /product="hypothetical protein"
                     /protein_id="BAP60600.1"
                     /transl_table=11
                     /translation="MISKEEFCKELTSLNLYCIVDNDKNPINYIFVDKSPFDDFENNE
                     YMFSFVTFDSNGNQNSLKVSKLQFPEGIIDLNLIDNLEITCDPESEQEFLTKITKNLC
                     KATIHKINRQK"
     CDS             complement(468319..469095)
                     /codon_start=1
                     /locus_tag="MMKA1_04840"
                     /product="hypothetical protein"
                     /protein_id="BAP60601.1"
                     /transl_table=11
                     /translation="MSSNSVNSIVDSNILLGVFNKHDDNNPISEKLISMSKNMFILED
                     VLKESSNSINMKWGNIIFEILNFYADIDFSLENDIIAQQEDKLLEKLNSEFGPQIAYN
                     KYFIEKSREIRHQCNDYKGMREKLMKLQISIRDIDKFKESLFLKIKRINPDHRTRIFG
                     YTNKEKHFRINYNLIKNCTESIEFPGNNGNYDKKIFQKVMACYPDKYDLPAYFLTEDH
                     AFFKKCIESLDKLAKETDSKFDNLETVLLSEFLKEYSQSN"
     CDS             complement(469085..469828)
                     /codon_start=1
                     /locus_tag="MMKA1_04850"
                     /product="hypothetical protein"
                     /protein_id="BAP60602.1"
                     /transl_table=11
                     /translation="MVSDAMHDESFSQSYYGNQSYLTLVSPGTGAKHYIEGSVRNPKY
                     SELVKNVSQWSKDKTNRFYDILSDFMALNNDINNYESVLENLSDKLIGLSGEFADMAA
                     IRDIFTKLDSNHKIHIMYESVANLKTNLTKVLDTNYELSLKYRKDPEISQKIHMEGLY
                     LQFILEFCKIAIKYGIRAKSINYESSSTSNKNWTKFSKYHGLTSLFLLRFIAYSKNKL
                     SAEDLLNDISEYSNLLSFGSDSGDEIFEL"
     CDS             complement(470614..472794)
                     /codon_start=1
                     /locus_tag="MMKA1_04860"
                     /product="hypothetical protein"
                     /protein_id="BAP60603.1"
                     /transl_table=11
                     /translation="MGNLSEIQKKEIVIQAKQELEERRVKRIELLEKVWQFSEKYAAE
                     KQVENNIFVFDLDEFSQKYELDNDEILELYPEGSDLTTIYDKIYRTLKIPGVKVEFKG
                     LSGRVEISEKSIFRELCKDGNLVFSDIKNLHAINYKIEDEAGFVKDLKPIAAYTRPKI
                     ENVTYFNGREFETQKKLLIKDKEVDLTDEINYFDDFIGAVKPSGNFNYIKYLEEYSEI
                     FDYILKRYDDKNKVIKRTIAFGYYGTDKIILNGWESQRESLRAKDFKKMLSMKYKKEE
                     IRSILELLKNYLGKEDFTKIIFEYSLASLFRYDLLNTKKLDKFSYLLIIGKQGIGKTA
                     RMNIVFNRLLLNTTNTYSNDDLKGSISKIAKEQYVNLPMWFDELKEFPERLVDMLKQM
                     GTGKEAVITRGNKDMEKDDYTFLLRRPFIMSTNHFKEFDPALVDRFIVLSAYDYELIN
                     NEEIGNELLDEMPKLGAYIYRNIEKIKEHVNTLNFDPSRENANDNVIMIGREIAKFIF
                     KEFELEYEPSKKVVYGNNNIYTSKDMIKKTIIKEVLKLSEWVEAGVKHNILDYIAEPE
                     GADYILGVKQLEKYGIYIKKDRLENHYVAITAKGLNFIEMNEIKVKTLAEFGAHGFEL
                     KTTRFSGINKPQKAVWIPITEEFSEHPDDQRIGELIVDTLKECLEEKDAAHESDITLR
                     LELTHGIPAEKSIELLENMVGNIVVKPKEYMYKFIENPIQEKLE"
     CDS             complement(472804..473772)
                     /codon_start=1
                     /locus_tag="MMKA1_04870"
                     /note="MM1_Con056_0001, MM1_Con103_0057 and
                     MM1_Con033_0003 are similar to one another."
                     /product="putative phage integrase"
                     /protein_id="BAP60604.1"
                     /transl_table=11
                     /translation="MQNLKNMILFTPKKEEIKETSKSKKWVDKFIGEREFDGIKKTTI
                     QGDVNRLKVFLNFIFNRLEKNPEEMTNAEFIKFFNYLEKERKLSRNTQNKYYNNLKVF
                     YKLMRLENFKDFKDESEERKRFTSFEIKHYDSLSTEILNMILNEILETRSTTKIRDAM
                     IIRFLWDTGARISEALKLEYGDSDLEKGEFRLRNTKGKEERIVTCSNDTLALVNYCLK
                     ANLRKEPKDKIFQTYKGEPLQRNRVSDVFRNAVKELKSQGRIPENKRVVIHSLRHGRA
                     VDLLDKGMPIDIVKEYLGHKSLETTLYYSHSKERQENMLKQIKKIL"
     CDS             complement(473816..473974)
                     /codon_start=1
                     /locus_tag="MMKA1_04880"
                     /product="hypothetical protein"
                     /protein_id="BAP60605.1"
                     /transl_table=11
                     /translation="MIHCPECGEPIEHEGSEIEKWPYGAKYEIICNFCNLKITVLEDS
                     DGGQSLSY"
     CDS             complement(473971..474135)
                     /codon_start=1
                     /locus_tag="MMKA1_04890"
                     /product="hypothetical protein"
                     /protein_id="BAP60606.1"
                     /transl_table=11
                     /translation="MEARDFFAGLIFVSQMDKLRFTDAGLIELDSMGDIPENCYAVAD
                     KILESQNVEK"
     CDS             complement(474137..474352)
                     /codon_start=1
                     /locus_tag="MMKA1_04900"
                     /product="hypothetical protein"
                     /protein_id="BAP60607.1"
                     /transl_table=11
                     /translation="MEFSKDPKCSHCPGRVTPEEKKMIIAALKGKIERIFKEIKSCEW
                     SGDVPEASAMLEIKEEYENLLKRIEGW"
     CDS             complement(474354..474758)
                     /codon_start=1
                     /locus_tag="MMKA1_04910"
                     /product="hypothetical protein"
                     /protein_id="BAP60608.1"
                     /transl_table=11
                     /translation="MISVKNVENFGSEDAEIKGSINKKFKVKGKDFDTFKSELKEVFE
                     KYNLKNGENMEDGTYSQTYRHENLEWYCPETKEEGVMEYYDVEYDVTIENGEVEDYSA
                     TSTAYVNGKRVHFQNIPDDLPEDIDLEGAQKW"
     CDS             complement(474755..474973)
                     /codon_start=1
                     /locus_tag="MMKA1_04920"
                     /product="hypothetical protein"
                     /protein_id="BAP60609.1"
                     /transl_table=11
                     /translation="MQEIKDGDFLKSDNGVLFLILRKFRNGDFIALSDVDSKPERFSS
                     VDVRNYEIIENMGNSQLKLLKQVMGVKA"
     CDS             complement(474978..475133)
                     /codon_start=1
                     /locus_tag="MMKA1_04930"
                     /product="hypothetical protein"
                     /protein_id="BAP60610.1"
                     /transl_table=11
                     /translation="MDTYSYWKYGLLNLQVEVNPKGRLVNQEGLREVLDELKTIVEEN
                     EDKIFMG"
     CDS             complement(475278..475508)
                     /codon_start=1
                     /locus_tag="MMKA1_04940"
                     /product="hypothetical protein"
                     /protein_id="BAP60611.1"
                     /transl_table=11
                     /translation="MKFHYIIQRGTIPESYGVANGKNELIRLSELVKDEKCSLKVLSR
                     PDFLKIKRRIDMKTNRKRERTFKIERIDYVNA"
     CDS             complement(475532..475729)
                     /codon_start=1
                     /locus_tag="MMKA1_04950"
                     /product="hypothetical protein"
                     /protein_id="BAP60612.1"
                     /transl_table=11
                     /translation="MITIQITKKGWKREREILPSFVCYAVAHGNAATMYPTLPREYIG
                     KTLIVTVVEPDSDLAKELKKI"
     CDS             475931..476302
                     /codon_start=1
                     /locus_tag="MMKA1_04960"
                     /product="hypothetical protein"
                     /protein_id="BAP60613.1"
                     /transl_table=11
                     /translation="MFLKVLSEKYSKEILLLLNDNEELYFNQIQKEIDVYKSNLSRTL
                     NKLLEAGLIDKREEMQSPKRKVAKSYYKLTDLGRRSLKFYELENELLKIKNNEEKNVN
                     IHIENVGENSLNNSFNFSSKK"
     CDS             complement(476390..476728)
                     /codon_start=1
                     /locus_tag="MMKA1_04970"
                     /product="hypothetical protein"
                     /protein_id="BAP60614.1"
                     /transl_table=11
                     /translation="MKVISKILVLIAISCLIITCGCAGVMGPDPEVVSVTSKKALDGL
                     NSVDKVTVLLKNNGYEGNVNVKAVFNSDKGRTFSEKQSIYLDEGASKYVTFTFDTEYD
                     EEGTISVTTS"
     CDS             476828..477748
                     /codon_start=1
                     /locus_tag="MMKA1_04980"
                     /product="hypothetical protein"
                     /protein_id="BAP60615.1"
                     /transl_table=11
                     /translation="MFKKLLLALLISISLLFSGCIDSSATTESNDIETPTTPQEQSVE
                     SKMIVWGTPDDFDYYKLPLSLHKSDLEGAEKVIIKTINGAEIYYLKDYTGEKTEVEEF
                     NSEYVDTIYIYYSETHMFTCPNNDNKNIPILPLGIYESDPDSVYDFYMEEAYSYYDEG
                     NYERADVYARAATYYKPNVESYTLRADCMRKLGDYEAQAYFQNKADDLPLTFAEFERT
                     YTKNMNIPDDAKDYEELGDKYEKTNPEKAIEYYEQSVRIFDGNACVWHKLAGCYYDVG
                     DYDLNAYANGMIFELDPDFYSDFPLIFERP"
     CDS             477776..478147
                     /codon_start=1
                     /locus_tag="MMKA1_04990"
                     /product="hypothetical protein"
                     /protein_id="BAP60616.1"
                     /transl_table=11
                     /translation="MDFNIGSVVVSVKENVMEFTFHNKVETISLDQISSVELTKMNYN
                     LLHISVVLAAISFAALIFVNEILSIIILFPALLCFIGGFFVCETLTFHVNGRGKFPLM
                     VQKRKANKLYSYVSELLNNRK"
     CDS             complement(478335..479111)
                     /codon_start=1
                     /locus_tag="MMKA1_05000"
                     /product="hypothetical protein"
                     /protein_id="BAP60617.1"
                     /transl_table=11
                     /translation="MKEFAVSDFKNIIVETNFITSFFNKHDSHRIVFEKILKYSENVY
                     IPQTAFKESIKSFKNKLDRIHTFLMSKYLKMDLNRDNSEIYEEEEKILEELNLTFDKS
                     INFNKYLLNVSRDLRLRYLDKTDFLSALTDHVLHIANIAVFEKVVYEHSRSINPELNF
                     YNVLVPNVNKPTIQKRYNKIKNAIEPVNYNDKPDKKLFLNIMYHYPDEYEFPLSFISS
                     DSEFIEKSRLSLIELNNQIDLDTSELKMIYVYDHFEKPTN"
     CDS             complement(479083..479796)
                     /codon_start=1
                     /locus_tag="MMKA1_05010"
                     /product="hypothetical protein"
                     /protein_id="BAP60618.1"
                     /transl_table=11
                     /translation="MGEICKNTLSYYDPNTLNRAFMAPLVPETRSKHYVKRMRDPLYY
                     NYLEDVENWSFDKKYEFLDIMTDLVTKNYTLEEIKALTKKIYDKMDNAVGFEEISTLR
                     EKSSHIAPYHRKQIFAESLSNLKKDIHELSKINFQNMLECSEDFEKLNEFTILGSGIN
                     LMVKYIDYCLDDLKRTNELFKKRYGALIVFSLRFLAYLMDKITLEELSSDVSVFGSVI
                     YDEEGIGDEDFEGICSFRF"
     CDS             complement(479878..480429)
                     /codon_start=1
                     /locus_tag="MMKA1_05020"
                     /note="MM1_Con048_0003 and MM1_Con103_0042 are similar to
                     each other."
                     /product="resolvase"
                     /protein_id="BAP60619.1"
                     /transl_table=11
                     /translation="MIIGYARVSTKDQKLERQIDELRKAGCEKIFLEKISGTKKNRPE
                     FDRMFEVLRPGDMVIVSELTRLSRSTKDLIEIMTRLEEMGVSVKCLKESWLDTSSAHG
                     KLLFTIFAGLAEFERDLISERVKSGLKAARSRGRQGGRPKADINQVELALKMYDSKEY
                     EVKQILKATGISKFTLYKYLNER"
     CDS             complement(480702..481226)
                     /codon_start=1
                     /locus_tag="MMKA1_05030"
                     /product="hypothetical protein"
                     /protein_id="BAP60620.1"
                     /transl_table=11
                     /translation="MSGEIEGDFLVPKPENTEEKIVEDPGKIGPENFDEENTEGPDKP
                     ENTEEKIVEKEEKHEKGTPEEEIEADLAPIKQEEHEEKTPSESPISFDIPTGRSRASP
                     ENFDEENGENPGRTAGRKKSVHLEKVVNKTIIDILEDLKEIHNSSYQKDVKRTSKKIG
                     ENIIYLREILDDNL"
     CDS             complement(481237..481995)
                     /codon_start=1
                     /locus_tag="MMKA1_05040"
                     /product="hypothetical protein"
                     /protein_id="BAP60621.1"
                     /transl_table=11
                     /translation="MGLLNSLGFKNKSDSPGKVGPENTEEIENDENEDETPGTFNVIR
                     KVKKKKEEYNAEREAYDSLAPYLCRQKLLIWHNGSGAKVFGYPHAVIPDEGTYKILYK
                     NKATDWLEDLIITIKSTIFNYKRHYAVVYAPKACVDVSEDIIMFFVDHFRDDKHANFV
                     KYAVPLEADDPRQRVAWIVERKRAEAYEVMVENLLSEDIPNLVDAALYINPTMKMYKG
                     SEKESSRKSTKEKSFEGGEFSFDNAINRMKNEMM"
     CDS             complement(482005..483357)
                     /codon_start=1
                     /locus_tag="MMKA1_05050"
                     /product="hypothetical protein"
                     /protein_id="BAP60622.1"
                     /transl_table=11
                     /translation="MVMINLGIGRTDSAKKHGERTKRSLNLKNDEANHITLLGKSGYG
                     KTTIMRGMIEEIYSSYSDAGIPPIIIVIERKVDTSKSKKVIEIYHEESKKSTEKYIYR
                     KYGDGVWNYIGHYVNELENDTKLRYGLMGDFAIGFPNILGKYTKAGMDEYKTLLGRHG
                     LSPAAYPARRFVFRPRREIEDIAFDNGPLTEVINSKLAYPDLPFEIIADMNNLGEQTR
                     YFAVLKNIWDISKIRDPKEVLSIAEHYEKPNSAPSQTYLRIDETMNRLKTDMLFTGKL
                     DDSFLKKITNKKINILDFSQNSELDTCEECLLFKLVVQHAINVAIKYRIPVFFVVDEV
                     QNFMKDSNGKWAIDKILREGRSLCINLICATQYTDNLPKDILIGSSHIGIMGKLASNT
                     DTKTLEKLIPDFKDVVDFDEPGSLSEYESLKRKLRFRGYFSYNKDYTEHIEYRQPQSL
                     "
     CDS             complement(483476..484015)
                     /codon_start=1
                     /locus_tag="MMKA1_05060"
                     /product="hypothetical protein"
                     /protein_id="BAP60623.1"
                     /transl_table=11
                     /translation="MQKKLFLVMFLCLLPSVFAYSDNETVFVLTDYDDFNYSTIIVYD
                     GNMVSGQNALIHELKQNITTLNEELSKKDKQLSSYIVAKAENVELKENITTLNSKIKL
                     LEAEKEILETQNEGYQDMITDLINKQSNDTKDFNAGAYNNAVKTVNSFKFGVLFSGVI
                     CLMLFLVLRWKKKQFDFGI"
     CDS             complement(484157..484597)
                     /codon_start=1
                     /locus_tag="MMKA1_05070"
                     /product="hypothetical protein"
                     /protein_id="BAP60624.1"
                     /transl_table=11
                     /translation="MKKIIFFTFLVIFLVVFQISNSSKTDEDIIQLKLLEFGYPSSGY
                     IISNKTVYYKDGSKTELSKPPKMYEIGGVEAYYLAQNYVDKEYGTSLESKGLMIRVEP
                     KSIEESDKYWKFKFYFGDIGSTGRFMGYIAVNREKGYVDMEGLF"
     CDS             complement(484603..485082)
                     /codon_start=1
                     /locus_tag="MMKA1_05080"
                     /product="hypothetical protein"
                     /protein_id="BAP60625.1"
                     /transl_table=11
                     /translation="MANFSFDVWLPKAFGASIVIGILLWWTGTQVVTISEIATSLSSI
                     PFAVILLIEALDKFADVSGIYNKLIPQNTANHLLKSVVIGVIAFVAVLYGILGTISLS
                     LGSIAAPALVAAGICAVYILAPETGDDELLLFAWLGATFATLGANISLIPSIPGITG"
     CDS             complement(485094..485831)
                     /codon_start=1
                     /locus_tag="MMKA1_05090"
                     /product="hypothetical protein"
                     /protein_id="BAP60626.1"
                     /transl_table=11
                     /translation="MAKNNNLWVGLAIAVILVAGASYYYLNQGESGGIIIPTSTTFSS
                     DATFDNETGDVLITFNASKENITADSIELYVSYDELTFTKTNTFEDVSFPLDIEVTPE
                     EGEENLYYYAVVSYSGKTYRLPSDAGAYETVEITVETSTEETVDPLTFAAVPDFNSTS
                     SVVLFALSASEENTTANVLLFTSYDNTTFENTVNSTALDLPGTFEFTTNSTETDLYYY
                     LEIVCDENTSRLPAEGAEWINITVAAE"
     CDS             complement(485941..486183)
                     /codon_start=1
                     /locus_tag="MMKA1_05100"
                     /product="hypothetical protein"
                     /protein_id="BAP60627.1"
                     /transl_table=11
                     /translation="MYVNFESIIPIIQSYWIQITLIMLVAVLIKNIKAIILATAVVFL
                     MSYFGFLDLSNFDVSGILEQVNSLIGGIEWQKLLVR"
     CDS             complement(486196..486513)
                     /codon_start=1
                     /locus_tag="MMKA1_05110"
                     /product="hypothetical protein"
                     /protein_id="BAP60628.1"
                     /transl_table=11
                     /translation="MINQLIVVILSFVLSMVLKPQVEVIGQGFGLAGLLSWMVPTLIV
                     LICVWKIGSDKWNLGDLIASFVLIVLILMYFYQDVSQIFLECSRIMLGACVGAIVAYS
                     AKK"
     CDS             complement(486540..487055)
                     /codon_start=1
                     /locus_tag="MMKA1_05120"
                     /product="hypothetical protein"
                     /protein_id="BAP60629.1"
                     /transl_table=11
                     /translation="MASNANSSSPKSLPSWLIFSLKMVGCGVGFAGLMWYVMNNSVMG
                     SDVVRGLAAVPFVFYLMAELLDTIVDMNKVVYTPLFKNYSGYVAIGLTIITIVCMFFV
                     TLWALSGSITLSIGSAGASSVVVAAIFALYLLAPNTGKEKFLLYLFVGASIATWGSYL
                     SIIPSFTGFGL"
     CDS             complement(487084..489102)
                     /codon_start=1
                     /locus_tag="MMKA1_05130"
                     /product="hypothetical protein"
                     /protein_id="BAP60630.1"
                     /transl_table=11
                     /translation="MINSKLFSIFCIFLIATLPSAHAFSVLGHELNAGWDDVGALGLG
                     GVALGAVAVTAGAPVLVAAGVGVIGAIAVDSAYRWATGKDVEESAAVTGAAKTNVSDD
                     EYINGTYKYDLLAGYRQYSEESAAKDIAEIKDKLESGIGTYSFKTSGTLSDVNVSMKG
                     PDKIYGFSAFPVQLKFDETLTGSESSYVMIENVKIYLVDSEGVKWNEKDYTDNIKLQK
                     NNDDHPEAIEEYIINFTMKAPDPYIGKAKSQITNAPNREILQELINAEVKRFELVVEI
                     DGHVEHYKKITKWSDELQDYITKEEHDDSVTLDTKLTTLEAWDRIHSGAYYIDGADAS
                     LPTSYINEVTPIAYSSYSNGATSNVIGRVWASPVHCYNSSSQYRFVLIGQPGNLEPVP
                     VTIEDDYRALVLKLRDDGVASIASDTPGNFHDMSTYTGLTTSLNYLKDSSTEAFETYF
                     LVVADVDDGIDSALPVWCLIKPRISVIDNVKYSLNEEFKEEILELMSDGSISDSDSQR
                     ITEIIQMSEESLKEKQYVAESESEKYNDNEKARNAILNSLEDYEKAFEYYEKAKNTDD
                     PEEVKVYTYLAGDVYEPAGDYWKEAAAKYNLGLDDQGDALASNAEKLESLASEYEPSL
                     WFTAGSTISDWWNQFKSGFGIGDVPDTVLIIVVVIVLVCGAAIVIKVL"
     CDS             complement(489099..491036)
                     /codon_start=1
                     /locus_tag="MMKA1_05140"
                     /product="hypothetical protein"
                     /protein_id="BAP60631.1"
                     /transl_table=11
                     /translation="MIKRYLLFVLILIGFVSSIDATAVTIPETCTVTDYYVELTETFD
                     TDTTKSLLLTYDFDSTVPGVSGVEGSKIYFDSLNSLVRFCNIPSRSSLSIPFEGAFDV
                     YKNGVRTETTTILYSSPTPSSYSSYNGYLTLNVSSSQVAYSYIYYRSGATSNSATFSY
                     SDTTIFTKSGSSTTSTFVSYAISPSGEFHLINYRNANEVSDFYASIVVFDYVEYNFTC
                     DSGSNMVVSTIMEPPERGSISIYTDPNTEIYEGSYLLGTTDNGGLLEIQLPLGERTLK
                     FVKDGYWDLLKTITVSENNTDVFVTMAPRNAIFQVQKEFSGNIYPNSVARLSMDINPV
                     KTAYATKLRVSGVEVNKVYYQTKELPKSSDGSYIIGDISSPQNIVIDFKTTSSWGERA
                     FTVELAATDIEGTAYTNLETINYNVLELPFLFEAPDSWAIGLNDVTLTDMSGESYSVL
                     MVLYDESGTEKWSSSTNLLEYCEYTFEVPVEDAGEYTLELNAKSGTVKSYYSVDIIEP
                     VSLVSDFLTANPGKVATVQFKISNPTESVKYYKASLMCPFYNDTIDKTFSIAPGTVDK
                     TVDVSFEVPEGLEMEYYQLTLEVFDEGKTDPIYSGHVVLTISTSSLFMASVPGGNTTL
                     ILLAAAVLLIAGTFAALRLKK"
     CDS             complement(491038..491364)
                     /codon_start=1
                     /locus_tag="MMKA1_05150"
                     /product="hypothetical protein"
                     /protein_id="BAP60632.1"
                     /transl_table=11
                     /translation="MVKICPNCLHVVDHFEKDYHKSEVKAVNVHTSNKNCSVLQTSFV
                     KDQAKCSNIQSLKMNAGKISKDLNLSEIQKKDFFNSIIKLKRDKNHLKDYIILQSALN
                     TVLVGG"
     CDS             complement(492424..493695)
                     /codon_start=1
                     /locus_tag="MMKA1_05160"
                     /product="putative iron compound ABC transporter
                     periplasmic binding protein"
                     /protein_id="BAP60633.1"
                     /transl_table=11
                     /translation="MKKVIALLMLAMIAFMPSISAQAIGDINGDDSISIADVVYLFKH
                     RNVGLDVGDLNCDNSVNVVDVVYLFKNYDTFRDPVVFAENFEMDPHWNEGYCYVKDSV
                     GNEFVLLKEGATDPQIEGATVLTAPINSLACTQYSPVLSTADVLNNADVYDMIDGIGN
                     WDTTNSEEIYSRYLNNETITVGGITDIDYDKIAILNPDVVFLGSWDDHDVAENKLETE
                     LGIDVARFYTYDEKTYLGRIEWAKFVAAFWGDSNSDAIEQYFQDAWHKRNELIRTAST
                     VDDYPTVVYVMPVDYGGLTYYLYGSQNYNNKMITEFGGENIFNDIPGSSSLIIDAETF
                     YERAASADVVIYMGMEYYGIESRDDLLQYDPNLASFESLSNGKLYIPVTSYYLDEAKD
                     PANYMEDFARMIHPELYSGGDSSLTYFNKIE"
     CDS             complement(493859..494995)
                     /codon_start=1
                     /locus_tag="MMKA1_05170"
                     /product="putative iron compound ABC transporter ATP
                     binding protein"
                     /protein_id="BAP60634.1"
                     /transl_table=11
                     /translation="MLKTENLTVGYNDYVVVENANLEIKEGEILCIIGPNGVGKSTLL
                     KTIATYLKPKTGVVYLNAEKIHELKPKELAKEMAVVLTDRVNPGNMTGFDIIAIGRHP
                     YTDLFGRLSDEDKLIVTNAAISVNAEHLLSKNFFEMSDGEKQKIMIARAIAQEPNVLI
                     LDEPTSFLDAKHKIELTLLLRKLATEKNLAIIVTLHDIELGLRIADKMALIKDHKIIA
                     YGYPEEIMDKKTVNSLYDLKNANYSNLIGYFELKNEFNDKKNGNKKVFVNCGGGSGSG
                     VLRYLVKNGYDITVGILQKNDIDYAVAESMELDIICEEAFCKISNEKLDEAFKELESA
                     DVFINTNYPVGDMNILNLNLLEQAQKLGKTVINYDGNIQCLKDI"
     CDS             495130..496086
                     /codon_start=1
                     /locus_tag="MMKA1_05180"
                     /note="MM1_Con107_0005 and MM1_Con103_0021 are similar to
                     each other."
                     /product="hypothetical protein"
                     /protein_id="BAP60635.1"
                     /transl_table=11
                     /translation="MNIFDFSILGNSLLSAVLYTIKLSSVVLLTMFIMNCLINTGIMK
                     KVSNFLYPFTKHLKMNQLSLYSILSCFFSPTVGYSILAEGYNDKKVNEKELIGSSLAN
                     SFPSIFSHIFTFFIPIAIPLLGMTGVIYILIRSGVAMVKTIIGLFYLALVSKNTEEYE
                     PKNEEQKNIKKSMKKSFESTLRVSKRILPIMFITMFIVIYFSNLGVFEFIKLIINPVT
                     GYLNLDPSVGILILTDLINVQAAMVMGSGLLENGVLGSKDVIIGLIFANVLSLSTRYA
                     KHSLPLHVSLFGPKLGTKIVMINAGITFAIDVVIIGAFLLLG"
     CDS             complement(496182..496682)
                     /codon_start=1
                     /EC_number="6.6.1.1"
                     /locus_tag="MMKA1_05190"
                     /note="fragment"
                     /product="putative magnesium-chelatase subunit ChlD"
                     /protein_id="BAP60636.1"
                     /transl_table=11
                     /translation="MILLDSSGSMGISKRIGIAKGIVDRYADDSYVKREYISVISFRG
                     REAIVLSPFTRKYNLIKAQLDSIKTGGKTPLSSALKVALNISKQFRNKNKKSSVEFIL
                     ISDGKANVPIKKDIKYEIEELSKIIQKRKISFKIYDIRNKGVIDPSISYLDKISEITN
                     AEMENI"
     CDS             complement(497036..498118)
                     /codon_start=1
                     /EC_number="6.6.1.1"
                     /gene="chlI"
                     /locus_tag="MMKA1_05200"
                     /product="magnesium-chelatase subunit ChlI"
                     /protein_id="BAP60637.1"
                     /transl_table=11
                     /translation="MSRKVVYPFGAIVGQEKAKKALLCCAVDPSIGGVLLTGDKGAGK
                     STLVRSLSHVLPNFEAVLECPFNCNPENPLEMCDNCYENANSANEFKKLEKTMKVVDL
                     PLSVTIDRLVGTIDIKKALNEGKRVLQPGILANANRNILYIDEVNLLDDYVIDILLDS
                     AAMGWNTIEREGISFKHPSRFVLIGSMNPEEGELRPQLLDRFGLYVEIESLFEAEDRL
                     EVLKRVEKFQKDPFSFYETYASIEENLTESIKTAKKILNDVTISEELLKMLIDSIIHL
                     GIKTHRAEITTIKTAKTIAALDGRMEVSLEDLKTAMDLALIHRLSNPNSNPPSQSMEN
                     ENNEEMEDESKKKRKQIRQLVPHHHH"
     CDS             complement(498115..501987)
                     /codon_start=1
                     /EC_number="6.6.1.1"
                     /gene="chlH"
                     /locus_tag="MMKA1_05210"
                     /product="putative magnesium-chelatase subunit ChlH"
                     /protein_id="BAP60638.1"
                     /transl_table=11
                     /translation="MAKISILLGYGAVTLPQFSEALDKEKIETSFEYLLSNSENLNID
                     LEFIKDSDVIFIYSPSMDEKLQKAIEESNAKVIISGSEPNLHLSKGSNAQLSKAIIYY
                     KIGGPKNIEQLVKIFLNFAGFNLTVEEPENTPWQGIWHPKHGTFENLEDYLKIYGTKK
                     DFVGIFFHRTFWISQSTDHIKSLVEELEKQDLGVIPVFTNRLNIEGYDSLTAEETIQK
                     YFFKEDKPVINALVNSTFFFMLDHSSKDHESKNRFKDVSGVELLKKLNVPVLQVIHSF
                     RESLDEWMKNPQGIDPMSQVYQVIMPEVDGTIEPIFLVGSKVDEDGVKRYEPYTEHAK
                     YVSKRIKKWVNLSKKPNFEKKIAVVLINPPCHGSEASLAVGFGLDVPESLVRLLKKLK
                     EEGYNVGDYIPETGQEMMDLLMSKKAVNEFRWTSSSEIVEKGGAVGFVDHGTYRDWFD
                     ELPDKVTSKMLEDWKDPKEVLSKNVSREYIGMVHENKFVVPGVLFGNILVTPQPKSGC
                     AGTFCDGKACKVLHDPLINPPHQWLAAYRWMTRIFNADMLMHFGTHGYLEFRPGKGVG
                     LSPACWPEITIDNVPHSYIYNSANPMEGVMAKRRAYATIINHMYPPMTMPEVLEDIDE
                     LLAEYSKAKSLEDTLKMEVTYEEILELALKNNIKISSKVPDDTVEELHEYINMISGTQ
                     VENGLHILGNPTDDAEKISKYVITIMTYDNYNFKSIKRVFSEYLGFDYDELRTESSKI
                     YNEGFTAKEIIKENSNLLQKALKEILIEDIDSNEEILKIINEKISESQMLKNCELNDY
                     DDILKAINTGKLIAMKIKACTAEYNGVFDVFDGKYILPGPSGAVTRGKIEILPTGRNF
                     YTIDPTALPTPASWKVGIKTAEKLVSHYLEHHGKYPENIGQIMWSMDAYKADGEQLAQ
                     ILYLMGVKPLWNKDGSVKDVEVISLEELNRPRIDTLVRISGITRDTLPNYIKMIDDAV
                     TKVISLDEPLEKNYVKKHYLEYLNEFKEQLTEDLLDEAKSRVWANAPGAYGSGVNLAV
                     DASAWSSDEDLSKVWLQWGSYRYTAKSYGKYSPEALISGLKTVDIVTMDHMSDEHDIT
                     NCCSKYAYQGGMYTAVSTLKGNSDIDIVIVDTKDISNAEVRTIEKELERVARSKILNP
                     AWVNEMKVHGYRGANEFSKKIQHIYGWSATTKMVNDWVFDEITEQYILDDEMREWFKE
                     NNIYACEEIARRLIEASARGLWDADEEKLEKLKEAYSELEGDLEELMDGESEIQGGQI
                     ITSSFNEDAKKESLSGLESLWNKSKVVK"
     CDS             complement(502247..505930)
                     /codon_start=1
                     /locus_tag="MMKA1_05220"
                     /product="hypothetical protein"
                     /protein_id="BAP60639.1"
                     /transl_table=11
                     /translation="MKFKLIVTSILALLALNACFATSVELNSSSLNVEKGDTFSLDLL
                     IKDAPETWAIENGISYDEDIINLTSITLSEICNAAPLKEVSPNGDISLAWFSDAPSGN
                     FTVATLSFETLNRGNTQIELNPSLSDTDGYALSTNVTNTNVSVYEPKPDLVITNVSID
                     PLKKYETNTVLVTVKNNGDFNASAFKVSLDAVTGVIDSDVEESIAGLNIGESTVVTFE
                     NITLGPNNLFDIIVDSEYAVEESDEINNEISFGNQPTENSISAVLSCENDSVKTGETF
                     DVALTLNDLTANRPAKAVEGALVFDSGVLSCNAFEFQLDASEANETYLENVTINSDNV
                     TFSIVDGTIDENTTIAIATFEALAVGNSDISLENLVVSDVNGYAFNNVNETETNVIVQ
                     GPDVSVENVEVSNPYYMEPATIKVTVANNGHQTVESCSVNVYIDSDELKPLTVTDLGV
                     GESKIVEFNWTPQKSKTFTVVTVLDSSDAISEENEDNNQNTTHCIVTENSISAVLSCE
                     NDSVKTGETFDVALTLNDLTANRPAKAVEGALVFDSGVLSCNAFEFQLDASEANETYL
                     ENVTINSDNVTFSIVDGTIDENTTIAIATFEALRAGTPVISLENLAVSDVNGYAFNNV
                     NETETNVIVQGPDVSVENVEVSNPYYMEPATIKVTVANNGHQTVESCSVNVYIDSDEL
                     KPLTVTDLGVGESKIVEFNWTPQKSKTFTVVTVLDSSDAISEENETNNQHTEQITVTE
                     RTVSMEIYKKSETENQTVASVKVSGIVEERQCSNYSAYISLDNLEAVEVNAIGETTNW
                     SVSNNTLFVTGYNFSDYGEFEIANITFNKTNNSISAIISECALSDSNGYAFNEIFTSN
                     KIVNLKSIENIVVDSNVSDLVNESALETVNNGEFNITKIYFNNSDSIWIPETVENISF
                     TNETLDAMNEAVSNLENIDFDSITSENDVSDIMDEVINNTVVVSNYGFDISNITQETA
                     KDGNNAISELRFTATNTSSKGFAIIRLPVGNLEISEIIVNNGTDNITLEKDNIESTIG
                     GYRLPVDGILEITLIKDPEVTITFSSALPQTTSSSSSSHGGGGGSSYSSDIADDIESK
                     VIKNFVSSATVIYGNEIDENYANQLRERVQNAEGFTISGNAVIVGGPLANGFAKEYND
                     QFEMPISNDYPGENKGVIQVLKVQDNSGNIVKSYTIVYIAGSDRYGTLAALEYFKTLD
                     ELPEGPIMIEWTANGSVVVEELI"
     CDS             506361..506906
                     /codon_start=1
                     /locus_tag="MMKA1_05230"
                     /product="hypothetical protein"
                     /protein_id="BAP60640.1"
                     /transl_table=11
                     /translation="MKKAFLLVIMSILILPVNFASNTGLEIEMPEEITAGEVFNIEVN
                     VKNNVEVCGFECELKIPLEEQDNFEIINVTENSEISEKAGQFYEIKTTKSGVLNRFTV
                     FDEPVNEDFHAFTVQLKALNSGDNTLTFVSECADTDGNAIPVDTVEKELTVIVNPELE
                     NNNNNSLLDMIKSILNFFFGG"
     CDS             506907..507764
                     /codon_start=1
                     /locus_tag="MMKA1_05240"
                     /product="hypothetical protein"
                     /protein_id="BAP60641.1"
                     /transl_table=11
                     /translation="MNKYIFFSIFLMFLMFSENFASDNLILKLTPEETKTDGELLYFN
                     ITVENIPPENSLDEGYDGSNLAEYEKDGGCAAVDVFINYSTDILGPVEFNWSETCMEM
                     DWKEYQFEDGEFYLSITFDETLYDDSLLIGTVVFNPIAESATELELSGCLASNLGSQY
                     NGGKRTADTDDERTTRVEYPETEFYGSEIKVNGVGSYEGSTSLEGTFEETPEVTGSNV
                     VYNINVIPNQQEPEVIVKKVDVEEISPNITVIVQNDGGINPVLLISIFLGSILSGAVF
                     GSVFRGRIL"
     CDS             507761..509836
                     /codon_start=1
                     /locus_tag="MMKA1_05250"
                     /product="putative cellulosome anchoring protein"
                     /protein_id="BAP60642.1"
                     /transl_table=11
                     /translation="MKKYLFYLLILFFAMPQVFSEDTSVNLYSDSDSFSVGDNFNMDL
                     VIENIPADQKCGGIEIKITYDHSLLSLSDIELDGNLNADYNEVKEFDGTIKLAWFINP
                     PSGTIDIAKIKFNTLNEGKSEISMSETTISDSEGYEYQNISINGLNISVNQLNQTIGE
                     IILEDYKTDEKIDAVLSLKGVKTPINNISGYLSFENVSIVENPSISELLCSKFNYELN
                     SNNFSFFIIPNKSSENETMFELLKIPIIVDNKNYKISSGLYINGVKLQNISTIEEKES
                     IDASTYSGLMFYVDGEYNTETELIIGSPKKIKLKVCNYDKNITNISGYLFINDSLFDV
                     SEYQIPTVSDVYNKLDSSDISLNESYLYFNVSMEDNGTNGTFSILEFKLRSKINENVS
                     STIQLGNLSTYFNETKLSVDAKDLDVNIVEKSENSPPSVKIFYNVYNNNQVYFYPISD
                     DEDDDLDDLDYEWNFGDGSESTKDEPIHTYSNYSRYYVNCKVLDTLNASDTSKGIIEL
                     IDISPVSYQMPNKNLVGIKGENKTLYLNLTLNNPLNYNVNAYIQFVDYNDYDPLNSSY
                     NVLLGADETKNLIIPINVTKSCKIKWNVLYYPPASITSDDIDIGYYLWNFEENVEFKE
                     KATIINSTEYVDVNNTKVILEVNKVKTVENQVIYKTVSSTDESVVYYCFTAISGVFAG
                     LIFVRYRIR"
     CDS             509964..511241
                     /codon_start=1
                     /locus_tag="MMKA1_05260"
                     /note="MM1_Con103_0024 and MM1_Con103_0013 are similar to
                     each other."
                     /product="putative iron compound ABC transporter
                     periplasmic binding protein"
                     /protein_id="BAP60643.1"
                     /transl_table=11
                     /translation="MKKVMALLMLAMIAFMPSISAQAIGDVNGDGSISIADVVYLFKH
                     RNVGLDVGDLNCDNAVNVVDVVYLFKNYDTFRDPVVFSENFEMDPHWDEGYCYLVDSA
                     DNKFVLLKEGATDPEIEGATVLNVPLTNVGTVFYCPIISTADLLDNAAVYDSLKVIPT
                     SYVKYSSELQTRYDAGEILNIGSSSTMNYDNVVASNPDIVFLADWEKHDVMEEQLTAN
                     NILSCRCFTYDEPTFMGRTEWAKFAAALWGDENSEVIDEYFQETWQKRNELLRTAATA
                     EEYPTVVSFSWSSSKDTACVYGAQHYYSRMVNEFGGEYVFNDIPGTSSNYPDKETFYE
                     RAQNADVCIMKVYTGDEVLTAEDLLAINPDFANFESYKNGRFYTSHRDYFIQEAIDPI
                     GYMDDYARMINPELFSNGDSGLLHHTKIEPIAG"
     CDS             511383..512429
                     /codon_start=1
                     /locus_tag="MMKA1_05270"
                     /product="putative iron compound ABC transporter permease
                     protein"
                     /protein_id="BAP60644.1"
                     /transl_table=11
                     /translation="MNLKKFSVLLSLSLILIGVLSYFSILEGSVKLTNENLKDYIFDG
                     STGNAGIDSMIKNLRMTRIVGSILVGSAIAVSGLLMQGYFRNPLADPYFMGIASGASL
                     GVVLYTFTSVLFDLGIPHSVYGRIIAAYAGSLIAMFVVINISKVVKQISTLLICGMMI
                     SAAISGFSDILVATGSYVDGENSELAGYLSWGMGSISSLTWVQLESMALIIIPFIILT
                     YLFLSKNLDANLLGENYAVSVGVDTKKFRRLLVFLSCILSSTVVAFAGPIAFVGIVCP
                     IVARLLCGTSKHFFVLPMTALTGVIFVILADILSRPGVLFQATVPLPLLCPLSLLGGP
                     IVIISFLKSKKMRI"
     CDS             512449..513504
                     /codon_start=1
                     /locus_tag="MMKA1_05280"
                     /product="putative iron compound ABC transporter permease
                     protein"
                     /protein_id="BAP60645.1"
                     /transl_table=11
                     /translation="MKYKIFLISIIFLLDLGLVFAGIYYGGNAKSIDCGDITNYIFEQ
                     TTGDELKDMILQNVRIPPIFAAIFVGLSLSVCGLMLQTLFRNFLASPYTTGITSGVLL
                     FASFVIFLKSFSELFAAFGPDKLLIGGWIGGLISIIILVIIASKIKDVNDIIVVSLLM
                     SYFLGGIRAYLVANADPASVMTYYFFALGSITGIRPEDLPIIGTCSLLFALCAFLAIK
                     PLNALLFGESYAKSFGLSVKKIRILILASTAFVAGSIMPYVGSINFVGVAAPFIARPL
                     IKTSDHRWLVPTTLLTGIFLMLVCHFITFKYNLPFSYLLGIDRPVSVIPIGSVLDIVG
                     GLLVIYLVVSREKKIKI"
     CDS             513559..514533
                     /codon_start=1
                     /locus_tag="MMKA1_05290"
                     /product="hypothetical protein"
                     /protein_id="BAP60646.1"
                     /transl_table=11
                     /translation="MYNLINVSNYKGDLEKFQYDHNNMGEFLKRNDLDGFEVLQFGPW
                     NEDEIPKNFIKGLHLRFYPTWIDFYRGDLDKLLSKVYSKENIVTLYGGTSKDVIIDYY
                     RSELKTAKEMGVDYVVMHVCHVDLEDSLNYNVNYTDEEVIDESINLINEVFNGENDYE
                     FYLLLENLWWPGLKLKNKESMQKLIDKINYEKVGFVLDTGHMINTNLEIKNENEAIDY
                     IFETIENLGEMKDYIYGMHLNYSLSGNYVKEFIKTQKITKRTCELDELFKEVCEHIGK
                     IDYHDPFEHEKIKELIESLNIKYLVYELFAPNLEELEDKIKRQNEWVK"
     CDS             514535..515044
                     /codon_start=1
                     /EC_number="2.7.1.156"
                     /EC_number="2.7.7.62"
                     /locus_tag="MMKA1_05300"
                     /note="bifunctional protein"
                     /product="adenosylcobinamide
                     kinase/adenosylcobinamide-phosphate guanylyltransferase"
                     /protein_id="BAP60647.1"
                     /transl_table=11
                     /translation="MSKVIYVSGGQKSGKTTFAQNLALSLSKNPIYLATSRVWDEDYK
                     KRIDRHKSDRGDEWTNIEEEKYISKYKFENKVVLIDCVTLWMTNFFYDNNQDIGKCIE
                     EAKTELNGLLKTDATYIIVSNEIGLGGTLADKMACKFIDLLGLINQYIANISDETYIM
                     FSGIPVKIK"
     CDS             515152..515346
                     /codon_start=1
                     /locus_tag="MMKA1_05310"
                     /product="hypothetical protein"
                     /protein_id="BAP60648.1"
                     /transl_table=11
                     /translation="MILKILSKKHVKEILKTIESHKSIYYGQLKKETGLNSGNLSKLL
                     NELLEFGFITKEEVPTDILK"
     CDS             515428..516144
                     /codon_start=1
                     /locus_tag="MMKA1_05320"
                     /product="hypothetical protein"
                     /protein_id="BAP60649.1"
                     /transl_table=11
                     /translation="MGGEMDLEIEITSVSELLDYLKDIEEISEILNYILDYNEKQSLI
                     KLKYDIILLSVLKNSIDKLITPVNRRYLDEYFRVLSSSKAKLEIQIKVNGWEDINRHV
                     RYEHFKNEKSKELFKSKFLTDVKKFMFKSDYDSLNEIIKGIKKISKYQIDYIVKIVSY
                     IFINNTNEYLISLSEVGNHLNAFRDELNNVTDISKGDIKTLILLEKIYCNLTVSIRYL
                     KSVLDDIKRKYTKKLMEYPI"
     CDS             516555..517028
                     /codon_start=1
                     /locus_tag="MMKA1_05330"
                     /product="hypothetical protein"
                     /protein_id="BAP60650.1"
                     /transl_table=11
                     /translation="MVFLEFVIKKVSPIYHLTAKKIKEHYYDRLGRNGNDENIEGYLK
                     EMSEHLKDLICGIHLIKPIITNDRLRVQQGCFSVYGGKLSKYWDSDDYSEYIHIADMA
                     DCDLENSDEILATFIIPANKKKEIREELQRLGIHYGTMFPELDKYGEYLKKKHGY"
     CDS             complement(517223..517630)
                     /codon_start=1
                     /EC_number="3.1.3.48"
                     /gene="arsC"
                     /locus_tag="MMKA1_05340"
                     /note="protein synonym:arsenical pump modifier"
                     /note="protein synonym:low molecular weight
                     protein-tyrosine-phosphatase"
                     /product="arsenate reductase"
                     /protein_id="BAP60651.1"
                     /transl_table=11
                     /translation="MDKSFKISDEKIAFVCIHNKRRSVMAESFAKNLGLNAYSAGVEK
                     TEEIDEKIVEVMAELGLKVKERPETILELTKKIGNIDILVTMGCIGSCPIVPAKKYIA
                     WNIKDPAGKEIEVYRKIRDEIKIKVEELLKSEF"
     CDS             complement(517843..518304)
                     /codon_start=1
                     /locus_tag="MMKA1_05350"
                     /product="hypothetical protein"
                     /protein_id="BAP60652.1"
                     /transl_table=11
                     /translation="MAETPKCTCGNHGVMNKKEKIIFACSGASNVGELSNAAAVKLTK
                     EGFGNKACTVSLAIKTPSVMERVENAGEIVVIDGCPVSCAKRIADNSGVKVDQYVIIT
                     ELGINKISDMDILDEDITKTVSAVKDGKSVCLDRKREDHKGSGCNCGCESR"
     CDS             complement(518677..519015)
                     /codon_start=1
                     /locus_tag="MMKA1_05360"
                     /product="hypothetical protein"
                     /protein_id="BAP60653.1"
                     /transl_table=11
                     /translation="MLRRKNKKRFSKNEEDPMAGSANLVDAMLVLSVGFLVFLVMSWN
                     MQSVVFSDSTQEEKMEIMQAMKQVAEIKMAKEITDMPEITDGSGSGFMEMGTVYQDPN
                     TGRYIMIETD"
     CDS             complement(519009..519650)
                     /codon_start=1
                     /locus_tag="MMKA1_05370"
                     /product="hypothetical protein"
                     /protein_id="BAP60654.1"
                     /transl_table=11
                     /translation="MVAIPGSELLSTTLHIISQSLLLPVVAFLLLFMAYAVINFGEFM
                     AEYSSRVRVNSKDLKNMINTFSNKNAQEISSLISEMRLNRTHIEIIKELCEEECNDLK
                     MVESHARNLIEREELRLEKTLEKTDFVTRLGPTLGLMGTLIPMGPGLAALGAGDIHSL
                     ANAIIIAFDTTVVGLAAGGICYVISKVRRRWYEEQMSTLDVLMESVLEALKKC"
     CDS             complement(519650..520369)
                     /codon_start=1
                     /locus_tag="MMKA1_05380"
                     /product="hypothetical protein"
                     /protein_id="BAP60655.1"
                     /transl_table=11
                     /translation="MMDELWQLGLMSAIIIFGIKIGLSLGFSGLSKKVSGTIVLLYGL
                     GTLLLSKLASGYVDIIQTVIYEYNFVIFIVMSLMILYAGFHTIKEWKVNQKNSVASCS
                     LAMIAPCPCCFGAVIASIVLISPTLGISTFEIGKYASLILMITIGAVYLLSDAISRVL
                     RAPRPVLMGNFMIFAGFYFLISALVIPNIVAGMSIQMSPMQYPEFSSLTHVFAITFGL
                     LILGYVKNRKRMNFTDKMRSI"
     CDS             complement(520726..526956)
                     /codon_start=1
                     /EC_number="6.6.1.2"
                     /locus_tag="MMKA1_05390"
                     /product="magnesium chelatase"
                     /protein_id="BAP60656.1"
                     /transl_table=11
                     /translation="MRFKNIFLILLSVLMLSSLITSVSAEEIDYKFISNTTSDGTGNF
                     SFNDVPNGNYTLSGVIWSTAMGGMWLTNVQEIEIENGSPVGNLSMAMRSNSSNDAEAI
                     LRMLNRTGISGATVDKYGAPKTGVTLVLTDKNGDFVTNTTSDATGNFSIENLQNGNYT
                     LSGVIWSSAMGGMWLTNVQEIEIENGIPVGNLSMAMRKNDNNDAEAILRMLNRTGVSG
                     ATVDKYGAPKTGVTLVLTDKNGDFVTNTTSDATGNFSIENLQNGNYTLSGVIWSTAMG
                     GMWLTNVQEIEIENGSPVGNLSMAMRSNNSNDAEAILRMLNRTGVSGATVDKYGAPKT
                     GVTLVLTKKIIVSTEDEEVSEPVEVGLVAETWYKFISNTTSDGTGNFSFSNVPNGNYT
                     LSGVIWSTAMGGMWLTNVQEIEIENGTPVTNLSMAMRKNDNNDAEAILRMLNRTGVSG
                     ATVSKTGDPKVGTKLVLTDKNGDFVTNTTSDATGNFSFSNVPNGNYTLSGVIWSTAMG
                     GMWLTNVQEIEIENGIPVGNLSMAMRKNDNNDAEAILRMLNRTGISGATVDKYGAPKT
                     GVTLVLTDKNGDFVTNTTSDATGNFSIENLQNGNYTLSGVIWSSAMGGMWLTNVQEIE
                     IENGIPVGNLSMAMRKNDNNDAEAILRMLNRTGISGATVSKTGDPKVGTKLVLTKKMV
                     SYIPGEVSKLNVAIVTGYSNYEKQLSTSTDRINTDSNLNIVASYYTTSNLSADIDLSQ
                     MDIIYIVMVTQSAEPIENTIQDAIDNGAVVIGSNTYLPESNYSIPEEHADIESFKKYL
                     SEYWSGGASDDENFDNLIFYLAREYYNRTDLTVKEPTGLQKAIYHPNMTSTPIEFFTG
                     DAGEYFVWYSNRTDGHSFDENAPTVGIAFYTSYYPNEMDPIDKLIAGFESKGVNVIAC
                     YGDADNQLDGFFNYNNNTKVDAVISFLYRGTYFNMEELGVPVIDGVLNGYMNTSEWIE
                     TSNPLPVTNMLRIYRPESEGLIDPIMIGAEETVLEDNDIISKYMGHDTQIEWLINRTI
                     AQCNLGIDPENEKKVAIIYYNHEGGKNNIGASYLEVAPSIVNLLNAMDSDGYNINESI
                     IPNKTGLVDLMLLQGRNIGSWAPGELESLVETGEVELIPEETYISWFNELPEKRRNEV
                     VETWGEAPGELMVYEYSNGSKYIVIPKISMSDNVIVAPQPSRGWMDSYDTLYHDTELP
                     PNHQYIAFYLWLQKEFDADVMVNMGRHGTVEWLPGKEFCLLSDEWPALMVGGIPVVYP
                     YVMDGTGEGMQAKRRGNAVIIDHLIPPVISAGLYGNYSLLNSEIASYQTSVTESESLK
                     QAQFEEIVNLTFELGLENRVNMSLSENNGTIDEFLDELDDVLRDLRTLSMPYGLHVLG
                     EAPDDDELVGMVNSMLGSSYSEKVAAYNSSDSAANDLLTKVLLENITIDDAQMQVLGT
                     TSEDIETDLQLAITYSELLLEADDEIEQVLKAMNGEYIEPGLGGDPILRPETLPSGSN
                     FYAFDEQLVPTKQAWEEGKALVDEWLSQYYDENGEYPTKVAYILWAGESTRHQGIMEA
                     QILYMLGVKPVWNENNGKVTDVEIINSSELNRPRIDVVVQISGLYRDSFPMKVQLIDK
                     AVRLAYEEDEPDNYVRINTDELKDVLNEHLQNESLSLDIAQFRLFGPADGNYGTGMAN
                     AVSSSETWNDTDALAELYISRMSYIYGQNIWGQTISEYIELQTGQNVEINNTIIFENN
                     INDVSDIFHSRSSNTYGSLDTNDFFQYVGGLINAITYESGESPDAHVVNLQNADDQKI
                     ESLQTYLENELYSRYYNPTWITGMQESGFEGATEMEKFVENLWGWEALTSDIISDGMW
                     NKVYDTYVTDSELSAWLNENNPYAYQSMTARMLETARKGCWDASGETLKNLANEFIQS
                     VAEYGVTCCHHTCGNLELNDWALEHSSLDEKTLKEYEKLYEEATQEDIEVPSQENKDT
                     YTDSSSEPDSYSRVYSEEESKQEVLSNETVKTNTTTKEDSAASAGSDGADSNSGSSST
                     DSSDAPNSQKAYEIEVNEPENSGSSGTTMFAILGAVGMTGLIGFGYFRQNPNFLKFLR
                     RK"
     CDS             complement(527508..529787)
                     /codon_start=1
                     /locus_tag="MMKA1_05400"
                     /product="putative DEAD/DEAH box helicase"
                     /protein_id="BAP60657.1"
                     /transl_table=11
                     /translation="MVNLNNSKITNFLSKLSTDSIHKSNIELIKEIPPKNAEYTENNL
                     DLPDNFKEYLLKKDIKLYTHQYSALENVRNRKNILLTTSTASGKTLSFNLPILETLQN
                     DKDATALYIYPTKALTNDQLNNLKNLENELNITLKPEIYDGDTPNSKRKSIREKSRII
                     LTNPHELHQVLQYNPKWISFFKNLKYIVIDEAHTYRGIFGSNISFLIRRLRRICGDYG
                     SDPQFILASATLANAKEFSEKLVGLDFTVIDKDGSPKNKKYFVFYNTLKNEISESSWY
                     SAAINILELCMKYGLQTIGFTLSRKMAELITIWTKKSLGNNILSRKISSYRSGFTPEE
                     RRDIESRLKNGDLRALTSTNALEVGIDIGSLDSVIMYGYPGTLMSLWQQAGRAGRAGY
                     DSVVTLLSRESPLDQYIISHPETVFGKTTENAVIDLENPQIIVGQLLCAAAELPITLN
                     DKPYFGENIEEYLNQLSNCGLLEKTDRGWVYVNTVRASELVSLDSIFSSEFKVVDEKG
                     NLIEILDEMHAYPEAHVGAVLLHNSENYIIKEMDLESKVCTTVKKDVEYYTKARGSTN
                     VEIINELDRKDFGSFSIHFGEVIVSKTYIMYDVMKFGKRMSQELLNLPPITFQTTALW
                     YTFEDEFFNDFENLKEKDFGDGLHGTEHAMINIFPIHIMCDSHDIGGLSTNMHYGTRK
                     PSIFIYDGFEGGIGLSKKAYEMPEKIAKTALNLIKDCTCEEGCPACLYSPNCGNDNQN
                     LDKQYTLAILEKIVGIFEK"
     CDS             complement(529781..530875)
                     /codon_start=1
                     /locus_tag="MMKA1_05410"
                     /product="hypothetical protein"
                     /protein_id="BAP60658.1"
                     /transl_table=11
                     /translation="MKINLNLKDKISGIAQAFKKKSEDTTASKPVVDSVESTYGSNQV
                     FGSPFFDEERQRALELQSKLLKKYSGVHLDDYFKGRVIKSEYGSSYCIEDEFKCKIKR
                     NDIEKVKNCILSDLQLIRGIGEKTELSLKNSGYNTICDLTKHNRYGSCAKEILTSLEN
                     NGVSGLLDSIPNNYPKSHPTIMEASKMHKLEDFVFYDIETMGLFGSPIILFGMSFVAD
                     NKINTKQFLLRNINEEPSSLYHTISELKNRKALVTFNGKSFDMPFTQDRLGYYRMDNL
                     GIPQIHYDLLHFSRRAWGNNLENCKLQTIEKELLGESRKDDVPSSMVPEFYRNYLRSG
                     NIGPLVPIVEHNKIDVVTSAKILNLLWEEW"
     CDS             531126..532610
                     /codon_start=1
                     /locus_tag="MMKA1_05420"
                     /product="hypothetical protein"
                     /protein_id="BAP60659.1"
                     /transl_table=11
                     /translation="MAKYRCNVCNVFEYDESRGDSVTNIKPGTKIKDFPNNWKCPICG
                     SDNTHLIQIAETNISKKLKGTFECPECKSKSEIEISMPVKMDSSYLGEWKREYDDMEE
                     HMFDIHKISVTGESVIEPMRTKKPVISWESIFIKGAQLAKFPLNNDEEVITKTIIGTK
                     AKHPLIIETPIFITHMSYGALSKNVKIALSKGSAAVKTAMCSGEGGMLEESFENAYKY
                     ILEYVPNQYSITDENLKKVDAIEIKIGQSSKPGMGGHLPAEKVSEEIAKLRGFKAGQD
                     IVSPSKFHDINNKDDLKNKVSTLREKSGGKPIGIKIAAGDIEADLEVATYAKPDFITI
                     DGRPGATAASPKFIKDSTSIPTIFALYRAREFFNKNGITDISLVITGGLRISSDFAKA
                     IAIGADAIAIGTAALMATACQQYRICDTGECPVGVTTQKPELKDRLKIELSAKKLSNY
                     LRVSTEELKTFARLTGNKNIHDLSVDDLCTSDSEISNFTSIKHV"
     CDS             532865..533479
                     /codon_start=1
                     /locus_tag="MMKA1_05430"
                     /product="hypothetical protein"
                     /protein_id="BAP60660.1"
                     /transl_table=11
                     /translation="MNKLFLRIVTFTLGLFIMAFGVALSVKANLGISPISCVPYVYSL
                     KIPLTLGQLTIFFNLVLIMLQIVVLRRNYRLVYLAQLPAVFLLGLFIDMIMNVISNLY
                     ISSYVGQMALCIFSCIAIAFGVFLEVKAKIIYLPGEGLAMAISNTFKKEFGKTKIGVD
                     VSMVAVGILSSFIFLHQVQGIREGTIFAAVLVGSIVKVFNKTLL"
     CDS             complement(533612..534352)
                     /codon_start=1
                     /locus_tag="MMKA1_05440"
                     /product="putative transcriptional regulator ArsR"
                     /protein_id="BAP60661.1"
                     /transl_table=11
                     /translation="MENVSANSDDMKEIKEELSKLNIRLNQFIEKSNQQHVELVIDEI
                     KKKYSDVFYNDILNESKFCLENNMISDCELKSSCYETLLGILNNSAKNLKENKISQDK
                     IITIRKNLENLKEKLPYEKCSVCYSETVKLFEKQIDLMKNLGIYSENYEKNELNVSEK
                     EIITSLLEPISNKHRLLILKSLMAETKTFSDISKITGLKAGNLLFHLKKLQDSEMIMQ
                     RSDRGDYMITKRGIDVLNGILGIYGKVF"
     CDS             534647..535198
                     /codon_start=1
                     /locus_tag="MMKA1_05450"
                     /product="putative NADPH-dependent FMN reductase"
                     /protein_id="BAP60662.1"
                     /transl_table=11
                     /translation="MKVVAINGSPKKQGNTALLINKILDGAKSNGAEVIQYDIDKMNV
                     NGCKGCMHCRSEFKCAQKDDMSEILENLKEADVLVMGSPIYMWQVTGQAKIFLDRLYP
                     VVNADFSPRLSNIKTATVYVQANPDESAFAPYIENTNSMLNFLGLNVVESIVKGGVGA
                     PGDVLNHEDTLEQAFNIGKKLTE"
     CDS             complement(535345..536847)
                     /codon_start=1
                     /locus_tag="MMKA1_05460"
                     /product="hypothetical protein"
                     /protein_id="BAP60663.1"
                     /transl_table=11
                     /translation="MKKSALVIALIMVLAPLAFVPSAAAATDEEIEASIDAGVEWLAS
                     QQNETGYWGDCGDDLPAITGFALVKLVDRARELGVDPFNTSEYEYAENVILGFEWLES
                     QKNVQFGINDSQTNNNGQAIFFSWYDYHQTYNTAIALMAFANLNGYDEYNENLVQDMV
                     DWFVDTQNYDGAWRYGASGISDNSNTGYAVIGLAYAENAGAIIPDSLKTDLNSWIDYI
                     QNDTNGGSGYTTPDYWVNSLKTGNLILEMGFVGDDSESTRMGYAIDYLVAHWNDVGSG
                     TLMTGWKPHNYQAMYCIMKGLEYMQIEEIGGIEWFEEISDYIVENQHSDGYWDGDPWA
                     DYTETPKILSTEWALLTLEKATVIKEIPVGFDVKPASCPNPINIKSNGVQPMAIAGSE
                     EFDVYDIDPATLKIGICVDGEFTEFEGVAPLRWEYDDVTESYIPEEGEPCCIVTYPDG
                     ITDLSMKYDTQELVEAGLGDYEKNDELCLCIKGTTYDGEQFVGRDCIIIK"
     CDS             537311..538390
                     /codon_start=1
                     /locus_tag="MMKA1_05470"
                     /product="hypothetical protein"
                     /protein_id="BAP60664.1"
                     /transl_table=11
                     /translation="MKKFLVGFILFSMIVSVIPGAVIDDCDTTCICCTEWEPYGLYAG
                     QNELVGNVSVRVCGDNLEYKYEITEPGWCISEVHLNALTEMPEKDENNTWYAGKYMTK
                     SGNPKVGKFEVNEECLCTTEYSGSLKLDDFKPCWGDKLYIAAHAVVCRCDIEKKCVEA
                     EEGESWAVGFENYIMGDSTGNDENRYDPYRCLGVANVLSGDRENFTSLGRNGSIELFF
                     ENKICGDGDCSTPDLEVYEITYNQNTGWEELISVEAYYGGSYHPVGIALNANGSTAVK
                     DSFINYFNLSCECIEKIRITDMSTGASSSGQVFDYDIDGVRANYWCISEYTCTGECET
                     AWGNGASFPGNNWAMYFEYPSCMCD"
     CDS             538802..539107
                     /codon_start=1
                     /locus_tag="MMKA1_05480"
                     /product="hypothetical protein"
                     /protein_id="BAP60665.1"
                     /transl_table=11
                     /translation="MVIDNEKHQKIRENIKKLVTNVLNSDEEFKTLLGHAYANLTSKN
                     HKCTNKLLNRLKERYGVDLTGDVDNLRTNYVNKKSKVKTNDDLKNYTNNNAETKIDS"
     CDS             complement(539163..540194)
                     /codon_start=1
                     /gene="modC"
                     /locus_tag="MMKA1_05490"
                     /product="molybdenum ABC transporter ATP-binding protein"
                     /protein_id="BAP60666.1"
                     /transl_table=11
                     /translation="MLVIENLRKNLSNFELYIEKLEVKNSDYFVFLGLSGSGKTTILE
                     MIAGFIKPDSGKIMLNGVDITDKPINERKIVLCNGKYLFPHLTIQKNIEYGIKHLKKP
                     EKKEKVDNISKLLNITHLLNRKPERLSNGEQQRVALAMALVMEPEIILLDEPLSSLDR
                     LLHEKLMYDLKEVHKSSKVTFIHVTHDFSEAAVLSNKMAILRNGKIEHIGTLQNVLKH
                     PKNEFVAKFVGIKNILYGNCIEKDGNYIIQLLGFEIPVKEANYGEITLGIFPKDIIVS
                     KKSEKDSKIYAGKIKSIVPSGPFDSKAVIEFNNIELISEISNSDLLKNPLKKGDSVEF
                     YIDSISMIG"
     CDS             complement(540211..540924)
                     /codon_start=1
                     /locus_tag="MMKA1_05500"
                     /product="hypothetical protein"
                     /protein_id="BAP60667.1"
                     /transl_table=11
                     /translation="MIDFKSELEKIATENSLLDETIEIKPVNVNLESKTIDDYPLMQG
                     KEFLLRAFFKGDVGDAFTNNLVEFNGKLSEVIASGSNQMIIAALNSVMKNLKMVEKSE
                     HCIKGEPEVCAKELSEFLMEEYGKEIKIGVIGYHPAIIRQMVTTFGKDNVIATDMDLD
                     TIGRIRQGIVIMHGSMNEHLIENSDIVLSTGSTAANGSLEEILSYTKKYDKRIIFYGT
                     TVACAAKMLDLERFCALGK"
     CDS             complement(540911..541711)
                     /codon_start=1
                     /gene="modB"
                     /locus_tag="MMKA1_05510"
                     /product="molybdenum ABC transporter permease protein"
                     /protein_id="BAP60668.1"
                     /transl_table=11
                     /translation="MKNNDFLKFFSLFALSVFILFILMIVMSIVTNISFETFYDSLFS
                     KEIQFAIKLSLETASIATILGTLLGVPAAYALARYNFKGKDIVDSIVELPVILPPLIT
                     GFALLVFFGNTVFGKFITENIIEILFTYKGTIVAQFFVATPFIIRTSKSVFECIDEKY
                     ELIAQSLGSKKYESFLDIVIPMAKNGIIAGAILAWARSIGEFGATMMLAGATKMKTET
                     LPIAVFLNISLGDLEKALAVSLIFLLVATLVLVIIRSVLKIGENNDRL"
     CDS             complement(541725..542507)
                     /codon_start=1
                     /gene="modA"
                     /locus_tag="MMKA1_05520"
                     /product="molybdenum ABC transporter periplasmic-binding
                     protein"
                     /protein_id="BAP60669.1"
                     /transl_table=11
                     /translation="MKKLLLGIISILSLTLLFSGCVDNTGAEQQEVLHAYVGAGMQMP
                     MDEIAVEFEKKYGIKVEYDYSGSGALLSKIVASNQGDIFMPGDCSYVYQLEDKEMIKE
                     CSNVTKHIPVIAVQKGNPKNITGLSDLGQDDLELALGDESISLGKLFKKILAKAETKG
                     LNITKAVDTNTVVTGATVKQVLLYVTEKNVDAAVVWKADAYENPDRVDIVPIESEYNI
                     VKTVPISILSTTKNYENSKLFYDFVNNEGKEIFEKHGFVALE"
     CDS             543094..543669
                     /codon_start=1
                     /EC_number="1.2.99.5"
                     /gene="fmdE"
                     /locus_tag="MMKA1_05530"
                     /note="MM1_Con085_0013 and MM1_Con113_0015 are similar to
                     each other."
                     /product="molybdenum containing formylmethanofuran
                     dehydrogenase subunit E"
                     /protein_id="BAP60670.1"
                     /transl_table=11
                     /translation="MHKAQEILDLVEDPNLLSQFERVVEFHGFPTAGAFIGIQMYNLS
                     KELLKFSNDDRIYVVSETYNCLPDAFQILGNATTGNKGLRIEDPGKMAARINPWAPAG
                     DNIKGVRIILDPKKTVNYPLLHAWYMNTAKVSHKDAVSELLKAGNDVYSYEFIGVVAP
                     SKPKKKVELCEVCKEPFIQQNGEKKCLACSK"
     CDS             543710..545464
                     /codon_start=1
                     /EC_number="1.2.99.5"
                     /gene="fmdA"
                     /locus_tag="MMKA1_05540"
                     /product="molybdenum containing formylmethanofuran
                     dehydrogenase subunit A"
                     /protein_id="BAP60671.1"
                     /transl_table=11
                     /translation="MMTKMVIKGGTVYDPLNGIDGEVMDIFIKDGKIVENLSDGELKD
                     AKILDVKGKVVMPGGVDSHTHVAGPKVNTGRVMCPEDHYKSPLKKTHNTHCGSGEIVP
                     STYAQGYKYSSMGYTTLFEAAVPPMLARHTHEEFKVMPIVDKAGYLLLGSNWFVMKYL
                     KEGNVEKAAAYVAWALETTKTFGIKLVNPAGVESWAWGKNVHSLEEENIHFGISSGEV
                     IRGLGAVNEMLGLPMSIHLHANNLGHPGNWEFTIDTMDVAKNIKPAVNKRGYDNGVKT
                     KYSHEREQSLYMTHMQFHSFGGTSWKDFESKAEDISNYVNKSDHVVMDSGSVAFGKAI
                     CMTGDGPGLYDLAVMNGQKWANVDVELECGSGVVPFVYSMKNKVHSVQWAMGIELLLL
                     TDPRKVIMTTDNPNAGPFTKYPQLITWLMSKKAREDTMKLCHKWAGERSGLAGNDKEL
                     SLYDLATVTRATPAKAIGMGHRKGHLSPGADADITVYDISPDYNSSDYAAIEKAFTTA
                     LFTIKDGEVITKDGRIIETPKGRTYYVDAKFNEEIQKEIIADVQDWFRRYYSIGFSNY
                     PVPDLYLTKPTPLNINVR"
     CDS             545474..546721
                     /codon_start=1
                     /EC_number="1.2.99.5"
                     /gene="fmdC"
                     /locus_tag="MMKA1_05550"
                     /product="molybdenum containing formylmethanofuran
                     dehydrogenase subunit C"
                     /protein_id="BAP60672.1"
                     /transl_table=11
                     /translation="MGEIILKPKYNGTIPVECDVITPDTFEGKSKEEIGALKTFIGPE
                     EHLLSDIFEISGDFTSQKEDMVIKIAGDAGNVKLIGFQMTAGKIIVEGDAGFHVGCEM
                     KGGEILVKGDVKPWAGREMEGGTLHIFGNAGDHLGGCYRGRWEGMLGGTIIVEGDAGN
                     NVGDGMVDGKIVVNGNVRAFCGIRLNGGVLYVGGNAIRAVGVEMKKGTIVVAGKIKNF
                     APGFISTGVVSDYETGLSGLALPGKLIGFNGDQAFFNKPKGKLYVSLSENYDLLNDEL
                     PAKERPIEFKGNALKVILNTGSTIEQGRIIKGGNKYSHEYLDVCAVCNMHPEDYILLG
                     KPEKVKVSSENGKYSVLVRAEPNEDVLRRNVFIPRSVWANVIVDAYSVSTGSPIYKGG
                     TVYVEPSEGEILEAEYIIDNIYR"
     CDS             546727..548058
                     /codon_start=1
                     /EC_number="1.2.99.5"
                     /gene="fmdB"
                     /locus_tag="MMKA1_05560"
                     /product="molybdenum containing formylmethanofuran
                     dehydrogenase subunit B"
                     /protein_id="BAP60673.1"
                     /transl_table=11
                     /translation="MASQTFKDIVCPVCGGACDDIEIVWDEEKRDLTVRNACKLGAAK
                     FKEIISHHRIMSPQIRKNGVLVDVSWEEALEKAAEILANSKRPLLYMGAETSCEAMTT
                     GLHMGEYLGGIVDSCSTVCHGPSLMGVQEAGKADATAGETKNRADVVIYWGTNPMDSM
                     PRHLSRYGVFPRGYFVEKGRNSRTVITIDPRKSATAKASDIHLQLNPSTDYELFSAFM
                     MASRGKRPHPSIEKVTGIPVDTIMETVELIKNAKFASIYGGLGLASSFGKQRNIECVM
                     TLVKELQRYTKVTIGLIRGHCNVAGFNVLASYLYGFPFGLDFAKGYPRYNPGEFTAND
                     VLREKEVDCAFIMASDVGAHYPQDSVSHLKNIPVITLDIAPCPSTSVADVVLPGVIDA
                     LECDGTFYRFDEIPIYYKPFAKSPFDFTKSNEDTMEQLFELVKEIKERNGQ"
     CDS             548176..549513
                     /codon_start=1
                     /EC_number="1.2.99.5"
                     /gene="fmdB"
                     /locus_tag="MMKA1_05570"
                     /product="molybdenum containing formylmethanofuran
                     dehydrogenase subunit B"
                     /protein_id="BAP60674.1"
                     /transl_table=11
                     /translation="MVAETFKDIVCPVCGGTCDDIEVEYDKEKRDIVVRNACKMGAAK
                     FREIVSNHRITSPKIRINGKLEDSKWEDAIEKAAEILVNAKRPLFFMGSETSCEAMTV
                     GLHMGEYLGGIVDSNSTICHGPSLMGVQEAGKAGATAGETKNRADVVIYWGVNPMCSM
                     PRHMSRYAVFPRGYFVQKGRKERKVITVDPRVSETAKGSDIHLQLKPSTDYELFSALM
                     LAVKGKPIHPSIEQVTGISVEKILEVAQIMKNAKFGSIYGGLGLASSFGKHRNLECVL
                     TLNKELQKYTKFQIGLIRGHCNVAGFNVLASYLYGFPFGVDFSRGYPRYNPGEHTTTD
                     VLREKEVDAVFVMCADLGAHLAQDSVRYMHDIPVICLDIAPCPSTSVANVVLPGVIDA
                     LECDGTFYRFDEIPIYYKPFTQSPFDFTKSNEDTMKQLFEKVKELKELKKNRK"
     CDS             complement(549590..550711)
                     /codon_start=1
                     /gene="moeA"
                     /locus_tag="MMKA1_05580"
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="BAP60675.1"
                     /transl_table=11
                     /translation="MISVPEAENILKKFKFEKTENVDLFNSYGRIIARDIVSKQNIPD
                     FRKSNMDGYAVTSPCLESYVLIDEVHAGDFRDLKIKGNECVWVATGGKVPEEAHCVIP
                     VENTLIENKIMGIIEIPDNTYVVEKGSDISNGDLVLKKGSLINERNIGLIASLGISEL
                     KVYKTPKVAIISTGDELEKISDVNSKSIAGIVKKAGCEPVFLGISKDDKTELRNKLIE
                     ALNYDVIVTSGGVSAGKRDFTSEIIEELGTVLFHGVMMRPGKPVLGGEIDGIPIICMP
                     GKVTSCIICSYLFLYPLLCRYSNSKKCKKIVNAKIMGEFKKEADKRFYLPVVYDNGFV
                     KPVFKDSSHITSIAYSNAIVELKEGISVADGEVEVWIYD"
     CDS             550950..551726
                     /codon_start=1
                     /gene="modA"
                     /locus_tag="MMKA1_05590"
                     /product="molybdenum ABC transporter periplasmic-binding
                     protein"
                     /protein_id="BAP60676.1"
                     /transl_table=11
                     /translation="MKKQIAIAGLLAIILLFSGCVSESPEETTTTITVSAASSLTDAM
                     NDIAAAFEKDNPNVKVELNYAASGALRQQIEGGAPVDVFASASQKHVDLLQGQNLIEN
                     ASRVTFAKNSLVLIVQAGNPLGIASADDLTNENVVKVSIGNPETAPVGRYAKESLETM
                     GLWGNLEGKTVYGENVRQVLTYLETGDVDAGFVYMTDAKIAKDNTIEVITTIPTVTEI
                     SYPVCVLKASEHNDEAQMFVNYLTGETGKQILTDYGFTAE"
     CDS             551737..552402
                     /codon_start=1
                     /gene="modB"
                     /locus_tag="MMKA1_05600"
                     /product="molybdenum ABC transporter permease protein"
                     /protein_id="BAP60677.1"
                     /transl_table=11
                     /translation="MDSILFPVLLTLKISFLSTFFVFFIGIFISYILAKVEFRGRNML
                     EIIVTLPMVLPPTVLGYLLALQLGKNGVIGSLFYKLTGSGILFTWEAGVIASFVVSLP
                     LMVKTTTAAISAVDKELEHVSYTLGNTKLGTALLITLPLSKKGIIAGMVLSFARSVGE
                     FGATLMVAGNMPGKTNTMSLSIYQAFQTGQYDLANILVITLILMSFLSIYITGKMADK
                     LNS"
     CDS             552526..553377
                     /codon_start=1
                     /EC_number="2.4.2.-"
                     /EC_number="2.4.2.19"
                     /gene="modD"
                     /locus_tag="MMKA1_05610"
                     /note="protein synonym:putative molybdenum utilization
                     protein ModD"
                     /product="putative pyrophosphorylase"
                     /protein_id="BAP60678.1"
                     /transl_table=11
                     /translation="MSFYIPDYELEKIIEEDINPLDLTSQIMKLDRFNAKLAYKARHD
                     MVLCCTEEAERICKILGLEVISYKRTGSYVKEGEVFFEAKGRADNVHLAWKSVLRLLE
                     GYCGMATRTYEFVTLARKYNENINVVTTRKNLAGTKKPTIKAIVAGGAYPHRLGLSET
                     ILIFDEHLAFVDGDEELKYVLKEMKANALEKKIGIEVDNFETGIKYVKMGFDYIQLDK
                     CDSKTVEKFVKAAKEINPNITIVAAGGITIQNIEEYAKTGVEVIVTSALYFGKAADIK
                     TIIEKID"
     CDS             complement(553405..553935)
                     /codon_start=1
                     /locus_tag="MMKA1_05620"
                     /product="beta-lactamase like-protein"
                     /protein_id="BAP60679.1"
                     /transl_table=11
                     /translation="MLDLVYKGILKFNEEKTKILEVASSVTFIETKKNKIVVDTSAKS
                     KTEDLKIYFKNKKINMDEINYLINTHDHFDHVSNNDLFKNAKIINQSNFKELNDPEIE
                     IMETPGHTFDSISVIYGDYLISGDASPLKNNILKERAPGVFVDLELALNSIRKIKSLD
                     KNIVTGHDGILYKNEY"
     CDS             complement(554016..554285)
                     /codon_start=1
                     /locus_tag="MMKA1_05630"
                     /product="hypothetical protein"
                     /protein_id="BAP60680.1"
                     /transl_table=11
                     /translation="MENRTLPIGKADDFFEVFVVDLMITRECDCAFKIDIFEDGHFIE
                     KEGDKLKRVESSIHRGSLIITPKNAKKMLNALKKAIEITTEEYGK"
     CDS             complement(554382..554759)
                     /codon_start=1
                     /locus_tag="MMKA1_05640"
                     /product="hypothetical protein"
                     /protein_id="BAP60681.1"
                     /transl_table=11
                     /translation="MNYLKCGFFGLLTWLVPFFLSFLFYSETTGLLIDIFLFKFIMIV
                     VSGLIGVSLLIMYFKDIKKDYLVEGIFVGVSWLIINLILDILILIPMSGMTYLTYFSQ
                     IGLRYLIIPTISISMGLLLKLKL"
     CDS             complement(554775..557351)
                     /codon_start=1
                     /EC_number="3.6.1.-"
                     /EC_number="3.6.3.8"
                     /locus_tag="MMKA1_05650"
                     /note="protein synonym:ATPase, E1-E2 type"
                     /note="protein synonym:ATPase, P-type"
                     /product="cation transport ATPase"
                     /protein_id="BAP60682.1"
                     /transl_table=11
                     /translation="MTFFKGFKEDYFGLTDLEVKQYRETYGKNELLQKKKKTLLSRIL
                     KILTEPMFVLLFIAAFIYFFLGEPRDGSIMVISVIFICAIEFFQEWRTDRTLQALKEL
                     SSPKSTVIRNGKMMTIDSTELTVNDLLVLKEGEKIAADGIIVENYGLGVNESTLTGES
                     DVVWKKIDLKEDETLEHWKKNICYAGTSVTQGRAVVKVIHIGSETEYGKIGKDIFSAE
                     SMPTPLEKQTEKLVKYSAIAAFFMLLLIVLVNFYYMGSVTDSILSGVTVAMAIIPEEF
                     PVILTVFLAMGAWRLANKNSLIRRIPAVETLGSISLLCVDKTGTLTKNQMEVKETYFD
                     SEFNETELMTYACLASETEAYDPMEKAIMIYSKSIRINIDELCTGCLLHEYPFSSETR
                     MMGNVWNKDNKKFIALKGSFENIINLCDLKESEKVNLEKKSIEMAKKGYRVIAVAKKM
                     DVVNINQHLNEYTFEFVGLIGLMDPPREGVSKAMKICNNAGIRVVMLTGDNGTTAKSI
                     AKTIGLKNSENVLTGNEIDSMGDEELLEKIKVTNIFSRVIPKHKLRIIKAFKELGEIV
                     AMTGDGVNDAPALKYADIGVAMGKRGTEVAKEASDMILLDDNFETIVETIHDGRRIYD
                     NIKKAIGYVFVIHIPVFLTALFAPLLKLPLLQKPRTSFQQTYLALFAPLLKLPLLLLP
                     INVVLMEFIIDPTCSIVFERQPAEKNIMLRKPRMPNEPLLDYSLIFKAIIQGVTIFAF
                     AFGSYVYLLYQGLEVNTARTFAFVILIAANFFLVYVNQSEIESVFSAFKKFKNDMLLW
                     LVNIGIFGGILIMLYVPSATEIAKTVPLTEKQLISAILISGVSTLWWEVIKLLKRIKM
                     KK"
     CDS             complement(557453..558700)
                     /codon_start=1
                     /locus_tag="MMKA1_05660"
                     /product="hypothetical protein"
                     /protein_id="BAP60683.1"
                     /transl_table=11
                     /translation="MKPLKLFNMASKMVKGSKLRSWITILGIVIGIASVIAIISAGDY
                     LSTSVSDQLNDMLSDEITLTASAAQGSDDDEDPELTDMDVLILNGISDIEYVDVRVST
                     RNEVRFAGGRETATITGVDPAVWSQMTDEELSAGRFLQASDSNAVIISYYTATEAFDR
                     EIGINQMITIGNKQFKVVGILEEDETQGFGQMGGMSSNTIYMPYEAVYTLELDDDASY
                     SISEKEEGVYDEIIFTLYEDVNQTTALENIQKKLMMSRHVNEDNMDFTIRSPTVFEGP
                     EQIISMLTTFLSFIAGISLIVGVTGISNTMFTTVLEKTREIGIMKAIGAKNKDIMLLF
                     VFNSAIIGLVGGFLGLVLGTILSQIIVWFIAQSMDSSYQFVLSIKSVVIAIGCSLAAG
                     IIAGIIPAYNASKLKPVEALRSE"
     CDS             complement(558723..560024)
                     /codon_start=1
                     /locus_tag="MMKA1_05670"
                     /product="hypothetical protein"
                     /protein_id="BAP60684.1"
                     /transl_table=11
                     /translation="MYKKSLKIGSVMLIMLFSIMGNYAYTFEEDVSDYVILEINKVNQ
                     DPDPAIAGDVFDLRIRIQNDGGNGEGDFIVEVEPSYPFEEVEGEDLIQDIGIINGYED
                     GNDAIIAKFKLRVSKDATEGDYPIEVHIYKKGEDASSGYTKEITVTVGNEESAEVSLD
                     ADELVAGDKTNITFTIENTGSAPIKNLEFSWESENNAILPLGSGNLKTISYIGVGSSV
                     DVTYTVLASTDVDPGIYELTMDLTYDDSLNNTKEEVEHLAGILVLGKTDFEVSYSGED
                     SGEYTLTVMNVGKSDVNSVIVSIPEQDAWSVSGVSTSIIGNLDGGDYTFSNFELSTTQ
                     SDSPLIVEITYTSPEGDRVTIQKEVEMPSETTVVSMSSDDSNAPQDFASGPGGNRNPL
                     STIQNSITSAIPYVIGGLVALAAIAVFVYRIIKRKKLAKQK"
     CDS             complement(560029..560733)
                     /codon_start=1
                     /locus_tag="MMKA1_05680"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAP60685.1"
                     /transl_table=11
                     /translation="MYKIISLEDVWKIYQMGEVEVQALKGVSLDVNKGDFVAIVGSSG
                     SGKSTMMNMIGCLDVPTKGDVYLKSKNISNMTESELSELRGKTIGFVFQQYNLIPNMT
                     ALENVLLPLQIQEVNDSTAERSAERALKQVGLEDRMNNKPSQLSGGQQQRVSIARALA
                     CDPEIILADEPTGALDSATGKEIINLFTALWESGKTIIMITHDQKLAKYAKTIVELKD
                     GKIINIIDNRPNAVHE"
     CDS             complement(560928..561503)
                     /codon_start=1
                     /locus_tag="MMKA1_05690"
                     /product="hypothetical protein"
                     /protein_id="BAP60686.1"
                     /transl_table=11
                     /translation="MRKIILGILMVLGLVSISFAASEFKDMGKEGPGIVCPIDFQNMT
                     TEEIQEQLQLRLAGLEDEYASCEDEQLRTRIQERIEMTQSLIDDPEKLEEMITNIPEG
                     MPERKGNGFKIDFQNMTTEEIQEQLQLRLAGLEDEYASCEDEQLRTRIQERIEMTQSL
                     IDDPEKLEEMISNMPEDMPERKGECQKANFE"
     CDS             complement(561544..562005)
                     /codon_start=1
                     /locus_tag="MMKA1_05700"
                     /product="hypothetical protein"
                     /protein_id="BAP60687.1"
                     /transl_table=11
                     /translation="MNKNLKKTTGAILMVITLVPYCMAMDEQTSENSSGIFNNILSWL
                     KSALGTNNQIEPETVEFENNSSKNLPMMPELNNSEMNNSTPEIINNTPENITNKTRNT
                     PNNMPENFNEYVPEQRNMSGMPENVNNTKYPPQIPENFENNTPIEINSNNE"
     CDS             562511..563236
                     /codon_start=1
                     /locus_tag="MMKA1_05710"
                     /product="hypothetical protein"
                     /protein_id="BAP60688.1"
                     /transl_table=11
                     /translation="MVGIMKRILIIFLVLTIIGIAIGVMQPFDSVLVEDDIFIAHGFE
                     DKPNTTEFNPYPQGNPALSDDQNRAIEIAVSNETVLGYLSEGYWLAPGTMLLKEDFEG
                     YGENFKGVLLAKNETVIYVIVNVKENKVKMIQNYTTFEFKAKTMVVEQNDEYSEIKAT
                     GFTDNDVKTVREILSNDQKTAQIIKNKNYNITIQDMVYLSNKNIQNATYAMVLLDIED
                     GSKYVVMVDITERKVFKMGRPVN"
     CDS             563250..563870
                     /codon_start=1
                     /locus_tag="MMKA1_05720"
                     /product="hypothetical protein"
                     /protein_id="BAP60689.1"
                     /transl_table=11
                     /translation="MSSKVKIAIYMLIFIVSVIVLTSKFLYPPTVQVIVQGDTTYVQE
                     VPNVYTLYDCMLMVLASFSLCLSTTLIYFTVRDLELSEKNNVNKIDLSDLNEHIGKIV
                     SSKVDDKINGNTDEISNFEVENELKTTENEEKLRMDNFIKILKGNEKTIVKILMDHGE
                     MTQSELFERTKIPKSTLSRTLSDLEVRGIVLRYEHGISKKVKLNKL"
     CDS             complement(563872..564093)
                     /codon_start=1
                     /locus_tag="MMKA1_05730"
                     /product="hypothetical protein"
                     /protein_id="BAP60690.1"
                     /transl_table=11
                     /translation="MLKKLYSKKGQVSMEIGILVASAVAVSAIASYFYAVNVKYSDTH
                     AGETAKNTSNALINVTENVCGNISEITIP"
     CDS             complement(564515..566173)
                     /codon_start=1
                     /locus_tag="MMKA1_05740"
                     /product="sulphate transporter"
                     /protein_id="BAP60691.1"
                     /transl_table=11
                     /translation="MKINNNLNYENLKNDLFAGFTIAIVALPLAMAFAIASGVSPEKG
                     LFTAIIAGFLISVFGGSKYQIGGPTGAFVVILYGIIASYGYEGLVIATLMAGVILIIM
                     GLLKLGNIIKFIPYPVTMGFTSGIALIIFSTQVKDFFGLSITNVPASFLGQWITYATN
                     IQLLNPYALLISILSLFILTNSKKVFSKIPSPIIAIAVGIFLVYAFNLPVETIESKFG
                     QIPNSIPFPSLPELNFQKMELLFPSALSIAFLGAIESLMCAVVADGMTGYKHNSNKEL
                     IGQGIANIGSVFFGGIPATGALARTATNIKAGATSRLSGIIHSVMLFLFMLLLSPLIL
                     KIPLATLSAILVVVAWNMAEVKHFKSILFKSPKRDRIVLLVTFLLTIFVNLNTAIQIG
                     MLLAVIVFMQRLIEVSEISNLKTIPQEEDPYSITLKDVPPCIEVYEINGPFFFGIADK
                     FKSTLNVVAKRKPSAIILRMRNVPIIDSTGIKNLEEFIEYSKIQNISLIISGADYKLR
                     AKFEKYGLTDKIGNENICENIDLALVRAKEIIKIKHPETGLCPK"
     CDS             566405..567022
                     /codon_start=1
                     /locus_tag="MMKA1_05750"
                     /product="hypothetical protein"
                     /protein_id="BAP60692.1"
                     /transl_table=11
                     /translation="MNALDKLYRAYYTKSENKLYFSELKELTGLSNSSLQNALKKLES
                     EKQILKLKEKSNAYYILKNTKKTVFKFSEIDDERFWKLHRNVRAPILDFLENLPKEID
                     FMILFGSASRKKETEGSDIDLMVVIHSFEDPDLQKRYREEINQKLEYAKAKAECRSIY
                     PLSIVAVEIDYFLNSNDHMVEQAKLTGFPVFGHQNYHEVILNVKR"
     CDS             567009..567518
                     /codon_start=1
                     /locus_tag="MMKA1_05760"
                     /product="hypothetical protein"
                     /protein_id="BAP60693.1"
                     /transl_table=11
                     /translation="MLNVEEYFKNKEKLEGAYDFHTYKKNLEKERHAKSLVYAHLDKA
                     KHNLAFVNQNIKSGNFQDWSIVGLYYAVYHAALALVAKKGFISRSHNATMIFLIKNYT
                     NEFRDEELQLIDDLAITKKDATFYTDLKSERQKASYSTDAMFNESKVLELQKKSIDFV
                     NKVEDIIED"
     CDS             567676..569145
                     /codon_start=1
                     /locus_tag="MMKA1_05770"
                     /product="hypothetical protein"
                     /protein_id="BAP60694.1"
                     /transl_table=11
                     /translation="MGLWSKIKDTSLNIATVGLYGLGKKIGNAASTAEEAAAEAAIAL
                     ASIGITVQEVGEQLESLLYETEKLIVIKRLIPRETDDLWDEEKERLEELQAELSEIEE
                     KMQNLGVDSSDYNFGSNFSDFFNFDRIHEIMDLVLRRYRLKKEIYEILYTEPGIISES
                     IYNINESIERFNTLEQPRIENIMDYVDENLLKTEELLKEVKKLFVINKKEEELKLKLP
                     WYNYKIEKLKSDKEYFSERFGKKELQIQKFEERLKPNFEIDIEVVNPPDVILETDTQK
                     EDLINLNEKAIEKTEILKNINVQKTSKNNVATQNVPKVISASTYENVVNLGKKFSIDL
                     NSFKTNSDVSRVKSCTRSKEETIQRAKNLLKSQKDYFEREMYRLDRIVELNNIKTENE
                     PGVIPKTLDEVYEILKGVREEEQPRIDKLLDSLNDTLYETKSTISEVKTTIEPIQGLI
                     DSFSGLEKPLKIGLILFGALLVLDLLAAFIVLVKIAIWG"
     CDS             569266..569835
                     /codon_start=1
                     /locus_tag="MMKA1_05780"
                     /product="hypothetical protein"
                     /protein_id="BAP60695.1"
                     /transl_table=11
                     /translation="MWEKDRIYADSKRKIHESFPKIIVNLAVAFIIWLLAILVFQPLG
                     DFLGNPFIFGLIGMKAIISGVVIIALIIILLKILKNILMLTDGISDMVAVKFMKDDLN
                     EEKLQHYRSGFRGLGYVLLAIIAYMFFLPLLAGIFAALAGIVLVLLIIWAIFVVIRVG
                     NIFSEDIERKAAEITKKFEKTENKESEEE"
     CDS             569842..570072
                     /codon_start=1
                     /locus_tag="MMKA1_05790"
                     /product="hypothetical protein"
                     /protein_id="BAP60696.1"
                     /transl_table=11
                     /translation="MKKEINIILLLILWIVLAFSVGLNPEILSFLTNYISYGINDIAA
                     IFVILMVILSIITAWGLIWSINKSLKEYSKDF"
     CDS             complement(570077..571159)
                     /codon_start=1
                     /locus_tag="MMKA1_05800"
                     /note="protein synonym:putative MscS mechanosensitive ion
                     channel"
                     /product="putative small-conductance mechanosensitive
                     channel"
                     /protein_id="BAP60697.1"
                     /transl_table=11
                     /translation="MIPELLEYLQNSFFYGLSYYSGLKLILVVVIGLFVSYFIEKRVK
                     KISETTKQTWILNEETAGLISTFVLAIFVVLALNVIESFVTYQLFGFDLKILTYSLLI
                     IYFTYRISNRSKRYLLLKGSQEGKFAEYRLKATVFHYSAMIIAFGIVFQMLGLTSKLG
                     TLLVAGGITGIILGFASQTVVANFISGIFLYFDNPLKIGDSVQIGTNSGIVNDIKMMS
                     TRIRTWDGVLVRIPNEKVFNSEIVNNKKYPARRVDIVVGIAYKEDAQRAMDIISKILE
                     NMTYVLVEPEFQIFVNDLGNSSVDISVKAWTPSEKWYDVKMELVKNIKKEFDREKVEI
                     PFPQRTVWFPQDLKIKIEKETGEKSE"
     CDS             complement(571160..571798)
                     /codon_start=1
                     /locus_tag="MMKA1_05810"
                     /product="hypothetical protein"
                     /protein_id="BAP60698.1"
                     /transl_table=11
                     /translation="MFGYRPLIPEKFQIENQEIEIEEKDGMLRYTRGNTSKLIKKSSY
                     SLKIVPRPAFGYGVHYLTINFKEPVIVPPKDTFRGYVESPCDIELKLGDMELDVIKLG
                     KEKYTIYGTVDIGDISRYHLSEVYTKEPDSPCVTKFILSNGSNYWKTFEKLVFPIWET
                     IMYYSEDKAYYPTIINITKNGTVELLNTAKTPKNGLNGTKNVTPVSNFLRRI"
     CDS             complement(571949..572362)
                     /codon_start=1
                     /locus_tag="MMKA1_05820"
                     /product="hypothetical protein"
                     /protein_id="BAP60699.1"
                     /transl_table=11
                     /translation="METKYVVIIQCEMAKNRCSGMRCTNAFYEKTDAFKNYAKDTKYI
                     SFTCGGCSGKLVSSKLANFSRWLKKYDGIEKDEVTIHLSSCMSTDNSHYDRCPNIDYI
                     KQIINKKGYKNIVEGSIFSKKSEKLREDGIYKKYQ"
     CDS             complement(572386..573456)
                     /codon_start=1
                     /locus_tag="MMKA1_05830"
                     /product="putative endonuclease III"
                     /protein_id="BAP60700.1"
                     /transl_table=11
                     /translation="MNDFDTKFIEFLDILDEKLKKDAVVDKISKNSDKNERAFKILIS
                     TVISARTKDETTAKVSKELFKKVKNPKDLVQIPIDELEKLVHPAGFYKTKAKNLKKLG
                     EILIDKYNSNVPNSIEDLVTLPGVGRKTANLVMTLAFDDYAICVDTHVHRITNRWNYA
                     DTESPESTEMELRKKLPKNYWKKINNLLVVFGQETCSPIPKCDRCFSEIKKICPHYNS
                     LKEIEKIYADFNFKKTPKTKIPKDKGTYVLRIKMNSPKTILVGKREIKFKKGDYFYIG
                     SAMGDSMNLYNRISRHLSDSKKKRWHIDYLLEFSNVKEVNVTLGRFECDVSQRFNLVL
                     DSIESFGCSDCKCKSHLYYIKP"
     CDS             573551..574162
                     /codon_start=1
                     /locus_tag="MMKA1_05840"
                     /product="hypothetical protein"
                     /protein_id="BAP60701.1"
                     /transl_table=11
                     /translation="MFNLIIKELGEHMPFTALGAIFGMVLLIIFNGISFNESYSIFYT
                     LHPIHVFLSAFTTTSMYLLHKKGGIGGYKGFITLFLIGYVGSLFIATISDSLIPYIGE
                     IILDLPNRGAHIGFIEEFWLVNLLAIFGIVLAYFKPFTKIPHSGHVFLSTAASLFHII
                     MALGTGLSFLMYFEIFVFLFIAVWIPCCTSDIIFPLIFVKEKD"
     CDS             574326..574616
                     /codon_start=1
                     /locus_tag="MMKA1_05850"
                     /product="hypothetical protein"
                     /protein_id="BAP60702.1"
                     /transl_table=11
                     /translation="MPYSDKEYSKIQKNIKHIIVTGRSSDDEFKNLLGLIYASIKLKN
                     QKCTTKMLDTLKNKYNLDLIGDIDKFRIYYYKKSPNIKTEEDLKEYIRNNRK"
     CDS             574797..575789
                     /codon_start=1
                     /EC_number="1.1.1.85"
                     /gene="leuB"
                     /locus_tag="MMKA1_05860"
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="BAP60703.1"
                     /transl_table=11
                     /translation="MHKICVIEGDGIGKEVVPAAVEVLKATGVEFEFNHALAGDEVFE
                     KTGVALPEETIAAAKAADAILFGAAGETAADVIVKLRKILDTYANIRPVKSYNGINCL
                     KTGIDYIIVRENTEGLYKGIEAEIADGVTVATRVITKDASERIFKHAFEMAKDRKKQG
                     TAGKVTCAHKANVLKITDGLFKKTFYEVSNDYKDIQTEDFYVDAMNMFIISRPESFDI
                     VVTSNLFGDILSDGAVGMVGGLGMAPSGNVGDKYGLFEPIHGSAPDIAGKGLANPTAT
                     ILTAVMMLRYLKENEAAEKVEKALEEVLSLGLTTPDLGGTLSTSEMGQEVAKRV"
     CDS             575887..576627
                     /codon_start=1
                     /EC_number="6.3.2.6"
                     /gene="purC"
                     /locus_tag="MMKA1_05870"
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="BAP60704.1"
                     /transl_table=11
                     /translation="MSEYDISKILANEPIYAGKAKSIYKIEENEKEVLVEFRDDITAG
                     NGAKHDVKSGKGYLNTLISTELFNVLEKNNVPTHLIEYIEPNIMIAKNVKIIPLEVIV
                     RNIAAGSLCKKYPFEQGQVLKTAVTQYDYKNDDYGDPMLNNEIAIELGLATEEELVEI
                     KKLALKVNDVLKGFFDEKGIILVDFKIEVGKTADGQIVVADEISPDTMRLWDKETKDV
                     LDKDVFRKDLGDVLEKYKIVAERIGCLK"
     CDS             576664..577305
                     /codon_start=1
                     /EC_number="3.1.3.3"
                     /gene="serB"
                     /locus_tag="MMKA1_05880"
                     /product="phosphoserine phosphatase"
                     /protein_id="BAP60705.1"
                     /transl_table=11
                     /translation="MTDNLVKKLILFDLDSTLADCEVIDEIAKFAGVESEIKKITNEA
                     MKGNINFEESLRRRVKLLKGIPVEKLNKFAETIPVMNGAPELILELKKQGYVTAVVSG
                     GFDFGAEHVKKVLGLDYSYANTLLSENGILTGEVIGPVMSETAKGDILEKIAANENIS
                     LKNTVVVGDGANDISMFEKAGFKIAFCAKEILRSKADICIDKKDLKEILNHIN"
     CDS             577431..578033
                     /codon_start=1
                     /locus_tag="MMKA1_05890"
                     /product="hypothetical protein"
                     /protein_id="BAP60706.1"
                     /transl_table=11
                     /translation="MDYNTIKIKLDEINTQIKELYENAKELKEIRDRANDDVKKYKDL
                     REDININVKDQIEEIRLLKQKRADMLAEFKSMKISKSYLAQKIEQLETTLETKPMSMD
                     QEKDMIREIESHRKLYERAVELEDLNETIKTMSDGISVLVNQSSEEHKKVLENARVSA
                     EKHQELLRTYAEINDLKAKATELYDKLKEMKIKEIVEEEL"
     CDS             578067..578582
                     /codon_start=1
                     /locus_tag="MMKA1_05900"
                     /product="hypothetical protein"
                     /protein_id="BAP60707.1"
                     /transl_table=11
                     /translation="MDDRYLKPYIVIGDLSKIHGLKNEEKILLGTDGSITNLLEILFG
                     EEVVVETLYQEIIDNVNYRAVLLGVNGIPLIYATSETPLNLIDEIHIREKIKKDLLSA
                     DIPIGKILKIHNLETRREIVEIAVKEVPDVVKNKLNPKRIKIPQRTYNIIHKNKVLMT
                     ITEMFNLEDHL"
     CDS             578597..579607
                     /codon_start=1
                     /locus_tag="MMKA1_05910"
                     /product="hypothetical protein"
                     /protein_id="BAP60708.1"
                     /transl_table=11
                     /translation="MLKEALFYENLENCKVKCNLCPKHCVISSGRRGICGGRENIDCK
                     LYAVNYGKICATAVDPIEKKPLFNYKPGTSVFSIATAGCNFRCKHCQNWEISQSLPED
                     VPFSELTPEDVVDLAKNYLCEGIAYTYTEPTIFYEFMQETAKIAKNNDLFNVMVTNGY
                     IEKEPLKKLSIDAMNIDIKGNSEFYKKICFAELEPVLETCILAKKLGIHVEITNLIVP
                     TYNDNQKDIEFIINFVKDELGVDTPLHFTAFYPHYKLTSVPSTSIDVIKKARDMALNA
                     GLNYVYAGNVPFSAGYDTYCPDCKSIVVDRFGYQKPKLHLDTSSKTPKCQKCGRKIDM
                     IL"
     CDS             579634..581484
                     /codon_start=1
                     /gene="moeA"
                     /locus_tag="MMKA1_05920"
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="BAP60709.1"
                     /transl_table=11
                     /translation="MRYLELCTIDHAKEVVRTLLNELSTEEVNLFELPGKMLAEDIVS
                     SVDVPPFDRSRMDGYAVRAKDTYEAEEDKPVTLEIIDKIRAGGNSDLEIAPGQCMEIA
                     TGAPLPKGADAVVMVEFAEIEGNSVKLYKAVSPHENIQPCGNDIMVGELIMRKNTVIS
                     PRDIGAISAVGKNKLKVFKNPSIGLLSTGNELISPDDKLELYKIYDVNTYTIASSILE
                     KGWNFNFYGIVQDNKEDLMEKLKKAMNEDVILLSGGTSAGVGDLTSTAIEELGGEILV
                     HGIKIKPGKPTIIGKIGKKLVVGLPGYPTSCLTIFDVLFNEKGKTMRAQVYNRYMSAK
                     GREEYLPVSIIRGNDGYGAYPVLKGSEAITSLTYADGYIIIPENKEIVEDEIFDVHMF
                     GDIRIGLNIIGSHCVGIDRILRKGHILARTVNTGSLGGIMAVKRKEADIAGIHLLDNN
                     GEYNVSYLKKYNVSDAVLVRGYIREQGFMFKKELGIKSIDDLIEKIRDYRIINRNKGS
                     GTRILFDKFLKENSVDKNSIDGYDIEAKTHSAVGAAVSMGKAQIGLGISTISDHYGLE
                     FIPIADEYYDLLIPKEKLYDEDIIKFIETLKKEELPFKKSKDTGKIIYEC"
     CDS             581701..582312
                     /codon_start=1
                     /locus_tag="MMKA1_05930"
                     /product="hypothetical protein"
                     /protein_id="BAP60710.1"
                     /transl_table=11
                     /translation="MKLTLEEGTSLVGYVRNVIKQYLKGEEPDIQKYPDKFNNVFGVF
                     VSLHTHPEHDLRGCIGIPEPTMSLIDAIKETSISAAVHDPRFQPLKHSELKNTIIEVS
                     VLTPPEDVEVEDSMEYLEKLEVGRDGLIIEFGPYRGLLLPQVATEYNWDTKQFLSNLC
                     LKAGLPTTAWIEYDVKIKSFQAQVFEELIPNGPVVEKSTYTGC"
     CDS             582374..583669
                     /codon_start=1
                     /gene="recJ"
                     /locus_tag="MMKA1_05940"
                     /product="single-stranded-DNA-specific exonuclease"
                     /protein_id="BAP60711.1"
                     /transl_table=11
                     /translation="MDILPIEDISKFNQITGKIKEKIENCDGLIRIVTHHDPDGLTAG
                     SIMLKTLLRLNKNVQMTILEHLSKESVEELSKENDKMFIFCDMGSGQINLINNLQFNA
                     VILDHHPPEVAETEIGNILQLNPHLFGANGAKEISASGVCYLIARLFEYYDLATVAVV
                     GAIGDMQHLPFIGLNKYILNEASKYRYLSVIKDIVYNCYNLPISRSIYYSTQPYIREL
                     DSIDKIKEILEELSINPEKKGITVAEKENLLEYFKCFNKNDDLIVDRYEINHKLNDAF
                     YLSEVLNACGRKEMTSVGIGILLGDDECIRQGENLYKEYKDELIEELKNVKLTSMDNI
                     EYFIGEKGKTGIISALMVKDKPVLGFNEQGEIYKVSSRGSKELVECGLNLSKAMAVSK
                     EFGGDGGGHNIASGAAIQKNYLNEFLEKVNEIVGEQLKK"
     CDS             583745..584317
                     /codon_start=1
                     /EC_number="4.2.1.19"
                     /gene="hisB"
                     /locus_tag="MMKA1_05950"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="BAP60712.1"
                     /transl_table=11
                     /translation="MRAFKVKRDTNETKIQLELNIDGTGKYSITTGVPFFDHVLSSFA
                     KHGSFDLKLDVLGDLEIDDHHTVEDVGIVLGKAFENMEKKNIKRFGWAIIPMDEAKAT
                     VSIDIGGRPFVVGNYVPNTERIGSFSTENVVHFFESFSNNAKINLHFEVTGENEHHKV
                     EALFKAFGVAMDMATQIDERKGIVSTKGVI"
     CDS             584327..584875
                     /codon_start=1
                     /locus_tag="MMKA1_05960"
                     /product="hypothetical protein"
                     /protein_id="BAP60713.1"
                     /transl_table=11
                     /translation="MKRNKKIALVSHCILNANSKVEGLSEYGGMLKDVMNYLMDEGYG
                     IIQMPCPEMAIYGIKRWGHVKEQFDTPHFRNVSRKLFQPILEQVQDYIKNGYEVSLLI
                     GIDKSPSCGINETCSSNEWGGYSSNGNMAEKSEKLEMIPEKGIFMDEILNILNENEIA
                     IKCVAIDEENIENSLEYLKRFI"
     CDS             585057..585851
                     /codon_start=1
                     /locus_tag="MMKA1_05970"
                     /product="putative extracellular solute-binding protein"
                     /protein_id="BAP60714.1"
                     /transl_table=11
                     /translation="MNNNVLILIIGLIGAVLAFSGCVSNYEAQSTEDNSWKNVEESGV
                     VKVGLCAAWPPFESRNEKTGEIEGFDVDLANALGEELGIEVEIVDAEWQALLGGLSKG
                     DYDTLITCMSKKEASVENVEMSDVYYELNDVIVVRNDNNEINNVSDLSGKIVGVQLGS
                     GSEQAVDALSGLKEIKRYNYNPEAMIDLQNNRSDAVIVGYTYVLSEISKYPDLKVLDT
                     PIASAEIVMVQKEGAKELTVKLNEALSKIKENGKYDEIQDKWLSLE"
     CDS             585886..586545
                     /codon_start=1
                     /locus_tag="MMKA1_05980"
                     /product="putative amino acid ABC transporter permease
                     protein"
                     /protein_id="BAP60715.1"
                     /transl_table=11
                     /translation="MKFYIVFDNIPFIIDAVFVTLKITIMSFLLAVIIAVLVGSVRAM
                     NFSKTLDLVLMAYVEVFRGTPLLIQLFFIYYGLPSIGITMSSTFAAVLGLSLNGGAYI
                     SEIIRAAIQSVPVGQFEAAESLGMGKIESMVYIVLPQAFRITIPPLVNSFSSILKESS
                     LISVLAITELTRIGQLIYTRTSRPFEIYLTIGLIYLLLVSIISISSWKIEKKLNGAFE
                     R"
     CDS             586620..587513
                     /codon_start=1
                     /locus_tag="MMKA1_05990"
                     /product="hypothetical protein"
                     /protein_id="BAP60716.1"
                     /transl_table=11
                     /translation="MMNKVKGTAYTIYSFVAFGIMPFLTKFAYDGGANAVTTLMFRFL
                     IAGLILYVFLKFKKISLKISGHNFVEILFYGAFLYALNTVFLYEAYNYIPTGIATTLH
                     FICPVTVTLLMISIFKENLGINKVLALIFSFLGMYCLLGGNCTGFDIYGVLLAAGSGL
                     VYAGYIVSAGKCKYSKIDSYVTIFYLSILSSVLLFIYGLFTNTLTLNMAFSSYASIGL
                     ISIFCTVLALIAFLEGIKLIGPSNTAILSTLEPIVSIILGILLLNEVLSFKIGLGSVL
                     VLISVIIVTIEKSKVSDTVKN"
     CDS             complement(587535..588449)
                     /codon_start=1
                     /EC_number="2.1.3.3"
                     /gene="argF"
                     /locus_tag="MMKA1_06000"
                     /note="protein synonym:OTCase"
                     /product="ornithine carbamoyltransferase"
                     /protein_id="BAP60717.1"
                     /transl_table=11
                     /translation="MDLLTLWNLEREEVLKIIEDAEYFKKNRYGHEILKNKSIALIFE
                     SPSTRTRMSFDLAVNELGGHSLMMNEGEIHLGKKESIADTARVMSRFVDAIVARVKNH
                     KTLEDLAEYGCVPVINALCDLAHPCQILADLLTMKENGKNFKGLKLAYFGDGNNVSNS
                     LMIAGAILGMDVVIATPRSYEPNGLFVKKALEIIAKYGEGSLTLTDDPEIAAKDADVL
                     YTDVWISMSDKNKQMDEILKIFPKFQINDKILSKAKKDAIVLHCLPANRGLEITDEVI
                     DGKQSKVFDQAENRLHAQKAVLKYIFEH"
     CDS             588573..589175
                     /codon_start=1
                     /locus_tag="MMKA1_06010"
                     /product="hypothetical protein"
                     /protein_id="BAP60718.1"
                     /transl_table=11
                     /translation="MHYFSENPDSKHDESTISGMLRGKRFSFKTDSGVFSPKKIDKGT
                     IILVEELELSKDDDVLDVGCGYGVIGISIADEVNSVTMTDLNNRSVGLTRKNIKLNGK
                     SEKNIEVFQGDLFEKVSNKKYSVIISNPPIKAGKELIHKIISKGHDLLNENGSIWVVI
                     QTKHGAKSLTKYMEEIFGNVETVTISGGYRVLKSVNMGSE"
     CDS             589219..589911
                     /codon_start=1
                     /locus_tag="MMKA1_06020"
                     /product="putative prepilin and preflagellin peptidase"
                     /protein_id="BAP60719.1"
                     /transl_table=11
                     /translation="MIEYIIGVIGLLLASVQDFRSREIEDYIWIFLAVVGVLFAIYTS
                     FTLSNYSILINSISGFVICFILGYMMFLSGIGGGDGKILIGLGALVPKFQMPIYTSLG
                     TLLNLNYIPNFPIMVFINGIFFMVFLPFVILFRNILNGARPKTGKEVILMFFGEKMKV
                     MVAKEQKRLIMGQNDKINFFPASDDEDFSKYSDEEEIWVTPQIPLIIPITLSYLVTPI
                     IGDRVLDLLIPF"
     CDS             complement(589908..590750)
                     /codon_start=1
                     /locus_tag="MMKA1_06030"
                     /product="hypothetical protein"
                     /protein_id="BAP60720.1"
                     /transl_table=11
                     /translation="MDILKELPITDNHIHIDPLNGLGPEKVAKTFKNAGGKIMIIPNK
                     PAFSTNLTKPMDEMLSIIEKVRENGIIAFGILGVHPAELTVMLRNGIELETAKKYMID
                     ALDYAKNMVLENEFLIGIGEVGRPHFEVEEKIWDVSNEILTYSMEIAKDIDCAVQIHA
                     ENASREQFKEFSEMAKSVKLSPEKVIKHHSSDMVLEGDEFGIFPSIVASKPIDTAVKK
                     STRFLMETDYIDDLKRPGVVLGIKTVPRKTRQMLENEIIDEEICFKIHKENVEKVYGI
                     EIDF"
     CDS             complement(590752..591165)
                     /codon_start=1
                     /locus_tag="MMKA1_06040"
                     /product="hypothetical protein"
                     /protein_id="BAP60721.1"
                     /transl_table=11
                     /translation="MDTVFKYIDENYQNLKNNGLKIAELGIGFYFNSAKKLKDSDFDV
                     IVIDINKNAVLDAKDNGLNAFYDDLFEPNFEIYKNVGLIYSFRPPRDLQPFILKIAKK
                     LNCDLIIKALSGEEPIEELKLVNYQGKPIYVWKRD"
     CDS             complement(591175..591471)
                     /codon_start=1
                     /locus_tag="MMKA1_06050"
                     /product="hypothetical protein"
                     /protein_id="BAP60722.1"
                     /transl_table=11
                     /translation="MSNNSVKVDYKKLIISIALDIVGMATYLIPGLGESGDFVWAPIY
                     ALIIRNLYHSSILGFFGGFEELLIGTDIIPSATILWVLETFGIIKNKEFQENYK"
     CDS             591587..592105
                     /codon_start=1
                     /locus_tag="MMKA1_06060"
                     /product="putative peptidase"
                     /protein_id="BAP60723.1"
                     /transl_table=11
                     /translation="MVAIVMVIAPEKFRDEELFEPLQVFQSKNIATQVVSTTTGQHKG
                     VLGRVMTTTKTIEEVNPDDFDAIVIVGGGGSRDYLWNNEKLLELLKEFNSMGKITAAI
                     CISPAVLAQAGLLTGKKATVFPDDESIEVLQQNGAIYLDEAVILDGTIITGRNPDAAK
                     EFGLKIAEALGK"
     CDS             592167..592928
                     /codon_start=1
                     /locus_tag="MMKA1_06070"
                     /product="hypothetical protein"
                     /protein_id="BAP60724.1"
                     /transl_table=11
                     /translation="MDFKKIKYQKIGDILIVKKNLNDNEIDYLVNKTKCKTIVKYNTY
                     ITGDLRTPKIKILHGSETETINKEHGCLFKIDVSKIMWSMGNLEERKRISTLSNSEEV
                     VVDMFAGIGYFTIPIAKYSNPKTIYALELNPDSYYYLSENIKLNNLDNIIPILGDNRD
                     FPFKNIADRISMGYVLKTHKFLDKAFEILKRDGGVIHYHETVHENILESRPIERLKYH
                     AEKNGYKLDEYKINKIKKYSPGVWHIVVDAEFSKI"
     CDS             complement(592942..593376)
                     /codon_start=1
                     /locus_tag="MMKA1_06080"
                     /product="putative carboxymuconolactone decarboxylase"
                     /protein_id="BAP60725.1"
                     /transl_table=11
                     /translation="MNEKSSISDEKLCELMEIVEKRYGKVPYIIEKMKNNPKLLESKI
                     NYDEAVVDEYKHIDPKTAELISIAVVSALGCEHCIEFHIEAAKKMGISEEQIMTAVLI
                     AGSLSNAAVLSKSTRALQKVNNILKYDENSLSCPECNISGIK"
     CDS             593586..596597
                     /codon_start=1
                     /locus_tag="MMKA1_06090"
                     /product="hypothetical protein"
                     /protein_id="BAP60726.1"
                     /transl_table=11
                     /translation="MDNLNIQLNGGIPITTLKKLILITLLISFIGFVSAETAPVDYNI
                     NNSNYDTARTISSPGIYNLTENISSTNGIEINSDNVTLNGQGYFLNVTSNNGIHASGY
                     KNITITDVNLCASGENASAINLTGAEIIILGNTITSNSGDGIFINRSSENITISANTI
                     TAGNKGVYCGGNNATILGNIITSNYSISMAGYNLTVENNALTSGIHCYYSLIYSNTLS
                     GNTINSKKLYFYKNVENVGEIPSDAGQVILVNCTNAQISNINFNEKAIAISIADSTGV
                     IVENCTINPSVFTAENYVFMQNSENCEFRRNTFKVSESNANIGFAASYVNNITISKNK
                     FEGIVAPVYGVNFTNSRIFKNIFENVTSAPLVFRYDCSGTYVYLNNFINCSWNVENTL
                     NESITFNSPLNVSYNYDGTTYSTIAGNYWSDYNETNANANEGIWSIPYAITELINDSY
                     PLVKPFSMVDENGIIHITLDDVDSENGYVITKPGTYVLDEDITNGGSVLINSSNATFD
                     GNGHCINNSKSYAVYSNAEMLENLTVKNVITSGNISIVASNSNLSSTDALYVSFYGDY
                     DTLSKNRAYKIVLQGNNNTIFNNTAPYIGAAFGNNNKILANTAYTIEIYCDNSDVISS
                     NTVQDHISATGDYNTISSNTVQDHIWTWGQYNTISSNTVINASYYAIDPNGYYDEGID
                     AYATVFNNTVLASNIGIWLDNYCEGYSNITQNTVYASEYPIFIGDNITGCNIYLNNFI
                     YTGNSTNISEIMPNTTVNNSLVSPFKIEYKYNGNTYSNILGNYWSDYSGTDADSNGIG
                     DIPYLYGCDYERTYGDDYYDIDYLENDTAPLIDMWNGNEIGNYVAPVTRSSGSSGRSY
                     DSDISDEIDSKVIKNFVSSASVIYGNEIDQQYAEELRERIQNANGYKISGNAVIVGGP
                     NANGFAKEYNDQFEMPISNDYPGENKGIIQVLKVQDNTGKIVQSYTIAYIAGSDRLGT
                     QAALEYFKTLDELPDGPIMIEWTENGPVVVE"
     CDS             complement(596659..596949)
                     /codon_start=1
                     /locus_tag="MMKA1_06100"
                     /product="hypothetical protein"
                     /protein_id="BAP60727.1"
                     /transl_table=11
                     /translation="MGALSEYLELKNESYLISEEVSRVLNDRKRTNSEKREIVEKLQK
                     KLRSKKQKIKILHDRVVEYYVFPGTLIILAYLAFQFSEYITETLIEILMKFI"
     CDS             complement(597099..597581)
                     /codon_start=1
                     /locus_tag="MMKA1_06110"
                     /product="hypothetical protein"
                     /protein_id="BAP60728.1"
                     /transl_table=11
                     /translation="MKTVNSGKCLSFFVGEFKLEVESKKAEKIVYLGSRGVCFSMAQL
                     FGYSIRDTVKNQYFIPDAEIENSVEYELTDIGYRFFGLENKKNLDNPDILVIMGGIAT
                     KHSKATIEEITGLIENLNPKIVMGISICNVFDKSGCLEKINFDSLIDGTLEPVVLMKK
                     "
     CDS             complement(597646..598554)
                     /codon_start=1
                     /locus_tag="MMKA1_06120"
                     /product="hypothetical protein"
                     /protein_id="BAP60729.1"
                     /transl_table=11
                     /translation="MNNKKIFLFEFTVGTGLVPDELLAEGKLMFDILLNQFLDEKYTV
                     KTVLCEKIAKKYPKYNEINNLEIIVSDNYLNSFKEGLNDSDFALAIAPEEDLILYNLT
                     ELIEESGCLNLGCKKSGVKIAGDKFLTYEAIKNTVNTPKTFPVKKYVVKNRLGCDSTH
                     DTFDENYIVQEFIEGEPYSVIFIAKNKKFYPVCMNKQYIEERYCGGEINIEHTLKEKA
                     IIECKKTLEKIEGINGYVGVDLMINGEEISILEVNPRITTSICGIKSKPSIGKLLIDN
                     ALEKDIKFEVESCLKFKRNDFGFEFL"
     CDS             complement(598574..599497)
                     /codon_start=1
                     /locus_tag="MMKA1_06130"
                     /product="hypothetical protein"
                     /protein_id="BAP60730.1"
                     /transl_table=11
                     /translation="MQYIDKSKEEFLSEIYRIVAKIRLELELTTSEITISDFEFKMDS
                     ENSKNLILMIYTPTRTDKSLLIGPGGWVVGKLREKLNDSFKENLIIRVESYIDRKKEL
                     DAIENSISHLREKGLDISSKKDALVIIQCEYDLSSIDFINEYFNPIFITFDLGTALLP
                     HKNRNRIERVFKDKNLKYEFLNPYYLNGEQITDAISKNPCETICNNLISEMVNYAKNK
                     NIEIVLFNHLNKDYEFRNGIHILNFLKMFPIKLNSLIHKGRSLDCPLLIQSCKRNKIT
                     KTFKIKQIVSGVYSGLVEPTEGAEEIIKYLK"
     CDS             complement(599539..601188)
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /gene="fadK"
                     /locus_tag="MMKA1_06140"
                     /note="protein synonym:acyl-CoA synthetase"
                     /product="short-chain-fatty-acid--CoA ligase"
                     /protein_id="BAP60731.1"
                     /transl_table=11
                     /translation="MLFTNDTIGEFFEKQAQKDPDREFLVYPDRNLRFTYKEFDERTD
                     LLAKGLLEIGIKKGDHIGIWARNVPDWLTFMFATAKIGVVLVTVNTAYKSHELAYVMK
                     QSDMKALAIIDSFRDVNYLEILYELVPELKTSQRGKLNSEEFPYLKNVIYVGQEKHRG
                     MYNTTELMLLGKYVSDEKLIEAKKGLDSNDVINMQYTSGTTGFPKGVMLTHKNILNNG
                     YYIGEKQKFTEEERLCLPVPLFHCFGIVLGVLALLTHGGTLVMLEIFDPLLVLAAIQK
                     EKCTAVYGVPTMFIAEFSHPMFEMFDLSSLRTGIMAGSTCPIEAMKKVMSDMYMREIT
                     ISYGLTEASPVFTMTSVDDPFEKRVESVGKAMPHCEVKIIDPETGETLAPGNVGEICC
                     RGYNVMKGYYKMPEKTAEVIEKDGWLHSGDLAVEDEDGYYKIVGRIKDMIIRGGENIY
                     PREIEEFLYTMPGINDAQVVGIPDEKYGEIVGAFVIPKEGYEIKEEDVRDFALEKIAR
                     YKVPKHVFVVEEFPMTASGKIQKFKLTELAVELLKKKKEEL"
     CDS             complement(601209..601616)
                     /codon_start=1
                     /locus_tag="MMKA1_06150"
                     /product="hypothetical protein"
                     /protein_id="BAP60732.1"
                     /transl_table=11
                     /translation="MFKTTVTPRFGDVDGLKHVNNIVPAIWFEQARNPLFEIFVPDFD
                     LSYEKWNLIMVRTEFDFVGQMYLGMDVEIRSYISKIGNSSFTMYQEAWQNGKLAVKGK
                     AVAVHYDFVNQKSVPIPDSIREKLMEHFIEGID"
     CDS             complement(601639..602178)
                     /codon_start=1
                     /locus_tag="MMKA1_06160"
                     /product="hypothetical protein"
                     /protein_id="BAP60733.1"
                     /transl_table=11
                     /translation="MREGQNMSIEELAQASNSSVKLIENLENGDLIPSLTPLFKIARA
                     LGVRLGTFLDDAPQNGPVLTRSGSSDSIVRFSGKLDGTKDSKLDFYALAAEKQDRHME
                     PFLIDVYPIESNEYKLSSHEGEEFIYVMDGEIEVMYGQEKYMLKKGDSIYYDSIVPHD
                     LHAFGKDVAKILAVIYSPF"
     CDS             complement(602368..603954)
                     /codon_start=1
                     /gene="sla"
                     /locus_tag="MMKA1_06170"
                     /note="protein synonym:cell surface glycoprotein"
                     /note="protein synonym:surface layer protein"
                     /product="S-layer protein precursor"
                     /protein_id="BAP60734.1"
                     /transl_table=11
                     /translation="MKSILKKIGCILVGSTVLSASITAAYALEKYGNINDFIDDDLIK
                     NGNPDVYIVVGENAAALDVTSANKISAKIGTLTYSETIIEDESTVEYQIIGESESIDL
                     LDGTDKLDSAGTEKSWILVTSADDNYADHFDDEEGNSFSYSGFSEADQTKSLGHFGYL
                     LEVGDIDPENHFESDDDATEIVFVRITDSNKNAGSQTFDIGKDMVYASIIYPNQVSAF
                     KLTKDLKEGYEIPFLGKKYRIVQIDEDDGIIYLGTSSYDGTLEQGNYISSGEYQVVIG
                     EILESGDEYSVEISILRNGNIIKEHTEILRSDKSFSVIAGDLGVTVHDVWTNAAADTG
                     YADITICKSLTELKLGEEYVNNWEVRAVTNTGGTIDFLKTYEDNTVGIALVYSGSDIE
                     GINDGDRIKIADYVNLVFDDEDDLDKMVAEFKAERTVTTGSTGGTVISKSGEVPEILM
                     DSEIELDEADKNLILIGGPVANKLTKELQNESKIDIDNESPATASLIEGAANGNNVLV
                     IAGGDRYSTESAVLSLINLI"
     CDS             complement(604028..604528)
                     /codon_start=1
                     /locus_tag="MMKA1_06180"
                     /product="hypothetical protein"
                     /protein_id="BAP60735.1"
                     /transl_table=11
                     /translation="MKNAEYFIKKLDLEKHPEGGYYRRIYQSDEMVNKSNLPERYNSD
                     RFYATSIYYLLNGNDVSKFHRLKSDEIWHYYFGSLVIIHIIDNFGNYSLEKLGPNLEE
                     DENFQVIIPKNSYFAAEITEKNSFVIVGCTVSPGFDFEDFELASKKELLKKYPKHHEL
                     IEKFSD"
     CDS             complement(604537..605430)
                     /codon_start=1
                     /gene="moaA"
                     /locus_tag="MMKA1_06190"
                     /product="putative molybdenum cofactor biosynthesis
                     protein A"
                     /protein_id="BAP60736.1"
                     /transl_table=11
                     /translation="MEDRYGRQIRSFRLSITPKCNLKCFYCHKEGRNEEHGKLMSADE
                     IGKIVNSSLEFGVRKIKISGGEPLLRTDLPEIISYIKNEQIKDISLTTNGILLEKYAQ
                     KLKDAGLDRVNVSLDTLDPVQYKKITAGGNIESVKKGIEKAIEVGLTPLKVNFLAMDC
                     TVNQLPAIMDYCRKIGAILQIIEFIPMEPELKHHHVDVVPIEEEIAKNADNVFTRKFM
                     QNRKKYVIDGLEVEFVRPMDNTEFCNHCTRIRLTYDGYLKPCLLRDDNLVDVANPLRN
                     GEDIRKYFIKCIHEREPFCKP"
     CDS             complement(605562..606248)
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /locus_tag="MMKA1_06200"
                     /note="protein synonym:putative PPIase"
                     /note="protein synonym:putative rotamase"
                     /product="putative FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="BAP60737.1"
                     /transl_table=11
                     /translation="MEKGKLVKISYEGYVDENLFDTTNEELAKEKGIFNPNMVYGPVT
                     ISAGEKMLIPGLDGAIMEMNVGEERELDLTAENAFGKRDPSQVKIVPMKEFKKHKVNP
                     IPGMPVNIDNKIGKVVSANGGRILVDFNHELAGKDLKYKLKIEEVVEAPEAVALEVAK
                     LFIPRISEEDLKITIDGENVTLDLPENTAFMQNLQMVKMGISNELIKRLEAKKVSFID
                     NFVKKEEKTE"
     CDS             606359..607003
                     /codon_start=1
                     /locus_tag="MMKA1_06210"
                     /product="hypothetical protein"
                     /protein_id="BAP60738.1"
                     /transl_table=11
                     /translation="MISAIILSGGKAERMGGEKSFRKSGNKYLIENIADMLIEMEIPF
                     VTVFKNPRFMEKPEEEIEKQLYYYKKYHQTITWDFVPGMGPLIGMLSGMLNTKSQWVF
                     LVPCDMPFITEESIINLLSFIKEAELNGQDCIVPKHKNGFIEPLFSLYHISSVNVLGM
                     VVEEMLEQNRSFPIRRLIDELNPLYVDVDKIDKTCDIFINLNTLKELENACFDR"
     CDS             complement(607409..607528)
                     /codon_start=1
                     /locus_tag="MMKA1_06220"
                     /product="hypothetical protein"
                     /protein_id="BAP60739.1"
                     /transl_table=11
                     /translation="MERETIKRSSRRWKKKGQMRWKHYKKRIRRMKREKRENK"
     CDS             complement(607545..607784)
                     /codon_start=1
                     /EC_number="6.3.5.-"
                     /gene="gatC"
                     /locus_tag="MMKA1_06230"
                     /product="aspartyl/glutamyl-tRNA(Asn/Gln)
                     amidotransferase subunit C"
                     /protein_id="BAP60740.1"
                     /transl_table=11
                     /translation="MIDVEKIQKQADEIVAQLSEVLENFDLETEEEYHILETKNVLRD
                     DDEALLDESFKIDALNVAPKVKDGSIVVEKSKWSQ"
     CDS             complement(607802..608671)
                     /codon_start=1
                     /EC_number="4.2.1.52"
                     /gene="dapA"
                     /locus_tag="MMKA1_06240"
                     /product="dihydrodipicolinate synthase"
                     /protein_id="BAP60741.1"
                     /transl_table=11
                     /translation="MQGVYPAIITPLKENKVDYDGLRNNIDFLIENGVNGVIPVGTTG
                     ESPTLTPLEHEKVVEKVVEFVDGRVEVIAGTGSNSTSEALEFSQYAEDVGVDGVLLIT
                     PYYNKPTQEGLKRHFGEIANSINVPIVLYNVPSRTALNIEPETIKYLFNEYSNISAVK
                     EANPNLSQVSEVLDSCDIDILSGNDELTLPIISLGGKGVVSVIANIAPKEFVQMVDFA
                     NAGKFDKAKEIHYNLFPLMKLMFVETNPIPIKTAMNMLGMPSGELRLPLCEMAESNKL
                     KLQNALNNLGLLK"
     CDS             complement(608681..608872)
                     /codon_start=1
                     /gene="rps17e"
                     /locus_tag="MMKA1_06250"
                     /product="30S ribosomal protein S17e"
                     /protein_id="BAP60742.1"
                     /transl_table=11
                     /translation="MGRIRQTFIKRTGEELIEKFADKFTSDFEENKKAVEEVAMISTK
                     PLRNRIAGYVTAKVKKMNA"
     CDS             complement(608952..609242)
                     /codon_start=1
                     /EC_number="5.4.99.5"
                     /gene="aroQ"
                     /locus_tag="MMKA1_06260"
                     /product="chorismate mutase"
                     /protein_id="BAP60743.1"
                     /transl_table=11
                     /translation="MSNSSEKRLEEIRKRINEIDEQLIELIAERTSFAPEIAALKKSL
                     GTCVFDPKREDAICEKTRLMCEKHHIEPEVALKVMKILMTYNKEVQKDSIDG"
     CDS             complement(609342..610058)
                     /codon_start=1
                     /locus_tag="MMKA1_06270"
                     /product="hypothetical protein"
                     /protein_id="BAP60744.1"
                     /transl_table=11
                     /translation="MDLDSWECYYNQILDDFGYGSAEDLKSAEILEEIIKKFKNNVDL
                     NEISKKILEKEVYIFGAGPSLKKHVLKLKESIESNITIIAADGATKALLEEDIVPDII
                     VSDLDGDIDSILKSNDLGSIVVAHAHGDNIDKLEKYIKLLKNIVGSTQFPKKFEFLIN
                     YGGFTDGDRCCFLAEEFGAKKIILCGMDFGIYVTKYSRPNIEKDIELADEIKVKKLKY
                     AEMFVNWLITNGKSPIEFMP"
     CDS             complement(610068..610778)
                     /codon_start=1
                     /locus_tag="MMKA1_06280"
                     /product="putative ribonucleoside-triphosphate reductase"
                     /protein_id="BAP60745.1"
                     /transl_table=11
                     /translation="MKISGIVELSTIDYPKHASAVVFLSGCNMKCGYCQNYEYITTNI
                     SEMTAEEVFNSMDLMFAEALVISGGEPTLQPEAVLELAKIAKGKGFPVKLDTNGTNPD
                     LVEKLISNNLLNYIAIDVKAGFNNYEKITGYKKEIKENILKIIDLCKKEGIFVECRTT
                     FIPELMDESDIEEIAKTVKNCDLYAIQQFDREHSYDKELCNVKRISEDDLIALGKIAK
                     KYIENVKIKTLSSEIPIN"
     CDS             610873..611655
                     /codon_start=1
                     /locus_tag="MMKA1_06290"
                     /product="beta-lactamase like-protein"
                     /protein_id="BAP60746.1"
                     /transl_table=11
                     /translation="MEIKILVDNTAKGKFLAQSGFSAIIKDEDSKILFDCGQNAHVFE
                     NNLKLMGENDNFDAVIFSHGHYDHTDGFNYFIEKYGENLDVPIYIHKSAFVDRYHGER
                     YIGIDENIKNFLKNYKNLKLIEDPFKISENLIISGTIPRTNFYEREDFEMIENGQKVD
                     DIIIDDMFVIVKDIILSGCTHSGLINCITHAKTLKEVNGIIGGFHMGTASENYINQVK
                     NYLKTQNFRLVSPVHCTGFNATKELSDISGFKFGHVGSVFEI"
     CDS             611800..612516
                     /codon_start=1
                     /locus_tag="MMKA1_06300"
                     /product="putative branched-chain amino acid transporter"
                     /protein_id="BAP60747.1"
                     /transl_table=11
                     /translation="MKQLSFNKLYFEGIKDAIPISIGYLPIGMAFGVLAKSMGIPYEI
                     SILMSLIIFAGASQFVGVNLIAIGTSSFEIVLTTFILNLRHFLMSSSLSQRIDYTKSK
                     KFLSLISFGVTDETFAVASLKEESKLSPEFLFGLNFTAFFAWNFGTVLGIFLAESIPK
                     EIQSSMGISLYVMFIGLLIPAVRRSTKVLKIVLVAVFISSALTWVPVFKFISTGWIII
                     ITTIVASFIGAKFIHGDGDE"
     CDS             612509..612817
                     /codon_start=1
                     /locus_tag="MMKA1_06310"
                     /product="putative branched-chain amino acid transporter"
                     /protein_id="BAP60748.1"
                     /transl_table=11
                     /translation="MSREEMVLLVIFMAIVTYIPRMLPIVLFKDAKLPHFWRAFFSYI
                     PYAALASLIFPGIIYSTGNIYSALFGAVISVILAYYRLNVIIVVFGGILGAYLAQMLI
                     "
     CDS             complement(612888..615548)
                     /codon_start=1
                     /EC_number="6.1.1.9"
                     /gene="valS"
                     /locus_tag="MMKA1_06320"
                     /note="protein synonym:valine--tRNA ligase"
                     /product="valyl-tRNA synthetase"
                     /protein_id="BAP60749.1"
                     /transl_table=11
                     /translation="MEIKEEYSIELEKKVQEKWEDEKTFKFLDDEKRPPYIIDTPPPY
                     PTGRMHLGHGLNWTYMDIIARFKRMNGYDVLFPQGWDCHGLPTEVKVEELNNITKSDI
                     DRHEFRRLCVELTDENVEKMRGQVRSLGISIDWDREYITMNPDYVRKSQTAFLKMYEK
                     GLIYRGKHPVNWCPRCETAIAFAEVEYQGRTSKLNYIKFPYAENSEKYLEIATSRPEL
                     MAACVGIVVHPEDERYSEVVGKTVKVPLFNQEVNVYPDSDVEKEFGTGVVMVCTFGDK
                     TDVTWVNRHKLEVKKAINEKGQLTEICGKYTGKKSDDARKEIISDLISENYMIKQEPL
                     EQNVGSCWRCKTPIEIIVGDQWFVNVTKLLNEVENAANEISWVPEHMKARLMKWIEDM
                     GWDWCISRQRLFATPIPVWYCKDCGEIILAKPEDLPIDPTKESPYTCKCGNSNLVAET
                     DVLDTWMDSSITPLVIAGWLEDEEFFKKHYPVQLRPQGHDIIRTWAFYTMVRSLAITG
                     KKPWDEIVINGMVFGEDGFKMSKSRGNVVEPGEITKTYGADALRLWASNSTIGKDVPF
                     AWKEVEYGGRFLRKIWNACKFAKMNISDETISELKSLKSISIENPVDLWILSKLNNLI
                     SKVSSDLGNYKINTVVEIQKFLWHEFCDNYIEMVKHRLYNKEESESAQQEKLMAQYTL
                     YKVITESVKLLTPFTPHFAEIVGEIYEIDDLHTSWPVADESLISLENEFVGEVAKNTV
                     ASIRRYKSNKGMPLNAELNKVEMYVSDEKDFDALSKVSKDVKKSLKIKELELNLGKPL
                     LEQKISEVTPNKSKIGPEFKKDAGKVTAFIKEADAETIEKILSEGIETEFGALNKEHI
                     KEVKRAIYNKGEIVETADIDSLIDTIAIIQ"
     CDS             615970..616407
                     /codon_start=1
                     /locus_tag="MMKA1_06330"
                     /product="hypothetical protein"
                     /protein_id="BAP60750.1"
                     /transl_table=11
                     /translation="MAYKKIIMPTDGSKISIEAAEQAIDLAKATEGRVYGIYVIDIVP
                     FVGLPTEGLWESMKEVLEKEGHTALRTLTDIAREKGVEIKTEILEGTPSKEIVEYAEA
                     KNADLIVMGTTGKTGLDKLLLGSVAERVLKKSHCPVLLVKSSE"
     CDS             complement(616412..617110)
                     /codon_start=1
                     /locus_tag="MMKA1_06340"
                     /product="endonuclease III"
                     /protein_id="BAP60751.1"
                     /transl_table=11
                     /translation="MDNKETFQKIYDHLFNLYGPQGWWPLLEVNGCNPTKTGSINGYH
                     PNNYEYPKTKNQCFEICIGAILTQNTSWPSVEESLKNLRKLIEITPENIINLDIEQLK
                     ETIKPSGYYNQKSVRLKGFSEFFIKLNHVPTREELLKLNGVGPETADSMLLYAFKVPS
                     FVIDAYTKRILINLNLIDGSEKYDKIKELFEENIEKNLEIYQEYHALFVEHAKNYYLK
                     KENYITCPLLKIIK"
     CDS             complement(617136..618305)
                     /codon_start=1
                     /gene="napA"
                     /locus_tag="MMKA1_06350"
                     /note="protein synonym:Na+/H+ antiporter"
                     /product="Na+/H+ exchanger"
                     /protein_id="BAP60752.1"
                     /transl_table=11
                     /translation="MDTYFLFFIILTSIFIVPQILKRFNVPTITATMLAGILIGPFGL
                     NIIQSSATLDTFAAFGVIFLMFLAGLEVDNETLKDEFKNSLVLSLFSMLIPSIGGYLI
                     GQYFGLDFIGSLLYAVIFSSHSVGIVYALMDELGLIKSRFGTTVISASVVIDLISLIV
                     ISILIKMGGSGINSDIIPFVVLISAYIIALLIIIPLISKLILKELQKFHVQKIHFILL
                     IILISIIVGEHIGIHPIIGAFIIGIAVSEELTKEEHDQILNENLNAIGYGIFIPLFFL
                     NLGMTTDISVIFNFDNISLILVSVVTLIGLKISSGYFSLRILDYGKLKSFCGGLLTVP
                     SLTASLVGATLGRDLGILPEKFFVSVVVIALLTSTVAPIYVKSLVSKNYDKLKLN"
     CDS             618422..619189
                     /codon_start=1
                     /EC_number="2.1.1.98"
                     /locus_tag="MMKA1_06360"
                     /note="protein synonym:diphthamide biosynthesis
                     methyltransferase"
                     /product="diphthine synthase"
                     /protein_id="BAP60753.1"
                     /transl_table=11
                     /translation="MLVMAGLGLYDERDVTLKTLDFAKKVDKIYAEFYTAILTGTTME
                     KIEGTLQKPITVLDREKVEYETNKLIDEAKDKDIMFLTAGDPMVATTHVDIAVEARKK
                     GIEVVIINAPSIYSAIGITGLQLYKFGKTTSIVFPEPNYFPETPYDVIKDNLKLGYHT
                     LCLLDIQADKERFMTANEGLDALLKIEEKRKENVISDETKVAVVARAGSINPGLYYGK
                     IKDLLNYDFKSPLHCVIIPGKLHFMEEDALKYLFENI"
     CDS             complement(619195..619404)
                     /codon_start=1
                     /locus_tag="MMKA1_06370"
                     /product="hypothetical protein"
                     /protein_id="BAP60754.1"
                     /transl_table=11
                     /translation="MGALVDDIKIIYLMMIGFTILGVGLSFKYYSSLDPAVRYIMHVF
                     YVFALITATYLLAKSSMPTTQCEEA"
     CDS             619657..621189
                     /codon_start=1
                     /locus_tag="MMKA1_06380"
                     /product="hypothetical protein"
                     /protein_id="BAP60755.1"
                     /transl_table=11
                     /translation="MKFLILDGYTDEPAGLGVPPYIGMYPRYAAGVLYKFKHDVDYIT
                     IDKLREELKKGYDFNRYDVVIAICGFHTPGKYLNANPATLREFVSILYNFKGLKILGG
                     PVATKFGSSLEGGKIKDESNLKYFFDVISEGDLDAVLHDLLKNNLNPEKTDGTRLRTY
                     DELDEFAKIGTKIVKLHPNYPNIIAEIETYRGCARAFSGGCSFCTEPRRYGSPKFRNS
                     KDIIEEVRNLYENGIKYFRIGRQPCMFSYMAKDVESTDVPVPNVLEIEKLFKGINSVS
                     KPDVLHIDNANPSVIARHEKEGREIAKILVRHCTPGNVAAFGVESFDEKVISKNCLLT
                     EPEDVLKAVNILNEIGGKRGENGMPHLLPGINLLSGLKGESNDTFEINYDYLKEIYDS
                     GNILRRINIRQVVPFFGTGITVKDVEKAKKRKNLFLKFKEKIRTQIDNPMLKRMLPTE
                     TILKNVLVEVKEKNDLYFGRQFGSYPILIGIAEKNVEIGKFVDIKVTGYGRRSITGKI
                     VK"
     CDS             complement(621194..621892)
                     /codon_start=1
                     /locus_tag="MMKA1_06390"
                     /product="glycosyl transferase"
                     /protein_id="BAP60756.1"
                     /transl_table=11
                     /translation="MMVAVIPAYNEEKNIISVLKDLSDINIDVVVVDDGSTDKTKTII
                     NEFLEKNEFKNKIFPIFKEKNEGKSKALEDGTNYAVTLNYDAIVYLDGDYQHKPSDII
                     PMYEKMKSENADAVFGIRKYKHIPFHRQFSNFLASVIMSITVSVFSGNFHIFRDIQCG
                     FRIIKSEFLKNSYFGDGYSVEHLIALQLAKKNAKITEEYVTIDYHNDAISYITTKKIL
                     DVVKEVAKYVLSKH"
     CDS             complement(621926..622582)
                     /codon_start=1
                     /locus_tag="MMKA1_06400"
                     /product="hypothetical protein"
                     /protein_id="BAP60757.1"
                     /transl_table=11
                     /translation="MKKIHYLFFLSLLLIQAINAAELAPDAVMVNDSVYLVFDWTAPE
                     NIENLSLTIDADEDIIFEEYEYNVSEVSANESVFKMFKGTATEIGNYKIKLLKRYFQN
                     GTLIGSVEFFELSVVPDAGVRIVEKVVTPENYEPVEILETENDTKEEISNTSENTTVI
                     SLEDKDLNKSEITDKNTTSTEVVTETKNGLIGPGGIYYILGGLILGILLGAVIAYAKE
                     "
     CDS             complement(622593..622775)
                     /codon_start=1
                     /locus_tag="MMKA1_06410"
                     /product="hypothetical protein"
                     /protein_id="BAP60758.1"
                     /transl_table=11
                     /translation="MNLDPGVLTVLVLISIVLNIFLFMKLVVLKGELEDIKQSTRLTS
                     DEVNKLNERLKSIKLR"
     CDS             complement(622772..623557)
                     /codon_start=1
                     /gene="minD"
                     /locus_tag="MMKA1_06420"
                     /note="protein synonym:cell division ATPase"
                     /product="cell division ATPase MinD"
                     /protein_id="BAP60759.1"
                     /transl_table=11
                     /translation="MAITIAVASGKGGTGKTTTCANLAVALSQFGKDVTVIDADIAMA
                     NLELIMGIEGKPITLNDVLSGNADIKSAIYEGPAGVKVVPAGVSLDSFKKARPERLLE
                     VLSKLDEQSEVLLIDCPAGIGKEALTAISAAEHLLVVVNPEISSISDALKVVSIANRV
                     ETNVLGAIINRVTEDSSELSSRSIETILEIPIVGIVPEDTNVRRSSAFGVPIVLKHSD
                     SPAAQSIMELGAKLVGKQYIPKEKTKDSFVKKFFKGIFGGKKK"
     CDS             complement(623634..624200)
                     /codon_start=1
                     /locus_tag="MMKA1_06430"
                     /product="hypothetical protein"
                     /protein_id="BAP60760.1"
                     /transl_table=11
                     /translation="MIGVSKMYSEIIDLLGIEDFKIVNPYNSDCNCEYILISKGYFDK
                     VRKLNPNSKIIEINSATFLDIIESLENLKTENIGNIDITNQSIENLKKLDFKIKNDNF
                     EFVKNFECNIDSDSKFIKRILDDLGFEHKNGSTIKIIPDYNLKEDLDLNDIIILKTHR
                     YDLKLVERIENRYMSILNSLNNIILGKT"
     CDS             complement(624219..625529)
                     /codon_start=1
                     /gene="spcS"
                     /locus_tag="MMKA1_06440"
                     /note="protein synonym:Sec synthase"
                     /note="protein synonym:Sep-tRNA:Sec-tRNA synthase"
                     /note="protein synonym:SepSecS"
                     /note="protein synonym:selenocysteine synthase"
                     /note="protein synonym:selenocysteinyl-tRNA(Sec) synthase"
                     /product="O-phosphoseryl-tRNA(Sec) selenium transferase"
                     /protein_id="BAP60761.1"
                     /transl_table=11
                     /translation="MLDFNIEGLIPKNMEKRGELVLNEYLKEIEDVFNHRKIPENGID
                     DEKIKLFLKFLSMMDTDKDPKSVRIGEREARTYSKIHEELSSGFCHGIGRSGNLVDPQ
                     PKASGASIMYALTNKILESFFKQLGLNVHAIATPISTGMSISLCLSAARKKYGSNVVI
                     YPYASHKSPIKAVSFVGMNMRLVETVLDGNRVYIPVEDIENAIKKEIELGNRPCVLST
                     LTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSS
                     DKNLLTPIGGGLIYSTDAEFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKN
                     QKNSKKLLDELLNDLSKKTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGI
                     KKTDHFGNCYLGTYTHDYIVMNAAIGVRTEDIVNSVSKLEKILL"
     CDS             625723..627153
                     /codon_start=1
                     /locus_tag="MMKA1_06450"
                     /product="putative NOP5/NOP58"
                     /protein_id="BAP60762.1"
                     /transl_table=11
                     /translation="MLFIAFAPFGAFALEANSKNDGYSLDDIKYYKIFENEDIPKIMY
                     ALRQGDFEIIAELKNEWEIEEEDVSFEYTTSKNPLGELIRDNLYELGQKYEVFEDESD
                     FVSKMNVWATAFTKSMMKKSSEQKDKLIVQTVNALDNLDETLNLFSERLREWYSLYFP
                     EMDNIVKKHDIYVSLVSEYGDREEYTRTKLKKTMPSNVARTISLAAKESMGADVSEFD
                     LKIMKNLADEIKSMYEYRESLQEYLETSMNEIAPNLTKVAGASLGARLISLAGGIERL
                     LRLPASTIQVIGAEKALFAHLRERALPPKHGVIFQHPLIQGSPWWIHGKIARAISCKI
                     SIAIRADAFGNDISDMLIEDMNKKVAQIKEKFPEPTRKRRPRPDTRSFGNKGGQDRDR
                     RSQGDRKPQGKRGDSKKGGKPFGKKPAGKDDRRDNRKGDRKPFGGKPKNSGNQPPKER
                     SGEKRRDSTKKVKAERKVIGKTSSQN"
     CDS             627171..627863
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /gene="flpA"
                     /locus_tag="MMKA1_06460"
                     /product="fibrillarin-like rRNA/tRNA
                     2'-O-methyltransferase"
                     /protein_id="BAP60763.1"
                     /transl_table=11
                     /translation="MEKIRVKEIFDNVYSVDFGDGLKRIATKSLVPGKRVYGEKLVYS
                     DSIEYRIWNPNKSKLGAAIINGLKKLPIKKGEKVLYLGASAGTTPSHVADIAENSLVY
                     ALEFAPRIMREFIDSCNERKNLIPVLGDANRPQDYSNIVEKVDVIFEDVAQPNQAEIL
                     VKNAKWFLKENGYAMISIKARSVDVTKNPREIFAEQKKILIEGGFEIVDEVNIEPFEK
                     DHMMMVGIWKGN"
     CDS             628020..629306
                     /codon_start=1
                     /EC_number="5.4.2.1"
                     /locus_tag="MMKA1_06470"
                     /note="protein synonym:putative
                     2,3-bisphosphoglycerate-independent phosphoglycerate
                     mutase"
                     /product="putative phosphoglycerate mutase"
                     /protein_id="BAP60764.1"
                     /transl_table=11
                     /translation="MKTIVLDFDGLLDDSYEILDNKTPLEYAKTPNFDKLVQKGSCGL
                     LSPYKKGVPTYSVMDLFLMLGYSRDEFPGISVLRALGEDLELSDNAVYIECTFVSTIE
                     DNYGHRVVDRASCDLTDKELNQLMSLIPTNFEGYEFNLKTCADYGCVLSMTDKNGWIS
                     DKISDSDPYYPGRHVNKISPVYELCDSPGECKRAKSTAEALNKFLLRCHKILENHEIN
                     IKRKRKGKYPINFLITRFPGKNIDISTFYEKYGLKALSISNCRLAKGFSRFVKVDYLL
                     TKDLSESVNSSIKYLDNYDLMYVKCCRISEGQIKDPVEKAAVIEEMDACLDKITDLED
                     VLIVITSKKLSKMMGAFVNSGNEYSLIVSGKNVRKDNISEFTEKNCYIGPLRIEHNEI
                     LNLILNYMDKALLYGLRPGGYLLDYIPNDEDIEHLK"
     CDS             complement(629311..630057)
                     /codon_start=1
                     /EC_number="1.3.1.54"
                     /gene="cbiJ"
                     /locus_tag="MMKA1_06480"
                     /product="putative precorrin-6x reductase"
                     /protein_id="BAP60765.1"
                     /transl_table=11
                     /translation="MNIWIRGGTSDANNISKEIKKNFKDSFLILTTTTDFGGKIAENY
                     ADLVISEKMTYDNLKKTLVNKKIDVFIDATHPFATHASETGIKISKELEIPYIRYERP
                     VEEFNDASYVENFEKAAKLALKISKKNIFYMSGIKNLKTVSEIIPIEKLIVRILPTSV
                     PEALKLLPSKNIVAMQGLFSENLNKNLIIDYDCDVIITKDSGKSGGLYEKVSGATLAG
                     AKTIIIKRPEIDYPLKFEKIDELVHYLKNV"
     CDS             complement(630088..630780)
                     /codon_start=1
                     /locus_tag="MMKA1_06490"
                     /product="hypothetical protein"
                     /protein_id="BAP60766.1"
                     /transl_table=11
                     /translation="MAKFSKGQISIELILLMMAVLLAGILVSFHMTKFTFEGDILSDV
                     REGTYQVFAISIYEPPIYYSLNFSDVKISPSTNLENAWLQINDTGNDTYLWYYSDGTF
                     KGLANTSDPGESVTEDNLVLLPHEGYASDIIFRSNIPTAMTWNSYELDFTDIKKFEIV
                     ANDVENNPISYSLTHGDSPETSNQAYLNIKANDVTIIVTKANNKVFEVAVDETSGTIE
                     LLPYEETTTEIY"
     CDS             complement(630888..631556)
                     /codon_start=1
                     /locus_tag="MMKA1_06500"
                     /product="hypothetical protein"
                     /protein_id="BAP60767.1"
                     /transl_table=11
                     /translation="MLLNSKRGQLSIEMVILILAVLLSGTVLAAHMTKDTNNAGEVQE
                     LKKLTLGAFSSSAVESGASVIPEEENPQAEDGEDTEPEEEEENNLDKIYAKLDINPTS
                     SAKNNEFEATLYGGGTVELQKKGPTKGIYINETFYPLENTQKEINVTKIILRIKGDCV
                     IIINDTIVFDKNDKNFIIECVEGGTCPIPITIGMENGAGTYWLEIDVDDVKVTSESSG
                     SGKN"
     CDS             complement(631677..632330)
                     /codon_start=1
                     /EC_number="4.1.1.23"
                     /gene="pyrF"
                     /locus_tag="MMKA1_06510"
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="BAP60768.1"
                     /transl_table=11
                     /translation="MYGESLVKLMLALDVMDEKKAVLIAKETSEYVDSIKIGYPLVLA
                     TGLNIIDKIKEATNKEVICDFKVADIPSTNEKIAELTLNHADGIICQGFVGSDSVSAI
                     LNVAKEKNKKVIMVTEMSHPGATEYLQNVAEDMAKMADRLKVDGIVAPSTRPERLKEI
                     KSIAKDAFVISPGVGAQGGNLSDVLNVLNENDYVIIGRAIYENENPKNAAKKYKIQM"
     CDS             632476..632790
                     /codon_start=1
                     /gene="eif1a"
                     /locus_tag="MMKA1_06520"
                     /product="translation initiation factor 1A"
                     /protein_id="BAP60769.1"
                     /transl_table=11
                     /translation="MRGQQTPPQQPTRVRTPRENENEVLGVIEQMLGASRVRVRCMDG
                     KLRMGRIPGKLKRKIWVREDDVVIVTPWEVQSDEKCDVIWRYTKGQVDWLNRKGYLDF
                     MR"
     CDS             632799..633620
                     /codon_start=1
                     /locus_tag="MMKA1_06530"
                     /product="hypothetical protein"
                     /protein_id="BAP60770.1"
                     /transl_table=11
                     /translation="MKDVLKMDLDKKEKQLDREFQKKIVERKKKFLEELKTENEVFDQ
                     RTLLNIYNLLVAKHIDEISGVVNSGKEAVVFSANKEDELYALKVYRVSTCDFKTMWKY
                     IQGDPRFHLRRSSTRQIITAWVEKEFRNLLRAGDYINTPEPLLKRENILLMDMVHEDG
                     VPAPRLKDIEVDYSEFYEMIKEDMKVLYQDAQLVHGDLSEYNILVHEEEPVYIDFSQG
                     VVKEHPLSKTLLIRDVKNVCNFFKRKGIDTDYKEFYRHVSGEELALIDEEMAKTY"
     CDS             633701..634255
                     /codon_start=1
                     /locus_tag="MMKA1_06540"
                     /product="hypothetical protein"
                     /protein_id="BAP60771.1"
                     /transl_table=11
                     /translation="MYENVEVVKIPKERTGILIGTHGEVRKKLESDLGVELEIDSEGE
                     VNIYSTDEQKDPLALWKARDIVKAIGRGFNPEKALKLVSDEYAFEVIDISEYGNSDKA
                     IQRLKGRIIGSSGKSRRYVEELTSTHISVYGKTVSIIGEIETAKIAKDAIEMLLRGTS
                     HSKMYKFLERHRQDVKRSELRLWK"
     CDS             complement(634308..635084)
                     /codon_start=1
                     /locus_tag="MMKA1_06550"
                     /note="protein synonym:23S rRNA m2U2552 methyltransferase"
                     /note="protein synonym:rRNA
                     (uridine-2'-O-)-methyltransferase"
                     /product="ribosomal RNA large subunit methyltransferase J"
                     /protein_id="BAP60772.1"
                     /transl_table=11
                     /translation="MGKKDKRWVLQRKNDHYYNLAKRRNYRSRATYKLFQLNEKFNLI
                     KERNVVVDLGCAPGGWLQAARDIVGDNGFIVGIDLQTVKPLPHDNVIAIKGDMTKEEI
                     LKQAKDLLPEKPDVIICDASPNISGVWDVDHVRSLELTTMALMTATKMLKKGGNFVVK
                     VFQGDLFEKYVQLVSEYFDKAFTTKPRASRDESAEVYVIGKRFNGRKFDMNSKSPIVK
                     LLDTKPVEEEITSPSLRKEISKEDSGLMIKRIKEMRSKKE"
     CDS             complement(635109..636719)
                     /codon_start=1
                     /gene="nrpR"
                     /locus_tag="MMKA1_06560"
                     /note="protein synonym:transcriptional repressor of nif
                     and glnA operons"
                     /product="NrpR"
                     /protein_id="BAP60773.1"
                     /transl_table=11
                     /translation="MDSNIDVEILSILSEASAPVGAKIIADSLKDRGYDIGERAVRYH
                     LKVLDENSLTKKLGYSGREITEKGIEELEKANISFRIGSVFSQVIEKLYLSDFPSKVL
                     INTAKFEGDYKTIKEMVLRSFEAGYSVGDYLNIKKKGNTVSVETLCSITFDNFLLKNG
                     IIPTPEYGGIVKFEDYEPVNFEGVIDFKSSSIDPLVAFIMQGKTDVIGVIENGEGLVP
                     ANFRVIPKSSEKQFENILKKDMLNSVLAYGTENVLGMNLNPEQIGVVLVGGLTPLCVP
                     HESGYTADISAATQLKDISSMEKKTKGFLEAKKKKGKFKVTPVLSKMLSKMQTINYDI
                     EDKKGNVVVNTAKIPIEYKEEAINALKDSYENKLAISDRLKVECDDKFLNAYTICSLT
                     VDGVFLKNKIPVIPYYGGILEVKADKKRFIEAIDYEGTSLDPHEVFFNKADGKNYILA
                     GIRKVPMSASEKLIELNEKLGWNSIIEIGRPNNDICGVRVEKCMFGITTIGGTNPFAN
                     IRKNNIPVEMKTLHKSIDYSELTHYDDI"
     CDS             complement(636756..637991)
                     /codon_start=1
                     /locus_tag="MMKA1_06570"
                     /product="ATPase"
                     /protein_id="BAP60774.1"
                     /transl_table=11
                     /translation="MAVKIAELTCGAEYSGVQAEIEKAAKEVGGELIYPEVDLEYIDK
                     VNDYLGFEVASANLKLMFARAMSIIEGNTDAEAVFISTCFRCAEGALVRNEVRRLIQQ
                     NTDLPVVMYSFTERTKASELLTRMEALVTIVDKKALLARKKQDGISLGLDSGSTTTKA
                     VIMKNNEVVGTGWVYTKDVVESAQEALDAALKESGLKMEDIETIGTTGYGRHTLGDHY
                     KADLVQEELTVNSKGAAFLAGAQKGEATVIDIGGMDNKAISLNNAIPDGFTMGGICAG
                     ASGRFFEITARRLGVSIQELGDIAATGDWRNVMMNSYCIVFGIQDLVTGLAGGATPND
                     VAAAAAHSVAEQIYEQQLQEVDVRDPLILVGGSSLLKGMVLALEEILGKKIIVPKYSQ
                     YIGAVGAALISSGYRNLKK"
     CDS             complement(638128..638478)
                     /codon_start=1
                     /gene="pth"
                     /locus_tag="MMKA1_06580"
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="BAP60775.1"
                     /transl_table=11
                     /translation="MYEQAIVIRNDLKMGKGKMAAQACHASIQAFLHAQKISSSAVSG
                     WMNEGQKKVVLKVNSEKELLEIFKNVNIEGLPCSLIRDAGRTQIEPGSLTAVGIGPEK
                     EEKISKVTKDLKLL"
     CDS             638626..640575
                     /codon_start=1
                     /EC_number="2.4.2.-"
                     /gene="tgtA"
                     /locus_tag="MMKA1_06590"
                     /note="protein synonym:archaeal tRNA-guanine
                     transglycosylase"
                     /product="7-cyano-7-deazaguanine tRNA-ribosyltransferase"
                     /protein_id="BAP60776.1"
                     /transl_table=11
                     /translation="MFEIKARDAMGRLGSITINGKKIETPTIMPVIHPNPKKQTVSMD
                     LINKMADVVITNSYITYTTPELREIAETKGIHELIDFKNVVVTDSGSFQLSVYGDVNV
                     GPMEIIDFQEKIGVDVGTILDIPTGPDVSREKAESDLIETFKRAEDSIKRRSEMGYKL
                     ALNGTIQGSKYLDLRQKSAEVMGKMDFDIYPIGAVVPLMEDYRYREVAEVILNSKMHL
                     PTNKPVHLFGCGHPMLFALSVALGCDLFDSAAYALYAKNGRYLTEDGTLHLKDMKDLK
                     SFPCTCKVCSEYTPKQLFNLEEKEKTRLLAEHNLYVTFEEIDRIKNAIKEGNLWELVE
                     ERCRSHPKLLNGLRVISKYMDFIEKHDPVSKKSGFFYTGYESMNRPEIYRHKQRLERI
                     QYDKIYVTSVSENTSKPYSENLSNVPCNVDVLVKDRVFGLVPLNIDTMYPLAQNEVPD
                     LYDFEKKYNNDFVSEFNEKYAEKILDISTYNYYINHYGKKKECEKVNPDIFRIGKMLE
                     YQYGAKILDEELMGKVKSRRSKNTGRIRNLLLEKEVLFTLRANDNFLIPAKSGAELLH
                     EKLEFPKYRIVIDSSVEEFARAGKSVYSKFVKDCDPELRPFEEVLIVNSDDELLAYGT
                     TILNGRELMEFDYGVAATLRGGLKK"
     CDS             640629..641105
                     /codon_start=1
                     /locus_tag="MMKA1_06600"
                     /product="beta-lactamase like-protein"
                     /protein_id="BAP60777.1"
                     /transl_table=11
                     /translation="MLKVLYSGSVTYLDEKNNVFVAPSSSCTYIETSENKIIVDTSSK
                     DKKKIIISNLNKLDVKLKEIDYIISSHNHNNHNGNNGLFRNAKIVKYSDGSINDFKDP
                     EVEIIWTPGHTFDSISVIHEDYVVAPAAVHLKKIFYKIMIFPLQSILKFQKNQSKE"
     CDS             complement(641172..641696)
                     /codon_start=1
                     /locus_tag="MMKA1_06610"
                     /product="hypothetical protein"
                     /protein_id="BAP60778.1"
                     /transl_table=11
                     /translation="MRCFLAIELKTDLKENLEVLKKQFNLKGIKTVEKENLHITVKFL
                     GDIDDKKLEDIVNSDLKIKKVISEIKGVGTFPNEEYIRVIWVGTTNLQETFKNIDEKL
                     LKLGFKKEKSYDPHITLGRVKFIENDSKETLKRLIEKNKHINFGKIEINSVSLMKSTL
                     TKKGPVYETVKRWE"
     CDS             complement(641705..641851)
                     /codon_start=1
                     /locus_tag="MMKA1_06620"
                     /product="hypothetical protein"
                     /protein_id="BAP60779.1"
                     /transl_table=11
                     /translation="MKWLEELTELLECPVCKGDLELLSNKLCCKKCKKVYLIKDKIPV
                     LLDE"
     CDS             641932..642732
                     /codon_start=1
                     /EC_number="4.1.1.5"
                     /locus_tag="MMKA1_06630"
                     /product="alpha-acetolactate decarboxylase"
                     /protein_id="BAP60780.1"
                     /transl_table=11
                     /translation="MNRFVKFLIGIMVLFSGCISTNDNSVSEVKSEQVSDVLYQVSTI
                     NALMESIYDGFIPVNELVTHGDFGIGTFDKLDGEMVVLDGICYQVKTDGVAYEVENVT
                     TPFATVTSFENDETYYLDNMNISEFESYFESKFPSKNMVYAVKLTGTFSKMKTRSVPS
                     QEKPYEKLVDVVKNQSVFEFENVSGTVVGFWVPEFMSGLNVPLYHLHFITDDRLAGGH
                     ILDFEIDSVEASFDTTPEFYMVLPTSGEFYSMEFSDNLENDLKAVEKQ"
     CDS             642828..643403
                     /codon_start=1
                     /locus_tag="MMKA1_06640"
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="BAP60781.1"
                     /transl_table=11
                     /translation="MKVVAFNGSPRRDGNTSILIDKVLNELKKEGISTEHIHIAGGKL
                     RGCTACYKCFETLNNKCIIECDIINNCIEKMIEADGIILGSPTYFTDVTAEMKALIDR
                     AGFVAKANDDILKRKVGAAVVSVRRAGGVHVFDTINHFFSINQMISVGSDYWNLGMGL
                     DIGDVQKDTEGLRTMELLGQNMAWILKKINK"
     CDS             complement(643616..644908)
                     /codon_start=1
                     /EC_number="5.4.99.-"
                     /gene="truD"
                     /locus_tag="MMKA1_06650"
                     /product="tRNA pseudouridine synthase D"
                     /protein_id="BAP60782.1"
                     /transl_table=11
                     /translation="MNAPFIQNARKKESEEIINQFRKEKQFKFRNNKIRQKLSEMPIN
                     INKFILDMERFDGTLKKYPEDFIVEEITPEGTVLEVGKEIGFEDVEKWHGSFIHFTVE
                     KTNWNTMDALKQIVRATKTKRKNFGFAGTKDKFAVTTQRFGCFGLKKEQLENINIKDI
                     VIRDVQKTNKKLRMGGLWGNKFTIKIRDLNLSEDEIKRISDLKLDYVLNYYGIQRFGL
                     IRPITHIVGKFIYERDFESAFYTYCGTPINETGDSLEARQLVDMGEFKKALKLFNRGH
                     DYEKRLIQQYLKFKDFKMAFTALPPQLNSMFVNAYQAYLFNEMINKRFEYGFDALEGD
                     ILEDNTPTGTLIGYDTEFSGGIQGEIEKEIVERENLDLKKFKIEDFGNFYGTRRKMVT
                     PIYDFKSRFENEIFELSFKLERGNYATIVTREFTGNLS"
     CDS             645039..646313
                     /codon_start=1
                     /locus_tag="MMKA1_06660"
                     /product="hypothetical protein"
                     /protein_id="BAP60783.1"
                     /transl_table=11
                     /translation="MYIGIDDTDSRDHYCTTYVGTILQEELEKTYLMDTPKLIRMNPM
                     VKYKTRGNGGVCLRIIEDEKKLNESEIESIKKLVIETVEKFSDFDCKNTNPGIVFLSE
                     ENYQKNQKTLLNYYNSVLYDILKVEDSEKILNEIGAEYIKYKKGHGIIGALGAIASKP
                     PFTYELLAYRKSEKWGTEREIDTDSIIKMDTDTFPFTFNNIDGKKSIITPHTPCPVLY
                     GIRGISREILEKAKNTVKSDEIDKCQVYITNQGTDVHLRFSKIKDIYPDTGVISYGKI
                     VENPKEITGGQVLFKMKDDTGEIDCIAYEPTKEFRNIVRRLSCGDLVGVYGTVREDPF
                     EINIEKLKIVTLQKIYEKNKFCECGGTLKAKGLKSGYKCNICGKRVNYDQIKLNEVKR
                     DIKEGFYEVPPSARRHLSKPIVLYDFDLENIK"
     CDS             646360..647010
                     /codon_start=1
                     /gene="radB"
                     /locus_tag="MMKA1_06670"
                     /product="DNA repair and recombination protein RadB"
                     /protein_id="BAP60784.1"
                     /transl_table=11
                     /translation="MLEELLNGNIEKKTITQIYGPPGVGKTNICIISMLKAIENGKNV
                     VYIDTEGSLSIERIKQLSGKDCDELLKNIIIYEPSSFEEQSEALEKIFLLENVGLIII
                     DGIVSLYRLELCDKINENTKLNRMLGKQISNLLKVSRQKNSGILITNQVKDSINGIEP
                     AGGRLLEYWSKSIIKIEKSESIRKLTLEKHRHAKEGENLRFKILQNGLEIINKSYQ"
     CDS             647116..647445
                     /codon_start=1
                     /locus_tag="MMKA1_06680"
                     /product="hypothetical protein"
                     /protein_id="BAP60785.1"
                     /transl_table=11
                     /translation="MRILLKLFVESQNLGKAINALSEGGISGFYLKEYQGMSPDDWKG
                     FLLAEEPEMAIKIVNELSQDTVVINSIVNIECLGKIKELVRKELENDRYTLVELPVLG
                     MEVNSPE"
     CDS             647456..647851
                     /codon_start=1
                     /locus_tag="MMKA1_06690"
                     /product="hypothetical protein"
                     /protein_id="BAP60786.1"
                     /transl_table=11
                     /translation="MKFRKGRPKILRLISEEPQFKLFKPVGIPRTDLESEVLTFEELE
                     SIRLVDYLNHPHEDAADEMGISRRVFWNILKSARKKVADALINGKMIDIGGGYYKIRD
                     CNYEDECQRGKFCKYGVSNCLRLKNRDSE"
     CDS             647874..649469
                     /codon_start=1
                     /locus_tag="MMKA1_06700"
                     /note="protein synonym:ABC transporter ATP-binding
                     protein"
                     /product="methyl coenzyme M reductase system component A2"
                     /protein_id="BAP60787.1"
                     /transl_table=11
                     /translation="MLLLEVKNVSKSYGDTEVLKNVSFELNEGDVMGVLGRSGAGKSV
                     LLHMLRGMEGYEPTSGQIIYHVAYCPHCENVEAPSQVGKKCECETEYVAKSVDFWNNN
                     EITYALKKKIAIMLQRTFALYGEKTVAENIMEALTAAGYEGKDATEWALNLIKMVKLE
                     HRVAHISRDLSGGEKQRVVLARQIAKNPVIFLADEPTGTLDPKTAKFVHNALTEAVIK
                     HNIAMVITSHWPEVIEELCQKAIWLDKGEMRLVGESKHVVEEFMKTVTSMKEFEKVEV
                     KDELLKLENVEKRYVSVDRGIVKAVDGIDVSINEKEIFGLVGVSGAGKTTLSKIIAAV
                     IPPSKGNYEFRLADEWVDMTKVGPLYRGRAKRYIGMLFQEYSLYPHRTILYNLTESIG
                     LEMPGEFAKMKAEHTLVSVGFTEEEAENMLEKHPSELSVGEKHRAALAQVLIREPHLI
                     LLDEPTGTMDPITRNQVAESIQKSRSELDQTYVIVSHDMDFVLNVCDRAALVRGGKII
                     KTGKPDEIVKILSEEEKDEMIGH"
     CDS             complement(649489..650298)
                     /codon_start=1
                     /locus_tag="MMKA1_06710"
                     /product="hypothetical protein"
                     /protein_id="BAP60788.1"
                     /transl_table=11
                     /translation="MVKIGCSSLFFWEYDIGEIVDIFLEIGLKNMEFFPENPEFWKKR
                     NDLDYINNVKTELSKIEVTIHAPYIELNSSSTNENIRHVTLMETFWAIDLSKKFKSEL
                     LTIHPGKRPTARIPTDEEYNNFDDYLEKSINYALKNEITLCLENSPKKINNICYNVES
                     MKKTLDKFENLNMTLDIAHARENSLDFIKNFHKKIKNMHISGVNSKDHYPLSESKINF
                     DETLNSLVNEYKYQGALNFELNDLIYNKTLLKQEKIDIIINEVQYLEKIIE"
     CDS             650345..651253
                     /codon_start=1
                     /locus_tag="MMKA1_06720"
                     /product="putative ADP-ribosylglycohydrolase"
                     /protein_id="BAP60789.1"
                     /transl_table=11
                     /translation="MDKMLEKFEGSILGLSIGDALGMPTEWFTKEEIAEKYGLIDNFV
                     DPKNKFNGILKAGQYTDDTDQTIAILNSFDVRGFNNDIFIKELIKWYNNNPVGIGPTS
                     TKAIEKLIEGDTTGCDSRTCGSSMRVGPLGLFYFGEYDKLKEITIKATKLTHNNDEAI
                     AGALSIAFFVAESVNNVKSEKSIKRCAKFIEDVSYDFSEKILLINDLNSADEAYNLFN
                     TGLPAIECVPSAIATFLRTDTFKDGMISCVNAGGDTDSMGSMYGAIAGAYYGVSNIPE
                     IWIAGLQNKDLLVDLSKKLYKLRFKK"
     CDS             651318..651986
                     /codon_start=1
                     /locus_tag="MMKA1_06730"
                     /product="hypothetical protein"
                     /protein_id="BAP60790.1"
                     /transl_table=11
                     /translation="MADYDFEITSRPSYSLLKINLKDQEIMTETGSMVYKDNGVNIET
                     SAKGGVLGVLKRAVVGESIFMNKLSGSGRIALAPGYSGDIVHHELNGTLYASSGAYLA
                     SSSDLSIDTKFGGGKTFFGGKGLFLMKIEGSGDVFLSSYGAVEEIELNNESIMVDNGN
                     LVAFTGDLNYNLGKVGGLKSTLLGGEGLVYNFSGTGKIYIQTRNIESFIDFITPYLPT
                     PKQG"
     CDS             652050..652451
                     /codon_start=1
                     /locus_tag="MMKA1_06740"
                     /product="hypothetical protein"
                     /protein_id="BAP60791.1"
                     /transl_table=11
                     /translation="MVKLTEEMKTEITGLLFLATSSKDGVPNVAPMGANQFVGDKLVI
                     SDNFMKKTLDNIKENPVVAINVANCRSHPFQYKGKAEIVTDGEYFEKAKELNKVKVPG
                     LTPKGAIVITITSIYSVKPGPDAGSLVETDD"
     CDS             complement(652570..652803)
                     /codon_start=1
                     /gene="rpl14e"
                     /locus_tag="MMKA1_06750"
                     /product="50S ribosomal protein L14e"
                     /protein_id="BAP60792.1"
                     /transl_table=11
                     /translation="MAAIEVGRVCIKTLGREAGNTCVIVEVLDKNFVVIDGSVKRRRC
                     NLKHVEPTDKKVDLEKAASTEEVKLALDAAGLL"