LOCUS       AP011119                4367 bp    DNA     circular BCT 02-APR-2009
DEFINITION  Rhodococcus opacus B4 plasmid pKNR01 DNA, complete sequence.
ACCESSION   AP011119 AB193159
VERSION     AP011119.1
DBLINK      BioProject:PRJDA34839
KEYWORDS    .
SOURCE      Rhodococcus opacus B4
  ORGANISM  Rhodococcus opacus B4
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Corynebacterineae; Nocardiaceae; Rhodococcus.
REFERENCE   1  (bases 1 to 4367)
  AUTHORS   Sekine,M., Hosoyama,A., Kosugi,H., Yamada,R., Matsuo,Y.,
            Tsukatani,N., Fujisawa,T., Takarada,H., Omata,S., Kishi,E.,
            Shimizu,A., Koga,C., Saito,S., Nakazawa,H., Sekigawa,T.,
            Nishiko,R., Takeyama,M., Tanikawa,S., Tago,S., Fujita,N., Kato,J.,
            Na,K.S., Ohtake,H., Nagayasu,K. and Harayama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2009) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Genome
            Analysis Center (NGAC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Takarada,H., Sekine,M., Hosoyama,A., Yamada,R., Fujisawa,T.,
            Omata,S., Shimizu,A., Tsukatani,N., Tanikawa,S., Fujita,N. and
            Harayama,S.
  TITLE     Comparison of the complete genome sequences of Rhodococcus
            erythropolis PR4 and Rhodococcus opacus B4
  JOURNAL   Unpublished (2009)
REFERENCE   3
  AUTHORS   Na,K.S., Nagayasu,K., Kuroda,A., Takiguchi,N., Ikeda,T., Ohtake,H.
            and Kato,J.
  TITLE     Development of a genetic transformation system for
            benzene-tolerant Rhodococcus opacus strains.
  JOURNAL   J. Biosci. Bioeng. 99, 408-414 (2005)
COMMENT     Kato,J., Na,K., Ohtake,H. and Nagayasu,K. are at Department of
            Molecular Biotechnology, Hiroshima University.
            
            Rhodococcus opacus B-4 strain was isolated as a benzene-tolerant
            bacterium (Kyung-su Na et al 2005). The complete genome analysis
            of R. opacus B-4 was carried out by NITE. The genome analysis
            indicated that this strain has one linear chromosome, two linear
            plasmids pROB01, pROB02, and three circular plasmids pKNR, pKNR01,
            pKNR02. The nucleotide sequence of the linear plasmid pKNR01 was
            previously determined independently by Kato et al and was
            registered with the accession number AB193159, which is now merged
            with this record with the permission of Dr. Kato.
            
            The differences between the entry AB193159 and this record are as
            follows.
            'A' was deleted between positions 2211 and 2212.
            'T' was deleted between positions 2329 and 2330.
            'G' at position 2719 replaced 'C'.
            
            This work was supported by New Energy and Industrial Technology
            Development Organization (NEDO).
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            The microbial genomic DNA clones used for the sequencing project
            are available through the NBRC.
            URL:http://www.nbrc.nite.go.jp/e/index.html
FEATURES             Location/Qualifiers
     source          1..4367
                     /db_xref="taxon:632772"
                     /mol_type="genomic DNA"
                     /organism="Rhodococcus opacus B4"
                     /plasmid="pKNR01"
                     /strain="B4"
     CDS             complement(367..648)
                     /codon_start=1
                     /locus_tag="ROP_pKNR01-00010"
                     /product="hypothetical protein"
                     /protein_id="BAH47256.1"
                     /transl_table=11
                     /translation="MKPRDGRRDDAQFDLFNHLRKWTYSAHQSFEGDGQSWLDEVTEV
                     AEEFHDKLLSCRLDPMPTQLIHDLAADCAVWTWETMHTGIVTSAENSSS"
     CDS             complement(912..1178)
                     /codon_start=1
                     /gene="repB"
                     /locus_tag="ROP_pKNR01-00020"
                     /product="replication protein RepB"
                     /protein_id="BAD95582.1"
                     /transl_table=11
                     /translation="MGAAERVMRRTQTAQELADKFGVSKSTIKRLVAEDRGDYIARAQ
                     ERRKKAVELRKQGLKYRQIADQMNISTGSVGTLIRQARIHGEMD"
     CDS             complement(1178..2092)
                     /codon_start=1
                     /gene="repA"
                     /locus_tag="ROP_pKNR01-00030"
                     /product="replication protein RepA"
                     /protein_id="BAD95583.1"
                     /transl_table=11
                     /translation="MTAAVDAWLDRWRFKYPHATDDYVRDGQWPQPRAEALTRRYIAA
                     RTPSIRLGLVLDVDDDQAQWAARNADLPDPTVMTINPATEHAHLWWLLESPVYTLQAA
                     RQGPLRLYDRVNQGLIASVVGADQGYAQQLTQNPIHPHWTTVWGPSDPYSLKGLAKAL
                     GDRFPAPPDYGRKTQVRTETGRNVELFDRTREWAYREIRKQNYPSITVWRQMVTDFTA
                     LTNFTLDANDGIGPMSRAEAEQIGKSVAHWTHRTFTAAEFSKIQARRGKVSSSAKTEA
                     VRKNATAPRPKLKKVDRSALFAAAEGTD"
     CDS             3257..3841
                     /codon_start=1
                     /locus_tag="ROP_pKNR01-00040"
                     /product="hypothetical protein"
                     /protein_id="BAH47257.1"
                     /transl_table=11
                     /translation="MTTPRCPRCDREIESNTSAVHGRGRPRKWCSDECRKLASEERRA
                     AERGIVAVELRERVVEVEKVVHRPATTAASIDRVLDDDQALQKLLNTLRHRIKEGTYR
                     PNRDPGTAMWMLQRLTAPVADLLAQIHSSAGTTPPMDPAQAVRTVLHSPRSCRAVLEG
                     LERMARSGELDGGQHTATLIALDRLVARTRRQSR"
     CDS             3936..4118
                     /codon_start=1
                     /locus_tag="ROP_pKNR01-00050"
                     /product="hypothetical protein"
                     /protein_id="BAH47258.1"
                     /transl_table=11
                     /translation="MMDLDAQVAVLRDQLNALGRQVREVTEAAGEQDKPDVVDALADV
                     RMHLNDAAAVLGDVIV"
     CDS             complement(join(4254..4367,1..285))
                     /codon_start=1
                     /locus_tag="ROP_pKNR01-00060"
                     /product="hypothetical protein"
                     /protein_id="BAH47259.1"
                     /transl_table=11
                     /translation="MGDAAGDRHRRVGRSGRGFEHPEHNGLGLDDPLTFGSDLFSGSK
                     LNMRECQFSFEFGDPTGGLGRPLHMVMNRVVNRVGRGGSVRVQSSSQQVVDPNRPALL
                     RFDRTGQLACLNAAEQGCPTDPCTPSRLGQ"
BASE COUNT          756 a         1404 c         1414 g          793 t
ORIGIN      
        1 gtcgacgacc tgctggctgc tggactgcac ccggacagac ccgccccgcc cgaccctgtt
       61 cacgaccctg ttcatgacca tgtgcagcgg ccgcccgagg ccgcccgtcg gatcaccgaa
      121 ctcgaacgag aactggcact cgcgcatgtt cagcttgctg ccgctgaaca ggtcgctgcc
      181 gaacgtgagc gggtcatcca agcccaggcc gttgtgctcc ggatgctcga agccgcgccc
      241 agaccggccg actcgccgat gccggtcgcc ggcggcgtcg cccacaccaa cccaccgccg
      301 gctgaagaac cgccggccac cctttcaccc gatcggcggg cggaaccggg caatcccctg
      361 acctggctac gaagacgaat tctcggctga ggtcacgatt cccgtgtgca tcgtttccca
      421 cgtccacact gcgcagtcgg ccgcgaggtc atggatcagt tgggtaggca tcgggtcgag
      481 gcggcacgaa agaagcttgt cgtggaattc ctccgccacc tcggtgacct catcgagcca
      541 gctctgtccg tcgccctcga agctttgatg cgcggagtac gtccactttc tcaggtggtt
      601 gaacagatca aactgcgcgt cgtcccggcg gccgtcacgt ggtttcaccg gccgatgctt
      661 acgaggttcc ggtgttgcgg caggtggttt cggtttcgcg ggtggtgtct tccggggtgg
      721 aggtgtccgg gcgggggcat gccaccggca cggccccttg cctccggttg cgataatgca
      781 ttgtgtccca tcatctttga gcgccccgca ttggcgttcc ggagcatgtg tcgggcacac
      841 atcgcggcct gccaaggctg gatgaccgca taggtcacca gttctggtct gtccgatgca
      901 ttgcaacggt ttcagtccat ctcgccgtgt atgcgggcct gacggatcaa cgttcccacc
      961 gagccagtcg agatgttcat ctggtcggcg atctgccggt acttcaaacc ttgtttgcgc
     1021 agttccacag ccttcttgcg gcgttcctgc gcacgagcga tgtagtcgcc tcggtcttcg
     1081 gcgacgagcc gtttgatggt gcttttcgag acgccgaact tgtcagccaa ctcctgcgcg
     1141 gtctgcgtgc gacgcatcac gcgttctgca gcacccatca gtccgtcccc tctgctgctg
     1201 cgaacagtgc cgatcgatcg accttcttga gcttcggccg cggcgcggtg gcgttcttcc
     1261 gtaccgcttc cgtttttgcg ctgctgctca ctttgccgcg gcgtgcctgg attttcgaga
     1321 actcggcggc ggtgaaggtg cggtgggtcc agtgggcgac tgatttgccg atctgctcgg
     1381 cctcggcccg actcatgggg ccgatcccgt cgttggcgtc gagggtgaag ttggtcaggg
     1441 cggtgaagtc ggtgaccatc tgccgccaca cagtgatcga cgggtagttc tgtttccgga
     1501 tctcgcggta ggcccattcc cgggtgcggt cgaacagttc gacgttccgg cccgtttcgg
     1561 tcctgacctg tgtcttgcgg ccgtagtccg gtggggcggg gaaacggtca ccgagcgctt
     1621 ttgcgaggcc tttgagcgag tacggatccg agggacccca gaccgtcgtc cagtgcgggt
     1681 ggatcgggtt ctgggtgagc tgctgcgcgt agccctgatc ggcgccgacc accgaggcga
     1741 tcagcccctg gttcacccgg tcgtagagcc gcagcgggcc ctgtcgggct gcctggaggg
     1801 tgtagaccgg gctttcgagc agccaccaca ggtgcgcgtg ctcggtcgcg ggattgatcg
     1861 tcatcacggt cggatcgggc agatccgcgt tacgtgcggc ccactgcgcc tggtcgtcgt
     1921 ccacgtcgag caccaagccc aacctgatcg acggggtgcg ggccgcaatg tagcggcggg
     1981 tgagcgcctc cgcgcgcggc tgcggccact gcccgtcccg gacgtagtca tccgtcgcgt
     2041 gcgggtattt gaaccgccag cggtccaacc aggcgtcaac agcagcggtc atgaccgcca
     2101 agctagggcc ggatctgtac cgatcggggg aggcgcgccg caaattattt aagagtctcg
     2161 ctagcaaacc atgtcaggtg ttgcggtggg ttccgggtaa acctccaccc gaattattta
     2221 agagtctcgc tagctaagcc ctatctgatg ctgcgcgggg ggtccttcgc actgaatctc
     2281 aaaggtggcc ggctgaattt cgtcgcgcga aaacctccct ggacagttct ggaattcagc
     2341 aagaggtgtg tctgaacttc ggtgtttttt tggggggtga ctccagcggg gtgggcacaa
     2401 cgcgaacaga gaccttgtgt gtacgacggc gggaggtaag tcgggtacgg ctcggactgc
     2461 ggtagagcaa ccgtcgaatc gatttcgagc agagcgagca gagcaagata ttccaaaact
     2521 ccggggttcc tcggcggcct cccccgtctg tttgctcaac cgagggagac ctggcggtcc
     2581 cgcgtttccg gacgcgcggg accgcctacc gctcgagcac cccgagagcg acggaggctc
     2641 ccgggacccc gcccgtgcgg agagcaagat aggcacttac ctgacgtaag tgaggagtga
     2701 cggtgcgcga gcggtcgcgc accgttggtg ttgtttcggg cggagcaaga tggagactta
     2761 ggtgccctaa gtcgtcggag cccggttcgg ggcgctgcgc tgggccggtg gaacctggtg
     2821 agcgcttaca gcgtcgggca gatgcgcgaa ctgtccgatc acctcccaca ggcaccggtg
     2881 cagatctgcg gctgcccggg actcgggtgc ggtaacagtg tccgattccg gagaccacga
     2941 gatctgtggg tcgatgtgag agacggcgcg gctcaatccg cgcgcccatt cccgcagacc
     3001 ggtgtcatcg acgaacgggt cccaggcgcg gatccacgcc gacaacgccg gccaccgcag
     3061 ttcgtcactc accaccgaac acctcaacac gtctccgact ttgctagaga tccgatctgt
     3121 tgccgtcatc cgcgagtagt gaaagttccg agcaagcctc gttcgaacag gcacaaccag
     3181 ccatacaccg acacacctct tgcactcagg agtgaataga gggctatttt cgcgcgacga
     3241 aattaggatc gcggctatga cgacaccgcg atgcccccgc tgtgaccgcg agatcgagag
     3301 caacaccagc gccgtgcacg gtcgcggccg gccgcgaaag tggtgctcgg acgagtgccg
     3361 caaactcgcc tcggaggaac gccgcgcggc cgaacgcggc atcgtcgcgg tggagttgcg
     3421 cgagcgggtg gtcgaggtcg agaaggtggt gcaccggccg gccacgacgg ctgcatccat
     3481 cgaccgcgta ctcgacgacg accaggcgct gcagaaactg ttgaacacgc tgcggcaccg
     3541 catcaaggaa ggcacctacc gacccaaccg tgaccctggg actgcaatgt ggatgctgca
     3601 gagactcacg gctcccgtgg ccgatctgct cgcccagatc cactccagcg ccggcaccac
     3661 cccgcccatg gatccggcgc aggccgtgcg aacggtgctc cactcgccac gctcatgccg
     3721 cgcggtcctg gaaggcctcg aacggatggc ccgctccggt gagctcgacg gcggccagca
     3781 caccgccact ctgatagctc tcgacaggct cgtagcccgc acccggcggc agagccggta
     3841 gaaaacgggc tgccgcggca ccgctgcgcg ctgccttgcc accgaaaaca agttcgccga
     3901 catgcccgca agcttcagac cgaaggagtg atcgcatgat ggatctagac gcacaggtag
     3961 ccgtattgcg cgatcagttg aacgccctcg gccgccaggt ccgcgaagtc acagaggccg
     4021 ccggcgagca ggacaagccc gacgtcgtcg acgccctggc cgacgtgcgc atgcacctca
     4081 acgacgccgc cgcagtcctc ggggacgtga tcgtatgacc gcacaggtaa ccgaagatcg
     4141 acacctgtgc gcgtggtgtg ggcagcacat gaacatgtgc gcccacactg atggccatgc
     4201 ccccggacac ccctgaccac gacgcccgcc tgaacagcca acggccccgg tggtcactgt
     4261 ccgaggcggc taggcgtaca ggggtcagtc gggcaaccct gctccgccgc attgaggcag
     4321 gcaagctgcc cggtgcggtc aaaacggagg agagctggtc tattggg
//