LOCUS       AP011118              111160 bp    DNA     circular BCT 02-APR-2009
DEFINITION  Rhodococcus opacus B4 plasmid pKNR DNA, complete sequence.
ACCESSION   AP011118
VERSION     AP011118.1
DBLINK      BioProject:PRJDA34839
KEYWORDS    .
SOURCE      Rhodococcus opacus B4
  ORGANISM  Rhodococcus opacus B4
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Corynebacterineae; Nocardiaceae; Rhodococcus.
REFERENCE   1  (bases 1 to 111160)
  AUTHORS   Sekine,M., Hosoyama,A., Kosugi,H., Yamada,R., Matsuo,Y.,
            Tsukatani,N., Fujisawa,T., Takarada,H., Omata,S., Kishi,E.,
            Shimizu,A., Koga,C., Saito,S., Nakazawa,H., Sekigawa,T.,
            Nishiko,R., Takeyama,M., Tanikawa,S., Tago,S., Fujita,N., Kato,J.,
            Na,K., Ohtake,H., Nagayasu,K. and Harayama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2009) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Genome
            Analysis Center (NGAC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Takarada,H., Sekine,M., Hosoyama,A., Yamada,R., Fujisawa,T.,
            Omata,S., Shimizu,A., Tsukatani,N., Tanikawa,S., Fujita,N. and
            Harayama,S.
  TITLE     Comparison of the complete genome sequences of Rhodococcus
            erythropolis PR4 and Rhodococcus opacus B4
  JOURNAL   Unpublished (2009)
COMMENT     Kato,J., Na,K., Ohtake,H. and Nagayasu,K. are at Department of
            Molecular Biotechnology, Hiroshima University.
            
            Rhodococcus opacus B-4 strain was isolated as a benzene-tolerant
            bacterium (Kyung-su Na et al 2005). The complete genome analysis
            of R. opacus B-4 was carried out by NITE. The genome analysis
            indicated that this strain has one linear chromosome, two linear
            plasmids pROB01, pROB02, and three circular plasmids pKNR, pKNR01,
            pKNR02.
            
            This work was supported by New Energy and Industrial Technology
            Development Organization (NEDO).
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            The microbial genomic DNA clones used for the sequencing project
            are available through the NBRC.
            URL:http://www.nbrc.nite.go.jp/e/index.html
FEATURES             Location/Qualifiers
     source          1..111160
                     /db_xref="taxon:632772"
                     /mol_type="genomic DNA"
                     /organism="Rhodococcus opacus B4"
                     /plasmid="pKNR"
                     /strain="B4"
     CDS             complement(1..444)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00010"
                     /product="hypothetical protein"
                     /protein_id="BAH56093.1"
                     /transl_table=11
                     /translation="MTFRQNAVRTVAVSAATAAIALVTNAVAAADVPPHTPGIMGDDI
                     VQLDNSGPCNGPIHVDFETTAARPGNLSVLLTPRGSFGARPACATNIQVDWINGIAPF
                     THTLRVPVDNGTTRIDVPTGAGVSLVNVSNFPLRALAISSYVLVP"
     CDS             complement(589..1761)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00020"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56094.1"
                     /transl_table=11
                     /translation="MNDLSIRAARIQVRALIAALIVAISIAIGITTGAFVLSFAVQRD
                     LALQAGIPHYLTWIFPAIVDGAILGATIAVVALSKISGRATGKRFFLWLAVVVVFISV
                     FGNAYHARRAGEEAARNVAAGMDLGFTPLTPTGASLIAIIPPLLVLAFTHGVGILIKA
                     IGTAHTEYNALCNDIASRSVEERESSGAVSTRLNPQVPDPKAQDSFRSINSITGNASN
                     AGVDIDIDVDAAETQVAGVRTSRDATSDDIAEAWPTGVDRCDGEDDVVAEVVADDLDV
                     ACNELATAETETPVLPDELQTTEYLLAFIESSKLDPMVKETARLKIEHPDATFAALAE
                     ATGEKWASTALRRYNKAKDLAVEAGFRTPPLPLTDEATDNGSDESESTPYELVGVR"
     CDS             complement(1839..2231)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00030"
                     /product="hypothetical protein"
                     /protein_id="BAH56095.1"
                     /transl_table=11
                     /translation="MSATDRAITGLPPRSGASARAATPDVSALRRQRNKAATDLTSTA
                     AAAQQPAEPEKKPSNKPTTVYIAPDVLKEARLAFKATQSAEADRNWSHFVEKALAAAT
                     QRRAAQHNDGNAFEGEDKPLPPGRPLAD"
     CDS             complement(2228..3178)
                     /codon_start=1
                     /gene="parA"
                     /locus_tag="ROP_pKNR-00040"
                     /product="putative plasmid partitioning protein ParA"
                     /protein_id="BAH56096.1"
                     /transl_table=11
                     /translation="MPPPRTHVVPQRDAVALHRVTAVINGKGGVFKTTLAANISGLLA
                     ESGYKVLLVDLDPQGNIAEDLGYTYGEIDDEGKNLAQALSFGDPITPVRDIRPNLDII
                     PGGTHLSMATAALASKATKDPLGAKLALATALAPLAGEYDMVLIDCPPGDETLQTAAA
                     AAAKWLLVPTKTDGSSRKGMAAVAARLTSVMDVNEELDLLGVVLVGVGANSTSVQRTA
                     REGIATAFGGDADDVVFEKMVRHSEATALAIRERGVLVHELDDVVQSGPKWYEVVRGS
                     AKAQEHAPKSAKEVAADLLAVCQEMVQRITEAEASEVAAS"
     CDS             4065..4883
                     /codon_start=1
                     /EC_number="1.1.1.1"
                     /locus_tag="ROP_pKNR-00050"
                     /product="putative alcohol dehydrogenase"
                     /protein_id="BAH56097.1"
                     /transl_table=11
                     /translation="MGYFEGRVVAITGAGAGIGRELALQLVQSGAHLALSDSSESQLL
                     ATADLCADGPGDIYTSVVDVTDRAAVLAHSTDVASRFGRVDALINNAGVLFAGDVLDT
                     TFEDYERVVDVDFWGVVNGTKAFLPHVMRSDRGHIVNISSAFGLMAAPSYSAYNAAKF
                     AVRGFTESLRQEMVLGGHRVKVTCVHPGGIRTTIARTARHAAGVDGTELADSFERRIA
                     RTDPNVAARTILRGVQRGSARVLIGADARAVDMVTRTLGARYLSILPALKKLGA"
     CDS             4960..5964
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00060"
                     /product="hypothetical protein"
                     /protein_id="BAH56098.1"
                     /transl_table=11
                     /translation="MATKWLLVSTFGGAVPSIVGQGRTPKPFVPLEQVIKSRRSFADA
                     TSAITEVMAHPTKIDRLSSDGLRRVIADPLCTFEGRLHAIYLWVGSAEEKVAQRDPAG
                     AWYFNLTDFKVSGSDDLFDLYGVAPENRRSEAAMAGAFDRLDTGVDEGHALAKIVKST
                     PGMEHQAVWTVKRDDGARRAAHFSCRAVEERPDPNSDRKVVILRGVTHDIGPADDVPT
                     APPPVILEHRVLDAKLKPGEYLAYVDHKKLSLLKWRGNPMPGIAWEGGVGEPTPAMHP
                     DDVEVARRLSADLARGSTSGVIRFRGLDGEWKPLHLEVSLMAFDQHTMGALVTVSAAP
                     "
     CDS             6273..8045
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00070"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAH56099.1"
                     /transl_table=11
                     /translation="MSGDMFVRTSSRRNKDGATVRYLQLAHNQWDPASKSSKMKVLYN
                     FGRAEEVDRAGIERLIASLARLLDTPALSGASEPGEGLTFCESRPLGGAWALDGLWSR
                     LGIGTAIRRLLGGTRRDAETTERVLFALVANRALAPSSKLAAASWIGEDVHIPGLAAT
                     SDDACYRAMDWLVGAEEQLARTVYASVADLLNLEVDLLFFDTTSTYFETDEADAPIWR
                     DTRGHLVDVTDDPARDPGAGTDEESGSLEPPAGAVRQAGFRAYGKSKDHRDDLPQVVI
                     GMAVTRTGIPVRVWSWPGNTTDSALIRQVKADMRDWNLSRIVWVADRGFASAENRRYL
                     QRAGGGYILGERLRSGSAEATAALSRQGRYRDVTDGLRVKEVRLGDHERFVIAHNPDT
                     AVRDAAVRADMLDRLRETIADTDKLTVTKRAELRGVLSTKPGLNRYLRVTPGGLLRVD
                     AKAIAAEAKLDGKYLLRTNEPHLSAEDIALGYKQLLEVERGWRDMKQILDLRPVHHRL
                     EDRIRAHVLLCWLALLLIRIVETTTDQTWTTTRRELQRLHVGHFTGPAGTYRQTTALT
                     PAQRSILTRLDVTPPPRILELTAG"
     CDS             complement(8127..8660)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00080"
                     /product="hypothetical protein"
                     /protein_id="BAH56100.1"
                     /transl_table=11
                     /translation="MRRPTTSTRNPQCRTPRTPCRTAADVVARFAQGAKTVIVDSPPD
                     QILELHDLIGTGTLRITGTSRVRITTSTPQQQTRSPAIVVTDAAQVQLEGHSRCYAYT
                     TAIIEAFDDTKVEARNKTTVYAVDRAKVRATDEPTIYAYDQATIHADGHTTVHATDNS
                     RILLHDNPEFRSSGVGR"
     CDS             complement(8783..10684)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00090"
                     /product="hypothetical protein"
                     /protein_id="BAH56101.1"
                     /transl_table=11
                     /translation="MDRAQGISRPDAGLITHARVTPPSGDPDSTQLLYNTCTRVWSPR
                     RRVRVDPDRKHKYDASISMPLQQPEFPWAVYLASSDHRFRLLVFDFDTSRFGADQARA
                     DSDRLAAHLDDLGVQFLRAHSGPTGGQHIWIRLGEDGADPAAVGELNRVLVQHYPTFD
                     KSPLRNPDKGVVRPPGAPHRNGGRSVPHLAGAELQQALERVSRGTTPEVVNWLLARHP
                     HVEPATPPEEHRRPRIIEDAAGPRLDRPRRPLPHRTAALLATVPSKGADRSALAYTIL
                     LSMARAGHTLDDARAAVATAPGLIRLREDAARGRDDTERQWSRALARAATFTADPGQA
                     PREPIDDDLDTIEHALAATTAHWGRRGGASDERILHALTALARTARTRVLDIDCRRLG
                     QTCALDASTVSRRLRLLAREGWVTLATPSAGTRAARWTLNLPPDVGVEITSHATQGEP
                     APASGPGLTLLTHHAHDLWSPPRSGGLGAATARVHWFYRSGVDSLTGLSEKTGYGTEY
                     IERALTRLHSAGLLTSEATGEQLLRTLETVAQTRGVAGINARRAARHLVDRELFTWWN
                     EEHLWRAARGKKSGARRTTSTGMLALPISAPARVRYGRFPTRSNGRADYPTARAVVSQ
                     INSAVRAAA"
     CDS             complement(11203..11697)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00100"
                     /product="putative Xre family DNA-binding protein"
                     /protein_id="BAH56102.1"
                     /transl_table=11
                     /translation="MVGYSSGRTPGVDEVPRSGVRGFRGDKLREQRVKARLTPDDLAA
                     RIGTTRQAVSTWETGRSRPAPEMLGLLAEALDTSIAVLVPIPAGKLRMSDLRVRAALN
                     QRNAAARLGIGATTLAEVENGVKPVRDDLVPKIAELYGVDKRIVAEAWKRGHEHRETR
                     AKNL"
     CDS             12961..14214
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00110"
                     /product="hypothetical protein"
                     /protein_id="BAH56103.1"
                     /transl_table=11
                     /translation="MWCAVPVALCVACAGVAQAAPSQPGTGGGSQPGTGGGSQPGTSA
                     PAPEQSRDYLPGYTPSPNVQNSEWRQYSDWETGYQQPQYEAPQYAQWSSPQTTDYDAA
                     PSYQQAYVEEPTQSAPSVVEPEPVPAPPMVERKGIAPVEAPEGYIFTGAGLLEQPDWM
                     PDEDRDRITNTIAAVQADAGNALTDAGVNAPQADRITGGAIGGGLLGAGIVGTGLAVP
                     AAALGAGIGAGIGAGIGAAVTAPTGGWGVGPGAAIGAGTGAVVLGAPAFVLGAGLGGV
                     GGAVAGATVFGGQDVTVQEPAPEPAPEATPEPLWTPPVVDTAAVSAQTSAVVEQVQAV
                     PGGSEVVEQARDFAALAPAYVEQATPRVDASAALVRDAALTQPGGDQVVASVESAGTN
                     AAAAAAPVIEQAAAFAGAVVNGLNA"
     CDS             14228..15784
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00120"
                     /product="hypothetical protein"
                     /protein_id="BAH56104.1"
                     /transl_table=11
                     /translation="MKLLPRVAAAAAVAVIGIGSAGTAYAAPAGPASELVGDSCPALF
                     ALGIQGTGESSPDTPATLDTGMLSQVFMPMMVKTTDSAGDTLAGRAYVPYPAGFGGAV
                     PGANVPYSQSVEEGLQNLIDTAAEVAQACPNTVFTGAGYSQGAHVMSMFAKRVGAGEG
                     PIPANKLVGVALFGDPTRAPGSPLFPGAAGQTSPKPAPGTTGAQVGKISAPAQATPEG
                     GGIGPTADTAVAYGSLTGRVASICEPGDLSCDAPANAPIMRAVTNIAGQSELSSGDPI
                     QSLTSISEALALTTIKTAVPVINEDIQGTTLANLSIDPKKSLSERVAIASDPRTEMPT
                     AQEAISAVLKVGTIGFNAVKTVAKEVLTPANIAQLATVGLANPAAGVALFATKLVGAI
                     PKLMPPATTSRLTRQAFDVVKDNISDNADLVSTTALTKYWNTVRAHGSYGSTPVTATG
                     QSAAQFVAEWFAALAKDVAAGTDSSSVTSTPRVTSQTTTAPRTSSSTTPASSGATSAR
                     PTSTSPVAAG"
     CDS             15848..16600
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00130"
                     /product="hypothetical protein"
                     /protein_id="BAH56105.1"
                     /transl_table=11
                     /translation="MTDTNFRRPDPTAGELTRWYPSFTPAAALADTSPVEHPAEHTPD
                     LPVDQAPPVAAPAPTPSVAAATRHRISPRAVAGLGSAAATAAVAAGLGVWALGGGQDS
                     SPTAAAVTAQPTTAPLTSAAPRPWCDPAAAVDGVIIGNGPGGTDSGPAAILAFDFAYY
                     VQRSGEAARAVVAPDAVGVEPANLLQSAIDTYIPAGAEHCVTIRAAEPQRFLVTLRER
                     QPSGEEVAYTQQAITTRVVDGRHVITSIGEAS"
     CDS             16597..17535
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00140"
                     /product="hypothetical protein"
                     /protein_id="BAH56106.1"
                     /transl_table=11
                     /translation="MSTEPEWMQWLNQEPEPETDLPPAAVVPLRGADSPASSAPAEHP
                     APAPRDQDPQREAADTPVWPQPPITAPPLVLVTGVGGGAGATTTAIGIAGAWATHDAS
                     SSVAVVDLTVTGGDLRSRASIEDLVTTIDTLIESVEPEALVSDLPLSAAGARVVDRGD
                     SRFDDPVVHRVPDLLRSHVDTAVYDLGADALGSRECVRLREDADAVFVLVVQARADAF
                     NRLRGYLDLLANAVGESVFEHTVVVISHQNSAEPDVDPAELVGYLSGRVRATLEVPYD
                     PHLATGLEIASWELRAATVGAYDRIRRATASAEGRQ"
     CDS             17532..18176
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00150"
                     /product="hypothetical protein"
                     /protein_id="BAH56107.1"
                     /transl_table=11
                     /translation="MMMSARSFSRWSQPQTSGSGIPVRTPNRVAEIWDRPVPRGLGSP
                     APLVWLLGAHGGAGISTLGHVLDFASECGQKWPAPFEGESPFVAIVARERVDSLDKAG
                     DLIRQHVSGMAGNSTLIGLITIADRPGRKIPREIDQTRKIVGGLAPTTWRIEWIEHFT
                     LVRDPRELPVWSHRDPVPENKKRAADDPTAVPSEIAEIAGALRNSIISRLHPGT"
     CDS             18213..18500
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00160"
                     /product="hypothetical protein"
                     /protein_id="BAH56108.1"
                     /transl_table=11
                     /translation="MMLLQSTLDTISVLAQGIELPPEPPPKSEKLLELGRWASWVVMF
                     AGVLALVYGGGKFGWEKFNGGSLESPKIIAGALVGGVIAASAGGIMASVVS"
     CDS             18497..18748
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00170"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56109.1"
                     /transl_table=11
                     /translation="MTVVAMWIPSEAVTEPLLQLGRYVMWIIFAILTIRLVWYGGLFA
                     WNKQQNPYESEPAARIGMTLGAAVLCSAGSGIAAALLTF"
     CDS             18766..19458
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00180"
                     /product="hypothetical protein"
                     /protein_id="BAH56110.1"
                     /transl_table=11
                     /translation="MITTRLAAASLAAAAAAAPMIAGCGSTEETTATDSVTTPAPPDP
                     TTPPAQIEWDRFQSIWLPFADEGPTRNTGNGAVSGFSHTPQGAALAAIHQTVRMSVAR
                     DDQWAAVVHEGLAPGPERDAFAVSRAQISVTAAADPAEAPTLGGYVVADYTDERADIS
                     IRTSFCDQSAAITDTTVVWTGTDWQLQLPAADESASRVHVYDPQTATYDTGREVALAA
                     PAAACSDQEGTP"
     CDS             19455..20363
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00190"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56111.1"
                     /transl_table=11
                     /translation="MTTEDTESTDHKPDSSPAADQRPRSGRRGRTAATSKHGLGFTFW
                     LAAVFVFVVVAGGGVAYFASRDDNDTAEGQVPVTLAPQSERADWGLPFTDELGRRVEV
                     PPNPDGVALDQDTDSRKPASDITGAPGGLQWQQIRSFPLPFSTSDGPTGIDGRMATGF
                     AQTPRGAALAGIQLYTRGGATMAGAAEFYADRVVPDSDPLEQLRQDFLRRATDAIASG
                     RGDERALLPYFRVDAYRVTQWDTQRPDYAVVEYAMLKESRTGWVSKSAELLWRDGDWQ
                     IKLTADLYGGQKEVSNLGGWTQWAAN"
     CDS             20348..21907
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00200"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56112.1"
                     /transl_table=11
                     /translation="MGRQLTRIFTALAVVLAIVLGAATTAAAQDTEPKPGEDRSVVCQ
                     GVEVAGQGLGQLIPGFGGVNIPGLPSTGDVVGNLSGSLCDNNGNPIGAVKDFASEQLQ
                     EQWDSQFGKIVTSIIDGMSQAMIMAITWWIKIPNADLESFGPLAQINEYTIWIQSFLL
                     IISIGFMSLRLAAARRQLMVEQAEETFRTLFRVVVTAATMSVIVALATRAGDAFAVEV
                     VNATSNNDPAGTVQSMMILNAYSGMAPGLMLIIGFFGAFGALAQAFLMPIRQGFLIVA
                     VAALPVAAAASGTKTGSQSYDKLLAWVIGFCLFKPVASLAYAMAFLTTQSSALDVPEG
                     QTPTLGQFQYSLIGIALLASTALVLPALMRIITPAISAVGSGGSGAKATAGALLAGAA
                     LLTGGKALGGKLAGGKAVPPGGGFSGGGGGSGTPGLVGGGGNPGNGSGSRGNHSGSRG
                     TPSTHGPRQGGPRGNGANTGSGPKKGSGAKASKWVGAGGGRGSRSVDSAAGDLAGDNY
                     AHPTSRHNIPR"
     CDS             21921..22091
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00210"
                     /product="hypothetical protein"
                     /protein_id="BAH56113.1"
                     /transl_table=11
                     /translation="MTSEIARIQLGKIADVCELDRAGVLPPVEAFRAADPGSCDVDHA
                     PTLLPPTGGDHR"
     CDS             22088..23584
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00220"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56114.1"
                     /transl_table=11
                     /translation="MSATRTNSEPQVYLGGRAPRNEGVMGLSGPVTWFILGTLIISLL
                     VLMRWGLKVGAITGGVLLLAVVPMVLKRHGLTGYERSLLAMQFFGALRRKENIYRGGL
                     FSEMPGGKSQLPGVLAPTKMYEGEDSAGYRFGMIHMPKTNQYTIVMRAWPQGDEAVDR
                     GLVNQWVGEWGIVLASAGLTSDIEGIVPVLDTVPETGNALLTQARAITRVDAPALAKA
                     VVFEGATEFHRDEVQLAARVAITFAATTDERKKDPGAQAVEIGRRLPGIRAAIEASGV
                     AVRPMTAAEITGVVRRSFDPASQLTIERAEATGDDHGITWDNAGPISHENKWEEYWHD
                     GGRSVTWLMSAGPKSAVDESTLRRLIAPHPDLPRKRVAIVYRPHRAADAVKIIDDDYR
                     NAIVAAQNRNRGISSAAAQIDVELAERSRDELARGHGATRIGLLITVTEPIEADMPRI
                     DALVGDLAVQCQLNIRRCYRFQDAAFAASLGIGVLLPDHASMPSALTA"
     CDS             23603..25273
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00230"
                     /product="hypothetical protein"
                     /protein_id="BAH56115.1"
                     /transl_table=11
                     /translation="MFEIMTPEQRAKYQTRVYAGGIGGGWAKFKIRTDDNRRRNASAR
                     ERTEQSTTAGGPKLSDRGHRGAGGGRAASVGKQPELRSTSVHAAGAFWPWSVGAGAPA
                     VGPVIGSHLVTHAPVSFGLLNWFRRGFITAPVAFVLGLNGYGKSSFVRKVILGAMAQG
                     VTALFLADKKPDYRKIVEEVAGTDAVVDVGYAFGHINPLAGGVLGSIIPRLAAFPDLQ
                     LRWLEELRGRQTETVSALIELRRGQAIEDWEESIVGSAIAILFDEKGFTPDEPPLLED
                     MLGLIIEGHPQLLEDAGVDTIEDYREAVRPLRRSLRAFVNPKSRFGRIFNGQTTHPLS
                     LDHPAIGFDVSHIPNGDKKLRAAVMLVCWSDGFALIDAANALTDAGLAPQRFFEAVMD
                     EIWDVLGLGPFMVDRIDALTRLNRQIATGLWMITHSMADLETAADGATTSRAVGFLER
                     ARVKIIGPIPEKEIDRLDGVVTFTDTEADMVTKWSSPPPMTGEQPREDQPAPPPPGTG
                     NVLIKTGDDPRAPGIPVHVIFTRSEIESGVHNTNARYTDTAAREEDAA"
     CDS             25270..25572
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00240"
                     /product="hypothetical protein"
                     /protein_id="BAH56116.1"
                     /transl_table=11
                     /translation="MIPQRRYRDVSPELRTAAVKSVALLQNEVSSRWRAIQLVAEATG
                     VHPNTLRNWVEAHPDGPRSPRRDLERELRERDAALAAASEMIADLSSRIRDHAGRD"
     CDS             25581..27269
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00250"
                     /product="hypothetical protein"
                     /protein_id="BAH56117.1"
                     /transl_table=11
                     /translation="MDIKKLVAAAVAAVLGLVLLVVVVASDSGNECPAPATPGGSTAP
                     AGSLVKPTESGTTTLTSGFGPRWGTEHRGIDFAGEVGTPIYAFTDGRVIAAGPASGFG
                     NWIIVDHQIDGKVVSTVYGHMFDDGVLVKAGDRVSAGQEIGRIGNAGDTTGAHLHFEV
                     WDGGRLPDGVGTAVDPAPWVDQAIEPGQAPAPETGEGDGGAPTSPGTSTAPGLAVYNA
                     RQLAIAKQAVAIGEAMGVSERGITVALATIGRESTFRMLASSVVPESLNYPHDGVGSD
                     NKSVNQYQQQVGIWGTVDELMNPVTANVKFYQALLQVSGWESMPVTLAAQTVQASAHP
                     EAYAPWEDAAHAMYSEFKGASKELTTDELSQISSAGRATAVAAGGILPDACPPAGGEH
                     GPLAPGPFGQKVIEAASRWLGTEYAWGGGDVNGPTRGISDGGGAADAHGDTNKIGFDC
                     SGLTLYAVYQASGGAISLPHFTGDHSNPGQLYDARGQDIPFDQKQPGDLIYFGSGGST
                     HHVGIYHGVTDGQDMLLNAPQSGDVVSIQPLSNWAGEEMYVRRFGDQPTERQPQ"
     CDS             27266..28264
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00260"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56118.1"
                     /transl_table=11
                     /translation="MTNTISTDDSPMTASAHVIGAPLGQHLEWISWIVLVAGAVIVTV
                     AGAVWGVAAVDRADGREITRDLVVLRIHAHVDRIYQHLPIPLGHRSHDRTQTDSEHEG
                     TGHMTENVIENPAPKSAAIKSWGQEEVAPHNWAAKVLGDQTEILEANGWQVTERQRDL
                     AYLSALEALDAEVLRRPLRGRGQPSPLYASTIHQITATELRKVAGEPAPVKPWERVSL
                     GLLVAAAAITVGLTWKVARDIASEFLRIDDTLWLGTERQQTAANWLFWLGQSGAVAAG
                     ILLVPALVTAGVTLVRRVRPRYTSGALALAIVAAVVCMATVVTTTFIAIMFAGLGR"
     CDS             28269..28865
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00270"
                     /product="hypothetical protein"
                     /protein_id="BAH56119.1"
                     /transl_table=11
                     /translation="MNRHHSRTIRGGVAAAMVTVALLAAGCGSSDDGHDHAAEPMDSG
                     GPTAALTTPPPPQLPEQFSGVDQNDPEAVMVAAAQALFSYTPATDPTQAAGADRAAAL
                     LDERFYAENKAAFSVLAPITGAQWDRWASANATVTARAAVTGDNHPPDAPARISRVVA
                     VTQTATTPAGAVLDESTVAVYMSATRLGVWRVSALTVR"
     CDS             28969..30756
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00280"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56120.1"
                     /transl_table=11
                     /translation="MSDRGVKDPVNSAREMYLIAAVVAVVGVVGGGVMLALRLGTDQE
                     VPANPAVVLIDLVKGHLQWSTTATVLITVYAVLVLAAAFVILVLVARSRGKRTRVDNK
                     AKHMGRLRDVGSLTEKLCRKESDRLGVVLEEGAAPGVPIGKHLLSGQNLYAKYEDMHV
                     DIWGPRSGKSSSRVIPAILEAPGAVLTTSNKRDVVDATRDPREAKGGKVWIFDPQKVA
                     DGENTWWWDPLSWVTDEVRAADLAAHFAAGDDGLDAKKDSFFDPEGQDLLTALFLAAA
                     AEQKPITQVYTWVTDETNVEPVNILRKHGYDLHASGLSGQYNAPAKQRGGVFGTARKM
                     IRCLKMQSIRPWVSTDGQRSWVPHFDPREFVRSNDTIYLLSREGNGSAGPLVTALTVA
                     ICEAAEELATRSKGGRLPVPLLAALDEAANVVRWTQLPKLFSHYGSRGIVIMAILQSY
                     AQGTEVWGNKGMGMLHSAANVKVYGGGCEVAVDDNYLRSLSTAIGEHWEYSGSVSSGR
                     GGRSTSRQRTKITTFTESELEELPRGRAIVRSSGNRATLVKTVPWWEGPYADQVRASI
                     ERHDPEADKTLAEAVTLTDDAEPKEVQPV"
     CDS             30753..31484
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00290"
                     /product="hypothetical protein"
                     /protein_id="BAH56121.1"
                     /transl_table=11
                     /translation="MTSLDEFDLPEPPDEDPAPPEDSWAPPLEGLVPAPAPAATPADG
                     NGAGDALALSDELSARIGKVTGTLLSTQIKAIAETQLAELLTPEIYQRIEELSRRRLA
                     AELETQLVAAAHAADAAENPPTTVFGSTEEFVRVRLAPGYRRDVIDNREIRWCPQWWR
                     HEEAISRLEALWRTWEHFRLDATTGMSVWWRDHADHHMSVLMSSEGPFSKCSVQHGHH
                     TPDNAIAPLPTDPAPAGMFPDTREL"
     CDS             31506..32399
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00300"
                     /product="hypothetical protein"
                     /protein_id="BAH56122.1"
                     /transl_table=11
                     /translation="MDMHRDDGIYTATCRHYEHRPSSEGPIGVTTTQHTSQAAAFDAL
                     HEFLSTAYEVGPRYDITITRDDTPQREVVFATGGPATVDRLRPAINEARSAYSSAWDI
                     LKAHANDLIAELRDPNALVHHPTPELRDVAWAARNQYGPRHRTRDAYQSHTGEELDRA
                     KNLARDAGHTEDQIDRATRADPDMDMHSLRQRSANMIRDVRSFATNYNLPPDQASALH
                     AAADRAEDTVAELAAPSGVPPAVPSLDSSTTIQQDITAAARLAASDFPSPARSVLVSP
                     NQPEPTHKSTAAPTRTSSLNL"
     CDS             32439..33263
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00310"
                     /product="hypothetical protein"
                     /protein_id="BAH56123.1"
                     /transl_table=11
                     /translation="MSEGPEVDSANHEVNAMMRVALQLASRMAEKMARNRERDLEQAR
                     RESAEHARELAQRLETSRAAAEAYLRASFDDQWWNRAQPGEIADQWQHAQAWKEHSQV
                     ASEAVERIRAETAKRYGIDVDAPGADEKVVDALLRDAENRKARAGAEHGRSQADTMTA
                     SEILDEAERADAERADENERNETNSEDVEPRTLGGDSLRSVADHDYDSAERRGEDTDQ
                     MRAAGIDEEEVATRMRADLDQARHPVEAVAGAGSHPKARKGRARRGKSAERTMTGR"
     CDS             complement(33330..35345)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00320"
                     /product="hypothetical protein"
                     /protein_id="BAH56124.1"
                     /transl_table=11
                     /translation="MTKSDPKTSRRSGRTFGETIAGPMARFWAGSHGPSRVDTVRVLK
                     SVGLECVGTNRQELVLHALESASDEDAKEALPRLLRLLRGLLSRAQRSTLGREDELVD
                     AVADLIETLKRVDVVLDPSGTLHWSGDTQEGSAATSPLATPAHTISPSSDLRQSQRET
                     PVSQPVTSPARDRRVFLVHGRDHRIKKSMVQLLRTFDLRVIEWEEAASYTGSGSPTTM
                     DIVTAGMEAAGAVVVLFTPDDLGRCRDEFLSDHDPQFERDLTPQPRMNVIFEAGMAMQ
                     KDREKVVLVRFGGVREMSDIAGVNYVQIKDTSDSRRDLGRRLRNTGLAVDMENDDWRT
                     AGDFTIPPSAGRGAATPSAGGPTVQPEPPPERDLVGQVKRYVVDGSKSIDLIDLVKNT
                     TKQLRRDINELPIVTSSSGPLEPLEARYRLLYELTEPTLQILHAGVEYDPASGDNRAW
                     PLALQELVDARGRFKKDGNSLIQRMPESAYDKSRHFPALLAFRVIGLSTLCFDSDADL
                     WIKLAENVKWRDTDRGPTAPRLPALRVLDEHEVLDERSVMNFAGMQDVAGLGFALSRY
                     LRKMLRPLFAEACPDDEDWSQLNDQYEYRRGLFYLRHDVEPGPTLAAGERRWGRDVWE
                     PEAIFVEEAQAAGSDWSWWPIIGDKSELADAIALARDRVGRRFLRRL"
     CDS             complement(35390..37108)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00330"
                     /product="hypothetical protein"
                     /protein_id="BAH56125.1"
                     /transl_table=11
                     /translation="MIVKIGTGGKMTGLLSYLQGPGRSNEHTDPHLVAGDPAIMAWHH
                     DNELSHQDAIEIGRQIDEPRRVFGTVVREPNYLRDSNGEDVRDSHGKKVRDPIDPWRD
                     ANVWHCSLSLHADEGQLTDEKWGEIAQQFMDEMGFTSQSGRSPARWVAARHGLSSKGN
                     DHIHIAASAVREDGTKVDLWRSKRRASEIVAKLERQHGLAVIASRETNSGERGYHRAE
                     KQRAEREGASELDRELLARRVRACATASKSEAEFVRRLRGQGLIVRPRFASGRGDVVV
                     GFKVAVRPANGHSPVFYGGGHLAKDLTLPRLRSEWEDSPQASAAAVDEWNAARRERPT
                     VRAGRESQELDPKLLDRATEDIGKWNAYLRSIPLEDRAQWARAAGRTAGVFAAWSAKI
                     EPTPGPLAAAARQLARSAQLPAHRAYRAPKGAMSAGGAALIVMQTGGHLPNSVSAMLL
                     LRQLMKAMEAIADAHRASGELYRALDIEYAARTELAAIYAPQQPRLSVPDSARVEDRM
                     TRQDGTSTSTLTPEQEELRRLVALDNASPPSEAVRRPGSPIPAPLDPSPRTHAGRDRA
                     QEGNER"
     CDS             complement(37105..37503)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00340"
                     /product="hypothetical protein"
                     /protein_id="BAH56126.1"
                     /transl_table=11
                     /translation="MSEDAVDRPRRFRRERRANVDGGRQARHVVKVTPEEESALLAKA
                     QHARVTVPRLLVESALADHSETASERREFAEQLFSGFRLLSAISINVNQMAKATNATG
                     DLPDNLRVTLDEVRRVARRIDGILQEFDAR"
     CDS             38059..38481
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00350"
                     /product="hypothetical protein"
                     /protein_id="BAH56127.1"
                     /transl_table=11
                     /translation="MYGSRFAGNVYTIDRMENQSLETEFAALDEQIRREAEKKMQAIR
                     VVATAHKTLADTREEFARADAANKKALTDAIAAARSAGFTDADLKRWQADDNKPSRRG
                     QQRRPRKAAQKDQPGTPTATASTDSSPQPANESLAASA"
     CDS             38610..39335
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00360"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56128.1"
                     /transl_table=11
                     /translation="MASKASVQSGSSSHFWDRFSEFATFARLAPNEPGFAALLGLHGL
                     VAAVVVVKLVPPCGPVWSVGAELARGFRWLGLAPVRIRNQPVSRRTQLLWLVAIPGTL
                     ALLHLLLATQLVTAFPVIDPAEDAANDAREILGTKYGLYSALTYAFFGSALVEEIAFR
                     NVVLLVQRWRPHATLLIAIIATASTALFAVSHLNYGTANVVSGFVGGAVYVGLALYTR
                     SLWPAIMTHFIYNTVIMVGWVAM"
     CDS             39467..40102
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00370"
                     /product="hypothetical protein"
                     /protein_id="BAH56129.1"
                     /transl_table=11
                     /translation="MEDTLSVTSGISPLPGMPVPSPHAEDEQLALIGQPQPVRVPARL
                     WRSWLTEPTIVARFEAKIYRRADELCTVWTGSVSSTGHGSFRAASLPGTSRRGTVPAH
                     LFAYQLEYGVIPRLGWSGADDAVLCHQCDFAGCVNPHHMRLGTNAVNRTEYYLRRRNL
                     ASPLADIRGPAGRTRAVAAAVRAGLANGDESDGIELRIRRAEAAGLPLTLW"
     CDS             complement(40246..41865)
                     /codon_start=1
                     /gene="parB"
                     /locus_tag="ROP_pKNR-00380"
                     /product="putative plasmid partitioning protein ParB"
                     /protein_id="BAH56130.1"
                     /transl_table=11
                     /translation="MTATLQPVGVELIEVDPHTLDVGKNVRDQVDLEATPGFVASVRE
                     HGVLHPITANRREDGVLVVIDGQRRTLAAIATGRDTIPVLVRSQDTTDEIERAIARIS
                     EQMNSNNHRTGLTTAQNAAGIAEMLDLGVPVERVSKELSVKRKAVKLLGAVGRREAAR
                     ASLEEQGLTIEQAAVIATFEADGDTEAVETLAQCQRHSFDYQARILLADRKEKATRAE
                     RTATYAEAGFTVLDSDPGFGDDTKIHWRYIATAEDAEADPRAHITEEQVRQRPELWGV
                     WVRTDTMYVEVESGEPVEEGDIDWDTFDDPDVEPEEGLRHANSVEERDVYVPQFYFLD
                     VLRAEDAGLVPVNGGRYQFNRAIQLAGFNPTNPLPEDEEAREAALLAAEEAKRVQRRR
                     VRELNKLAESATDVRREFIREMLSANKPPKNAATWTAMMVALAPHQLSEFHSSDLLPE
                     LMGDKTWTTYDAKKKIAAAATAASESRAWMLTFALTVAAMESRMAKDAWRSRPQYVSE
                     YLAMLTENGHTLSNVEKVISGELRPEDIDIT"
     CDS             complement(42168..42983)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00390"
                     /product="hypothetical protein"
                     /protein_id="BAH56131.1"
                     /transl_table=11
                     /translation="MSIQRLQSHWAFTRMPFGRDLAPGMLHRHPGHGEAVARITWCVD
                     QRAIGVITGEVGAGKTVAVRAAAAALDPSRHVIIYLANPTIGVRGMLGHVVAALGHTP
                     AFHTASLAPQASEALATEHAERGRNPVLVIDESHLLDNHQLEAIRLLTNHEMDSGSPF
                     AVVLVGQPTLRHRLRLGVLAALDQRIAVRYTIAGMSAADTADYIRHHCRIAGRDDTLF
                     SDDATELIHNASRGHPRAVNNLALHALTAAFAADHAIVDEKAARIAISEIAAD"
     CDS             complement(42980..44461)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00400"
                     /product="putative transposase"
                     /protein_id="BAH56132.1"
                     /transl_table=11
                     /translation="MSLDEHKRRERAQAIGLFRYRLICPALDEGLSTKQRGKLVREIA
                     AEPHADPFGNQVRISRETLDRWIRRYRRGGFEALVPEPRRLAARTDTQVLELAASLKR
                     ENPTRTVAQVARILRTATGWAPSESTLLRHFHRVDLMGPGAGEAPAVFGRFEAADPNE
                     LWCGDALHGPRIGDRKTYLFAFVDDHSRLLPGYRFGFAEDTVRLAAALKPALAARGVP
                     RAIYVDNGSAFVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEVTD
                     TSSEDLAAAGVDHAAALLEMNRLFTAWVETEYHRRVHSETGQSPLARWQDGWDRLGRT
                     PAMPTAADLTEAFLWSEHRTVTKTATVSLHANVYEVDPALVGRKVELVFSPFDLETLE
                     VRYRGKSFGTATPHTISRHAHPKAKPETTAPQSPAQTGIDYLALTAVAHHEQLRRDER
                     IGYHALYSTTHGHAADENPALSLDDDTVVVLDHTPATDGEVSA"
     CDS             complement(44530..45171)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00410"
                     /product="hypothetical protein"
                     /protein_id="BAH56133.1"
                     /transl_table=11
                     /translation="MVTVEADPVHVESRLAAGTIGCPSCGDGVLGGWGYARARRIVGL
                     GDRLRPRRARCRACSVTHVLLPVAVLLRRAYAAELIWAALTVRAEGGGHRRVAAVVGV
                     PATTVRGWLRRMAERLEEVRSWFLGVAVVAGVDVTIPDTTGCRWRDVLSAVETAAAAV
                     RSRFGPAGFVGAVTPVRVAVAASGGRLLAPGWPSAAPRPDATPVAPDAGGDDR"
     CDS             complement(45345..45548)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00420"
                     /product="hypothetical protein"
                     /protein_id="BAH56134.1"
                     /transl_table=11
                     /translation="MTEDAVRIIREQGFTAGVLASCGESDDEPLHVLAERAGIEFGYM
                     AAELDTFNDGFATGWQIVDRLCG"
     CDS             complement(45565..45912)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00430"
                     /product="hypothetical protein"
                     /protein_id="BAH56135.1"
                     /transl_table=11
                     /translation="MNVTPGAPSVPMRVLHNEARDAMLIGYTDGDPLREVIRFEMDPR
                     RDLEVNLEEVFEVFNEPGPQLVGLEVVRRYRAERHRSLSKGDVLFYGEVAYAVAAAGF
                     VRVYPTRESITFR"
     CDS             complement(46044..46448)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00440"
                     /product="hypothetical protein"
                     /protein_id="BAH56136.1"
                     /transl_table=11
                     /translation="MRTTFSAVVIEIDGTMTAQDLPVDPLWASLRIPAGIGAALDAVG
                     DVGTTGFVLGRGPHQGTASLLVGANHQHVPAVPINQLATAIVHRYGPVTDHPIRGRAV
                     LVAGWDENPEPILGPVAEALIASRSARPAQAA"
     CDS             complement(46477..46692)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00450"
                     /product="hypothetical protein"
                     /protein_id="BAH56137.1"
                     /transl_table=11
                     /translation="MSTTIVLDTVIDPINVARAIYADLRVEEDPDFDDLDTDMRAELV
                     GMVFGLVPDDPYIQAAEIRLVPADFGL"
     CDS             complement(47318..48235)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00460"
                     /product="hypothetical protein"
                     /protein_id="BAH56138.1"
                     /transl_table=11
                     /translation="MSAASHLSRMIVTAEPSANPHEEGCGCGREDRGMTELKPGRIPV
                     GDPIALRFDPETKRRLEEMAEGIGPRRFGALVRVACRRLVNQPKAVGRGLSEQRRISE
                     ALRAIPLVMLKIKVEPATALEFAELAVEHDTTVSALMRIALHRFLEAPGRYKHPLLRE
                     AERAGLSDWVDVMVLPSSKQQVWRLAGRYGDKLNTALLRVVLRRLLDEPGDLTRDLEA
                     IAPLRDLRPEIYPARANVHFDDALRDKLDALAARVGSDRAELMRLAAKRVLDEPGMID
                     QAVTREIFRSEKNKKHLLARHARRHTQPD"
     CDS             complement(49001..50272)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00470"
                     /product="hypothetical protein"
                     /protein_id="BAH56139.1"
                     /transl_table=11
                     /translation="MTMTNEQTNRAVAQMTGDPMSEEEREPTAAEILEWRRDAVFLPE
                     EDATPDEFPSLYNLSAGFMFGGMVRPLEPSPPEYVALSMPHNAGPEFELAVGKWNMLW
                     ESAQFRRRFFDVDDLPDQLAKLAELGDVNVTLVPRTRSRYFEYAPLMHLLPKRVLDMF
                     GLPTLRRGQWPFMADNAGVDDFLPADFAARLTRAWAWTVWPHLESGSKMKAFSDDDPV
                     RLLTHNLDFWVPAVTAVIQDRLRDFDEVDKGKTAGPVTLEDGSVLEAAVAGNPRKGGP
                     VWFGEDDAREALVETVEAADRIGQLRGILDAVRSHRIEDDFSSHWSYAREDFERKLHG
                     KRRKIKVTFVELTDTIPVQGPESEIVGNVVTNDFLALLDARNRQIVVLLNSGVTSKSE
                     IAEMLGYASHSAVSKRLAQIRREAETFFDRN"
     CDS             complement(50407..59076)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00480"
                     /product="hypothetical protein"
                     /protein_id="BAH56140.1"
                     /transl_table=11
                     /translation="MAARVERVSADAHEARDAAERARQVCTDAGYDVDGVDVAAVSRA
                     RPPRRTWRDRPATDRQQSYLRTLRRRRGLPVRLPDDLTIGRADEQIKMLRARSGKVAD
                     ASDPEIARILAEAETQRAQDEHAEHTGPPLSPGQARERSALIRDQLAAQKADREHRPP
                     QTPTPTPETENLAGRRPLRELVAEFTAQREPTAPAEDVTALLDEITGQVMADEDLNLA
                     AGAQSNTFEQFTSWAMRRAHDEVQAGLVEQVVSEDPQIAAVARAALDDPAHWQAAAAQ
                     LPARIWAQHNRDRTAADAAVTALEADPAVAEAATGRAEQFTAALPVQQAIDTVTAAGP
                     ETETERQQLAEDTLTRVHANSHRTDPVDWRQIGRDAWTEHGPGGGASIPAADPRVRAA
                     LDGVPVGDPRTEQIFSDWNRGWNGARTEWAREREDEVLADLQAEMVTHPRLQVLRRRP
                     EDYLSVGRHRLLNHTVSDWLLSVDSADPQYQAAAHWLHDNIATTLDTVHAAVKTSPEL
                     AAPAPETASTVEADVAAEIPATAVDAPKAAVEAGDEIPDREKIHAWLDAQRVHTALML
                     DGAEDAVVAEAEQAAAGARVLIPDASLRAWQAAGSIDDRAADVEKWRDWAQGELRQDP
                     LVVALAASTLVSKRTSVVLEAAAADLADRLTGRPDLAAVIDDHGGHQWLTAEVRGPLL
                     GALGDTYRDKATDWLARDINTFVATGRPRTQVHRFTLHTGTPVWEVTTDGGNSRELWG
                     GHHLPAVRRATVGGRGTSAGPIREGLTAEQARGRFAEITGRALSEDEVFAAAATSLHP
                     SLNRTGFLTSQGCRELRGRVLTEFERDHRDLAAACRAHGLDTSELLRLDIAHQAFDTL
                     HTSAREPDDLFTAATGPADLEALRDSEYLVGEPGQDRAQVNYRWRTKDWQVSRGDAEP
                     VITATLAEAIATARTGRSAESVAATEVTASITGERDTRNHVVRDPENEPAAETAPLAV
                     QPVPDQPDAAAANFVLGAEVLAPSGAKARARANIDAIRLVHQLGDEHRAATPAEQRIL
                     AAWSGWGAVPDIFDKRKPEWDELRSDLSAVLTPPEIDAARASTLNAHYTDPAIAAEMW
                     SALGRAGFTGGRVLEPGCGAGNFIGHAPKGTRMVGVELDPMTARIAHHLYPGHQVRGH
                     GFEKFSPDEGAFTAVIGNVPFGNFAVGDPLHNPSGLTIHNYFLRKSLALTETGGYVAV
                     ITSAFTSDAQRTKAREEIAELGDLVGALRLPTKAFDRQAGTDVVTDLLIFRRREAGRA
                     QAAATEQWITTSKAELADGEIQVNDYFLAHPENVLGELGVGSGMYSAATLKVTADPSR
                     PLATQVRDRLTAIVDTAKRAGLGQDAEEPAADPMLDRAGLVTAEEAAITEVPGSVRFN
                     DEIEMFEQLSLGGRWMPVPSKIDKARTAQWKSMLAMAGTVTDLVDAQRTGGDEDIKNR
                     LRAQLNRQYDGYARKYGPLGRFTWVTPGPPTQKVIDKRFADLEKKWRANNGDETGPVT
                     GALPEDVAARLLAEASEPNPPWKKMRHLEGAIRYDPAIQLVRSIEIFDEDTQQARKSK
                     IFTEDVITPPQRAQSAQDVAEALAVSLDETGQVDLDRISGLVGIDIDAARDQLAGLVF
                     PDPEDPTELIPAPRFLSGNVREKLAATEAAARQDPQLYAGAVDALRQVIPADLDPTNI
                     TVRPGANWVPTPMYAQFIREAFSVHPDTRIAVEYSPITASWDFTIAGDQYTDPYGLPY
                     ETAGDRRGVDGLSLLEKIANNQPIRVLKTEAELEHSPKPRFHEELTEELQQRAEMLET
                     AFGDWLFNDPARTAELTRVFNDRFNSFVDPAYNGQGRTFPGLRIAPHPHQAAVAVRQI
                     NEPSVLLDHTVGTGKTWSITMCAMEMRRLGQIKQPWVVVPNHLIDQWGREVADAYPGA
                     RVLVGDDFKSRADRQLFMAQSASQDWDLVIVPEPAFTKMQCSVDTQAAYIADEITKLE
                     EARESATGQNTIKEIEKAKKRWQDKLEKKVNADSKDVGFSFEQTGCDYLFLDEAHMWK
                     NLSRQSNNADLALREGSSRATDLDMKLSYLRRKYRQRAAVEGRKPVPEKVVTFATGTP
                     VANSMSELWVMTKYLRPDLLEAGGMENIDAWAANFAAMRQSVEMNVTGSELRSVSRIG
                     KFVNLPALMAMNAQFTDVVIREQVPATLPEIAGGGRQNLTFEMPQQVRDFMIDLDERM
                     QMYTGKTAHIDNPLKIGSDGANVTLDPRLGGLDAPPAGEGRVDLLVNKLWEVEQRTAD
                     TVYYDEAGNPEPRTGGLQIVFLDRGTPKTGRDDTVYDIIRADLVARGMSPGAVQFIQD
                     YPKPKDKRELFAACRRGEVKVLIGSSETMGTGMNVQKRATALYHVDCPWRPADLEQRE
                     GRIIRQGNQNKTVEIINIVGERSYDTTKWQTVEKKSAYIEQLRRGAIDFSEAEDIGSD
                     DMTSSMAATKAAATGDPRYIEVVELETRLRKLNAEARAHRSDQERIKWQLHDNRTRLP
                     ILTKEIAEGREVADALTAWGELPRKQRTLTVGGRAVSFAEPAEVRKAVQTRLAHIVRD
                     LERQPDGQHLVAEIAGAEISMGRLPVGGYAFRLTGGIVRTVDAEVVDLALGSADGGSG
                     MVTRLTNMAADLPAAMDLHVKDRDYMVTQTEQLADKLGVPFAKTDEITRLTHTYNEMR
                     ADLAARENSPEALAEKEATKERLAAAGMYRGWTRDLNPTRGHAEDQGMTEDELREATP
                     ARMVAAAREHAERKAERAANPQPPRWQRTDEIGSELTAGFDRDTGDPGAVVKWTGRDW
                     YWSAHNDRETLDSGTFPNRDAAISAAEKAIGTALAEAAVPPVVVWERDQAALTEVRAN
                     GTQPAAAAETVADKELAEVIRLVHSDYPAHATTAAATNTATIERIPPGLRADRSRDTG
                     RER"
     CDS             complement(59247..59873)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00490"
                     /product="hypothetical protein"
                     /protein_id="BAH56141.1"
                     /transl_table=11
                     /translation="MAEFDPTIRAEVERIWREHLGVDPGATETQLTAQFDEEAARLSE
                     LVLQRVGGGQGYLVRNWKAEHPGQDPDVMTTHQLIAQAEHDSREAVLTEELYSQVPEI
                     SEEQIARELKIEQRIEAEIAAKRQARDPDRWRTSMVEIPPLAWQVVDRVWPSEPDAFQ
                     GYAAALIAQKMEDNETTPLTAADPLADELAQMIDEQIKASKAAGNRVV"
     CDS             complement(60071..60433)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00500"
                     /product="hypothetical protein"
                     /protein_id="BAH56142.1"
                     /transl_table=11
                     /translation="MADASHYTYRVTWSEDDGEFVGAVAEFPSLSWLAETQAEALDGV
                     IGVVREVLEDMTLTGEQPPVPIADRPYSGKFMVRTSPQVHRTLAIEAEEQGVSLNMLV
                     NQKITAPAAPRSAAAGAA"
     CDS             complement(60822..61445)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00510"
                     /product="hypothetical protein"
                     /protein_id="BAH56143.1"
                     /transl_table=11
                     /translation="MNWWDVEFGEIRMMSAEETAAFLAEVKRDNRTQRRQQRFPDHRL
                     RRASFIQPVDVDGNAITERFTSMDIYARDGGICQLCLEPVDLDAPQGPEALSIDHIDR
                     EGPHTRANCRLTHLFCNNDAQWASGFDPDLARARLHHKVITNEKVDPADHFPRRSPFT
                     GQVVSYEERRQQEFAAADMARRIDTPPPPRTATERLIAAIRSLFRRG"
     CDS             complement(61533..61706)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00520"
                     /product="hypothetical protein"
                     /protein_id="BAH56144.1"
                     /transl_table=11
                     /translation="MTTDIHRTHQTVRPDGAPVALNHAETGILETFVRALALQTITDT
                     NDGGEEDRRDTRR"
     CDS             complement(61777..61968)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00530"
                     /product="hypothetical protein"
                     /protein_id="BAH56145.1"
                     /transl_table=11
                     /translation="MTIHANGIHTDDERDAWNLHEAGLSWTQVGREIGCTESAARAFA
                     SAYQQRTDAAASENQGALF"
     CDS             complement(61965..62516)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00540"
                     /product="hypothetical protein"
                     /protein_id="BAH56146.1"
                     /transl_table=11
                     /translation="MTAALALVPDDTAVDTDQIQVGDIDTNTHTDVEALCLCALLWAP
                     SEAAARAVAALEAEDFERPIHRELFTVIARLVRAGKPHDTTMVAAELERTGNLAGHHG
                     SERSRYLANITTRGADHIAVDHYTRTVVSQAYRRSFRAAAQSLAQAAEQLPEDQLFEH
                     MIALGRQQRAATNRLNHLRGEGQ"
     CDS             complement(62573..62836)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00550"
                     /product="hypothetical protein"
                     /protein_id="BAH56147.1"
                     /transl_table=11
                     /translation="MSYISAPTLRRLSIAALGGVAGLLLVVGSAETVAQPARYDRSWE
                     TAPEGTSCRIGPGDPGHVVVARVKGKVWNQCHQLLPGTTRLYE"
     CDS             complement(62861..63088)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00560"
                     /product="glutaredoxin-like protein"
                     /protein_id="BAH56148.1"
                     /transl_table=11
                     /translation="MSVQVYSKSSCVQCTATHRALDKEGIEYSVIDLEGDPHAVNALR
                     ALGYSQAPVVIAGDQHWGGFRPDRIKALVAA"
     CDS             complement(63542..63877)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00570"
                     /product="hypothetical protein"
                     /protein_id="BAH56149.1"
                     /transl_table=11
                     /translation="MTEPGNQLSQLDLFISCAVPTCDFPVVEPGDVCTGCQDEFGHML
                     RARPAAPCVSPQLDPAHSAGIPEQNRTSRTSSATDELTRSQRCWLCEERRTCTKVRGR
                     WECRGCTRG"
     CDS             complement(64003..64434)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00580"
                     /product="hypothetical protein"
                     /protein_id="BAH56150.1"
                     /transl_table=11
                     /translation="MSTNIFQAGDRVIIDPVVANKDMKGRVFEVVRRLKVNYDVKPLD
                     GVGPLVRAQPEVLLPAPAELLAKPIVAVAPLSTGSTVRVKRARNIDPTTLFVVLANGA
                     KVKIAELGGEDGRYWNVPRSALEKVTIDLAAATASAQVVEV"
     CDS             complement(64479..64955)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00590"
                     /product="hypothetical protein"
                     /protein_id="BAH56151.1"
                     /transl_table=11
                     /translation="MGTPTAPVAPAVETSEVLDYRHYGTLEEIYHRELIRLAAVGVAD
                     PEVTSTGGNCYALTGDAGYAPDGRSIYLLAATNGDPALTTGGPITSWAVGLYEMQGDS
                     VALAMGEASVDALGDSPDALGCAATRARTALHQYTGGAPAGKVALIGDQGLTWIPA"
     CDS             complement(65345..65536)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00600"
                     /product="hypothetical protein"
                     /protein_id="BAH56152.1"
                     /transl_table=11
                     /translation="MRVKSSAVYLSGLRPALQTHWFKIHDGQWLAAITVYVTDAAGMN
                     SLELDMVVTADAISEPPSA"
     CDS             65610..66548
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00610"
                     /product="hypothetical protein"
                     /protein_id="BAH56153.1"
                     /transl_table=11
                     /translation="MFDPTDRDLFNEQRQRFDWSLLQNGNVYRYDTAFQLDSACTRLT
                     DLGYLVHHIEAELWTTVADMHTAFANAMSFPAYYGRNLDAFNDVLRDVAMFDYGSDPT
                     SSGTVLAIADYDTLAGIDRRTAGEVLDIFAFQARLAALYGHPMLCLAESTVTDYPPVG
                     GRPVYFGSVWDVEPDPPAPFHEGDLVENVLQIYADETGASEYVAALNTVLTDTLTPLG
                     RWQILDPVLASERTALFHAEHRPEPPPPGTQLWEIFIGLRGTGDHNLLGDQLVHVLSD
                     TGIHFDQLITRFYAAGTEDRGQALSNYPDLRNPDNR"
     CDS             66967..67380
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00620"
                     /product="hypothetical protein"
                     /protein_id="BAH56154.1"
                     /transl_table=11
                     /translation="MSSGVGAGNNPDCSAYVFAVARALNAETIRRWDEVSFDAVIVVS
                     KQFRYYGGRRILLAWNRYFGWSLGIEGQCPDRVLIICGLGLGRQPQPECIADRTDEVI
                     ADLLHLECRSPDRFPVPIVIHRRGAGPADPRPPCR"
     CDS             complement(67804..68292)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00630"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH56155.1"
                     /transl_table=11
                     /translation="MPEESDRRESESPSVRGVYGISVAAELSGFGVAALRLYEEYGLI
                     TPGRTGGGTRRYSDFDLTRLRRIAELIDAGVNLVGIGRVLDLEHRTGELERDNLRLEA
                     DNAQLRAEQDPAAEPVREPADPAVPAPETTRRGRRRRPAARGRTGSGDGPARERTGGD
                     HH"
     CDS             68425..68850
                     /codon_start=1
                     /gene="hsp18"
                     /locus_tag="ROP_pKNR-00640"
                     /note="protein synonym:18-kDa antigen"
                     /product="putative heat shock protein Hsp18"
                     /protein_id="BAH56156.1"
                     /transl_table=11
                     /translation="MLMRTDPFRDLDRLTQQILGTAARPAVMPMDAWREEDRFVVEFD
                     LPGVDADSLDLDVEKNTLTVHAERAALNENREMVAAERPRGVFSRQLFLGENLDVDKI
                     EANYESGVLRLTIPIAERAKPRKIEISSNGHSEQKAVTA"
     CDS             68918..69226
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00650"
                     /product="hypothetical protein"
                     /protein_id="BAH56157.1"
                     /transl_table=11
                     /translation="MTSTHMVAEVSATDTGERTERETVWPWHELDYALLVADSDRILA
                     DALTPQAVVLLRRVATAPAGPPRLSPLTPVGWTALPPPLPGIRATQRSPPRPEKPGTI
                     "
     CDS             69627..69875
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00660"
                     /product="hypothetical protein"
                     /protein_id="BAH56158.1"
                     /transl_table=11
                     /translation="MATERDPYRVLGLSPSASQADIASAYRRLLRRHHPDTRTPQRAD
                     PAADEHLQHILTAYAQLRDPDHRAYHDQAKPTGKTPKR"
     CDS             70230..70877
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00670"
                     /product="PhoU family protein"
                     /protein_id="BAH56159.1"
                     /transl_table=11
                     /translation="MRTKFHDQLDTLFDQLTTMCQLAGDAVTTATDALDAADLTHAEK
                     VFAVTERIGALRGPCEDQAMALLALQAPVARDLRQVVTGVFLVSDLSRMGGLAEHIAE
                     SVRRRHPHPVAHGQTQHLLVQMGRLAGELATAAALVLQTRDPALALALDVTDNRLDDL
                     HRDLLTVIQEPAWDGSTTEAVDATLLGRFYERFGDHCVEVGRRVIFLATGQQLPQ"
     CDS             71117..72061
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00680"
                     /product="site-specific recombinase"
                     /protein_id="BAH56160.1"
                     /transl_table=11
                     /translation="MLIGYARVSSAGQNPDHQVDALRSAGVAAEDIHVDHAGGAKASR
                     PQLDLVLQRLREGDVLVITRLDRLGRSMLHLITLGADLRERGIDLQVLEPGIDTATAE
                     GRAMFGMLSVLAEFQRELIAANTRDGLAAARARGRKGGRPSKLSPDQITLAQRLYDAG
                     EHTVAQIADMLKVPRTTVYGHLNKRSADPAPATQNVVVTADPPAPVLRSRTCQTCGHE
                     PTTRAEAAHQRADLAVMWLHPDPDHRGTVISRQHCRQCEPGQPAFDVACRVCGDGPIL
                     AGDFAELAENGELAEPVRQWLAGTGWTIAPDLLCPDHA"
     CDS             72271..72786
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00690"
                     /product="hypothetical protein"
                     /protein_id="BAH56161.1"
                     /transl_table=11
                     /translation="MHAFADESRRGDYLVCAATIAPADLTEARKALKALRAPKAARIH
                     MSHDSRRAHEIIRGVVALDVRAHLYVARLHGRPERHARDEALAAMVTDLDTMGVRQLW
                     LESCDQDRQDRHVIRAALMASSGPGFPFRHALPTSEPMLWVPDVIAWAWGKRGHYRKA
                     VADLVEVHTLP"
     CDS             72854..73132
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00700"
                     /product="hypothetical protein"
                     /protein_id="BAH56162.1"
                     /transl_table=11
                     /translation="MGTSSIGSRALLRQGAHCRAAGPAIVTIAATDGAVTTDGAVTTN
                     RCDNCHYAALEMSAADAPPRAPNTCPPVGRHHFGRTSCPVTTAVRRSW"
     CDS             complement(73531..73878)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00710"
                     /product="putative LSR2-like protein"
                     /protein_id="BAH56163.1"
                     /transl_table=11
                     /translation="MARKVVVELVDDIDGTVFTEGGESIHYAVDGVEYVIDLKDEHAT
                     EFRETFEYYIAHSSRVGGRKHRAGRPATPTTGKPRRGEAAKIRAWAIEQGYELSGRGR
                     IPTEIEEAFRAAH"
     CDS             complement(74152..74397)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00720"
                     /product="hypothetical protein"
                     /protein_id="BAH56164.1"
                     /transl_table=11
                     /translation="MNPRTNHSPIAEEHGAFVAHGVVRPITPVDERNPTTIAIAIAPS
                     IIRKPAPGPRNFEDTVDRRQRIPDSAEADARAAPGRA"
     CDS             74497..75903
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00730"
                     /product="hypothetical protein"
                     /protein_id="BAH56165.1"
                     /transl_table=11
                     /translation="MRFKDKNPELFRQLHPTRNTGVDLDSVTNSSHEMLWWRCPVGHE
                     WRETPLQRRSPAAWKNGALHACLHCVAPGCLVYSCGHRRFQPSESTFRVLAHPCRKCE
                     VTEHARLILDRLDESAAAAVRVLDGSPLYALFCATAADTVEWWDKIFPLVEAYFVRMV
                     SVYVALAAIEHRPTLSCPTSGLLGACMLRILDALPPSCREEMHNAVPDDAGHFRHTYL
                     PGWHDSDIGWGLKKLGFDIRDTSLDTDIERRLQFCEQQRFTATGELPPVHLANRHYPL
                     FTHLPRDRESGALAELRGFRPKQAPPRITAVRVTLGESCPAGPGDPLGRTHVGYAPGL
                     TTAELWELGRGVWKLRADHVAASSIVLVVFDKTVVLVASITGLTVHRGGLAILGEPVP
                     EHPLLGRPDPLYTPNPLAHGVIHGEAERRGRESEHRFRSSSSRPVPIPLPRTVSSADA
                     VRSGRERVVRAHASNSIV"
     CDS             76166..77008
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00740"
                     /product="hypothetical protein"
                     /protein_id="BAH56166.1"
                     /transl_table=11
                     /translation="MITRLSRGSGVEMSESRPGRPREYASDADRVRAWRARQKGKSGS
                     TTADTAEAPTDPIEASATLAQSLPLLRQEADRLSAVATRITESVNLLGDPAAVDAHLR
                     RAQVAADKVRADAAAEIEQLRDQLDTAVDDRINADAAAQAAEQAAEQSATALADANAS
                     HAEQMRTMESSYRERLVEQEQLVESLRTQTTELGDEVVQIRGGADRAAAAAAATINRL
                     EADLDEARAAVQAERARTDGIRDELAAARADLAAARTQTEASRERVEELRAELAEIRS
                     HPPR"
     CDS             77082..78326
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00750"
                     /product="hypothetical protein"
                     /protein_id="BAH56167.1"
                     /transl_table=11
                     /translation="MARNPIGPPSPGGGRSSGGLRRDILPKPKLSAGVTRFTLEGVRQ
                     TAVIPEWCLDVAVSEQSPAPHAPFPLHLRLNIAKYMLVAFDPKNYLKLSEIIGLESSG
                     DIRPLSMQQFFALLPRLGLISDPYPVMWQITSIADQLVSNGLLQKMPGASLPPPLGNT
                     FYAMHGGATKAQAAGDLWLSESLGPELIIRSYIARTVQISGRKSNGDASCGTGLLLDN
                     HHILTNAHVVTDMTVDEILWTPKSPPVDSPESTIDAVELRVEDSRYHETGEFSHANPV
                     DVAILEVTGLGETYADGGGIAFRGPGWSDSAWSFGYPPVPQAAEPAVVVHRGEVVNPQ
                     VQNQRRNDMMLFSATARPGNSGGPIVAQDGRVIGIVAEDLGVKDSAEVPFYAGVPTHE
                     IARALNEMGYPDLLNLETWEAP"
     CDS             78872..79744
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00760"
                     /product="putative recombinase"
                     /protein_id="BAH56168.1"
                     /transl_table=11
                     /translation="MTGASKQAALDGEWRTRIPMFGYTAHGAAVVESEAAAIREGARS
                     LSSGVSTGEISRRWNTAGLTTREGNPFTSKKVVAVLRNPTYAALSTYRGQIVGAGHWP
                     AIIDEHTHRTVVGILDGRRTAARDRRWQGSGVYLCGKCGSTTHVTASRATHYYVCKES
                     AHLWRRQDTLDAYIDTLVIDRVTAEDMRPVLGKPDNGEEGLLEALYDVTRIDSAFAVQ
                     TQWDRLAKSIGADDLRARWEKIGADDLRARWEKIGADRRGAVIALLMTVTILPSPRGR
                     KAFDPNFVRIDWKH"
     CDS             complement(80031..80603)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00770"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56169.1"
                     /transl_table=11
                     /translation="MRKIVAAMIVATILICCTAGAGFIVYNRSAVDDIRSVDAIVVLG
                     GERDGREEFAFDLARQGLSRNVVLSDPYGPYGTKLAARCETRDPRFTVRCIPPNPSTT
                     LGEAVFTRNLATANGWNSLMVVSWRYHLPRARYIFSRCLDGRDVLMVPVPGTYSVARW
                     AYQYLYQSAGFVKAFVQDPSSTCDGSQPGT"
     CDS             complement(80678..82003)
                     /codon_start=1
                     /EC_number="1.1.1.22"
                     /gene="udg"
                     /locus_tag="ROP_pKNR-00780"
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="BAH56170.1"
                     /transl_table=11
                     /translation="MTTRIAVFGTGYLGATHAACMAELGHEVLGVDVDTEKLAKLEAG
                     EVPFYEPGLEDVLRRNIAAGRLRFTSSYEEAAAFADVHFLGVGTPQKKGEFAADLKFV
                     DAVIETLAPLITSPAVLFGKSTVPVGTAERLGSLARELSPAGADLEVAWNPEFLREGF
                     AVQDTLHPDRLVLGVDRNRPGRAEQVAREVYAQLLGENIPFVVTDLATAELVKASANA
                     FLATKISFINAISEVCEATGADVTVLADAIGHDARIGRRFLNAGLGFGGGCLPKDIRA
                     FMARAGELGADQALTFLREVDNINMRRRTRMVELAREACGSLLGARVAILGAAFKPDS
                     DDVRDSPALNVAGQIQLQGASVNVYDPKAMENSRALFPTLGYSTTAMDACEGADVVLV
                     LTEWPEFQKLQPADLDAVVRRKVLIDGRNCLDPQQWREGGWTYRGLGRP"
     CDS             complement(82054..83025)
                     /codon_start=1
                     /EC_number="1.1.1.271"
                     /gene="fcl"
                     /locus_tag="ROP_pKNR-00790"
                     /note="protein synonym:GDP-4-keto-6-deoxy-D-mannose-3,5-
                     epimerase-4-reductase"
                     /product="GDP-L-fucose synthase"
                     /protein_id="BAH56171.1"
                     /transl_table=11
                     /translation="MTEASFVPGPLDRHAPLYVAGHRGLVGSAIWRRLEADGFDNLIG
                     RSSSELDLRDREAVFEFFEQTKPRTVVLAAAKVGGILANNTYPVDFLSENMRIQVNVL
                     DAALEHGVERLLFLGSSCIYPKLAPQPIKEEYLLTGHLEPTNDAYAIAKIAGILQIQA
                     VRRQYGLPWISAMPTNLYGPGDNFSPQGSHVLPALIRRYDEARHTGLESVTNWGTGSP
                     RREFLHVDDMASACLHLLENYDGPDQVNVGTGEDSTIKEIAQIVAEEVGYGGRIEWDT
                     SKPDGTPRKLLDITKLRNSGWEPKIGLREGIASTISWYRQHVDLVRT"
     CDS             complement(83022..84050)
                     /codon_start=1
                     /EC_number="4.2.1.47"
                     /gene="gmd"
                     /locus_tag="ROP_pKNR-00800"
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="BAH56172.1"
                     /transl_table=11
                     /translation="MKRALITGITGQDGSYLAELLLRKGYEVHGLIRRASSFNTARID
                     HLYVDPHDPEARLFLHYGDLSDGARLVTLLAGIRPDEVYNLAAQSHVRVSFDEPEHTG
                     NTTGIGSVRLLEAVRLTGLNCRYYQASSSEMFGATPPPQNEETPFYPRSPYGAAKVYS
                     YWVTKNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAVARIKAGVEEHLYMGNLD
                     AIRDWGYAPEYVEGMWKMLQADEPDDFVLATGGKYSVRDFLTVAFEHAGLDWEKHVRF
                     DERYLRPTEVDALIGDASKAEEKLGWKAAVHTPELARIMVDADIRALEHEGRPWIDSP
                     AHPDWEIL"
     CDS             84437..85231
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ROP_pKNR-00810"
                     /product="putative glycosyltransferase"
                     /protein_id="BAH56173.1"
                     /transl_table=11
                     /translation="MTTGSIGARFERRGVGHIPFSVTTLRNATETIIEAAVKGVAMPI
                     RLSNAYCVALAAQDEEYRAVMNGPGVNLPDGTPIPWVMNYGSDVDVFAGRVRGPSLFV
                     EVLDIGRRSNVRHFFLGATEDTLASLVEQASARFPGIQIAGAYSPPFAPVTEHFYAQC
                     VSEIQRTDAQIVWVALGTPKQDVVGATIAEMAQLPTVAVGAAFDFLAGTVREAPVWIQ
                     NSGTEWLFRLATEPRRLWRRYLIGNFQFLRAAYYARGLRNLPAIEI"
     CDS             complement(85228..86604)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00820"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56174.1"
                     /transl_table=11
                     /translation="MTAVRSDSKNHTDTSVWRSPSARSAVVSAAARVAILPLTGVTSI
                     VLARTITGTYGVEAYAVFSLVVSLPLLLPVIDLGLGAAVTNAAAGLPSEAEKFVAILR
                     ASGKYLLGGCAIGLLVINLIGLLQLWPPILGVDQVLGMNWGVCLALSVFLMTMPASIG
                     YAILIGLKRNPLAILLQGVAPILSGLVVIAASLQLNLQSIIAISTIGIPIASWLALAM
                     AIASLRARGIRPNLRRPVQTRPALFGSAGPMLVIALAMPFAIQGGRLILSWRASLEDV
                     AVYSAAMIAFLPVFSIAQVAGRSLWGEYAHDRANHHSSTRRFAIGLTTGAVIGLGGFA
                     GLVVAGPFVSRLAVGNAVHVPWALYWLLGGVVLVQALHLASGMYLTDSRGLRFQALTT
                     VLTVVFVTSCTVVLVGSAGTLAPAISLLIGLTLCQFVPCLLHAVSRLSVRERWLTYAG
                     HSKSSART"
     CDS             complement(86601..87395)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ROP_pKNR-00830"
                     /product="putative glycosyltransferase"
                     /protein_id="BAH56175.1"
                     /transl_table=11
                     /translation="MSATTSPVLSVITVNYNDHDGLVETTESLTNQRDCTYEHVIVDG
                     GSSDGSAEFIDNYRQRDSRVVAVSEPDDGIFDAMNKGIRMASGDVVVFMNAGDRFTDE
                     ETLSFVAADYQAVGWDWAYGCLRYMSEEGDVFGATVQAPFLQRRFEMGIRFVPHQATY
                     LSLEFIRGLGGFDVDFGVACDQELAMRAALKSNPRVWVRFMSDFRVGGVHTDISFFER
                     EDLWHRMRVKNGVALGDSAKLDRMASHAIAVGRTARSYAGSALRRA"
     CDS             complement(87392..88546)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ROP_pKNR-00840"
                     /product="putative glycosyltransferase"
                     /protein_id="BAH56176.1"
                     /transl_table=11
                     /translation="MNNQRIAIVVPAIEGGGAEVVARKWAEALGHRDHRVDVITTHRV
                     PSAPVTGFNLVPLTPPKSGVIAAVRALKATFETGRYDTVVSLLTFSNLLCLLAASLMR
                     QSRPRIIISEHTLHSHRRAEYGVNMRGQQRLARLLYRYADGWIAPSHAVAAEMTTAYH
                     LDNKKMWVVPNPVAFDAPSQEPDYYKRPPNAPLRLVFVGRILAPKRPELVLDIAAHLT
                     SSWGEPVVVDFIGDGDLRPQLSAMAANHPFPVNFHGWVDQWHKHCEPGSVLVVPSPIE
                     GFGNVLIEAASAGIPVVVSSRCLGAADACIPGVTGQLISDDSVPSFSAAIRKASFART
                     AEVQAWLNRFTIESAAELLHLAVSGSADKITPSPQAGNQPTKTVAGGKTK"
     CDS             complement(88539..89741)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ROP_pKNR-00850"
                     /product="putative glycosyltransferase"
                     /protein_id="BAH56177.1"
                     /transl_table=11
                     /translation="MSTYNLKSVDALDAARIIIDQIDPERLVPGGTDTCIHDLVKYSE
                     TSSLAIVGVTESDSAQLGQWCSAQVADESVPFLPVARFSRTREARFLRIPHSVRLAWG
                     LVRFRKQIPRGVLQTHRIETGVVVSAVVRPKRLVQFIHNDSTGLTGGNSDSLWKYLGF
                     LYRACEKVVFRRADQVVLFNQSDSARIKEMYPRLTVAKTWFDPAVFTLKRKQWKSSDP
                     LKVVFVGRLESQKDPSLALATFAEVHKRYPNAQMVFVGEGSLRSTIASQANDKDIAAH
                     VVFAGALSRAEVARIMADSTVMLMTSHYEGSPRVMAEAGAVGLPVVATNGADPDHVLD
                     SEFGNGVRVAAREPRELASAVLLAANFDPQQCANAVADRSAPVAVSRLLAVPDDGPLR
                     APNSTDNE"
     CDS             complement(89738..90700)
                     /codon_start=1
                     /EC_number="5.1.3.-"
                     /locus_tag="ROP_pKNR-00860"
                     /product="putative nucleotide-sugar epimerase"
                     /protein_id="BAH56178.1"
                     /transl_table=11
                     /translation="MVALITGVAGFIGSTLARRLISEGIEVRGVDSLTDYYDPDLKKS
                     NLASIPKSRFEFVEGDLNTLELSDLLRGVEFVFHQAGQPGVRKSWGSEFDLYALDNVQ
                     ATQRLLEAVKTDGSRIKKLVYASSSSVYGNALQYPTVESDTPRPLSPYGVTKLAAEHL
                     CSLYGENFGIPTVSLRYFTVYGPGQRPDMAFTRFFRAVLQGDSIEVYGTGDQIRDFTY
                     IDDIVEANIAAAFSDVPPASVYNVAGGSSVSLNETIKIIGDITKRPVEISSGGTVAGD
                     VFRTGGSTAKISSELGWSPIVPIDDGLEKQYQWARDVFGEGPLT"
     CDS             complement(90801..92321)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ROP_pKNR-00870"
                     /product="putative glycosyltransferase"
                     /protein_id="BAH56179.1"
                     /transl_table=11
                     /translation="MTAFDFSVEPTLTVNGGAEGSALPRRTGGREDWQSKYRRCLAAT
                     DALVIVAAVCLAQWIRFGDNGILHSSELFDNLSYTFISALLIFAWLIALVIFRTRSVR
                     VVGSGPDEYRRIFESTVRLFGFIAIMALLFRLDLARLYLAIAFPVGLAGLIVGRWMWR
                     QVVASKRARGEYQTSVLVVGNERSVRNLVASFARGTADGYRVVGVCIPGYTGKLPAAV
                     DVAGQALPIFGDECNIVRALEVCHADTVAVTATEHLGDDGLRALAWSLEPHRVDLVVA
                     PGMMDVSGPRLSMRPVAGLPLIHIEKPQYRGAQRFSKTSFDLLFATVALIVVCPVMLA
                     IALAIKFSSPGPVLYRSERMGLDGTPFSMLKFRSMVVGADKHVSRLMSSNDGAGLLFK
                     LHEDPRVTRVGRFLRKYSLDELPQFLNVLRREMSVVGPRPPLRREVESYDGTVRRRLL
                     VKPGITGLWQVSGRSDLSWEDSVRLDLSYVENWSMVGDGLIIAKTVKAIAGGRGAY"
     CDS             92640..94082
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00880"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56180.1"
                     /transl_table=11
                     /translation="MLAAVSVIALFVVARQLRQRHLIWDAGTVFILVLGWAALIPVVL
                     NKLSDGVMHSWNYWGELVEVPIPVDPRVQSALQYVIIGASLLLLWRSVRDADTWRISL
                     FGIAVMGTSFVAMAVDTSAYDSIIKGQPMVLLVVLVAASFATPSREGAITGGALFTIS
                     VCATGAFLGLYAPDKVFMPCTDKCSLAGELYMAATPHSNTLGLITAIGIPFVWLAFKG
                     PIRFWMLVYIGANLVVTGSRTSMFAAAATLVVLALTNPTHTGGSIVGRHRAFLTLGVV
                     TSTAVAMILPFTGQSDSFATGRGYLWRIAVEQFEHTPFFGAGLTAWDRFYEAGEFGAA
                     AAYSTHNQWLELLLLAGVAGAVVFALGWAILVFGGDESRKFTVLPVLLTVALLSSTER
                     PLSIGLINTMTWVLVALVALSSEGRQGQGRQATAATPSSNRSYRFMPAHGPSQSRTPD
                     AGRTSTPAASRLTTAVAMPGEVAIAPTVHL"
     CDS             complement(94077..94595)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ROP_pKNR-00890"
                     /product="putative acetyltransferase"
                     /protein_id="BAH56181.1"
                     /transl_table=11
                     /translation="MGILKSIGRDLGPARRDIVLNRLAAGYGVPAQLRRRILRAAGHD
                     IHPTAWINPRGFYGSNSGLTIGAGSFINYGCFFDLGAPTTIGERVDIGYEVVFATCTH
                     EDGDSARRAGTAKAAPIRVGDGAWIGARSVIMPGVSIGEGCVIAAGSVVTRDCKPNSL
                     YAGVPAEWKKAL"
     CDS             complement(94709..96868)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ROP_pKNR-00900"
                     /product="putative acyltransferase"
                     /protein_id="BAH56182.1"
                     /transl_table=11
                     /translation="MVTSLLPGSRRGARRRGMGEAKPKQRLDIQGLRMVAVMLVVLSH
                     LFHWPRGGFIGVDVFFVISGFLITGSLLHTFEKTGKISFSNFYRRRIRRIVPIATLVL
                     FATIVASYFIYTGARFKSTVLDAVAAFFFVSNWRFGIEGTDYFNSAGPVSPLQHYWSL
                     SVEEQFYFVWPAVILATGIVVMRKSWSVRARLVLAAAVMGTAVLVSFWYSVLNTEGSP
                     TWAYFSTLARVWELGVGALLAISIGYFERIPDWARPYIAWTGLIAIGAGAFAITETGG
                     GFPAPWAAVPVLGAALVIAAGVSGDQKHLQILTNRGSTYIGDISYSLYLWHWPIIILL
                     ASLADRNNHYFAAALLLMFGISIASYHFFENPIRNSNWLATRKEKQERNLLAKSRWRL
                     PTLRMSESNQTRGIVALALITAGLVAFTLAPVSPATAPPVRTAAPAIAAVTGKVVGPE
                     QSKLAQSIASAVQATSWPELNPSMDAVIKGRQAPPDIVPCGLVDRPETTACIWGNPLA
                     PRSIFVLGDSVAMTYVEPLRKFAEKSNGQWSVRSEAMFGCPFVDLELRAADDEIGAAC
                     PTRKASAIRSLNEIRPEVVVIANSYSDGANDKWAAGITRMTDQFAGNVGKIVFLSSPP
                     DDVNIGECYNRVNSPADCISRVTGTWFERFTTEQYLADSLNGTFLDSRKWFCTPEDYC
                     PSFVGTTPAKMDAKHMTPAYADLISPAFAEALLDALE"
     CDS             97373..97591
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00910"
                     /product="hypothetical protein"
                     /protein_id="BAH56183.1"
                     /transl_table=11
                     /translation="MDADSAGAVPGGVQTEDLLTRAVIEALKAGKSWAHIATQLGVPP
                     PSTCDHVATDRDWQEAIVDHENARAARA"
     CDS             complement(97681..97956)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00920"
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="BAH56184.1"
                     /transl_table=11
                     /translation="MSSGPGPVPDSIAGPPRRPALSPRELEILRLWLRSESRNVAASE
                     LGISLGTIQTHLTRIRAKYAAVGRPVADKSGLLVRALQDGLVSLDEL"
     CDS             complement(98389..99405)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00930"
                     /product="hypothetical protein"
                     /protein_id="BAH56185.1"
                     /transl_table=11
                     /translation="MYATTPGTGTAPTPRLSARDRHVWALFADWCAATDQPQTPATPQ
                     QLARFLCENPAALATQRRRVSVINTVHRRQGHPAPGTDEAIRRALNTTRAARLHRVSA
                     VVAERIPNIPTAGWPAGFFGRRDRFILALAAAGVGFEQLARLRRRDLTATGDRGAPLQ
                     LCIDGDRIDLPESPEIPLAAIYRDWIEVLGFLDRNHATTTIAKHVKAGRDLTGFDAGY
                     RADDRPLLTSINRWGHTPLDPAPPTARAITAIVHAHLAGTAPAHILPPPKPRPRPRQA
                     ESPDRYPIDDGRVLDPHYYERGTAARRSAHHDLTNVTDLLDDIEDRADQLLAELDGIL
                     NDVP"
     CDS             complement(99408..100583)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00940"
                     /product="phage integrase family protein"
                     /protein_id="BAH56186.1"
                     /transl_table=11
                     /translation="MLGMTIDQGLRPRELPAAAVTGDPAVFPDLSEAVVGRIGRSMAE
                     SRSEGTRRTYASAWRRFTHWCATQGHAPLPAHSATVAAYLVDAADTIGPDGVRVYAPA
                     TLTKWVAAIAHHHSRAGHESPTGQEIVRATLSGIRRDYAAVGDRPRNPRAALLTADIV
                     TIVAAARNAVDGWADAVLERRDSALILMGFAGAFRRSELVGLDGGDVRVHRHDGVHVR
                     LRRSKTDQEGDGTVRALPITDRHDSCPPCAYVRWAQVVAAFDTRGRPGVIRLLTTAEP
                     FETHVCRGASPRIAARVPLFRSIRKNGNLSDTALSGAAVHKAIRRRAAQAGYDPDQVT
                     QLGGHSLRAGFVTQAFRNGADAHAIMRQTGHTTPEMVEAYARERTPLVGNAVTILGL"
     CDS             complement(101134..103116)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00950"
                     /product="putative ABC transporter permease/ATP-binding
                     protein"
                     /protein_id="BAH56187.1"
                     /transl_table=11
                     /translation="MTSTQQLMPQDCDTIVPASPGGDVRGRRRRLRAAVAPVSAAVTM
                     WRQLVAHLPVPDRRRLLQAVLATAIASLATASIPVIVGMFVDAVYDDGELVGLGQALW
                     PLITLFIAYTLISLMNVVRHQKVHAVTTSFEAGARTKIYGHLIRWPLQRFHTGTDGAI
                     YGRANRSVEGAVRLIKLGSADLLPAVLIAVFAIGIATARHGLLGLLMSVVIPTGFGLV
                     AWQIASQNGIRVSLKNTKERIDGWVTSCLTMLKVIRTSGTESYFDNRVSAEVQDLRRT
                     ELRHHIVMSLFDCGKAANEVLWLVVTVVVAIQFDLADTPGDLASVILLYAALTRPLNE
                     LHRVIDESSEAALQARDLLDDLAGPIDPSFKRADVSPAPDTDEDHGLRRRTGSGTPVA
                     DLSHVSAVTLDNVSFSYQQIDDHHVRDDPRDSAASARQILRGVTLRVPLGQRVGLVGA
                     SGSGKSTILDLLERLHHHYTGSITINGRDLCSIDRTYMTENIGYVGQRPTLFPGTIRD
                     NLVMGRPGITDTDLDTACLRANIYHDIQRIDGGYEANVAQKGENLSGGQQQRLCIARA
                     LLHTPSIMLLDEPTSALDGPSQAIVQRAIDGFDDVTMLVVAHRLSTLSTMDRIVVLHD
                     GQIVEDGTYIDLSASNGPFAAMLKSEPWTSQCNGSL"
     CDS             complement(103292..104881)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00960"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH56188.1"
                     /transl_table=11
                     /translation="MLHIAKFRREIVSLSFTRLVAVTGNNPVTAAAAAVREAVAAKGI
                     DEDTLNAMLRTVPARKTDADAIHYCFNTAAPVPTRAAMRRVVEAVEELDLGTFESIDL
                     ISPVTRLVRHVRDVAAGALFAFCLYLVLGAVLTGQNAMANHTSTAFVLGALAVCLGLL
                     ALLEAAHIAAVALSTADVSQLRESHSRVFKLHPFVATSERLEHYLAGRQAGVVLVVFG
                     IAEVTRTAGMTSLPFTSIGIPHTAEILLGIGVPGALIVLCIGQVAPQLVAARKPAGMM
                     NTLPMAGAFTVTRWIANLGLATPSKWLMAGFPGTERIATAPRQRYLSDSLDAEGFGVE
                     SIAHQVIVGAQGSIARSLTTTVFTQAGRTTHGTTVAVTTRMPRTTASITQLRRGAEAL
                     PVVVTGDDSHRTSDSEGYIFTETHAPRIGTFEANDVLHTAFKATFDDALTTDRVVISA
                     PTRLAIIRVVLEHPSAPLPPARLSITHVTNAEIAMTSLVCPTMHETDNSVEFVAIVKY
                     PTVGSVITLDWSREELACTPA"
     CDS             complement(104887..105309)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00970"
                     /product="hypothetical protein"
                     /protein_id="BAH56189.1"
                     /transl_table=11
                     /translation="MPHHLPHGPDHHGPDHYGPHHHGPHHHGPHHHGPHHPPHGPDHH
                     GHGWLEHDSRVMTREEFGRELEALGKLIAENPEFTFKGVLVSMPEQVTNETVFERNHH
                     GEFVFRVHAAWEEYGANRIPSSDQVPKFGTPQRDAGKA"
     CDS             complement(105424..106341)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00980"
                     /product="putative molybdenum cofactor biosynthesis
                     protein"
                     /protein_id="BAH56190.1"
                     /transl_table=11
                     /translation="MPVSFGRLRVFLTEQCNLACFYCHNEGQPKGSAYLSDQLFDAAV
                     SMSRQPEVEKVILSGGEPLLHPRVLELVEAVSPNVARSSLITNGLLLTPSLARDLAFA
                     GLSKIRLGVDSFREDKPRPSVGYLDDPFSIDDTVAAVREAGLAVEVNVVLTRFNQREV
                     PRFLRWAVVNGVNIKFFEHLEVGAPEPGRLINSMRPKPQVSEEWFMRTLTDTLGHRPD
                     FTETDQFAPATSAARVGGVEVRYCRYLCTYQRCAAPGTRLDVAGFVYTCMSNRGLDRV
                     ESISVDALRDVFSRATQRGCSAEVPMKLA"
     CDS             complement(106343..108163)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-00990"
                     /product="hypothetical protein"
                     /protein_id="BAH56191.1"
                     /transl_table=11
                     /translation="MPRELTSAVEPAVFGWKAHYLGRLSGLGYKTPRGVAYRTDETIT
                     PPVLLKEAESLAVRSSGLSEDSVTLSSAGSFLTELGVKFDAVEAAAARVRASARGKPM
                     GVVIQELVPAAVSGVAFSVDPTSYSLDSWAVSWVEGLGDGLVSGRSTGNDVLVAWSNG
                     IPRYGTWPLREDLLEQIGTALKDLARELAGPVDVEWCVDSAGELIVLQVRPIVLPDPG
                     VQNLDSAAAFLDLPSVVSGHPKISLRRRAAELGVEMTPSRATVATSREHLPQPPMTRS
                     PAIAGSSVVLLHPFTVGSRVIREFAKIDRSDVEFFTAECRRYSIRDYPSFENITDTET
                     RVATMGLSSAAVAVVLEQEIWDAEVTGIIRASADGYLLEVGLGHFVPKGYVETSAYVV
                     DKAGWVLSRREVRQSVAFHFVNGHVIREVDPPESPWLTADDIVKVVETLGPLIEVEPQ
                     LALEFGITKRGEGGIVYLIDAAESDHLSVDLGSDDLERGIVSRGHAGGPIVDLRGNAQ
                     VEDLHAHLYQSVVGDAPDEPTIFIASSASVDLLPLLEACPPGCGFLFEEASLLAHFAV
                     VLRERGVPGVVVTRDELDRLGGDAFLDTESTPILRSGRGR"
     CDS             complement(108153..108725)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-01000"
                     /product="hypothetical protein"
                     /protein_id="BAH56192.1"
                     /transl_table=11
                     /translation="MSEPKNGLVLGRFQPFHLGHLEYVEAARSHCRRLFVGITNPDPE
                     SRVPSGADPKRSLAENNPFTFAERRTMIEESLWDLGWTGRDFAIVPAPILQADRLLHY
                     LPRPAETTVYMTIYDAWGEQKVEFMSKLGYQVEVLWRRDDDSRVASGTQIRTLLTSGD
                     DWRVTSGDDWRALVPGAVARLLGESNFLAS"
     CDS             complement(108836..110494)
                     /codon_start=1
                     /locus_tag="ROP_pKNR-01010"
                     /product="hypothetical protein"
                     /protein_id="BAH56193.1"
                     /transl_table=11
                     /translation="MSARRHVQWPTAQLSSAQLRSAARRGAARRGAAARPSWSSASLS
                     DVIGGEWRRRLFVRLCDTRVTVQSGDADPLPLTGQAALFLRLLLLWDDGLVTADLAAH
                     VLDVRSSHIGTYVGNLRDALGDREAKARLETIAGNSRSIPRQPTTYKVSLTADFPEFR
                     TLTDQALEIAGEMWTDHRDLTDSAVAAAVPLLDKALGMWRGSPATGLDHAGSRNCNPK
                     KLKVADLRDLDGHRERLVDIFDEWKKRHADAVLLRADCTLFSDDGKAASNEVLERVSR
                     LAKIAPPDDRIWYRLLFAADRAGDRKRHEDFWARAEKHFAKDGEEMPPEVEQLKPHRG
                     RQNLDRGKAATQPGTPESRSGIDALVPIVEALGIGAPSAHALGEVSLSPIECTKRAEN
                     ALDFAGVLAGKWVGTREVHDSFVAMLQKFQRRNPRGRARFLVIDPSSEAYDRLVQIRG
                     GEVSPSSVEVLLRLREKYPCLEVRGTKHLPAFRVLVIDDDIVSVSPYDLENQSAQSSR
                     LGWQAPHMLLDPLAPFPLAPAFRLYFDSEWDAANPLPTRSRTSG"
     CDS             110794..111093
                     /codon_start=1
                     /locus_tag="ROP_pKNR-01020"
                     /product="hypothetical protein"
                     /protein_id="BAH56194.1"
                     /transl_table=11
                     /translation="MRTGQPYALRNVDGTPITRPARATRPSGVLHEIVDGLVECNVAL
                     NIDGTKYHPADPMGKMFIGFLAMPSSNQTSNLKLARNKRAGASPQPELAEDELPE"
BASE COUNT        19125 a        36067 c        36226 g        19742 t
ORIGIN      
        1 ctatgggacc aggacgtagc tgctgatcgc cagtgcccgg agcggaaagt tcgagacgtt
       61 gacgaggctc acgccggcac ccgtgggaac gtcgatcctg gtggtcccgt tgtccactgg
      121 aacgcgcagg gtgtgtgtga acggggcgat cccgttgatc caatcgacct gaatattcgt
      181 cgcacatgcc gggcgggccc cgaaactgcc tcgcggagtg agcagaacgg agagatttcc
      241 tggccgggcc gcggtggtct cgaaatccac gtggatcgga ccattgcacg gcccgctgtt
      301 atcgagctgc acgatgtcgt cacccatgat tcccggcgtg tgcggcggaa cgtccgccgc
      361 tgcaaccgcg ttggtaacga gtgcgatcgc ggccgtggcg gcgctgactg caaccgtgcg
      421 gacagcgttc tgccgaaatg tcattggtct ctcccctacc ccacccgagc gtgttccgaa
      481 ccgacaatgc ctcgacccgg tcgtgaacta tgggtcaacc ctatcggaca cgcacctcgg
      541 atctgtcggg gcgaggcatc cgcagctctg cccccttgcc gagagtttct agcggacacc
      601 taccagctcg tacggtgtcg attcggattc gtcgctgccg ttgtctgttg cctcgtcggt
      661 aagcgggagt ggcggggtac ggaatccggc ttcaactgcg aggtccttgg ccttgttgta
      721 acggcgcaat gcagtgctcg cccacttctc cccggtcgcc tccgcaagtg ctgcgaacgt
      781 tgcgtctgga tgctcgatct tcagtctggc ggtctccttg accatcggat cgagcttgct
      841 cgactcgatg aaggcgagca ggtattccgt ggtttgcagc tcatcgggca acaccggggt
      901 ctcggtctcg gccgttgcga gctcgttgca cgcaacgtcc aggtcgtccg caacgacctc
      961 tgcaacgacg tcatcttcgc catcgcaacg gtcaacgccg gtaggccacg cctccgcaat
     1021 gtcgtcgctc gttgcatcgc gtgacgttcg cactcccgca acctgggttt ctgcggcatc
     1081 gacatcgata tcgatatcga cgccagcatt gctggcattg ccagtaatgc tgttaatgct
     1141 tctgaaactg tcctgggcct tggggtctgg gacctgcggg tttagccggg tgctgactgc
     1201 gcctgagctc tctcgctcct caaccgacct gctggcgatg tcgttgcata gggcgttgta
     1261 ctcggtgtgt gctgtaccga ttgccttgat gaggatgccg acaccgtggg tgaacgccaa
     1321 caccagcaac ggcgggatga tcgcaatgag cgatgcgcct gtcggcgtca gcggtgtgaa
     1381 gcccaggtcc atgccggccg cgacgttgcg ggcagcttct tccccggctc ggcgggcatg
     1441 gtaggcgttg ccgaagacac tgatgaagac cacgacgacg gcgagccaga ggaagaaccg
     1501 ctttcctgtc gcgcggccac tgatcttgct cagcgcaaca accgcgatcg ttgcgccgag
     1561 gattgcgccg tcgacgatgg ccgggaagat ccaggtgagg tagtgcggga tcccggcttg
     1621 caacgcgagg tcgcgttgca cggcaaagga caacacaaag gcccctgtgg tgatgccaat
     1681 tgcaatggaa atcgcaacga tcagagccgc aatcagcgcg cggacctgga ttcgtgctgc
     1741 tcgaatacta aggtcattca tgactggtct tccttccacg gggtaccggt cggaacgagg
     1801 cccctgccga cccaaacggc aggggcctca tctatttgct agtcagcgag cggacggccg
     1861 ggtgggaggg gcttgtcctc cccctcgaac gcgttgccgt cgttgtgttg cgcggcgcgg
     1921 cgctgtgttg cggcggcgag cgccttctcc acgaagtgcg accagttgcg gtcggcctcg
     1981 gcggactgcg ttgctttgaa tgccaggcgc gcttctttca ggacgtctgg ggcgatgtag
     2041 acggttgtcg gtttgttgct cggcttcttc tccggttcgg ccggctgttg cgcggccgca
     2101 gccgtcgatg tcagatccgt tgcagccttg ttgcgttgcc tcctcagcgc tgacacatca
     2161 ggggtcgcag ctcgcgcgga cgccccggaa cgcggcggca gccccgtgat agctcgatcc
     2221 gttgcgctca cgatgccgcc acctccgagg cctcagcctc agtgatgcgt tgcaccatct
     2281 cttggcatac ggccagcaag tccgcggcga cctctttcgc gctttttggt gcgtgctcct
     2341 gggccttggc actaccgcga acgacttcgt accacttcgg tccgctctgg acgacgtcgt
     2401 cgagctcatg gaccagcact ccccgctccc ggatcgcgag cgctgtggct tctgaatgcc
     2461 tcaccatctt ctcgaacacg acgtcgtcgg cgtccccacc gaacgccgtg gcgattcctt
     2521 cacgagccgt tctctgtacg gacgtggagt tcgcgcccac accgacgagg acaacgccga
     2581 ggaggtccag ctcctcgttg acgtccatga ccgaggtgag gcgggccgcg acggctgcca
     2641 tgcctttgcg gctcgacccg tctgtcttcg tcgggacgag cagccacttt gcggccgcag
     2701 cggcagcagt ttgcagtgtc tcgtcgccgg gagggcagtc gatgagcacc atgtcgtact
     2761 cgcctgccag cggcgccaga gccgtcgcga gggccaactt tgcacctagc gggtctttcg
     2821 tcgctttcga ggccagcgcg gcggtagcca tcgacagatg cgttccgccc gggatgatgt
     2881 cgaggttggg gcgaatatcg cggaccgggg tgattggatc accgaacgat agagcctgcg
     2941 cgagattttt gccctcgtcg tcgatctcgc cgtacgtgta gccgagatcc tccgcaatat
     3001 tgccctgcgg gtcgagatcg acgagaagga ccttgtaacc agactcggcc agcaaaccag
     3061 agatgttcgc ggccagggtc gtcttgaaca ctcccccctt cccgttgatt actgcggtga
     3121 ctcgatgcaa cgcgaccgca tcgcgttgcg ggactacgtg cgtgcgaggt ggtggcatcg
     3181 atgtctccct cgttatcccg gagcgggttt cactgttaat gctggcattg ccatcaacga
     3241 tggctattgc tgcaacgcca ggattacctg cgttgcaggt gttgcaggcg ttaccagcgt
     3301 tgctggtatt gcacatgtta ccggcaacgc ggtcattgca agcattactg ttattcccgg
     3361 cgtgtcgtcg tgcccagcaa tgcttgcaat gcttttatgc agttcagatg cggtatgccg
     3421 gtattgcttt cattgccgtc atggactgct tctctccgga agccagcaat gcttggtttg
     3481 cttgtaatgc ttgctataag cgaatcggtg ggatacagcc ggccgtgcat gctgtccaac
     3541 cctcgcatca gccagctttg ctggcattac cggtaaagca acgaattcag ctattgcccg
     3601 caatgcttgc gcaacgcccg tcgttgcgtg gccgtcgttg cgtgcaacgg cattgctccc
     3661 cgtttacgcc aatacggggc ccggcctatt gcgtgccatt gcacgcaacc caccgcctca
     3721 cgctgccagg cgagtagtcc acgttgcaca ggatgcaggc tccggctgga ggaggctctc
     3781 ggtgcccgga gctcgccgac tggggcgtag tcgccggtgt tgagccgaag ggccaggtct
     3841 tcgaactccc atcgcagtgc caccacatac agctggtgcc ccaccgtcgt aggtaagggc
     3901 accagtgtgg acgcaggtag ggcgaagctg atcgtcccga cgtgaagcat ccaaagtgca
     3961 tgagagtcat cacagtgcgg cgacgacagt ttcgatagaa ctatggaccc atagacgttg
     4021 gatagggtaa aagcagggac gccgcccgaa aacgagggga acagatgggc tacttcgagg
     4081 gtcgtgtcgt cgcaataaca ggagccgggg cgggaattgg acgcgagcta gctctacagc
     4141 tcgttcaatc tggcgcacat ctggcgctgt cagactcgtc ggagtctcaa ctgcttgcta
     4201 ccgctgacct gtgcgcagac ggccccggag acatctatac gtcggttgtc gatgtgacgg
     4261 accgagctgc cgtactcgcc cattcaacag atgtcgcttc tcgattcggc cgagttgacg
     4321 ctctgatcaa caatgccggc gtactttttg ccggcgacgt cctggacacg accttcgagg
     4381 actacgagcg agtggtcgac gttgacttct ggggagtcgt caacggaacg aaggccttcc
     4441 ttccacacgt gatgcgctca gatcgagggc acatcgtcaa catctcctcg gcctttgggt
     4501 tgatggccgc tccgtcgtat tccgcctaca acgcggccaa gttcgccgta cggggcttca
     4561 ctgagtcgct ccgccaggaa atggttctcg ggggacatcg ggtaaaggtg acctgcgttc
     4621 acccaggtgg cattcggacc accatcgcgc gcactgctag gcacgcggca ggagtagacg
     4681 ggaccgaact cgctgattca ttcgagcggc gtatcgcgag aacagatccg aatgtcgccg
     4741 ctcggacgat cctccgtggc gttcagcgcg ggtctgcgcg cgtcttgatc ggcgcagacg
     4801 ccagagcggt cgacatggtt acgcgaacgc tcggagcgcg ttatctgtcc atcctgcccg
     4861 ccctgaagaa gcttggtgcg tagctggacg ttcgacctga acagcgttca atccggacag
     4921 gctaggatct cctcgttcat tcggtcgggg aggttttgga tggcgacaaa gtggttgctg
     4981 gtaagtacgt tcgggggcgc ggtgccgtcg attgtggggc agggccgtac acccaagccc
     5041 ttcgtgccgt tggagcaagt gatcaagagc aggcggtcat ttgcagatgc gacttcggcg
     5101 atcaccgagg tcatggcgca cccgaccaag attgacaggc tttccagtga cggcctgcgc
     5161 cgggttatcg cggaccccct ctgcacattt gagggcagac ttcacgccat ctatctgtgg
     5221 gtcggatcag ctgaggagaa ggttgcacaa cgtgatcctg ctggagcctg gtacttcaat
     5281 ctaaccgact tcaaagtcag tggtagcgat gatcttttcg acctttatgg ggtagcgccc
     5341 gagaatcgta gatctgaggc tgcaatggcc ggggcgttcg acaggttgga taccggcgtc
     5401 gacgaggggc acgcactagc caagatcgtt aagtcgaccc cggggatgga acaccaagcg
     5461 gtatggacgg tcaaacgcga cgatggcgcc cgccgtgctg cgcatttctc gtgccgcgct
     5521 gtcgaggaac ggcccgatcc gaacagcgat cggaaggtcg tgattctgag gggtgttacg
     5581 catgacatcg gcccggcaga cgatgtgccg actgcgccgc cgccggtcat tctggaacat
     5641 cgcgtcttgg acgccaagtt gaagcctggt gagtacctgg cctacgtgga tcacaagaag
     5701 ctgagcctgc tcaaatggcg aggcaacccg atgcccggga ttgcttggga aggtggggta
     5761 ggggagccga cgccggcgat gcaccctgat gacgtcgagg ttgcaaggcg tctctctgcc
     5821 gaccttgcgc gtggtagcac ctccggtgtt attcgtttcc gcgggctgga tggtgagtgg
     5881 aagccattgc accttgaggt ctcgttgatg gccttcgacc agcacacgat gggtgcactt
     5941 gtcaccgtgt cagcggcgcc gtagccggga caccgatgac tctccgtcgc tagctcgcga
     6001 tcacagggtg ccggcccggc gccagttctc gatttggcct tcgcaaccat cattgacgga
     6061 tccgagtgtt ggtgcgcgct gggccttgga tggtgacacc tcgttgcgct gtgacgttgg
     6121 cattgtcccg agttccgcag ctaatcgggt taccgggaca tgccgaaaga taagcgtgca
     6181 ggtcagcggc ctgcgcgatg gtgacacagc ccgaaagtcc tagtgacacg attttgtcat
     6241 tttcaccgat atgacgagca tgttctctgg taatgtccgg tgacatgttc gtgaggacat
     6301 cgtcacggcg gaacaaggac ggcgccacgg tgcggtacct gcagctggca cacaatcaat
     6361 gggatccggc aagcaagtcg tcgaagatga aggtgctcta caacttcggc cgcgccgagg
     6421 aggtggaccg ggccggaatc gagcggctga tcgcgtcact ggcccggctg ctggacaccc
     6481 cggcgttgtc cggggcgtcg gagccgggtg aggggctgac gttctgcgag tcccgcccgc
     6541 tgggcggggc atgggcgctc gacggcctgt ggtcccggct cgggatcggc actgcgattc
     6601 gccggctgtt gggcggtacc cgccgggacg ccgagaccac cgagcgggtg ctgttcgcac
     6661 tcgtcgccaa ccgagcgttg gcgccgtcgt cgaagctggc tgcggcgtcc tggatcggcg
     6721 aggacgtgca cattccgggg ctggcggcca ccagcgacga cgcctgctac cgagcgatgg
     6781 actggctggt cggggccgag gagcagctgg cccgcaccgt gtacgcatcg gtggcggatc
     6841 tgttgaacct cgaggtcgac ctgctgttct tcgacaccac ctccacctac ttcgagaccg
     6901 acgaggccga cgcgccgatc tggcgcgaca cccgcggcca cctcgtcgac gtcaccgacg
     6961 atcccgcccg cgatcccggc gccggcacgg atgaggagtc cggcagtctc gagccgccgg
     7021 cgggagcggt gcggcaggcc gggttccggg catacggcaa atcgaaggac caccgcgacg
     7081 acctgccgca ggtggtgatc gggatggccg tgacccgcac cggcatcccg gtgcgggtct
     7141 ggtcctggcc gggcaacacc accgattcgg cgctgatccg gcaggtcaag gccgacatgc
     7201 gggactggaa cctctcgcgg atcgtctggg tcgccgaccg cgggttcgcc tccgccgaga
     7261 accgccggta cctccagcgc gccggcggcg gctacatcct cggcgagcga ctgcgctccg
     7321 gctccgccga ggccaccgcc gcgctgtccc gacagggccg ctaccgcgac gtcaccgacg
     7381 gcctgcgcgt gaaggaggtc cgcctcggcg accacgagcg gttcgtgatc gcccacaacc
     7441 ccgatacggc ggtccgcgac gccgccgtcc gcgccgacat gctcgaccgg ctgcgcgaga
     7501 cgatcgccga caccgacaag ctcaccgtca ccaagcgggc cgaactgcgc ggcgtgctct
     7561 ccaccaagcc gggcctgaac cgctacctgc gcgtcacccc gggtgggctg ctccgggtcg
     7621 acgcgaaggc gatcgccgcg gaggccaagc tcgacggcaa gtacctgctg cgcaccaacg
     7681 aaccccacct gtccgccgag gacatcgccc tgggctacaa gcaactactc gaggtcgaac
     7741 gcggctggcg ggacatgaaa cagatcctcg acctgcgccc ggtccaccac cggctcgagg
     7801 accgcatccg cgcccacgtc ctgctgtgct ggctggcgct gctgctgatc cgcatcgtcg
     7861 agaccaccac cgaccagacc tggaccacca cccgccgcga gctgcagcgc ctgcacgtcg
     7921 gccacttcac cggccccgcc ggcacctacc gccagaccac cgcgctcacc ccggcgcagc
     7981 ggagcatcct cacccgcctc gacgtcacac ccccgccgcg gatcctcgaa ctcaccgccg
     8041 gctgaacccc gcaccccgac acccctagtg acacaccgtg tcaccggcca aacgcgcctt
     8101 cccgcaggtc accaccacaa tccgcgtcac ctgcccacac ccgagctgcg gaactcagga
     8161 ttgtcgtgga ggaggattcg gctgttgtcg gtggcgtgga cggtggtgtg tccgtcggcg
     8221 tggatggtgg cctggtcgta ggcgtagatc gtgggttcgt cggtggcgcg aaccttggct
     8281 cggtcgactg cgtagacggt ggtcttgttg cgggcttcga ccttggtgtc gtcgaacgct
     8341 tcgatgatgg cggtggtgta cgcgtagcag cgagagtgtc cttcgagctg cacctgggcc
     8401 gcgtcggtga cgacgatggc cggcgaccgt gtctgttgtt gcggtgtgct ggtggtgatg
     8461 cggacgcgtg aggtgccggt gatccgcagg gtgccggtgc caatgaggtc gtggagttcg
     8521 aggatctgat cgggcgggga gtcgacgatg acggtcttcg cgccctgagc gaaccgggct
     8581 acgacgtcgg cagcggtgcg gcacggagtc cggggcgtgc ggcactgtgg gttacgtgtc
     8641 gaggtggttg ggcgcctcat gctcgataac ctagccggga tccgcggccg gggagtgagt
     8701 gccgcgctgg cggcgccgag tcctgcctgg gcctgtgtat gcccagccgc agcgttgttc
     8761 gtcgatccac tgggtttggt tgtcatgcgg ccgcccgcac ggctgaattg atctgagaca
     8821 ccacggctcg ggcggtgggg tagtcagccc ttccgttcga tcgggtgggg aacctgccgt
     8881 agcggactcg ggcaggggcc gaaatcggta gcgccagcat tccggtcgag gtagtccgac
     8941 gtgccccgct ctttttaccc cgcgcggcgc gccacaggtg ctcttcgttc caccaggtaa
     9001 acagctctcg gtctactagg tgtcgtgcgg cgcggcgggc gttgattccg gcaactcccc
     9061 gggtctgtgc gacggtctcg agcgtccgga gcaactgctc gcccgtggcc tctgaggtga
     9121 gcagtcctgc cgagtgcaag cgcgtcagtg ctcgttcgat gtactcggtg ccgtaaccag
     9181 tcttctccga caagccggtc aggctatcga ccccagatcg gtagaaccag tggacgcgtg
     9241 cggttgcagc gccgaggccg ccggaccggg ggggactcca tagatcgtgg gcgtgatggg
     9301 tgaggagcgt aagcccgggc ccagaagcgg gggcgggttc cccttgtgtt gcatgagaag
     9361 taatctctac gcccacatca ggcggcaggt tgagggtcca ccgtgcagct cgcgtccccg
     9421 cgcttggagt ggcaagcgtg acccagcctt cccgtgccag caaacgaagc ctgcgcgaga
     9481 ccgtggacgc gtcgagagcg caggtctgtc ccaggcggcg gcaatcgatg tcgaggaccc
     9541 gagtccgggc ggtgcgcgct agcgcggtca gtgcgtgcag gatccgctcg tcacttgctc
     9601 ctcctcgccg gccccagtgc gctgttgtcg ctgcgagggc atgttcgatg gtgtcgaggt
     9661 cgtcgtcgat cggttcacgg ggtgcctggc cggggtcagc ggtgaaggtc gcggctcggg
     9721 cgagggcgcg ggaccattgg cgttctgtgt cgtcgcggcc gcgggccgcg tcctcacgaa
     9781 gccgaatcag acctggggcg gtggcaacgg cggcgcgggc gtcgtcgagt gtgtgtccgg
     9841 cgcgggccat ggaaagaagg atggtgtacg cgagggcact tcggtccgcc cccttcgacg
     9901 gcaccgtcgc gagcaaagcc gcagttcggt ggggtagcgg ccgccggggt cggtcgagtc
     9961 tcggacccgc cgcatcctca atgatccgcg gccgtcgatg ttcttcgggc ggtgtagcgg
    10021 gctcgacatg ggggtgccgc gcgaggagcc aattgacgac ttccggcgtc gtcccgcggc
    10081 tgacgcgctc gagagcctgc tgcagctcgg cgccggccag gtggggaacg gaccgtccac
    10141 cgttgcggtg tggtgcccct ggaggccgca caaccccctt atcggggttt ctcagggggg
    10201 atttgtcgaa ggttgggtag tgctgaacga gcacgcggtt gagttcgccg accgcggccg
    10261 ggtcggcacc gtcctcgcca agtcggatcc agatgtgttg gccgcccgtc ggcccggagt
    10321 gcgcacgcag gaactggaca cccaagtcgt cgaggtgtgc ggcgaggcgg tccgaatcgg
    10381 cacgagcctg atcggcgcca aaacgggagg tgtcgaagtc gaacacgaga agccgaaagc
    10441 ggtgatctga gctggcgaga tagaccgccc agggaaattc cggctgctgc aggggcatgg
    10501 agatagaggc gtcgtacttg tgttttcggt ccgggtcgac gcgaacgcgc cgccgcggcg
    10561 accacacgcg agtgcacgtg ttgtagagca gttgtgtgct atctgggtca ccacttggcg
    10621 gggtgacacg cgcatgagtt attagacctg catcagggcg tgagataccc tgggctctgt
    10681 ccacgagaca gtccctccgg ggataagcag tacagagaat cgagcggcta actcttttct
    10741 caaccaactt caaagaccca atgccctcgg ccctgcccgg tcgggggttt tttggttagt
    10801 tggtgtgatg cactacgtaa tgtgtgttcg tttgtgcagc ctcaaggccg ccatcgcgtt
    10861 cacgcggaaa gtttcagcac ctcctggttg gtctcctgaa cgagctgggt atggccggta
    10921 gcggctgcga gaagatctgc caggaattgg ctcatgttca cgcccgctgc catccgccta
    10981 cgttcgagtt cctcgaacac cacgtcaggg actctgctgg ttacgcgagt tcggtctccc
    11041 ttgtatgggt ttcccatacc cttctccttc cctgaccccg accgtccaca tcggactcca
    11101 atctgcagca ccaaacctgt cacaagttgg accgataacg atgaagacac gccgtcgaac
    11161 gctctcagag atgaagaatc cgtgctttag ttgcgtgatt atttataggt tcttcgcgcg
    11221 tgtctctcga tgttcatgac cgcgcttcca tgcctctgca acgatccgct tatcgacccc
    11281 gtagagctcg gcaatcttgg gcacaaggtc atcgcggaca ggctttaccc cgttctcgac
    11341 ctcggccaac gtagtggccc cgattccgag ccgggcggct gcgtttcgtt gattcagcgc
    11401 tgcccgcact cgaaggtcgc tcattctgag cttgcccgcc gggatcggca cgagcacagc
    11461 gattgatgta tctagggctt cggcaagaag gccaagcatt tccggtgccg gccttgaccg
    11521 tccagtttcc caggtcgaga ctgcctgacg agttgtaccg attcgggccg cgagatcgtc
    11581 cggcgtgagc cgcgccttca ctcgctgttc gcggagcttg tcaccccgga atcctctgac
    11641 tccgctgcga ggcacttcat caactcccgg ggtccgacca ctgctgtatc cgaccattgt
    11701 tgcccttccc ggagtgccat catgcgctag cgcgttttat agttgcgtgt tattgttgcg
    11761 ctaatcttag ctgcttctag cggactcgct caggaagggg cgtgaatgaa aagcgtgaat
    11821 aggttgcgca cagaagctgc cgcggtttac gatcctttcg cgcgccccac cggggagtcc
    11881 tgcggccttg tacacgtcgg gtccgcttgt agcgcaaaag gtgctgcaca ccgtctattt
    11941 ggtgtgccct ttggactctc aggggcgatc gtgtcggaag caactaacac atggtgtggc
    12001 tcgcgtagag ccgcaccatc gcgtgcttct gaccacactt tccaggtcac caccgcggcg
    12061 accagcggtt cgactcgacg agtttctgaa gtcgaattgg ctcaggctca ttcgctccgg
    12121 gccaacctcc gaatccccaa gacttccact gtgcggttga acttctgccc aagtcaccgc
    12181 tcagtggtct cacttcgcag ctcgtggctc gcacgcgggc caacttgtgc tgcgcagaaa
    12241 accccaggtg cggtgatgat tggcgtcctc gcccgcacct ggggttctac tccccacagc
    12301 gtttcaacgc gtaaacgtcc acgccgcagg atctcggatc cccgcgggcc atttctgtac
    12361 ccagttggag gctccgatgt ctttgggtgc ccagatccac ccgaccacta atcgtaccgc
    12421 tgccccgttt tcgttacagg cggattccag cgagtccgtt cctcacgttc cgatctcgat
    12481 gaatgagtcc gggcggccac ttggcgtcgt cgcacattgc gctggtcggg cacctggtca
    12541 caggtgctac agcatcggcc ttcctgggtt ttcgacctgt cccgcgggcc actcattagt
    12601 gccgtattcg tcaccctggg tcggcgttca gcccgtcgtc tagatcactg acagacttca
    12661 attcgattct ccattaagga ttttcgcgat gtttctcgtc tttctgatca ccttgctctt
    12721 cggtctcggc ggggccttcc ctggctggcc tgcctgaccg ttcgccccac ggccggtgga
    12781 gggtcagtca gcctcctgcc caggtctcca aagttgttgt cattcacata tttccgattc
    12841 gccttcggca cctgcggttg cacagaggtg caccgcaacg gcgtttcctt cgagagaaag
    12901 cgagtagtga tgagtagatc aggtgggggc cggcatcgtc ggcgggcgga gcgggccgcg
    12961 gtgtggtgcg cggttcctgt ggcgttgtgc gtggcgtgtg cgggtgtggc gcaggctgct
    13021 ccgtcgcagc cgggcaccgg tggtggcagt cagccgggga ccggtggtgg gagccagccc
    13081 ggaacgtctg ccccggctcc ggagcagtca cgggattacc tgcctgggta cacgccgtcg
    13141 ccgaatgtgc agaactcgga gtggcggcag tactcggatt gggagaccgg gtatcagcag
    13201 ccccagtacg aggcaccgca gtacgcgcag tggtcgtctc cgcagaccac cgactacgac
    13261 gcggcgccct cgtatcagca ggcgtacgtc gaagaaccga cccagtcggc tccgtcggtc
    13321 gtcgaacctg agcccgtccc ggctccgccg atggtcgagc gaaaggggat cgcgccggtc
    13381 gaggcaccgg aggggtacat cttcaccggt gccggattgc tcgagcagcc ggattggatg
    13441 ccggatgagg accgggaccg gatcacgaac acgatcgcgg cagtgcaggc cgacgccgga
    13501 aatgcgctga ccgacgccgg cgtgaacgca ccacaggcgg accggatcac cggcggtgcg
    13561 atcggtggcg gcctgctcgg cgcgggaatc gtcggtaccg gcctggctgt gcctgccgcc
    13621 gcgctcggtg ccggtatcgg cgcaggtatc ggtgcaggta tcggtgcggc tgtgaccgct
    13681 ccgaccggcg gatggggcgt cggcccgggt gcggcgatcg gcgccggtac cggggcggtc
    13741 gtcctcggtg cacccgcttt cgtgctgggc gccgggttgg gtggtgtcgg cggcgcggtg
    13801 gctggtgcca ccgttttcgg cggccaggac gtgactgttc aggagcccgc ccctgaaccg
    13861 gcacccgaag ccactccgga gcccctgtgg acacccccgg tggtcgatac cgcggcggtg
    13921 tcggctcaga cctccgctgt tgtcgagcag gttcaggccg ttcccggtgg cagcgaagtt
    13981 gtcgagcagg ctcgggattt cgcggccttg gcaccggcgt acgtcgagca ggcgactccg
    14041 cgagttgatg cgtcagctgc cctggtccgt gacgcggcgc tgacgcagcc gggcggagac
    14101 caggtcgtcg cctcggtgga atcggccggg acgaacgcgg cggccgcggc cgcaccggtg
    14161 atcgagcagg cggccgcgtt cgctggcgcc gtcgtcaacg gcctgaacgc ctgagcgggg
    14221 tgaccacatg aaactacttc cccgggtggc cgcggcagcg gcagtggctg tgattgggat
    14281 cgggtcggcg ggaacggcgt atgccgcgcc cgccggcccg gcgagcgagc tggtcgggga
    14341 ctcgtgcccg gcgttgttcg ctctcgggat ccagggaacg ggggagtcgt ccccggacac
    14401 tccggcgaca ctcgacaccg gcatgctctc gcaggtcttc atgccaatga tggtcaagac
    14461 caccgattct gcgggggaca ccctcgcagg ccgcgcctat gtgccgtatc cggccgggtt
    14521 cggtggcgcg gtgcccggtg cgaatgtgcc gtattcgcag tcggtggagg agggcctgca
    14581 gaacctcatc gacaccgccg cagaggtcgc gcaggcgtgc ccgaacacgg tgttcaccgg
    14641 ggcgggatac tcccagggcg cgcacgtgat gagcatgttc gctaagcgtg tcggcgccgg
    14701 tgaggggccg attccggcga acaaactcgt cggggtggca ctgttcggtg atccgacgcg
    14761 agcaccgggt tcgccgttgt tccccggcgc cgcaggccag acgtcgccga agcccgcccc
    14821 gggcacgacc ggcgcccagg tcgggaagat ctcggccccg gcgcaggcga ctcccgaggg
    14881 cggcggtatc ggaccgaccg cggacaccgc agttgcctac gggtccctca ccgggcgtgt
    14941 ggcgtcgatc tgcgagccgg gcgatctctc gtgtgatgca ccggcgaacg cgccgatcat
    15001 gcgggcggtg accaatatcg ccggtcagag cgagctctcg tcgggggatc cgattcagtc
    15061 gttgacctcg atcagtgagg cgttggcgct gacgacgatc aagacggcag tgccggtgat
    15121 caatgaggac atccagggca ccacgctggc gaacttgtcg atcgacccga agaagtcgtt
    15181 gtcggagcgg gtggcgatcg cctccgaccc gcgcacggaa atgccgaccg cgcaggaagc
    15241 gatcagcgcg gtgttgaagg tcggcacgat cgggtttaac gccgtcaaga cggtcgcgaa
    15301 ggaagtcctc actccggcga acatcgccca gctggccacg gtcggtctcg cgaatccggc
    15361 tgccggcgtc gcgttgttcg ccacgaagtt ggtgggggcg attccgaagc tcatgccccc
    15421 tgcgacgacg tcgcggctca ctcggcaggc gttcgacgtg gtcaaggaca acatcagcga
    15481 caacgccgac ctggtgtcga caacagcgct gacgaagtac tggaacacgg tgcgtgcgca
    15541 cggttcctac gggtcgacgc cggtgaccgc caccgggcag tccgcggcgc agttcgtggc
    15601 cgagtggttc gctgctctcg ccaaggatgt cgcggccgga accgactcgt cgtcggtgac
    15661 gtccacaccg cgggtgacct cgcaaaccac cacggctccg cgaaccagtt cgtccactac
    15721 ccccgcgtcg tcgggggcga cgagtgcgcg tccgacgtcg accagcccgg tcgctgccgg
    15781 atgaccgacc cggttccccg gacggcctcg tccggggaac cggattcgca cagaaaggga
    15841 ttcgatgatg acagatacca acttccgcag gcctgatccc acagctggtg agctgacccg
    15901 ctggtatccg tccttcaccc ccgccgcggc ccttgcggac acctcgcccg tcgagcaccc
    15961 cgccgaacac accccggacc tacccgtgga ccaggccccg ccggtggcag cgcccgcacc
    16021 gacaccttcc gtggccgcgg ccacgcggca ccggatttcc ccgcgcgcag tcgccggact
    16081 cgggtccgct gccgcgacgg ctgcggtcgc ggcgggcctg ggcgtgtggg cgctcggtgg
    16141 tgggcaagac agctcgccta ccgctgctgc cgtgaccgcg cagccgacca cggctccact
    16201 gacctcagcg gccccgcgcc cctggtgcga tccggccgca gccgtggacg gcgtgatcat
    16261 cggcaacggc cccggtggaa ccgactccgg ccccgccgcg atcctcgcgt tcgacttcgc
    16321 ctactacgtg cagcgatccg gagaagcggc acgcgccgtc gtcgcccccg acgccgtcgg
    16381 tgtcgagccc gccaacctgc tccagagcgc catcgacacc tacattcccg ccggcgcgga
    16441 gcactgcgtg accatccgcg cggccgagcc gcagcgattc ctcgtcacgc tgcgcgaacg
    16501 ccagccgagc ggggaagaag tcgcctacac ccagcaagcc atcaccacac gagtggtcga
    16561 tggacgtcac gtgatcacgt cgatcggaga ggcatcatga gcaccgaacc cgaatggatg
    16621 caatggctca accaggagcc ggagcccgaa acggacctgc ccccggcagc ggtggtgccg
    16681 ctgcgagggg ccgacagccc ggccagttcg gcaccagccg agcacccggc acccgcaccc
    16741 cgagaccagg acccgcagcg cgaggctgcg gacacaccgg tgtggccgca gccgccgata
    16801 acagctccgc cgctggtact ggtcaccggc gtaggcgggg gagcgggagc cacaacgacc
    16861 gctatcggca tcgccggggc atgggcaacc cacgacgcca gctcctcggt ggcggtggtc
    16921 gatctcaccg tcaccggagg tgacctgcga tcacgcgcga gcatcgagga cctcgtcacc
    16981 acgatcgaca cgctcatcga atccgtggaa cccgaggcgc tggtgagcga cctgcccttg
    17041 tcggcggcgg gggcccgggt cgtcgaccgc ggcgacagtc ggttcgacga cccggtcgta
    17101 catcgggtgc ctgaccttct gcggtctcac gtcgacaccg cggtctacga cctgggggcg
    17161 gatgcgcttg gcagccgcga gtgcgtccgg ctgcgcgaag acgcggatgc ggtgttcgta
    17221 ctggtggtgc aggcccgggc ggatgcgttc aaccggctgc gcggctacct ggacctgctc
    17281 gctaacgccg tcggggagtc ggtgttcgag cacaccgtcg tagtcatctc gcaccagaat
    17341 tccgccgaac cggatgtcga cccggccgag ctggtcggat atctgtcggg ccgggtgcgc
    17401 gcgaccctcg aggtgcccta cgacccgcat ttggccaccg ggttggagat cgctagctgg
    17461 gagcttcgcg ccgccaccgt cggtgcctac gaccggattc ggcgggcgac agcatccgcc
    17521 gagggtcggc agtgatgatg tcggcacgca gcttctcccg ctggtcacag ccgcagacaa
    17581 gcggttcggg catccccgtc cgcaccccga acagggtcgc ggagatctgg gatcggccgg
    17641 taccgcgcgg gctgggcagc ccggcaccgc tggtgtggct gctcggagcc cacggcggcg
    17701 cgggaatcag cacgctcggt catgtcctcg acttcgcgag cgagtgcggt cagaagtggc
    17761 cggcaccgtt cgagggggaa tcacccttcg tggcgatcgt cgcccgcgag cgcgtcgatt
    17821 ccctggacaa ggccggtgac ctgatccgcc agcacgtttc cggcatggcc ggtaacagca
    17881 cgctcatcgg tctgatcacc atcgcggacc ggcccggccg caagatcccg agggagatcg
    17941 accagacccg aaagatcgtc ggaggcctgg ccccgaccac gtggcggatc gagtggatcg
    18001 agcacttcac gctcgttcgc gatccgcgag aacttccggt ctggtcgcac cgcgacccgg
    18061 taccggagaa caagaaacgc gcagcagacg acccgacggc cgttcccagc gaaatcgcag
    18121 agatcgctgg ggcgctccgc aattcgatca tcagtcgact ccacccgggc acctgactcg
    18181 ggcctggaac aacaagggaa aggacaactc gaatgatgct gctacagagc acactcgaca
    18241 cgatcagcgt gctggcacag gggatcgaac tcccgccgga accgccgccg aagtcggaga
    18301 agctgctcga actcggccga tgggcgtcgt gggtggtgat gttcgccggc gttctcgcct
    18361 tggtttacgg cggcgggaag ttcgggtggg agaagttcaa cggtggctcg ctcgagtcgc
    18421 cgaagatcat cgccggagcc ctggtcggcg gcgtgatcgc ggccagcgcc ggcggaatca
    18481 tggcctcggt cgtgtcatga cggtcgtcgc gatgtggatc ccctcggagg cggtgaccga
    18541 gccgctgctc cagctcggcc gctacgtgat gtggatcatc ttcgcgatct tgaccattcg
    18601 cctcgtctgg tacggcggac tgttcgcctg gaacaagcag cagaacccgt acgaatccga
    18661 acccgccgct cgaatcggga tgacgctcgg cgccgcggtg ctgtgttcgg cgggcagcgg
    18721 tatcgccgca gctctcctga cgttctgaca aggaaggacc atctgatgat cacaacccgc
    18781 ctggcggcag cgtccctggc cgctgccgcc gcggcggcgc cgatgatcgc tggttgcggt
    18841 tccactgagg agaccaccgc aaccgactcg gtcaccaccc cggcgccgcc tgacccgacc
    18901 accccgcccg cacagatcga atgggaccgc ttccagtcga tctggcttcc gttcgccgac
    18961 gagggcccca ctcgcaacac gggcaacggg gcggtgtccg ggttctcgca caccccgcag
    19021 ggtgccgccc tggcagcgat tcatcagacc gtgcgcatgt cggtcgcccg cgacgaccag
    19081 tgggccgccg tcgttcacga gggcctcgca ccgggacccg aacgtgacgc gttcgccgtc
    19141 agccgcgctc agatcagtgt caccgctgcc gccgaccctg ccgaagcccc gacgctgggt
    19201 gggtatgtcg tcgccgacta caccgatgag cgtgccgaca tctcgatccg cacctcgttc
    19261 tgcgaccagt cggccgcgat caccgacacc acggtcgtgt ggaccggcac ggactggcag
    19321 ctccagctcc cggccgccga cgaatccgca tcccgcgtcc acgtctacga cccgcagacc
    19381 gccacctacg acaccggccg tgaggtggct ctcgccgcgc ccgccgccgc gtgcagcgac
    19441 caggagggca ccccgtgacc actgaagaca ccgaaagcac tgaccacaag cccgacagct
    19501 ccccggccgc tgaccagcgg ccgcggtcgg ggcggcgggg gcgcacggcc gccacctcga
    19561 agcacggcct gggcttcacg ttctggctcg cggccgtgtt cgtgttcgtc gtcgtcgccg
    19621 gcggtggcgt cgcgtacttc gcttcccgcg acgacaacga caccgccgag ggccaggtgc
    19681 cggtcaccct tgctccgcag agcgaacgcg ccgactgggg gcttccgttc accgacgagc
    19741 tcggccgccg cgtcgaggtc ccgccgaatc ccgatggtgt cgccctcgat caggacaccg
    19801 actcccgcaa gcctgccagc gacatcaccg gcgccccggg tggtctgcag tggcagcaga
    19861 tccgcagctt cccgctgccg ttctccacca gcgacggacc caccggcatc gacggccgca
    19921 tggccaccgg attcgcccag accccccgcg gtgcggcact ggccggtatt cagctctaca
    19981 cccgcggcgg cgccaccatg gccggtgccg ccgagttcta cgccgaccgg gtcgtccccg
    20041 acagcgaccc gctcgagcag ctgcgccagg attttctgcg ccgggccacc gatgcgatcg
    20101 catccggtcg aggcgacgag cgggccctgt tgccctactt ccgtgtcgat gcctaccgag
    20161 tcactcagtg ggacacgcag cggccggact acgcggtggt cgagtacgcg atgctcaagg
    20221 agagccgcac cggctgggtc tcgaagtccg cggaactgct gtggcgcgac ggggactggc
    20281 agatcaagct caccgcggat ctctacggcg ggcagaaaga ggtcagcaac ctcggggggt
    20341 ggacccaatg ggccgccaac tgacccgcat cttcaccgcc ctggcggttg tcctcgcgat
    20401 cgtgctcgga gccgcgacca ccgcggctgc gcaggacacc gaacccaaac ccggcgagga
    20461 ccggtcggtg gtgtgccagg gcgtggaagt cgccggccag ggactcggcc agctgatccc
    20521 cggcttcggc ggagtcaaca tcccgggcct gcccagcacc ggcgacgtcg tcggcaactt
    20581 gtccggcagc ctctgcgaca acaacggcaa ccccatcggc gcggtcaagg acttcgcgag
    20641 cgaacagctt caggagcagt gggattcgca gttcggcaag atcgtcacct cgatcatcga
    20701 cggcatgtcg caggcgatga tcatggcgat cacctggtgg atcaaaattc ccaacgccga
    20761 cctcgaatcg ttcggacctc tcgctcagat caacgaatac acgatctgga tccagtcgtt
    20821 ccttctgatc atctcgatcg gattcatgtc actgcggctg gccgcggccc ggcggcaact
    20881 gatggtcgag caggccgaag agaccttccg gaccctgttc cgtgtggtgg tcaccgcggc
    20941 gacgatgtca gtgattgtcg cgctcgcgac ccgcgccggt gacgcgttcg cggtcgaggt
    21001 ggtcaacgcg acctcgaaca acgaccccgc cgggaccgtg cagtcgatga tgatcctcaa
    21061 cgcgtactcc gggatggcgc cgggactgat gctgatcatc gggttcttcg gcgcgttcgg
    21121 cgctctcgca caggcgttct tgatgccgat ccggcaaggg ttcctcatcg tggccgtcgc
    21181 cgctctgccc gtcgcggccg cggcgagcgg aaccaagacc ggatcgcagt cctacgacaa
    21241 actccttgcc tgggtgatcg ggttctgcct gttcaaaccg gtcgcatcgt tggcgtatgc
    21301 gatggcgttc ttgaccaccc aatcctccgc gctcgacgtt cccgaaggtc agaccccgac
    21361 tcttgggcag ttccagtact cgctgatcgg aatcgcgctg ctcgcctcca cggcgctcgt
    21421 ccttccggca ctgatgcgga tcatcacccc cgcgatctcg gcggtcggca gcggcggctc
    21481 cggggcaaag gccaccgccg gggcgcttct cgccggtgcg gccctgctga ccggcggcaa
    21541 agctctcggc ggcaagctcg ccggcggcaa ggcagtcccg cccggaggcg gattctccgg
    21601 tggtggcggc ggaagcggca cacccggtct cgtcggcggc ggcggaaacc cggggaacgg
    21661 cagcggcagc cgcgggaacc acagcggaag ccgaggcacc ccgtccaccc acggaccccg
    21721 ccaaggcggg ccccgcggca acggggcgaa taccggcagc ggcccgaaga agggcagcgg
    21781 cgcgaaggca agcaaatggg tcggagccgg aggaggccgc ggcagccggt ccgtcgacag
    21841 cgccgccggt gacctcgccg gtgacaacta cgcccacccc accagccgcc acaacatccc
    21901 ccgatgacca ggagataccg atgaccagtg agattgcgcg aatccagctc ggaaagatcg
    21961 ccgacgtgtg cgagctcgac cgagctggcg tgttgccgcc ggtagaggct ttccgcgccg
    22021 ccgatcccgg ctcgtgcgac gttgaccacg caccgacctt gctgccgccc accggtggtg
    22081 atcatcggtg agcgcgaccc gaacgaacag cgaaccgcag gtctatctcg gcggccgggc
    22141 acctagaaat gaaggcgtca tgggcctgtc cgggccggtg acctggttca tcctcggcac
    22201 gctgatcatc tcgctgctcg tgctcatgcg ctggggcctc aaagtcggcg cgatcaccgg
    22261 cggggtcctc ctgctggccg tagtccccat ggtcctcaaa cgtcacggcc tcaccggata
    22321 cgaaaggtcc cttctggcaa tgcaattctt cggcgcactc cgacgtaagg agaacatcta
    22381 ccgcggcggc ttgttctccg agatgcccgg cgggaaatcg cagctccccg gtgtcctggc
    22441 tccgacgaag atgtacgagg gcgaagacag cgccggctac cggttcggca tgatccacat
    22501 gccgaagacg aaccagtaca cgatcgtgat gcgcgcctgg ccgcagggtg acgaggccgt
    22561 cgaccggggg ctggtcaacc agtgggtcgg ggagtggggg atcgtcctgg cctcggcggg
    22621 tctgaccagt gacatcgagg gaatcgtccc ggtcctcgac accgtccccg agaccggcaa
    22681 cgccctgctc actcaggccc gggccatcac ccgcgtcgac gcccccgcac tggcgaaggc
    22741 cgtggtgttc gaaggcgcga ccgagttcca ccgcgacgaa gtgcaactcg cggcccgcgt
    22801 ggcgatcacc ttcgccgcga ccaccgacga acgcaagaag gaccccggtg cgcaggccgt
    22861 cgagatcggg cgccgtctgc ccggcatccg cgccgccatc gaggcctccg gtgtcgcggt
    22921 acgcccgatg accgccgccg agatcaccgg ggtggtgcgc cgctcgttcg acccggcatc
    22981 gcagctgacg atcgaacggg ccgaagccac cggcgacgac cacgggatca cctgggacaa
    23041 cgccggtccc atctcgcacg agaacaagtg ggaagagtac tggcacgacg gcggccggtc
    23101 cgtgacctgg ctgatgagcg cgggcccgaa gagcgccgtc gacgaatcga cgctgcgacg
    23161 tctgatcgcc ccgcacccgg accttccccg caagcgcgtc gcaatcgtct accgcccaca
    23221 ccgggccgcg gacgcggtca agatcatcga cgacgactac cgcaacgcga tcgtcgccgc
    23281 tcagaaccgc aaccggggca tcagctcggc cgccgcccag atcgacgtcg aactcgccga
    23341 acggtcccgc gacgaactcg cccgcggaca cggcgccacc cgcatcgggc tgctcatcac
    23401 cgtcaccgaa ccgatcgagg ccgacatgcc ccgaatcgat gccctggtgg gcgacctggc
    23461 tgtgcagtgc cagctcaaca ttcgccgctg ctaccggttc caggacgcgg cattcgccgc
    23521 ctccctcggc atcggtgtgc tgctgcccga ccacgcgtcg atgccgtcgg cgctgaccgc
    23581 ctagaagaag gacggcacac tgatgttcga gatcatgacg cccgaacagc gggccaagta
    23641 tcagacccgt gtctacgccg gtggaatcgg cggcggctgg gcgaagttca agatccgcac
    23701 cgacgacaac cgtcgccgca acgcgagcgc ccgcgagcgc accgagcaga gcaccaccgc
    23761 gggtggcccg aagctgagcg atcggggcca ccgcggtgcc ggcggcggcc gcgccgcatc
    23821 ggtcggcaag caacccgaac tgcgctcgac gagcgtgcac gctgccggcg cgttctggcc
    23881 gtggtccgtc ggcgcaggtg cccccgcggt cggcccggtg atcggcagcc acctggtcac
    23941 ccacgccccc gtctcgttcg ggctgctcaa ctggttccgc cgcggcttca tcaccgcccc
    24001 ggtcgcgttc gtcctgggcc tcaacggcta cggcaagtcc tcgttcgtcc gcaaagtgat
    24061 tctcggcgcg atggcacaag gggtgaccgc gctattcctc gccgacaaga aacccgacta
    24121 ccgcaagatc gtcgaggaag tcgccggtac agacgcggtc gtcgatgtcg gctacgcctt
    24181 cggccacatc aacccactcg ccggtggtgt gctcgggtcg atcatcccgc gactggccgc
    24241 gttccccgat ctgcagctgc gttggctcga ggaactacgg ggccgccaga ccgagaccgt
    24301 gagcgccctg atcgagttgc ggcgcggaca agcgattgag gactgggaag agtcgatcgt
    24361 cggctcggcc atcgcgatcc tgttcgacga gaagggcttc acccccgacg agcccccgct
    24421 gctcgaggac atgctcggcc tgatcatcga gggacacccc cagctcctcg aggacgccgg
    24481 agtcgacacc atcgaggact accgcgaggc ggtgcggccg ctgcgccgat ccctgcgcgc
    24541 cttcgtcaac cccaagagcc ggttcgggcg gatcttcaac ggacagacca cccatccact
    24601 cagtctcgat caccctgcga tcggcttcga tgtctcgcac atccccaacg gggacaagaa
    24661 gctgcgagct gcggtgatgc tggtgtgctg gtcggacgga ttcgccctga tcgacgcagc
    24721 gaacgccctg accgacgcgg gcctggctcc gcaacggttc ttcgaagcgg tgatggatga
    24781 aatctgggat gtgctcggac tgggcccctt catggttgac cggatcgatg ccctcacccg
    24841 cctgaaccgg cagatcgcca ccgggctgtg gatgatcacc cactcgatgg cggacctcga
    24901 gaccgccgcc gacggcgcca ccacctcccg cgcggtcgga ttcctcgagc gcgcccgggt
    24961 gaagatcatc ggcccgatcc cggagaagga aatcgaccgc ctcgacggcg tggtcacctt
    25021 caccgacacc gaagccgaca tggtcaccaa gtggtcgtcc ccgccgccga tgaccggtga
    25081 gcagcctcgg gaagaccagc ccgccccgcc cccgccggga accggaaacg tgctgatcaa
    25141 gaccggtgac gacccgcgcg cccccggaat cccggtgcac gtgatcttca cccgctccga
    25201 gatcgaatcc ggagtccaca acaccaacgc ccgctacacc gacaccgccg cccgtgagga
    25261 ggacgccgcg tgatcccgca acgccgctac cgggacgtct ccccggaact gaggaccgcc
    25321 gccgtcaaga gtgtcgccct cctccagaac gaggtctcct cccgctggcg ggcgatccag
    25381 ctcgtcgccg aagccaccgg cgtgcacccg aacacgctgc gcaactgggt cgaagcgcac
    25441 cccgacggac cccgatcccc gcgccgcgac ctcgaacgcg aactgcgcga acgggatgcg
    25501 gcactggccg cggcgtcgga gatgatcgcc gacctgtcgt cgcggatccg cgaccacgcc
    25561 gggcgggact gaacccggcc gtggacatca agaagctggt cgccgccgcc gtggccgccg
    25621 tgttgggact cgtgctgctg gtggtcgtcg tcgcctccga cagcggcaac gagtgcccgg
    25681 ccccggcgac gcccggcggc agcacagctc ctgccggatc actggtcaaa ccgaccgagt
    25741 ccggcaccac cacactgacc tcgggattcg gcccgaggtg ggggaccgag caccggggca
    25801 tcgacttcgc cggcgaggtc ggcactccca tctacgcgtt caccgacggc cgggtcatcg
    25861 ctgccggtcc cgcctccgga ttcgggaact ggatcatcgt cgaccatcag atcgacggga
    25921 aggtggtttc gaccgtctac gggcacatgt tcgacgacgg tgtgctggtc aaggccggtg
    25981 accgggtgtc cgccggacaa gagatcggcc gtatcggcaa cgcgggcgac accaccggcg
    26041 cgcacctgca cttcgaggtc tgggacgggg gccgcctccc ggacggtgtc ggcaccgccg
    26101 tcgacccggc tccctgggtg gaccaggcca tcgagcccgg ccaggcaccg gctcccgaga
    26161 caggtgaggg agacggtggg gcgccgacct cgcccggcac ctctacggca ccggggctcg
    26221 cggtctacaa cgcccgccaa ctcgcgatcg ccaagcaggc ggtcgcgatc ggggaagcga
    26281 tgggtgtctc cgagcgcggc atcaccgtcg ccctcgccac gatcggccgc gagtcgacgt
    26341 tccggatgct cgccagctcc gtggtgcccg aatccctgaa ctacccgcac gacggcgtcg
    26401 gcagcgacaa caagtccgtc aaccagtacc agcagcaggt cgggatctgg ggaacggtcg
    26461 acgagttgat gaacccggtc accgcgaacg tgaagttcta ccaggccctt ctgcaggtct
    26521 ccgggtggga gtcgatgccg gtcaccctcg ccgctcagac cgtgcaggcc tcggcgcacc
    26581 cggaggcgta cgccccgtgg gaagacgccg cgcatgccat gtacagcgag ttcaagggtg
    26641 cgagcaagga actcaccacc gacgaactgt cgcagatctc ctccgccggt agggctacgg
    26701 ccgtcgcagc gggaggcatc ttgcccgatg cgtgcccacc cgcaggcggc gagcacggcc
    26761 cgctcgcacc gggcccgttc gggcagaagg tcatcgaggc cgcgtcccgc tggctcggca
    26821 ccgaatacgc ctggggcggc ggtgacgtga atggccccac ccgcgggatc agcgacggcg
    26881 gcggtgcggc cgacgcccac ggggacacca acaagatcgg cttcgactgc tccggcctga
    26941 ccctgtacgc cgtctaccag gcatccgggg gtgcgatcag tctgccgcac ttcaccggag
    27001 accactccaa ccccggccag ctctacgacg ctcgcgggca ggacattccg ttcgaccaga
    27061 agcagcccgg tgacctgatc tatttcgggt ccggcggcag cacccaccac gtcggcatct
    27121 accacggcgt cacagacggc caggacatgc tcctcaacgc cccgcaatca ggtgatgtcg
    27181 tctccatcca accgctgtcc aactgggctg gcgaagaaat gtacgtccgc cgattcggcg
    27241 accaacccac agaaaggcaa ccccagtgac gaacacgatc agtacggacg acagtccgat
    27301 gacggccagc gcgcatgtca ttggcgcacc gctcggacag cacttggagt ggatctcctg
    27361 gattgtgctc gtcgccggcg cggtcatcgt gacagtggcg ggcgccgtgt ggggggtggc
    27421 ggcggtggac cgagcggacg ggcgagagat cacccgggat ctggttgttc ttcggattca
    27481 cgctcatgtt gaccggatct accagcactt acccattcct ctaggccacc gctcacacga
    27541 ccggacacag accgactcag aacacgaagg gacagggcac atgacggaaa acgtgatcga
    27601 gaaccccgca ccgaagagcg cggctatcaa aagttggggc caggaagaag tcgccccgca
    27661 caactgggct gccaaggtgc tgggcgacca gaccgaaatc ctcgaggcga acggatggca
    27721 ggttaccgaa cgtcaacgcg acctcgcgta tctgtcggcg ctggaagcgc ttgatgccga
    27781 ggttctccgg cggccgctgc ggggtcgggg tcagccctcc ccgctctacg ccagcacgat
    27841 tcaccagatc acggccaccg aactgcggaa ggtcgccggt gagccggccc cggtcaagcc
    27901 ctgggagagg gtgtcgctgg gactgcttgt ggcggcggca gcgattacgg tcggcctcac
    27961 ctggaaggtg gcgcgggaca tcgccagtga gttcctccgg atcgacgaca cactctggtt
    28021 ggggaccgaa cggcaacaga cggcagcgaa ctggttgttc tggctcgggc agagcggtgc
    28081 cgtcgccgcc gggatcctgc tggtacccgc cttggtcacc gcgggggtca ccctcgtgcg
    28141 ccgcgtccga ccgcgataca ccagtggcgc attggccctg gccatcgtcg cagccgtggt
    28201 gtgcatggcc actgtggtca cgacgacctt catcgcgatc atgttcgccg gcctgggccg
    28261 gtgacgagat gaatcggcat cacagcagga cgatccgcgg cggcgtcgcc gccgcgatgg
    28321 tgacggtggc cctgttggcg gccgggtgcg gcagctccga cgacgggcat gaccatgccg
    28381 ccgaaccaat ggattccggt ggcccgacgg cagcgttgac gaccccacca ccgccgcagc
    28441 tgccggaaca gttcagcgga gtcgatcaga acgatccgga agcggtgatg gtcgccgccg
    28501 cgcaggccct gttcagctac acccccgcga cggacccgac gcaggccgct ggcgccgacc
    28561 gggccgcagc gctgctcgac gagcggttct acgccgagaa caaggcggcg ttctccgtgc
    28621 tggcaccgat caccggtgcc cagtgggacc ggtgggcgag tgcgaacgcg accgtgacag
    28681 cccgtgcggc ggtgaccggt gacaaccatc caccggatgc gccggcccgg atctcgcggg
    28741 tggtcgccgt cacccagacc gcgaccaccc cagccggagc ggtgctcgat gaatccacgg
    28801 tggcggtcta catgagcgca acccgtctcg gggtgtggcg ggtgagcgct ctgaccgtcc
    28861 gctgacaccg gacaggcgtg accgacagct gcaacgacat tcaggagtga tgatgacgag
    28921 ttcgaccaag acggtcgtgg ccacgaccct cgggcgaggg gagctgcgat gagtgaccgt
    28981 ggagtcaagg atccagtcaa ttcggcacgc gagatgtatc tgatcgcggc agtggtggcc
    29041 gtcgtcgggg tggtgggcgg cggggtgatg ctggcgctgc gcctgggcac cgatcaggag
    29101 gtgccggcga acccggccgt ggtcctgatc gacctggtga agggccatct tcaatggtcg
    29161 accaccgcaa ccgtgctcat cacggtgtac gcagtgctgg tgctggcggc agcgttcgtg
    29221 attttggtgc tggtggctcg cagccgcggc aagcgcaccc gcgtcgacaa caaggccaag
    29281 cacatgggcc ggttgcggga cgtgggatcg ctgaccgaga agctgtgccg taaggagtcg
    29341 gaccggttgg gcgtcgtcct cgaagagggt gcggcgccgg gggtcccgat cggaaagcac
    29401 ctgttgtcgg ggcagaacct gtacgcgaag tacgaggaca tgcacgtcga catctggggt
    29461 ccgcgttcgg gaaagagcag ctcccgggtg attccggcga tcctcgaagc gcccggcgcg
    29521 gtgctgacca cctcgaacaa gcgggacgtg gtcgatgcca cccgcgaccc gcgtgaagcc
    29581 aagggcggga aggtgtggat cttcgacccg cagaaagtcg ctgacgggga gaacacctgg
    29641 tggtgggatc cgctgtcgtg ggtgaccgac gaggtccggg ccgcggacct ggccgcgcat
    29701 ttcgctgccg gcgacgacgg cctggacgcg aagaaggatt ccttcttcga cccggagggc
    29761 caggacctgc tcaccgccct gttcctggcg gccgcggccg agcagaagcc gatcacccag
    29821 gtgtacacgt gggtcaccga cgagaccaac gtcgaaccgg tcaacattct ccgcaaacac
    29881 ggctacgacc tgcacgcatc cggtctcagt ggccagtaca acgctccggc gaaacagcgc
    29941 ggcggtgtct tcggcacggc ccggaagatg atccgctgct tgaagatgca gtccatccgg
    30001 ccgtgggtgt cgaccgacgg ccagcgaagc tgggtaccgc atttcgatcc gcgggagttc
    30061 gtccgctcga acgacaccat ctacctgctc tctcgtgagg gcaacgggtc cgccggaccg
    30121 ctggtgacgg cgctgaccgt cgcgatctgt gaggccgccg aggaactggc gacccggtcg
    30181 aaaggtgggc gtctaccggt gccgctgctc gccgccttgg acgaagccgc caacgtggtc
    30241 cgctggaccc agctcccaaa gctgttcagc cactacggat ctcgtggaat cgtgatcatg
    30301 gccatcctgc agagctacgc ccagggcacc gaagtgtggg gcaacaaggg catgggaatg
    30361 ctgcactcgg ccgccaacgt gaaggtctac ggcggcggct gcgaagttgc cgtcgacgac
    30421 aactacctcc gatcgctgtc caccgcgatc ggggagcact gggaatacag cggatcggtc
    30481 tcctccggtc gcggaggccg ctccacctca cgccagcgca cgaagatcac caccttcacc
    30541 gagtccgaac tcgaagaact gccccgcggc cgcgcgatcg tccgctcgtc cggaaaccgg
    30601 gccaccctcg tcaagaccgt gccctggtgg gaaggcccct acgccgacca ggtgcgggca
    30661 tcgatcgaac gccacgatcc cgaagcggac aagaccctcg ccgaagcggt gaccctcacc
    30721 gacgacgccg aaccgaaaga ggtacagccg gtatgaccag ccttgacgag ttcgacctgc
    30781 ccgaaccgcc cgacgaggac cccgccccac ccgaggattc ctgggcgccg ccgctcgagg
    30841 gtctcgtgcc cgcacccgca ccggcggcta ccccggccga cgggaacggt gcaggcgacg
    30901 ccctcgcgct gtccgacgag ctgagcgccc ggattggaaa ggtcaccggg acgctgctga
    30961 gcacgcagat caaggcgatc gccgaaaccc agctcgccga gctactcacc ccggagatct
    31021 atcagcggat cgaagagctc tcccggcgtc gactcgccgc cgagctggag acgcagctgg
    31081 tcgcggccgc ccacgcagcg gacgcggcgg agaatccgcc gaccaccgtg ttcgggtcga
    31141 ccgaagagtt cgttcgggtg cgcctggccc cgggctaccg ccgcgacgtc atcgacaacc
    31201 gggaaatccg ctggtgccct caatggtggc ggcacgaaga agcgatctcc cgcctcgaag
    31261 cgctgtggcg cacctgggaa cacttccgcc tcgacgccac caccggaatg agcgtgtggt
    31321 ggcgcgacca cgccgaccac cacatgtcgg tgctgatgtc ctcggagggc ccgttcagca
    31381 aatgcagcgt ccaacacggc caccacacgc cggacaacgc catcgcaccg ctgccgaccg
    31441 atccggcacc cgccgggatg ttccccgaca cccgcgagct ctgacgcacg gaaggaccaa
    31501 tcctcatgga tatgcaccgc gacgacggca tctacaccgc cacctgccgc cactacgagc
    31561 accgaccaag ttccgaagga ccaatcggcg tcactaccac ccagcacacc tcacaagctg
    31621 ccgcattcga cgccctccac gagttcctca gcactgctta cgaggtcggt ccccggtacg
    31681 acatcaccat cacccgcgac gacaccccac aacgcgaagt cgtcttcgcc accggcgggc
    31741 ccgccacagt cgatcgcctt cgccccgcga tcaacgaggc cagatcggca tactccagcg
    31801 catgggacat cctcaaagcc cacgcgaacg acctcatcgc agaactgcgt gacccgaacg
    31861 cgctcgtaca ccatccgacc cccgagttgc gtgatgtggc atgggccgcc aggaaccaat
    31921 acggcccccg gcaccgcacc cgcgacgcct accaaagcca caccggtgaa gaactcgacc
    31981 gcgccaagaa cctcgcccgc gacgccggac acaccgagga ccagatcgac cgcgcgaccc
    32041 gcgccgaccc ggatatggac atgcacagcc tccgtcagcg gtccgcaaac atgatccgcg
    32101 acgtccgctc tttcgccacc aactacaacc tccccccgga ccaggccagt gccctccatg
    32161 ccgcggccga cagggccgag gacaccgtcg ccgaactcgc ggccccgagc ggtgtccccc
    32221 cggctgtccc ctcactcgac agcagcacca ccatccagca ggacatcaca gcagccgccc
    32281 gactcgctgc cagcgacttc ccttccccag cccggtccgt cctcgtctca ccgaaccagc
    32341 ctgaaccgac ccacaaatcc acggccgcgc ccacccgcac ctccagcctc aacctctagg
    32401 ccaagcccgt caccacaaca accggtaggg agaaccacat gtccgaaggt cccgaagtcg
    32461 actcggcaaa ccacgaagtc aacgccatga tgcgcgtcgc actgcaactg gcctcccgca
    32521 tggcagagaa gatggctcgc aaccgtgagc gtgacctcga gcaggcgcgc cgcgaatcag
    32581 ccgaacatgc ccgcgaactc gcacaacgac tagagaccag tcgcgcggcc gccgaggcat
    32641 acctgcgtgc ctcgttcgat gaccaatggt ggaaccgggc acagcccggc gagatcgccg
    32701 accagtggca gcacgcacag gcatggaagg aacactccca ggtcgcatcg gaagccgtcg
    32761 aacggatccg cgccgaaacc gccaagcggt atggcatcga cgtggacgct ccgggcgcgg
    32821 acgagaaggt cgtcgacgcc ctgctgcgcg atgcggagaa ccgaaaagcc cgcgccggcg
    32881 ccgaacacgg ccgatcccaa gccgacacca tgacggccag tgagattctc gacgaggccg
    32941 agcgggcgga tgccgaacgc gccgatgaga acgaacgcaa cgagacgaac agcgaagacg
    33001 tcgaaccgcg gacacttggc ggtgattcgc tgcgctcggt ggccgaccac gactacgact
    33061 ccgccgaacg acgcggggag gacaccgacc agatgagggc cgccggcatc gacgaagagg
    33121 aagtcgccac ccgcatgcgc gccgacctcg accaggccag gcacccggtc gaagcggtgg
    33181 ccggcgcggg cagccatccc aaggcccgca agggtcgggc cagacgcggt aagtctgccg
    33241 agcggacgat gactggccgg tagtagatcc aatccgtgta cctggtcggt tccctcgaaa
    33301 ccaaccaggt acacggccca ctcctgcctt tacaggcgcc tcaagaatcg tcgtccgacc
    33361 cggtctcggg cgagagcaat ggcgtcagct aattccgact tgtcaccgat gattggccac
    33421 catgaccagt cggatcctgc cgcctgtgct tcctcaacga agatcgcttc tggctcccac
    33481 acgtcccttc cccaccgccg ttcacctgca gccagtgtag ggcctggctc gacgtcatgc
    33541 cggagataga acagccctcg ccggtattcg tactggtcgt tgagttgact ccaatcctca
    33601 tcgtcaggac atgcctccgc aaagagcggc cgcagcattt tccgtaggta ccgactgaga
    33661 gcaaatccaa gtcccgcaac gtcctgcatg cctgcaaagt tcatcactga gcgctcatcc
    33721 agcacttcgt gctcatccag cactcgaaga gcaggcagtc tcggggcagt cggtcctctg
    33781 tccgtatcgc gccatttaac gttctctgcc agtttgatcc acagatccgc gtccgagtcg
    33841 aagcacagtg ttgacaaacc gatgacgcgg aaggccagta aagcggggaa gtggcgcgac
    33901 ttgtcgtagg cagattccgg catccgttgg ataagggaat tcccgtcttt cttgaagcgt
    33961 ccgcgggcgt cgacaagttc ctgcaacgca agcggccatg cacgattatc cccgctggcc
    34021 gggtcgtact caacgccggc atgcaggatc tgcaacgtgg gttcagtgag ctcgtaaagc
    34081 aaccgatatc tggcttcgag tggctcaagc ggcccgctgc tcgacgtgac gatcggaagc
    34141 tcgttgatgt ctcgccgtag ttgttttgtc gtgttcttca ccaggtcgat gaggtcgatg
    34201 ctcttcgaac cgtcaacgac gtatcgcttg acctgaccta ctagatcccg ctccggagga
    34261 ggttcaggct gaactgtggg cccgccagca gaaggggttg cagcgccgcg cccagcggac
    34321 gggggaattg tgaagtcgcc ggcagtccgc caatcgtcgt tctccatatc gacggcaagg
    34381 cctgtgtttc tcagacgtcg tcccagatcc ctacgactgt cggaagtgtc cttaatctgc
    34441 acatagttca ctccagcgat gtccgacatc tcccgcacgc caccaaaccg gacgaggaca
    34501 actttttccc gatccttctg catagccatt ccagcttcga agatgacgtt catacgcggc
    34561 tgaggggtca gatccctctc gaactgcgga tcatgatcgg agagaaactc atccctgcat
    34621 cgcccgaggt catccggcgt gaacagcact acgacggcgc cggcggcttc cattcctgca
    34681 gtaacgatgt ccatcgtggt agggcttccg gagccagtgt atgaggctgc ctcctcccac
    34741 tcgatgaccc ggagatcgaa ggtacgaagt agctggacca tggacttctt gattcggtga
    34801 tcgcgaccgt ggacaagaaa gactcgtcta tcgcgcgcgg gagaagtaac gggctgagac
    34861 acgggagtct ccctttgtga ttgtcgtagg tctgatgaag gggagatagt gtgagcgggg
    34921 gttgcgagtg gagatgtggc agcggacccc tcctgcgtat cgccactcca gtggagagtc
    34981 ccggacggat cgaggaccac atcgacgcgc ttcaatgtct cgatcagatc ggctaccgca
    35041 tcgacgagct catcttccct tcctagagtt gaacgctgag ctcggctgag aagtcctcgg
    35101 agtaacctca acagtcgagg aagggcttcc ttcgcgtcct cgtcgctcgc cgattcgaga
    35161 gcgtgcagta ccagttcctg cctgttagtg cccacgcatt cgaggcccac gctcttcaaa
    35221 actctgactg tgtcgaccct cgatggcccg tgggagcccg cccaaaaccg cgccattgga
    35281 ccggcgatcg tctcgccgaa ggttcgccct gatcggcgag acgtcttcgg gtcggattta
    35341 gtcatggacc caagaatgcc gcatcagttc caaccgatac gccggagtcc tacctttcgt
    35401 tgccttcctg ggcacggtcg cgaccggcgt gagtgcgtgg ggacggatcg agcggcgcgg
    35461 gaatcggcga tccgggacgc ctcactgcct cagatggtgg tgatgcgttg tcgagtgcga
    35521 caagtcgccg caactcttcc tgttccggtg tgagtgtcga tgtcgacgtg ccgtcctgcc
    35581 tcgtcatccg gtcttcgacg cgcgcggaat ccggcaccga cagccgcggc tgttgagggg
    35641 cgtagatggc cgcgagctcg gtccgcgcgg cgtactcaat gtcgagggca cggtacaact
    35701 cgcctgacgc gcgatgcgca tccgcgatcg cctccatcgc cttcatcaac tgccgcagca
    35761 acaacatcgc ggacacgctg ttcgggagat gccctccggt ctgcatcacg atcagtgcgg
    35821 caccacccgc agacatggcg cccttcggtg cccggtacgc ccggtgcgcc ggaagttgcg
    35881 cggaacgggc gagctgacgc gcggccgcgg ccaggggtcc gggtgttggt tcgatcttcg
    35941 cggaccatgc cgcgaacaca ccggcggtgc ggcctgctgc gcgtgcccac tgtgcccggt
    36001 cttcgagtgg gatggatcgc aggtaggcgt tccacttacc gatgtcctcg gtggctcggt
    36061 cgagcagttt cgggtcgagt tcctgactct cacggccggc ccgcacggtc ggacgttcac
    36121 ggcgagcagc gttccactcg tcgacggccg ccgccgacgc ctgcgggctg tcctcccact
    36181 cgctgcgcaa acgcggcagc gtcaggtcct tggcaaggtg ccctccgccg tagaagaccg
    36241 gagagtgtcc gttggcgggt cgaaccgcga ccttgaaacc gacaaccacg tcgccgcgtc
    36301 cggaggcgaa gcggggccgc acaatcaacc cctgtccacg caggcggcgc acgaactccg
    36361 cttcggattt cgacgcggtc gcgcacgcgc ggacgcggcg agcgaggagc tcacggtcca
    36421 actcactcgc accttcacgc tcggcacgct gcttctcggc acggtggtag ccgcgctcac
    36481 cggagttggt ttcccgggag gcgatcacgg cgaggccgtg ctgtcgttcg agtttggcga
    36541 cgatctcact tgcccgtctc ttcgaccgcc acaagtcgac cttcgtgccg tcctcacgca
    36601 cggcagaggc ggcgatgtgg atgtgatcgt tgcccttgct ggaaagaccg tgacgggcag
    36661 ccacccagcg ggcgggggag cggccggact gactggtgaa tcccatctcg tccatgaact
    36721 gctgggcgat ctcgccccac ttctcgtcgg tgagctgccc ctcgtcggcg tgcagcgaca
    36781 gcgagcagtg ccacacgttc gcgtcccgcc aggggtcgat cgggtcgcgg accttcttgc
    36841 cgtgcgagtc ccgtacgtct tcgccgttgg agtcccggag gtagttcggc tcccggacta
    36901 cggtgccgaa tacccgtcgc ggttcgtcga tctgacggcc gatctcgatt gcgtcctggt
    36961 gggacaactc gttgtcgtgg tgccacgcca tgatcgcagg atcaccggca accaggtgcg
    37021 ggtcggtgtg ttcgttggat cggcccggac cctgtaggta cgacagcaga ccggtcatct
    37081 tcccaccagt gccgatcttc acgatcatcg cgcgtcgaac tcctgcagaa tcccgtcgat
    37141 ccgcctcgcc acccgccgga cctcgtcgag tgtgacacgg agattgtcgg gcagatcccc
    37201 ggtagcgttg gtggccttgg ccatctgatt gacgttgatc gaaatcgcag acagcagccg
    37261 gaacccgctg aacaactgct ccgcgaattc acgccgctcg gaagcagtct cggaatggtc
    37321 tgccagcgct gactcaacga gtaaccgagg cacggttacc cgcgcatgct gcgccttcgc
    37381 cagcagcgcc gactcctcct ccggagtcac cttcaccacg tgccgggcct gccggccacc
    37441 gtcgacgttc gcacgtcgct cacgccggaa tcgccgggga cgatcaaccg cgtcttcgct
    37501 catcgtccct gcctttcagt tggcccagcg cagcgccccc accacgtggg gctacacggc
    37561 agtgtctcag gtccagagcg cagcgtccag acctgacccc aacttagggc acctaagttt
    37621 ccatcttgct ccgccggggc tcgatcagtt ggcacgcagc gcctgcgtcg tgtgcccgtt
    37681 cttgaaagaa gcacaggacg agcgcagcga gttcctttgc gcggtcttcc ggccgtcccc
    37741 acctgtggtg tggacccgat tgtgggtgcc tgagatcgag cggagcggga cagggaatct
    37801 cgggcatcca cacgaggacc agggcactcc acacttgtgg tcggccggcg cccgaacggg
    37861 ccgacagagg ggccgcgcta cgcgcgtcca acgcgacttc gccgcggggg agttgtcccc
    37921 aagtgggtac cgggcttaac ggcattgggc acccacgaca tttctccgct ccgctgtgtc
    37981 gtgtgcacac aacgcctacc cggacaccca cccggggaca acggaatccg agcgcgactc
    38041 gactcgcgca cacgccgcgt gtacggctcg agattcgcgg gcaacgtcta tacgatcgac
    38101 cgcatggaga accagtcgct ggaaaccgaa ttcgccgctc tcgatgaaca gatccgacga
    38161 gaagccgaga agaagatgca agcgatccgc gtcgtcgcca cagcacacaa aactctcgcc
    38221 gacacccgcg aggagttcgc gcgcgccgac gccgcgaaca agaaggcgtt gaccgacgcg
    38281 atcgccgccg cgcgcagcgc cggattcacc gacgccgacc tgaagcggtg gcaggccgac
    38341 gacaacaagc ccagccgtcg cggacagcag cgccgtcccc gcaaggccgc acagaaggac
    38401 cagccgggga ccccgaccgc gaccgcttcg acggactctt cgccccagcc ggcgaacgaa
    38461 tccctcgccg cgtcggcctg accaagcacc cgccatagtg ccactgaccg ctctgtgtca
    38521 gtggcacact catgttcagt actccggggg gagttcgatg agcgagatca cgctcgatag
    38581 atcagaagag tccgccgctg gaaacggacg tggcgtccaa ggccagcgtt caaagcgggt
    38641 cctcatcaca tttctgggac cggttctcgg agtttgccac ctttgcgcgc ctcgcaccta
    38701 acgagcccgg tttcgccgcc ctactcgggc tgcatggtct cgtcgcggcg gtcgtcgtgg
    38761 tgaagctagt tcctccatgt ggtccggtgt ggagtgttgg tgcggagctc gcgcgcggtt
    38821 tccgttggct cggcctcgca ccggtgagga tccggaacca gccggtatcg cgacgcactc
    38881 agctgctgtg gctcgtcgcc attcccggca cgctcgcgct gttgcacctt ctccttgcca
    38941 cacagctcgt cacggcattc cccgtgatcg atcccgccga agatgccgcc aacgacgcaa
    39001 gggaaatact cgggacgaag tacggcctct acagcgcgtt gacgtatgcc ttcttcggct
    39061 cagccctcgt cgaggagatc gccttccgaa acgttgtcct tctcgtgcag cggtggcggc
    39121 cgcacgcaac gctcctcatc gcgatcatcg cgaccgcgtc caccgctctg ttcgcggtgt
    39181 cgcatttgaa ctacggcacc gccaacgtcg tctcgggatt cgtcggagga gcggtctacg
    39241 tcgggctcgc gctgtacacc cgatcgctct ggcccgccat catgacgcac ttcatctaca
    39301 acaccgtcat catggtgggc tgggtggcga tgtagccaac aaccacaaca tgcagcgagc
    39361 gccccgatcc ggtcacgggt cggggcgctc gctgcatcac cacttgtgtc cgacctgtcg
    39421 gtccccgcct ctatcctcgc cggtaacagc acctggaacc ggttgagtgg aggacaccct
    39481 gagcgtcacc agcggcattt ccccgctccc gggtatgccc gttccctcgc cacatgcgga
    39541 ggacgagcag ctcgctctga tcggacagcc gcagccggtg cgcgttcctg cacgactgtg
    39601 gcgatcgtgg ctcaccgagc ccacgatcgt cgctcggttc gaagcgaaaa tttatcggcg
    39661 tgccgacgag ttgtgcactg tctggaccgg aagtgtcagc tcgacgggtc acggatcctt
    39721 tcgggcggcg agtctgcccg gcacgtctcg acgtggcacc gtgcccgcgc atctgttcgc
    39781 ctaccaactc gagtacggag tgatcccgag gctggggtgg tccggtgccg atgacgcggt
    39841 gctgtgccat caatgcgact tcgccggttg cgtcaatcca caccacatgc gcttgggcac
    39901 caacgccgtc aatcgcaccg agtactacct gcggcgacgg aacctggcca gtccactcgc
    39961 cgacatccgc ggtcccgccg ggcgcacccg cgccgtcgcc gccgctgtcc gcgccggcct
    40021 cgcgaacggc gacgaatccg acggcatcga gttacggatc cgccgcgccg aagccgccgg
    40081 cctgccactc actctttggt gattctcggt gcgtcgcaca gacccaggtg cacgcacacg
    40141 gctgatgcgc agagggtgtt cggggctcga tgccccgaac accctccatc ccctccctga
    40201 cgggcccccg gaactccgca cttccggggg cgcgccgttt catgactagg tgatgtcgat
    40261 gtcttcgggg cgcagttcgc cgctgatcac cttctccaca ttcgagaggg tgtgcccgtt
    40321 ctcggtgagc atcgcgaggt actcgctgac gtactgcggc cgcgaccgcc atgcatcctt
    40381 cgccattcgc gactccatcg ccgcgacagt gagcgcgaag gtaagcatcc aggcgcggga
    40441 ctcgctggcc gccgtcgctg cggccgcgat cttcttcttc gcgtcgtacg tcgtccaggt
    40501 cttgtcaccc atcaactccg gcagcagatc ggacgagtgg aactccgaca actggtgcgg
    40561 tgcgagcgcg accatcatcg ccgtccacgt ggccgcgttc ttcggaggct tgttcgccga
    40621 cagcatctcg cggatgaact cacgcctcac gtcggtagcg gactcggcca acttgttcag
    40681 ctcccgtacc cggcgacgct gcacccgctt ggcctcctcc gccgcaagga gtgcggcctc
    40741 acgggcttcc tcgtcctccg gcaacgggtt ggtcgggttg aacccggcaa gttggatcgc
    40801 ccggttgaac tggtagcggc caccgttgac aggaaccaga ccggcgtcct cggcacgcag
    40861 cacgtcgagg aagtagaact gcggcacgta cacgtcgcgt tcctcgaccg agttcgcgtg
    40921 ccgcagccct tcctcgggct cgacgtccgg gtcgtcgaag gtgtcccagt cgatgtcgcc
    40981 ctcttcgacc ggttctccgg actcgacttc gacgtacatc gtgtcggtgc gcacccacac
    41041 gccccatagc tccggccgct gccgcacctg ctcctcggtg atgtgcgcgc gcgggtccgc
    41101 ctcggcgtcc tcggcggtgg cgatgtatcg ccagtggatc ttcgtgtcgt cgccaaagcc
    41161 gggatcgctg tcgagcacgg tgaacccggc ttcggcgtat gtcgcggtgc gttcggcgcg
    41221 ggtcgctttc tccttccggt ccgccaggag tatgcgggcc tggtagtcga aggagtggcg
    41281 ctggcactgc gccaatgtct ccacggcctc ggtgtcgcca tccgcctcga acgtggcgat
    41341 cacggccgcc tgttcgatcg tcaggccctg ttcctcgagg ctcgcgcgcg cggcttcgcg
    41401 gcgtccgact gcgccgagca gcttgaccgc cttgcgcttt acgctcagct ccttcgagac
    41461 tcgttccacc ggcaccccga ggtcgagcat ttcggcgatc ccggcggcgt tctgcgcggt
    41521 cgtcaggccg gtgcggtggt tgttcgagtt catctgctcg ctgatccggg cgatggcacg
    41581 ctcgatctcg tcggtcgtgt cctgtgagcg caccagcacg gggatggtgt cgcggcctgt
    41641 ggcgattgcg gcgagcgttc gtcgttgtcc gtcgatgacc accaggacgc cgtcctcgcg
    41701 gcggttcgcg gtgatcgggt gcagcacacc gtgctcgcgg accgacgcca cgaatcctgg
    41761 tgtcgcctcg aggtcgacct ggtcgcgcac gttcttgccg acgtcgaggg tgtgcgggtc
    41821 gacctcgatc agctcgacgc ccaccggttg cagtgttgcg gtcatgatgt ctctctcctg
    41881 tactgtctcg ggcgagaaca ccgggcagat agttgctgcc cggtgttctc ttgtttccgg
    41941 gtggttcgtc gtcagtgggg ggccggggta tcggtggtgc ggtccgcctg ccgtgccatc
    42001 tgcctgttgc gcgtcgttga aggtgacgac gacggcgtca tcggggttga cgacgatgcg
    42061 gtgcgaaaac ggccccgctc gggggtggtg agcggggccg tggtgggcgt ggtgacggag
    42121 tgttcgtcgg gttgacgcgg tggtggtcgg gctgatgggg atcgggttca gtccgcggcg
    42181 atctcgctga tggcgatgcg ggcggccttc tcgtcgacga tggcgtggtc ggcggcgaag
    42241 gcagcggtga gcgcgtgcag tgcgaggttg ttcacggcgc ggggatgccc gcgtgaggcg
    42301 ttgtggatga gctcggtcgc gtcgtcggag aacagggtgt cgtcgcggcc ggcgatgcga
    42361 cagtggtggc ggatgtagtc ggcggtgtcg gctgcgctca tcccggcgat cgtgtagcgc
    42421 acggcgatgc gctggtccag ggcggcgagc acgccgagtc ggagccggtg ccgcagggta
    42481 ggttggccga ccagcacgac cgcgaaaggg gatccggagt ccatctcgtg gttcgtgagc
    42541 aggcgaatcg cttcgagctg gtggttgtcg agcaggtgag attcgtcgat cacgagcacc
    42601 ggattacgtc ccctctcagc gtgttcggta gcgagtgctt ccgatgcctg cggggcgagg
    42661 ctggcggtat ggaaggcggg ggtgtgcccg agcgcggcga cgacgtgccc cagcatgccg
    42721 cgcactccga tggtggggtt ggccaggtag atgatcacgt gccgggaggg gtcgagggcc
    42781 gcggcggcgg cgcggacggc gacggtcttg ccggcgccga cctcgccggt gatcacgccg
    42841 atcgcgcgtt ggtcgacgca ccaggtgatg cgggcgactg cctcgccgtg gccggggtgg
    42901 cggtgcagca ttcccggtgc gaggtcgcgc ccgaatggca ttcgggtgaa agcccaatgt
    42961 gattgcagcc gttggatact catgccgaca cctcgccgtc ggtggcgggt gtgtggtcga
    43021 ggacgacgac ggtgtcgtcg tcgagggaga gggcggggtt ctcgtcggcg gcgtggccgt
    43081 gggtggtgct gtagagggcg tggtagccga tgcgctcgtc gcggcgcagc tgctcgtggt
    43141 gagcgaccgc ggtcaaggcg aggtagtcga tcccggtctg cgccggcgac tgcggcgcgg
    43201 tcgtttccgg tttcgccttg gggtgcgcgt gccgggagat ggtgtgcggt gtggctgtcc
    43261 cgaagctctt gccgcggtag cgaacctcga gggtttccag gtcgaacggg gagaacacca
    43321 actccacctt ccgcccgacc agggcgggat cgacctcgta gacgttggcg tgcagtgaca
    43381 cggtcgcggt cttggtgacg gtgcggtgct ccgaccacaa gaacgcctcg gtgagatcgg
    43441 cggctgtcgg catcgccggg gtgcggccga gccggtccca gccgtcctgc caccgtgcca
    43501 gcggactctg cccggtctcc gagtgcacgc ggcggtggta ctcggtctcc acccaggcgg
    43561 tgaacaggcg gttcatctcc agcagcgcgg ccgcgtggtc gacgccggcg gcggcgaggt
    43621 cctcgctgct ggtgtcggtg acctcgacga ggaactgctc gcgcacggtc cggaaaaacc
    43681 gctcaatctt gcctcggccc tgaggccgac cgggggtcga gtgcaccagc cgcacaccga
    43741 gtttcgcgca ggcacgcagc agccacgcgt cgacgaacgc ggaaccgttg tccacgtaaa
    43801 tcgcccgggg aacaccgcgc gcggccaggg caggtttcag tgccgcggcg agccggaccg
    43861 tgtcttcggc gaacccgaac cgatagcccg gcagcaaccg ggagtgatcg tcgacgaacg
    43921 cgaacaggta ggtcttgcgg tctccgatcc gcgggccgtg cagggcgtca ccgcaccaca
    43981 actcgttcgg gtcggcggcc tcgaaccgcc cgaacaccgc cggcgcctcg cccgcgccgg
    44041 gacccatcag gtccacccgg tggaaatgcc gcagcagcgt cgattccgac ggcgcccacc
    44101 cggtcgcggt gcgcagaatc cgtgccacct gcgcgacggt gcgggtgggg ttctcccgct
    44161 tgagcgaggc cgccaactcc agcacctgcg tgtcggtgcg cgcggccagc cgacgtggtt
    44221 cgggcaccag cgcctcgaag ccgccgcggc ggtagcggcg gatccagcgg tccagcgttt
    44281 cccgcgagat ccgcacctga ttgccgaacg ggtcggcatg cggttcggcg gcgatctcgc
    44341 gcaccagctt gccgcgttgc ttggtcgaca acccctcgtc cagggccggg cagatcagcc
    44401 gataccggaa caacccgatc gcctgcgccc gctcacggcg cttgtgctca tccaacgaca
    44461 tcttctcggt ttcccctctc gatgaagacc cgccggcaca ggtgttgccg gcgggtgcct
    44521 tcgtgaggat caccgatcat cgccgcccgc gtcaggggcg actggtgttg cgtccggcct
    44581 cggcgccgcc gagggccacc ccggggcgag gaggcgacca ccgctggccg cgaccgccac
    44641 ccgcaccggc gtcaccgcgc cgacgaaccc ggccggaccg aaccgagatc gcaccgccgc
    44701 ggccgcggtc tccaccgcac tcagcacatc ccgccaccgg cagccggtgg tatcgggaat
    44761 cgtcacgtcc accccggcga ccaccgcgac accgagaaac cacgaccgca cctcctccaa
    44821 ccgctccgcc atccggcgca gccaaccccg caccgtcgtc gccggcacac ccacgaccgc
    44881 ggcgacccga cgatgcccgc cgccctccgc gcgcacggtc aacgccgccc agatcagttc
    44941 cgccgcatac gccctgcgca gcagcacagc taccggcaac aacacatggg tcaccgaaca
    45001 cgcccggcac cgcgctcgcc gcggccgcag ccgatcaccg agcccgacga tccggcgagc
    45061 gcgggcatac ccccaaccgc cgagcacacc gtccccgcac gaggggcacc cgatcgtccc
    45121 ggccgcgagt cgggactcga cgtggacagg atcagcctct accgtcacca tcagtgcctc
    45181 cagcactaca gtgcggcacc ccgctggccc gccaagactt cgcggggtgc cgcgcacccg
    45241 tcagttcctc gtcacactga cgatgcacac gaagcagatc aacccctgcg atcaccgcga
    45301 ttctccatcg gcaccctcag tggagaacgg gcatgccgtg gtcgtcaccc acagagacgg
    45361 tcaacaatct gccacccggt ggcgaagccg tcgttgaagg tgtcgagttc ggcggccatg
    45421 tagccgaact cgatgcctgc acgttcggcg agcacgtgca gcggttcgtc gtcgctctca
    45481 ccgcacgacg cgagcacacc ggcggtgaat ccctgctcgc ggatgatgcg gaccgcgtcc
    45541 tcggtcatct cgatctcctg gttgtcagcg gaaggtgatg gattcgcgcg tcgggtagac
    45601 ccgtacgaat ccggcggcgg cgacggcgta tgcgacttcg ccgtagaaca ggacgtcgcc
    45661 cttgctcagc gatcggtgac gctcggcccg gtaccggcgg accacttcga gtccgacaag
    45721 ctgggggccg ggttcgttga acacctcgaa gacctcctcg aggttcacct ccaggtcgcg
    45781 gcgcggatcc atctcgaacc gaatcacctc gcgcagtggg tcgccgtcgg tgtagccgat
    45841 gagcattgcg tcccgtgctt cgttgtgcag cactcgcatc ggcacactcg gcgctcccgg
    45901 tgtcacgttc atctggggtt cccttcggtg gtgatgggac cggaactttc cggtcccggt
    45961 cgtgtgtgtg gtgtccgtcg tggcggtggg aaccgggcag atagttgctg cccggttccc
    46021 accgacgttt cggatcggag tgcttacgcc gcctgggcgg ggcgagcgct gcggctggcg
    46081 atcagtgcct ccgcgaccgg accgaggatc ggttccgggt tttcgtccca tccggcgacc
    46141 agaacggcgc ggccgcgaat cgggtggtcg gtgaccgggc cgtaccggtg aacgatcgcg
    46201 gtggctagct ggttgatcgg gacggcgggg acatgctggt ggttcgcccc gacgagcagg
    46261 ctcgccgtgc cctggtgggg gccgcgtccg aggacgaacc cggtcgtgcc gacgtcaccg
    46321 acggcgtcga gggccgcgcc gataccggcc gggatccgca ggctcgccca caacgggtcg
    46381 accgggaggt cctgggcggt catggtgccg tcgatctcga tcacgacggc ggaaaaggtg
    46441 gtgcgcatgg tgtctccttc tgaaggttgg atgtggtcag aggccgaagt cggccgggac
    46501 cagccggatc tcggccgctt ggatgtacgg gtcgtcgggg acaaggccga agaccatgcc
    46561 caccagctcg gcgcgcatgt ccgtgtccag gtcgtcgaag tcggggtctt cctcgacccg
    46621 caggtcggcg tagatcgcgc gcgcgacgtt gatggggtcg atgaccgtgt cgaggacgat
    46681 ggtggtgctc acacagaacc tccgatgctc agccgggcca cctgcgcggc ccgatcattt
    46741 tttgtgccct tctggcaaag gagaggtccg ccggtatgag gtggccggag tgcaactgtc
    46801 gagccgaaaa atcttggggg agcgaagcgg aggaaagaat tttcggagcc cttgggccgc
    46861 cgtcaggcgt cggcggttgc gcgcaggtca ccgccggcga gactcggaag gccagaaggg
    46921 aacaacaacg gcgcccttca ctgggcggag cgcagcggag ctcgaatcag ggggacaccg
    46981 caggtggcct cgcccgggac gaaggaccgc ggccgccaga ccgacggctt cctgcacact
    47041 ccggctggct tcggtggtca tccacagagc cgccggttat ccacagacct agttgtggtc
    47101 gggacgcgtt ttgttgttca ctccccgcca tgaatacgag tccaggagtc cgagccatcg
    47161 ccagcttcgt tgtcgctggg ggagttttcc ttacggccct tgcggcaggt tgcaagaatc
    47221 gtgatgcggc gcactacgca ttctggggcc tcatgttgac ggcggcgttc gcctaattgc
    47281 ccagactcgc agcggcggat aatggcagcc ggtgaagtca gtcgggctgc gtgtggcggc
    47341 gagcatgccg ggccagaagg tgcttcttgt tcttctcgct gcggaagatc tcgcgagtca
    47401 cggcttggtc gatcattccg ggctcgtcga gcacgcgctt cgcggcgagg cgcatcaact
    47461 cggcgcgatc agatccgacc cgtgcggcca gcgcgtcgag cttgtcacgg agggcatcgt
    47521 cgaagtgcac attcgccctg gccggataga tctcgggtct gagatcccgc aacggcgcaa
    47581 tggcctccag gtctctagtg aggtcaccgg gctcgtccaa caggcgccga aggacgaccc
    47641 gcagcagcgc agtgttgagc ttgtccccgt atcgtccggc gagcctccag acttgctgct
    47701 tgctggacgg gagaaccatc acgtcgaccc agtcggacag ccctgcccgc tcggcctcac
    47761 ggagcagtgg atgcttgtag cgaccaggcg cttccaggaa acgatgcagc gcaatccgca
    47821 tgagggcact gaccgtggtg tcgtgctcga cggccaactc cgcgaactcc agcgcagtgg
    47881 caggctccac tttgattttc agcatgacca gcgggatcgc ccgcagcgct tccgagatcc
    47941 tccgctgttc cgagagacca cgaccgacag ccttgggctg attaacaagt cgccggcacg
    48001 caacacggac cagcgcccca aatcgacggg ggccgattcc ctcggccatc tcctcgagtc
    48061 tgcgtttggt ctccgggtcg aagcgaagcg cgatgggatc gcccacaggg atccgcccag
    48121 gcttcaactc agtcattcct cgatcttctc gtccgcaccc gcaaccctct tcgtgtgggt
    48181 tcgctgatgg ctcggcggtg acgatcattc gggaaagatg cgaagccgct gacacgctcg
    48241 gtgcaggcgg cttctcatgt gcatggcgtg ccgcgtggca tacgcaacac caccacacgc
    48301 gtgccggtgg cgctcattgc gtggtgtcgc caggtcgcat gccacgccca acttcgcccg
    48361 gcaacgtgtc ccggtcgagt actgctgggc gcccgcgatc acggcgcgca gcagtactcg
    48421 gcgtacctcc atgcctcctt tgccggtgtt gcggctcggc tggcgcctac gaacgcggcg
    48481 gcagccgagc cgccctactc ttgtcgcaag cctccgacct gcgacgataa ccctggcgaa
    48541 tcgatctcaa gtgcaagtac gatctcttcc tgaggttaca aaagtaggaa agtgtgatac
    48601 tttaattgag gagttaggta ccccagctgt agaagcctgg ggaaacccaa ctcgccgata
    48661 attaaatatc gaccaggttt gcaaacatct gttcaagcag ccatcggacg agtgctccag
    48721 ccagaagctt tccgataacg ctagagacgc gcttagagcg cggctgatca ggcgtcatgc
    48781 ctcccacctc ctctctttgt agttgttggt ggaaccggtc acacagatat ccgacaccag
    48841 acgagatggt gtcggataga ggcgtgtccg ggtacatcct atcagatcgc ttgacctggg
    48901 cttttgttca ccccgatgta ccaatcccgc cgccggagac cgggtttccc cggtccgtct
    48961 ccgggttccc tggcggccct gcgagtccca aggcccgtgg tcagttcctg tcgaagaacg
    49021 tctccgcttc ccgacgaatc tgtgcgagcc gcttcgagac tgcgctgtgg ctggcgtacc
    49081 ccagcatctc ggcgatctcg ctcttgctcg tcacgccgct gttgaggagc actacgatct
    49141 gcctgttacg ggcatcgagc agcgcgagga agtcgttggt gacgacgttg cccacgatct
    49201 cgctctccgg tccttggacc gggatggtgt cggtcaactc gacgaacgtc accttgatct
    49261 ttcgccgctt gccgtgcagc tttcgttcga agtcttctct cgcgtacgac cagtggctgg
    49321 agaagtcgtc ctcgatccgg tgagagcgga cagcgtcgag gatgccgcgt agctgaccga
    49381 ttcggtccgc ggcctccacc gtctcgacca gggcttcacg ggcgtcgtcc tcaccgaacc
    49441 agacgggccc gcccttccgg gggttgccgg ccaccgccgc ctcgagcacg ctgccatcct
    49501 cgagagtgac cggcccggcg gtcttgccct tgtcgacctc atcgaagtca cgcagtcggt
    49561 cctgaatgac cgccgtgacc gccggcaccc agaaatcgag attgtgggtc agcagccgta
    49621 ccgggtcgtc gtccgagaac gccttcatct tcgatcccga ctccaggtgg ggccacactg
    49681 tccatgccca cgcccgggtg agccgggcag cgaagtcggc tggcaggaag tcatcgacac
    49741 ccgcattgtc agccatgaat ggccactgtc cgcgacgcag cgtcggcaac ccgaacatat
    49801 ccaggacgcg cttcggcagc aggtgcatta acggtgcgta ctcgaagtat cgcgaccgtg
    49861 tgcgaggcac gagagtgacg ttgacgtccc cgagctccgc cagcttagcc aactggtccg
    49921 gaagatcgtc cacgtcgaag aaccggcgcc ggaactgggc cgactcccaa agcatgttcc
    49981 acttcccgac cgccagctcg aactccggac ccgcgttgtg gggcatcgac aacgccacat
    50041 actccggcgg cgacggttcc aatgggcgga ccatgccgcc gaacatgaac ccggccgaga
    50101 ggttgtacaa ggacgggaac tcgtccgggg tcgcgtcctc ctcggggaga aacaccgcat
    50161 cgcggcgcca ctccaagatc tctgccgcag tgggctcgcg ctcctcctca ctcatcgggt
    50221 cccccgtcat ctgtgccact gcccggttcg tctgctcgtt tgtcatcgtc atacctacat
    50281 cacgacggtc ctccctgatt ccgttccgag agctccgtca catagttctt ccgtccggct
    50341 gctatatcga gggagtccgg cgggcacgac taacaggtcc tctactggtc gtgcccgcaa
    50401 gcgggtctac ctttcccgac ctgtatcgcg gctgcggtcg gctcgcaggc cgggtgggat
    50461 ccgctcgatc gtggcggtgt tcgttgcggc ggccgtggtt gcgtgggcgg ggtagtcgga
    50521 gtggaccagg cgaatgacct cggccagctc tttgtcggct actgtttcgg cggcggccgc
    50581 aggctgggtg ccgttggcgc gcacctcggt cagcgcagct tggtctcgtt cccacaccac
    50641 caccggtgga actgcggctt ccgcgagggc cgtcccgatg gccttctctg cggcggagat
    50701 cgcggcgtcc cggttgggga aggtgccgct gtcgagggtt tccctgtcgt tgtgggcgga
    50761 ccagtaccag tcgcggccgg tccacttcac cacggcgccg ggatcgccgg tgtcacgatc
    50821 gaatccggcg gtgagctcgg agccgatctc gtcggtgcgc tgccaccgcg gtggttgcgg
    50881 gttcgccgcc cgctcggcct tgcgttcggc atgctcgcgg gccgccgcca ccatccgggc
    50941 aggggtggct tcccgcagtt catcctcggt catgccctgg tcttcggcgt gcccgcgggt
    51001 ggggttgagg tcgcgggtcc acccgcggta catgccggcg gccgccaatc gttccttggt
    51061 cgcctccttc tcggcgagcg cctcggggga gttctcccgg gcggcgaggt cggcccgcat
    51121 ttcgttgtag gtgtgtgtga ggcgggtgat ctcgtcggtc ttggcgaacg ggaccccgag
    51181 cttgtcggcg agctgctcgg tctgggtgac catgtagtcg cggtccttga cgtgcaggtc
    51241 catcgcggcg ggcaggtcgg cggccatgtt ggtcagccgg gtcaccatgc cggatccgcc
    51301 gtcggcgctg ccgagtgcca ggtcgacgac ctcggcgtcg acggtgcgga cgatgccacc
    51361 ggtgaggcgg aatgcgtacc cgccgaccgg gagccggccc atcgagattt cggctccggc
    51421 gatctcggcc accagatgct ggccatcggg ttgacgttcg aggtcgcgga cgatgtgcgc
    51481 cagccgggtt tgcaccgcct tgcgtacctc cgccggttcg gcgaacgaga ccgcacgccc
    51541 gcccacggtg agggtccgct gtttgcgggg cagttcaccc caggcggtga gggcgtcggc
    51601 gacctcgcgg ccttcggcga tctccttggt caggatcggc aatcgggtgc ggttgtcgtg
    51661 cagttgccac ttgattcgct cctggtcgga gcggtgggcg cgggcttcgg cgttgagttt
    51721 gcggagtcgg gtttcgagtt cgacgacctc gatgtagcgg ggatcgccgg tcgcggcggc
    51781 cttggtcgcg gccatcgacg aggtcatgtc gtcgctgccg atgtcttcgg cctcggagaa
    51841 gtcgatcgcc ccgcggcgga gctgctcgat gtaggcggac ttcttctcca cggtctgcca
    51901 cttggtggtg tcgtaggagc gttccccgac gatgttgatg atctcgacgg tcttgttctg
    51961 gttgccctgc cggatgatcc ggccctcgcg ttgttcgagg tccgcgggcc gccaggggca
    52021 gtcgacgtgg tagagcgcgg tcgcgcgttt ctgcacgttc atgccggtgc ccatcgtctc
    52081 cgacgagccg atgagcactt tcacctcgcc gcgtcggcag gcggcgaaca actcccgctt
    52141 gtccttcggc ttggggtagt cctggatgaa ctggaccgcg ccgggggaca tgccgcgggc
    52201 gaccaggtcg gcgcggatga tgtcgtagac ggtgtcgtcg cggccggtct tgggggtgcc
    52261 gcggtcgagg aacacgatct gcagaccgcc ggtgcgtggt tccgggttgc cggcctcgtc
    52321 gtagtagacg gtatcggcgg tgcgttgctc gacctcccag agcttgttca ccagcaggtc
    52381 gacccggcct tcgcccgctg gtggtgcgtc gagcccgccg aggcgggggt cgagggtgac
    52441 gttggcgccg tcgctgccga tcttgagtgg gttgtcgatg tgcgcggtct tgccggtgta
    52501 catctgcatc cgctcgtcca ggtcgatcat gaagtctcgg acctgttgcg gcatttcgaa
    52561 ggtcaggttc tggcggccgc ctcctgcgat ctcgggaagg gtcgcgggga cctgctcgcg
    52621 gatgacgacg tcggtgaact gggcgttcat cgccatcagg gcgggcaggt tgacgaactt
    52681 gccgatcctc gacaccgacc gcagttcgga gccggtgacg ttcatttcca ccgattggcg
    52741 catcgcggcg aagttcgccg cccaggcgtc gatgttctcc atgccgccgg cctcgagcag
    52801 gtccgggcgc aggtacttcg tcatcaccca cagctcagac atgctgttgg cgaccggggt
    52861 gccggtggcg aaggtgacga ccttctccgg aacgggtttg cggccctcga cggcggcgcg
    52921 ctggcggtac ttacgccgca ggtaggacag tttcatgtcc aggtcggtgg cccggctcga
    52981 tccttcccgc agcgccaggt cggcgttgtt ggactggcgg gagaggttct tccacatgtg
    53041 cgcttcgtcg agaaacaggt agtcacagcc ggtttgctcg aaggagaacc cgacgtcctt
    53101 ggagtcggcg ttgaccttct tctcgagctt gtcctgccac cgcttcttgg ccttctcgat
    53161 ctccttgatc gtgttctgcc cggtagcgga ttcccgggcc tcctcgagct tggtgatctc
    53221 gtcggcgatg taggccgcct gggtgtcgac cgagcactgc atcttggtga aggccggctc
    53281 ggggacgatc accagatccc agtcctggga cgccgattgc gccatgaaca gttgccggtc
    53341 ggcgcgggat ttgaagtcgt ccccgaccag cacccgggca ccggggtagg cgtcggcgac
    53401 ctcgcggccc cactggtcga tgaggtggtt cgggaccacc acccagggct gtttgatctg
    53461 cccgaggcgg cgcatctcca tcgcgcacat cgtgatcgac caggtcttgc cggttccgac
    53521 ggtgtggtcg aggagcaccg acggttcgtt gatctgccgc accgcgacgg ccgcctggtg
    53581 cggatggggt gcgatccgca gtccggggaa ggtgcggccc tgcccgttgt aggcggggtc
    53641 gacgaaggag ttgaaccggt cgttgaacac tcgggtcagc tcggcggtgc gggccgggtc
    53701 gttgaacagc cagtccccga acgccgtttc gagcatctcg gcccgctgtt ggagttcctc
    53761 ggtgagctct tcgtggaacc gcggcttggg ggagtgttcg agttcggcct cggtcttcag
    53821 cacccggatg ggctggttgt tggcgatctt ctccagcaac gacaacccgt cgacgccgcg
    53881 ccggtccccg gcggtttcgt acggcagccc gtaggggtcg gtgtactggt cgccggcgat
    53941 cgtgaagtcc caggacgcgg tgatggggga gtactcgacc gcgatgcggg tgtccgggtg
    54001 caccgagaac gcttcccgga tgaactgcgc gtacatcggg gtcggcaccc agttcgcacc
    54061 ggggcggaca gtgatgttgg tcggatccag atccgccggg atcacctgcc gcagtgcatc
    54121 gaccgcgccg gcgtagagct gcgggtcctg cctggcggcg gcttcggtgg ccgccaactt
    54181 ctcccgcacg tttccggaca ggaacctcgg ggccgggatc agctcggtcg ggtcttccgg
    54241 gtcggggaag accagccccg cgagttggtc ccgggcggcg tcgatgtcga tgcccaccag
    54301 cccggagatc cggtccaggt cgacctgccc ggtctcgtcc aagctgactg ccagcgcttc
    54361 ggcgacgtcc tgggcggact gggctcgctg cggcggggtg atgacgtcct cggtgaagat
    54421 cttcgacttc cgcgcctgct gggtgtcctc gtcgaaaatc tcgatgctgc ggaccagctg
    54481 gatcgccggg tcgtagcgga tggcaccctc gaggtgccgc atcttcttcc acggcgggtt
    54541 cggctcggat gcctccgcca gcaaccgggc ggcgacgtcc tcagggagtg ccccggtgac
    54601 cgggccagtc tcgtcgccgt tgttggcccg ccacttcttc tccaggtcgg cgaagcgttt
    54661 gtcgatgacc ttctgcgtcg gagggccagg agtgacccag gtgaaccggc ccagcggccc
    54721 gtacttgcgc gcatacccgt cgtactggcg gttcagctgc gcccgcagcc ggttcttgat
    54781 gtcctcgtcg ccgccggtgc gctgggcgtc gaccaggtcg gtgaccgtgc cggccatggc
    54841 gagcatggac ttccactggg cggtgcgggc cttgtcgatc ttcgacggca ccggcatcca
    54901 ccggccgccg agggaaagct gctcgaacat ctcgatctcg tcgttgaacc gcaccgatcc
    54961 cggaacctcg gtgatcgcgg cttcttccgc agtgaccagc ccggcccgat cgagcatcgg
    55021 gtcggccgcc ggctcctcgg catcctgccc caatcccgcc ctcttcgcgg tgtcgacgat
    55081 cgcggtcagc cggtcacgga cctgggtggc caacgggcgg gacgggtcgg cggtcacctt
    55141 caaggtggcc gccgagtaca tccccgaccc gaccccgagt tcaccgagca cgttctccgg
    55201 gtgggccagg aagtagtcgt tgacctggat ctcaccgtcg gccagctcag ccttcgaggt
    55261 ggtgatccac tgctcggtcg ccgctgcctg tgcgcggccg gcctcgcggc gccggaagat
    55321 cagcaggtcg gtgaccacat cggtaccggc ctgccggtcg aatgccttgg tcggcaaccg
    55381 cagtgcgcca accaggtcgc cgagctcggc gatctcctcg cgggccttgg tccgctgggc
    55441 gtcggaggtg aaagcgctgg tgatgaccgc gacgtaacca ccggtttcgg tcagcgccag
    55501 ggacttacgg aggaaatagt tgtgaatggt cagcccggac gggttatgca gcgggtcgcc
    55561 gaccgcgaag ttgccgaacg ggacattgcc gatcaccgca gtgaaggcgc cctcgtcggg
    55621 ggagaacttc tcgaatccgt gaccccggac ctggtgcccc ggatacaggt ggtgcgcgat
    55681 ccgggcggtc atcgggtcca gctccacccc caccatccgg gtgcccttcg gggcgtgacc
    55741 gatgaagttg ccggccccac agcccggttc gaggacccgc ccgcccgtga acccggctct
    55801 gcccagcgca gaccacatct cggccgcgat cgccggatcg gtgtaatggg cgttgagagt
    55861 ggaggcgcgg gcggcgtcga tctccggcgg ggtcagcacg gcggagaggt cgctgcggag
    55921 ctcgtcccac tccggtttgc gcttgtcgaa gatgtccggg accgcacccc acccggacca
    55981 ggcggcgagg atccgctgtt cggccggggt cgctgcccgg tgttcgtcgc cgagctggtg
    56041 caccaggcgg atcgcgtcga tgttcgcccg ggcgcgggcc tttgccccgg acggagccaa
    56101 tacctcggcg ccgaggacga agttcgcggc cgccgcgtcc ggctgatccg ggaccggctg
    56161 gacggcgagc ggcgcagttt cggctgcggg ttcgttctcg gggtcccgga cgacgtggtt
    56221 tcgggtgtcg cgctcaccgg tgatgctcgc ggtgacctcg gtcgccgcaa ccgactcggc
    56281 gctccgtccg gtgcgggcgg tggcgatcgc ctcggccagg gttgccgtga tgaccggttc
    56341 ggcgtcaccg cggctgacct gccagtcctt ggtgcgccac cgatagttga cctgcgcccg
    56401 gtcctggcca ggttcgccga caaggtattc cgagtcccgc aacgcctcga gatcggccgg
    56461 tccggtcgcc gcggtgaaca ggtcgtcggg ctcacgggcg ctggtgtgca gggtgtcgaa
    56521 cgcctgatgg gcgatgtcca ggcgcaacag ctccgaggtg tcgagtccgt gggcgcggca
    56581 ggccgccgcc aggtcgcggt ggtcgcgctc gaactcggtg aggacgcgtc cgcgcagctc
    56641 ccggcaaccc tgcgaggtca agaacccggt ccggttcagg ctcgggtgca gcgacgtcgc
    56701 ggccgcggcg aacacctcgt cctcgctcag tgcccgcccg gtgatctcgg cgaaccggcc
    56761 ccgggcctgt tcggcagtaa ggccttcccg gatcgggccc gcgctggtgc cgcggccgcc
    56821 caccgtggcg cggcgcaccg ccggcaggtg atgcccgccc cacaactctc ggctgttacc
    56881 gccgtcggtg gtgacctccc acacgggggt gccagtgtgc agggtgaacc ggtgcacctg
    56941 ggtgcgggga cggcccgtcg ccacgaaggt gttgatgtcg cgggcgagcc agtcggtggc
    57001 cttgtcgcgg taggtgtccc cgagtgcgcc caggagcggg ccccggacct cggcggtgag
    57061 ccactggtga ccgccgtggt cgtcgatcac cgctgcgagg tccgggcggc cggtgaggcg
    57121 gtcggcgaga tctgctgcgg cggcctcgag gacgacgctg gtccgtttgc tcaccagggt
    57181 gctcgccgcc agggccacca ccagcgggtc ctgacgtagc tcgccctggg cccagtcccg
    57241 ccatttctcg acgtcggcgg cgcggtcgtc gatgctcccg gccgcctgcc aagcgcgcag
    57301 gctggcgtcc gggatcagaa cccgggcgcc ggcagccgcc tgctcggcct cggccacgac
    57361 ggcgtcctcg gcgccgtcga gcatcagtgc ggtgtgcacg cgctgggcat cgagccaggc
    57421 gtggatcttc tcccggtccg ggatctcgtc gccggcctcc acagcagcct taggcgcgtc
    57481 caccgcggtg gccgggatct cggctgccac gtcagcctcg acggtcgatg cggtctccgg
    57541 tgcaggtgcg gccagctcgg gggaggtctt gactgccgcg tggaccgtgt cgagggtggt
    57601 ggcgatgttg tcgtgcagcc agtgcgccgc cgcctggtac tgcgggtcgg cggagtcgac
    57661 agacagcagc cagtcgctga cggtgtggtt gagcagccga tggcggccga cgctgaggta
    57721 gtcctcgggt cgtcgccgca acacctgcag gcgggggtgg gtgaccatct cggcctggag
    57781 atcggcgagg acctcgtcct cgcgttcgcg cgcccactcg gtccgggcgc cgttccagcc
    57841 gcggttccag tcggagaaga tctgctcagt acgtgggtca ccgaccggaa cgccgtcgag
    57901 cgcggcgcgg actcgcgggt ccgccgccgg aatggaggct ccgccaccgg gaccgtgttc
    57961 ggtccaggcg tcgcggccga tctgccgcca gtccactggg tcggtgcggt ggctgttggc
    58021 gtgcacccgg gtcagggtgt cctcggccag ttgctgccgc tcagtttcgg tttcagggcc
    58081 ggcggcggtg acggtgtcga tcgcctgctg caccggcagt gcggcggtga actgctcggc
    58141 acggccggtc gcggcctcgg caacggccgg gtcggcctcg agggcggtga ccgcggcgtc
    58201 ggcggccgtg cggtcgcgat tgtgctgcgc ccagatgcga gcgggcaact gggcggcggc
    58261 agcctgccaa tgcgccgggt cgtcgagagc ggcgcgggcg acggccgcga tctgcgggtc
    58321 ctcgctcacc acctgctcga ccagaccggc ttgcacctcg tcgtgggcgc ggcgcatggc
    58381 ccaggaagtg aactgctcaa aggtgttcga ctgcgctccg gcggccaggt tgaggtcctc
    58441 gtcggccatc acctgcccgg tgatctcgtc gagcaacgcg gtgacgtcct cggcgggggc
    58501 ggtgggttcg cgctgggcgg tgaattcggc aacgagctcc cgcagcggcc gccgacctgc
    58561 gaggttctcc gtctccggtg tcggagtggg tgtttgcggt ggtcggtgtt cccggtccgc
    58621 cttctgggcc gcgagctggt cgcggatcag tgcagagcgc tcacgtgcct gccccggcga
    58681 cagcggcggt ccggtgtgct cggcgtgctc gtcctgcgcc cgttgcgttt ccgcttcggc
    58741 caggatgcgg gcgatctccg gatcggaggc gtcggcgacc ttccctgacc gggcgcgcag
    58801 catcttgatc tgctcgtcgg cgcgaccgat cgtcaggtcg tcgggcagcc gcaccggcaa
    58861 cccacgccta cgccgcaagg tgcgcagata cgactgctgg cggtcggtcg cgggccgatc
    58921 ccgccaggtc cggcgcggcg gccgcgcccg gctgaccgcg gcgacatcca ccccgtcgac
    58981 gtcgtagccg gcatcggtgc acacctgccg ggcacgctcg gccgcgtcgc gggcctcgtg
    59041 ggcatcggcc gaaacccgtt cgacccgggc cgccatccgg tccgcggtcg tggtcaggtc
    59101 ctcgatcagc tccggatcgg tgcccagcag cgtcgcctcg gcgacctggg cctggacctg
    59161 tttggtggcc tcgcgcaggg tccggacctt ctgccgcagc gcgtcggcgt cccgctgggc
    59221 gcgggcgtag gcgatgagct ccggggctac accactcggt tccccgcggc cttcgatgcc
    59281 ttgatctgct cgtcgatcat ctgcgccagc tcgtcggcca gcgggtccgc tgccgtcagc
    59341 ggtgtcgtct cgttgtcctc catcttctgc gcgatcagcg ccgccgcgta cccctggaac
    59401 gcgtccggtt cgctcggcca cacccggtcg accacctgcc acgccaacgg cgggatctct
    59461 accatcgacg tccgccaccg atccgggtcg cgggcctggc gcttcgccgc gatctccgcc
    59521 tcgatccgct gctcgatctt cagctcccgg gcgatctgct cctcgctgat ctccggcacc
    59581 tgcgagtaca gctcctcggt cagcactgcc tcccggctgt cgtgctcggc ctgggcgata
    59641 agctgatggg tcgtcatcac gtccggatcc tgccccggat gctctgcctt ccaattccgc
    59701 accagatacc cctggccgcc cccgactcgc tgcaacacca gctccgagag cctcgctgcc
    59761 tcctcgtcga actgcgccgt caactgtgtc tccgtcgcgc ccgggtccac gcccagatgc
    59821 tcccgccaga tccgctccac ttccgcgcga atcgtcggat cgaactccgc catcgtcgtt
    59881 tcctccctgg atgatgtgtt cgctgcgttc gctcaaccgt ctggcccctc tcatgcgctg
    59941 ccacgcgaag cgtgaccttc ccgtgcgccc attcgttgga cacaaagcac atgaagccta
    60001 tgacggattt cgcgaaagtg cttgcagcgc aaagttgtta aagttctaca acttcgcctg
    60061 cggccttccc tcaggcggct ccggcggccg ccgaccgagg cgccgccgga gccgtgatct
    60121 tttggttgac cagcatgttg agcgagacac cctgttcctc ggcttcgatc gccaaggtcc
    60181 ggtgcacctg cggggaagtg cgcaccatga acttgccgct gtagggacgg tccgcgatcg
    60241 ggaccggtgg ttgctcgccg gtcagcgtca tgtcctcgag cacttcacgg acgacgccga
    60301 tgacaccgtc gagtgcctcg gcctgcgttt ccgccagcca ggacaacgac gggaattcgg
    60361 cgacggcccc gacgaactcg ccgtcgtctt ccgaccaggt cacccgatag gtgtagtgcg
    60421 atgcgtcagc cattgtcagc ctccttcgtg agcttgtcgt atgcgatgac gacttggccg
    60481 acctggtagg gcttcgcctt gccgccgctg cctttcttcg atgttcactc gtgggtcgcc
    60541 cgcccacggc atcttgaaca ccgcgtgcga ggtgccgcgc tgccgcggtt ccccgaatat
    60601 gtcgcagcag aagttgagca gctcggtata cgtcacgctc tgtggactcg ccctcatcct
    60661 cgcgatcagc tttgcctgct tcgacatacc agaatggtat caccggcgat actatcgaga
    60721 taggcgttga gggctgcgag agagaggtcg cgtcccttcg acgtcggcca tcgaacggaa
    60781 aatctgctgg tcagacgaat catcgagcgg tgccgccgct gttacccgcg ccggaagagc
    60841 gatcggatgg cggcgatgag ccgctcggtc gcggtgcgcg gtggtggggg agtgtcgatg
    60901 cgccgcgcca tgtccgcggc ggcgaattct tgttgtcgcc gctcctcgta ggagacgacc
    60961 tggccggtga acggggaccg tcgcgggaag tggtcggccg ggtccacctt ctcgttggtg
    61021 atgaccttgt ggtgcaggcg ggcccgggcg agatcgggat cgaaaccgct ggcccactgc
    61081 gcatcgttgt tgcagaacag gtgggtgagg cggcagttcg cccgtgtgtg ggggccttcc
    61141 cggtcgatgt ggtcgatcga cagggcttcc gggccttgcg gcgcgtcgag gtccacgggc
    61201 tcgaggcaga gttggcatat cccgccgtca cgggcgtaga tgtccatgga ggtgaagcgc
    61261 tcggtgatgg cgttgccgtc gacgtcgacc ggttggatga agctggcccg gcggaggcgg
    61321 tgatctggga accgctgctg acgtcgttgc gtccgattat cgcgtttcac ctcggcgagg
    61381 aatgcggccg tttcctcggc gctcatcatc ctgatctcgc cgaattcgac gtcccaccag
    61441 ttcatacggg gcacagtagc gaggcgtacc gacagctcac atcgatcgta tttccgcaga
    61501 tccggtctct tggatcgatg gttactcaac gctcatcggc gcgtgtcccg ccggtcctcc
    61561 tcgccgccgt cgttggtatc agtgatggtc tgcagtgcaa gcgcgcgaac gaaagtctcg
    61621 agaatgccgg tttccgcatg gttgagggcg acgggcgctc catcgggacg gacggtctga
    61681 tgcgttcggt ggatgtcggt ggtcatcgat gcagtcctgg gaagtagtcg gtggacatgg
    61741 gcctgctggc tacggccagt gtgcgttgag ggtcggtcag aagagagcgc cttggttctc
    61801 gctcgcggcc gcgtcggtgc gctgctggta ggcggaggcg aacgcgcggg ccgcggattc
    61861 ggtgcagccg atctcccggc ccacctgcgt ccagctgagc ccagcttcgt ggaggttcca
    61921 cgcgtcacgt tcgtcgtctg tgtgtatgcc gttggcgtgg atggtcactg gccttctcct
    61981 ctgaggtggt tgagacggtt ggtggcggct cgctgctggc gaccgagcgc gatcatgtgc
    62041 tcgaagagct ggtcttcggg cagctgctcg gcggcctgag cgagggactg ggcggcggcg
    62101 cggaagctgc gccggtacgc ctggctgaca acggtgcggg tgtagtggtc gacagcgatg
    62161 tgatcggctc cgcgggtggt gatgtttgcc aggtagcggg accgttcgga gccgtggtgg
    62221 ccggcgaggt ttccggtgcg ttcgagttcg gcggcgacca tcgtggtgtc gtggggtttt
    62281 ccggcgcgca cgagtcgggc gatgacggtg aacagttcgc ggtggatagg tcgttcgaaa
    62341 tcttcggcct cgagggcggc gacagctcgg gccgcagcct cactgggtgc ccacaagaga
    62401 gcgcacaggc agagggcctc gacatcggta tgggtgttgg tgtcgatgtc gccgacctga
    62461 atctggtcgg tgtcgacggc ggtgtcatcc gggacgagcg cgagggcggc ggtcattggg
    62521 cggtcctttc gtggtggcat gttcggctgg ccggggtcgg tgagccgggc tgtcattcgt
    62581 agagccgggt ggtgcctgga aggagctggt ggcattggtt ccacaccttg cccttgaccc
    62641 tggccacgac gacgtggccg ggatctccgg gtccaattcg gcaggaagtg ccctcaggtg
    62701 cggtttccca actgcggtcg tatcgagcag gctgtgccac ggtctcggca ctgccgacca
    62761 cgaggagaag gccggccacc ccgccgagtg cggcgatgga caatcggcgc agcgttggcg
    62821 cggagatgta cgacatggcg accttctcgg ttgcagggac tcaggcagct acgagggctt
    62881 tgatgcggtc agggcggaag ccgccccaat gctggtcacc ggcgatgacg accggggcct
    62941 ggctgtagcc gagcgcccgc agagcgttca cggcgtgagg gtcgccctcc agatcgatca
    63001 cggagtactc gatcccctct ttgtcgaggg cccggtgagt ggcagtgcat tgcacgcatg
    63061 agcttttgct gtacacctga accgacattt tagatcctcc ccgtttgcgc tttctctacc
    63121 attcttattg tagtcgaaat tggagatatt tctacatata gcgggcagtt tttcgagcaa
    63181 tttagagcct ttcttcgtcc gcctccagtt cgccaccaca ctccgagatc acggcgttta
    63241 gctgcacttt catcgaatcg actcgcggtt agcgcacgac gggcggtagc gtatttcact
    63301 ccaggaagaa gcggacttcc cggaatacat ctcgcgtcga gagtggatgc aatatagcgg
    63361 ctcaaattct cgaatcccaa gaattggaaa caggtaattc caaccttttc aggaaatggc
    63421 gcgagaatag aattcgatcg cactcgatcg tcgcggggcg acactacgcc cgatgttcgg
    63481 aaatcctcct agttccgtcc ggtgcgggat tcttatcgcc cgcaccggac gggcgcgcta
    63541 gctatccgcg ggtgcaccct cggcactccc aacggccacg caccttcgtg caggtccggc
    63601 gttcctcgca caaccagcac cgctgagacc gcgtgagctc gtcagtggcg ctggaggtcc
    63661 ggctcgtcct gttctgctcc gggatgccgg cggagtgtgc gggatcgagc tgcggtgata
    63721 cgcacggtgc ggcgggtcgg gctcgcagca tgtggccgaa ctcgtcctga cagccggtgc
    63781 acacgtcacc gggttcgacg accgggaagt cgcaggtggg gacagcgcac gagatgaaca
    63841 ggtcgagctg agaaagttgg tttccgggct cggtcatggt ggtcgctctt tccttctggg
    63901 cgagcgcacc gggcagatag ttgctgcccg gtccgctcgc aactcggcgg atcggcggtc
    63961 aggatgagcc tgccgagcgc cgcgctatcg gctgatcccg cgtcagactt cgaccacttg
    64021 agcactggcc gtggctgcgg cgaggtcgat cgtcaccttc tccagcgcgc tccgcggcac
    64081 attccagtac cggccatcct cgccgcccaa ctcggcgatc ttcaccttgg cgccgttggc
    64141 cagaaccacg aacagcgtcg tcggatcgat attgcgggcg cgcttcaccc ggaccgtgga
    64201 gccggtcgac aagggcgcga ccgcgacgat cggcttggcc aacagttccg cgggggcggg
    64261 taacagcacc tccggttgcg cccgcaccaa ggggccgaca ccgtcgagtg gcttgacgtc
    64321 gtaattcacc ttcaaccggc gaaccacctc gaaaacacgc cccttcatgt ccttgttcgc
    64381 gaccacgggg tcgatgatga cgcggtcgcc agcctgaaag atgttcgtcg acatagtttt
    64441 cgttctcctt cggtgatgga tgtgtgcggt cttggtggtt atgcggggat ccaggtcaag
    64501 ccctggtctc cgatgagagc gaccttcccg gccggggcac cgccggtgta ctggtgcagg
    64561 gccgtgcggg cgcgggtggc tgcgcagccg agtgcatcgg gagagtcgcc gagtgcgtcg
    64621 acgctggcct cgcccattgc cagagcgact gagtcaccct gcatctcgta caggccgaca
    64681 gcccagctcg taatgggtcc accggtcgtc agagcgggat cgccgttggt ggcggcgagg
    64741 aggtagatcg atcggccgtc gggtgcgtaa ccggcgtcgc cggtgagggc gtagcagttg
    64801 ccgccggtcg aggtcacctc gggatcggcg acgccgaccg ccgccagtcg gatcagttcc
    64861 cggtggtaga tctcctcgag ggttccgtag tgccggtagt cgagtacctc tgacgtctcc
    64921 actgcgggag cgacgggtgc tgtcggtgtg cccatgtagc gggaaccttt cgtcggaacc
    64981 ggaccacctg cggcggcccg atcatttttt gtgcccttct ggcatgggag aggggcgccg
    65041 gtatgagggg gccggagtgc aactgtcgag ccgaaaaatc tcgggggagc ttgcggagga
    65101 gagaattttc ggagccgaag gccgccctgc gtcggcggtt gcgcgcaggt caccgccggc
    65161 gaaactcgga aggccagaag ggaacaacaa gaacgctctt caccagggcg gagcgcagcg
    65221 gagcatccgc ttggaggaca ccgaaggtgg ccaggccgcc gggcaggcgg atcaccagcc
    65281 tgctagacga ctgcgtttcg tcgcgtcacc ggttcatccg agacggcggg cccgcgttcg
    65341 gcagctaggc ggagggcggt tcgctgatgg cgtcggcggt aacgaccatg tcgagttcga
    65401 ggctgttcat ccccgcggcg tcggtgacgt acacggtgat cgccgctagc cactgtccgt
    65461 cgtggatttt gaaccagtgc gtttgaagtg ccggccgcag accggacagg tagaccgctg
    65521 agctctttac cctcatgctg acgtaatcgg cgcgcgctgc gcccccacgc ccgagcggca
    65581 gcgcggctca gggtatggcg cacagaggtg tgttcgatcc gaccgaccga gatctgttca
    65641 acgagcagcg acaacgcttc gactggagcc tcctgcaaaa cggaaacgtg taccggtatg
    65701 acaccgcgtt ccaactcgac agcgcgtgca cccgcctgac ggatctcggc tatctcgtac
    65761 atcacatcga ggccgaacta tggacgaccg tcgcggatat gcacaccgca ttcgcgaacg
    65821 cgatgtcctt tcccgcgtac tacggcagaa acctcgacgc gttcaacgac gtcctccgcg
    65881 acgtcgccat gttcgactac ggcagcgatc ccaccagttc tggcaccgtc ctcgccatcg
    65941 ctgactatga cactctcgcc ggaattgatc ggcgcaccgc tggcgaagtt ctcgacatct
    66001 tcgcgtttca agcgcgtttg gccgcgctct acgggcaccc gatgctgtgc ctggccgaat
    66061 ccacggttac cgactatccc ccggtgggtg gccgccccgt ctactttggc agcgtctggg
    66121 atgtcgagcc ggatccgccg gcgccgttcc atgaggggga ccttgtcgag aacgtgttac
    66181 aaatctatgc ggacgaaacc ggtgcttccg agtatgtcgc agcactgaac acagtcctca
    66241 ccgacacact cacgcccctc ggccggtggc agatcctcga tcccgtcctg gcctccgagc
    66301 gcaccgcgct cttccacgct gagcatcgac cggaaccgcc cccaccggga acccagctgt
    66361 gggagatctt cattggtctc cgtggcaccg gagaccacaa cctcctcggc gaccaactcg
    66421 tccatgtcct gtccgacacc gggatacatt tcgatcaatt gataacgcgg ttctacgcgg
    66481 ccggaaccga ggatcgaggg caagctctga gcaactaccc tgatctccgc aacccagaca
    66541 accgatagag gaacgctgac cggcacgtcc cgaaagccgg ccctgactga aactcgctga
    66601 tcagcgcccc gtcccgagag acctgtcgac aatgatcctt agacgacacg gctttgaccc
    66661 gcgcatttgc ccaggtcagt ggtgtcgaca aaacatgtcg agaaactgtg tcgaaaaacc
    66721 tcacagggag atttttcgac acatgctgat cggctcctaa cgcacgagtc tccagcgcag
    66781 accagaaacc cgaccatcac cttgacgccc ccgtcggccg cctcccggaa caccgtcaga
    66841 agacggccgc cgtcgtcacg gtcaacaggt tcccctcccg gtccgcatcg attcggcgtt
    66901 gaccagtacc gaggggtact ttcgacgtca ccgcggggta cgtgttccgc gacggaggtg
    66961 tgcgcgatga gcagcggcgt cggcgccgga aacaatccag actgcagcgc atatgtgttc
    67021 gcggtcgcgc gagcactgaa cgccgagacg atccgccgat gggacgaggt cagcttcgat
    67081 gcggtgatcg tggtgtcgaa gcagttccgg tactacggcg ggcgccgcat ccttctcgcc
    67141 tggaaccggt acttcgggtg gtcgttgggc atcgagggac agtgccccga tcgggtcctg
    67201 atcatctgcg ggctcgggct cggccggcag ccgcaacctg agtgcattgc ggatcgaacc
    67261 gatgaggtga tcgccgatct gttacacctc gaatgccgtt ctccggaccg ctttccggtc
    67321 ccgatcgtga tccaccggcg cggcgctggc cctgccgatc cccggccgcc ctgccgctga
    67381 ctcgcagggt aggcggctta cgcaaaccgg ccggcgtagc cgcatcgagg cagccgcgct
    67441 cgtcggccgc atgggtgtgg gcggtgagga cagctcgccg atgcgacacc gcccgtcagt
    67501 cgcccgctcc tcgtaaaggc atcgtcgggc agtgtggtcg gctcgggcga cagttctgcc
    67561 agggtcgagc gcctgcaccg cacatgactt cccgtcccgg tcgaccctca cgcgctcacg
    67621 ctgttcctcg acagcccctc cgagtccggt ttcgaggaac accgggcccc cgaggtagcc
    67681 cccgacgtgc ccgggacccc tggctgcctg ctcatggcgg cactgcacgg cccgggtggg
    67741 tgcgctcggt tgcgacctgg ccgacagttc gccgctgtcg tctttcaagt gccggtgtcg
    67801 cttttagtgg tggtcgccgc cggttcgttc ccgggcgggg ccatcccccg atccggttcg
    67861 gccgcgggct gccgggcgcc gacgccgccc gcgccgggtg gtctccggtg ccggtaccgc
    67921 cggatcggcg ggctcgcgaa cgggttcggc ggcggggtcc tgttctgcgc gcagttgcgc
    67981 gttgtccgct tccaggcgga ggttgtcgcg ttcgagttcg ccggtacggt gctcgaggtc
    68041 gagaacccgg ccgatgccga cgaggttgac gccggcgtcg atgagttcgg cgatgcgccg
    68101 cagccgggtc aggtcgaagt cgctgtagcg gcgggtgccg ccgccggtgc ggcccggggt
    68161 gatcagtccg tactcctcgt acaggcgcag cgccgcgacc ccgaaaccgg acaactcggc
    68221 tgccacggaa atgccgtaaa caccacgcac tgacggtgat tcggactccc gtcggtcgga
    68281 ctcttccggc atcttgtcgc tccgattcgg aattttctcg cccatcctct tgtcatagtc
    68341 tacggcagat gctataacga atctacagca tctgtaggaa gtttacctga tgggatgaaa
    68401 ggattctgga ggtaggtgga catgatgttg atgcgcacgg atccgttccg cgatctggac
    68461 cgactcaccc agcagatcct cggtaccgcg gcccgtccgg cggtgatgcc gatggacgcc
    68521 tggcgggaag aggaccgatt cgtggtggag ttcgatctcc ccggagtcga cgccgactcg
    68581 ctggatctgg acgtcgagaa gaacaccctg acggtgcacg ccgaacgggc agcactgaac
    68641 gaaaaccggg agatggtcgc cgccgaacgc ccgcgcgggg tgttcagccg gcagctgttc
    68701 ctcggggaga acctcgacgt cgacaagatc gaggcgaact acgagtccgg ggtgctgcgg
    68761 ttgacgatcc cgatcgcgga gcgggccaag ccccgcaaga tcgaaatcag cagcaacggt
    68821 cattccgaac agaaggccgt caccgcctga cccgactgga tgacacgacc ggctgcacct
    68881 gaccgacggt gacggtgcgg gagggggtga acagacgatg acatcgacac atatggtcgc
    68941 cgaggtgtcc gccaccgaca ccggggagcg caccgaacgc gagacggtgt ggccgtggca
    69001 cgagctggac tacgcactgc tcgtggctga ttcggaccgc atcctcgccg acgcgctcac
    69061 gccgcaggcc gtggtcctgc tccgtcgggt ggccaccgca ccggccggtc cgccacgtct
    69121 ttctcctctg actccggtgg ggtggacggc gcttcccccg ccgttacccg gaatccgcgc
    69181 cacccagcgc tcaccaccga gaccggaaaa gccgggcacc atctgagatg tcgaaaggag
    69241 tgagaaacca gacgaggaac caacggacgg ggttccgccg ccgcctccct cacctgtcac
    69301 tgtttcgcgg tgcggcgcgg cgacccccgg gcacacccgc ccgccgccga tccccgagac
    69361 gataagtgag ggcgccgacc gagaatccga gcatgcgttc gggcggattc gaccgggccg
    69421 cagcgccatc gactggcacc cgagagtctc gtcggccgtc cgggcgggca gtgcccaccc
    69481 ccagagaaca aatgcccata acaagcacat gcagccgaca agcggggcgg gtcccctgat
    69541 gcgggccggg cccgccccgc cctggtggtt ccggcatccc gagcccggaa ccacctgttc
    69601 tcgtgcacca cgaatgaggc gaggtgatgg ccaccgagcg cgatccctac cgggtgctgg
    69661 gcctgtcccc gtcggcatcc caggccgaca tcgccagcgc ctaccggcga ctgctgcgcc
    69721 ggcaccaccc cgacacccgc accccccagc gggcagaccc ggcggccgac gagcacctcc
    69781 aacacatcct gaccgcctac gcccagctcc gcgaccccga ccaccgggcc taccacgacc
    69841 aggcaaagcc caccggcaag accccgaagc ggtagaaccc gaacctgggg gacggcacgg
    69901 gcgaccgcct ccggccccgc ccgtcatgca cgtggtgatg gtcccctccc cgccacccca
    69961 aaccccggcc accggattgt gggccggacc ggtgcgccgg caccgctgag ccacgccgcg
    70021 tcctcgctcc ccggcctgac tgatacctgc acaccggcgc ggcggcaggg agaccgtcgg
    70081 ctcggggacc cgaacgaggg tcgaagtcgg tgtgcgggtc caggttccgc tgccggctcg
    70141 cgtgccgtcg ctgatccccg tcccacccgc atgatccccg tcccacccgc agaagtacca
    70201 cgcccgtgat cgtgagtgat gatgagcaga tgcggacgaa gtttcacgac cagctcgaca
    70261 ccctcttcga ccagctcacc acgatgtgcc agctggccgg cgacgccgtc accacggcca
    70321 ccgacgccct cgacgctgcc gacctgaccc acgccgagaa agttttcgcc gtcaccgagc
    70381 ggatcggcgc cctgcggggg ccgtgtgagg accaggcgat ggccctgctg gcgttgcagg
    70441 cacccgtcgc ccgggacctc cgccaggtcg tcaccggtgt gttcctggtg tcggacctga
    70501 gccggatggg cggtctcgcc gaacacatcg ccgagagcgt gcgccgacga cacccccacc
    70561 ctgtagccca cggccagacg caacaccttc tcgtccagat gggacgcctc gccggcgaac
    70621 tcgccaccgc cgccgccctg gtactgcaaa cccgcgaccc cgccctggct ctcgcactcg
    70681 acgtcaccga caaccgcctc gacgacctcc atcgcgacct tctcaccgtg atccaggaac
    70741 cagcctggga cggcagcacc accgaggccg tcgacgccac cctgctgggc cgcttctacg
    70801 aacgtttcgg cgaccactgc gtcgaggtcg gccgcagggt catcttcctc gccaccgggc
    70861 aacagctgcc ccagtaggac cacccggcac ctctgccgca ggcccacctc tcgggaatat
    70921 cctggactgg ctccgatcct tcgcatcccc ctcaggcgaa gtcaccggtg cagtggcccc
    70981 cgccagccga acatctcaga tccccctgac gggggctcac acgtgcggtt ccaacggaaa
    71041 atagtgaccc ctatcctcgg cctgcccact gactagcggc atgtcggaaa acctcacctc
    71101 agggtatttt cgacacatgc tgatcggcta cgcacgtgtc tcgagcgcag gccagaaccc
    71161 cgaccatcag gtcgatgcgt tgcgcagcgc cggggtggcg gccgaggaca tccacgtcga
    71221 ccacgcgggt ggggcgaagg cctcacggcc gcaactggat ctggtgctgc agcggctccg
    71281 cgagggcgac gtcctggtga tcacccggct ggaccggctg ggccggtcca tgctgcacct
    71341 gatcaccctc ggcgccgacc tgcgcgagcg cggcatcgac ctgcaggtgc tcgagccggg
    71401 catcgacacc gcgaccgccg agggccgcgc catgttcggg atgctgtcgg tcctggcgga
    71461 attccaacgc gagctcatcg ccgcgaacac ccgcgacggc ctggccgccg cccgcgcccg
    71521 cggccgcaag ggtggccgac cctcgaagct cagccccgac cagatcacac tcgcgcaacg
    71581 gctctacgac gcgggggagc acaccgtcgc gcagatcgcc gacatgctga aagtgccgcg
    71641 caccaccgtg tatgggcatc tgaacaagcg aagtgcggac cctgccccgg ccacgcagaa
    71701 tgtcgtcgtg acagccgatc cgcctgcgcc ggtgctgcgc tcgcggacgt gccagacctg
    71761 cggacacgaa cccaccacgc gcgccgaggc ggcgcaccag cgcgcggacc tcgccgtgat
    71821 gtggctccac cccgacccgg accatcgcgg gaccgtgatc agtcgacagc actgcaggca
    71881 gtgcgaaccc gggcaaccag cattcgacgt cgcgtgcagg gtctgcggcg acggacccat
    71941 cctcgccggc gatttcgctg agctggccga gaacggtgag ctggccgaac cggttcgaca
    72001 atggctcgca ggcaccggat ggaccattgc gcccgatctg ctctgcccgg atcacgcatg
    72061 agacgtcccg gacccgacca cgacgagcgg atccagagac cgccccaagg cgaactgtcc
    72121 ccggtttgcg atgtacgccc ctcagcgcga gccccagcga aacccccaac tgaggctgag
    72181 attatcccca ggtcatgcac aggccggttt gaacgctgca cgcccgcgtg attgggttgc
    72241 cgtcaccaaa cttcgagagg caggtgagcg atgcacgcgt tcgcggacga gtcacgtcgc
    72301 ggtgactacc ttgtctgcgc ggcgacgatc gcccccgctg atctgaccga ggcccggaag
    72361 gcactcaagg cgctccgcgc cccgaaggct gcacggatcc acatgtcgca tgacagtcgc
    72421 agagcacacg agatcatccg gggggttgtt gcgctcgacg tgcgggcgca cctgtatgtc
    72481 gcgcgactgc acggccggcc ggagcgccat gctcgcgacg aggcccttgc cgcgatggtc
    72541 accgacctcg acaccatggg tgtccgccaa ctctggctcg aatcctgcga tcaggatcga
    72601 caggaccggc acgtcatccg ggcggcactg atggcctcga gcggaccggg gttccccttc
    72661 cggcacgcgc tacctacgag cgagccgatg ctgtgggttc ctgacgtaat tgcctgggcg
    72721 tgggggaagc ggggacatta ccgaaaggcg gtggccgatc tggttgaagt gcataccctg
    72781 ccttagatac gcaaaacccg ggcgactcac cgtccggaga gctcccgggt ccacttccca
    72841 cgagcgctat gtcgtgggca cctcaagtat cgggtcgcgg gcactactgc gtcaaggcgc
    72901 acactgcagg gccgccggtc cggcgatcgt gacgatcgcg gccaccgatg gcgccgtcac
    72961 caccgatggc gccgtcacca ccaatcgctg cgacaactgc cattacgctg cgttggagat
    73021 gagtgccgcc gacgccccgc ctcgagcgcc gaacacctgt ccgccggtag gaagacacca
    73081 cttcggacgc acgagctgtc cggtcacgac ggcggtccgg cgctcctggt gaacgggtgc
    73141 cggagccgac gatggttcac ctcagcgcac tggaccagtg ggccgatctt ctacgctgga
    73201 ctacgcacca gaggcggcaa tcggaatccg ccgctgctcc gtagccattt ccacaaggaa
    73261 agccgccggc accttccccg atgtcagcgg ctcctcatcc ccaaacgtcc cgagaacgct
    73321 acgcactgta ggtcttaccc gggtcggggg tgacagtgac gccatatcgc ctctcggcaa
    73381 gtggtcgctc gcagcgactg ttctggtgtg gtacccgggg tatgcgcgcc accgtcagcc
    73441 tgttcaacgc aaggaccagc cgggagtatt ccgagcgccg aaagcgatcc ggcgagggca
    73501 cgcgcctgcg cgaacccacc ccgaccgtgg tcagtgggcg gcgcggaagg cctcctcgat
    73561 ctcggtgggg atgcggccgc gcccggagag ctcgtagccc tgctcgatcg cccaggcgcg
    73621 gatcttcgcg gcctcccccc gccgcggctt cccggtagtg ggggtggccg ggcggccggc
    73681 gcggtgtttg cggccgccga cccggctgga gtgcgcgatg tagtactcga aggtttcgcg
    73741 gaactccgtg gcgtgctcgt ccttcaggtc gatgacgtac tcgacaccgt cgacggcata
    73801 gtggatgctc tcgccgccct ctgtgaagac ggtgccgtcg atgtcgtcga ccagctcgac
    73861 tacgaccttg cgtgccacag atttcactcc tcgaggtctt cgacccggac catatgacag
    73921 taccgatctg ctacctgcgc ctgcggtatc ggaggcacca gagggaaaca agcgcgcccg
    73981 gacagcggcc gcatcggcga cactccggcg gaccagcggc gacacgcccg gccttcggcg
    74041 gtcttgatag gctcagcgat gcccgctcgg gcatcgctgc tggtcaggac gctccactcc
    74101 ctcacgtgcg ccctgtgaat ctgatctacc gtgcgcagtc atgatgagct ttcacgccct
    74161 gcccggcgcc gccctggcat ccgcctctgc agagtcaggg atccgctgcc gacgatcgac
    74221 ggtgtcttcg aagttcctcg gcccgggcgc cggctttctg atgatgctgg gcgcgatcgc
    74281 aatcgcgatc gtggtcgggt tcctctcgtc cacgggcgtg atcggccgga cgacaccgtg
    74341 agcaacgaag gcaccgtgtt cctcggcgat cggggagtgg ttcgtcctcg ggttcatggc
    74401 ctggctggcg taagcggccg ccgggcacgc atcacggggt gccgggtggt gcccgagaaa
    74461 tgttgatacc gcaattgtga gtcttcaggg gggcgtgtgc gtttcaaaga caagaaccca
    74521 gaactgttcc gtcagctaca tccgacccgc aataccgggg tcgatctcga ctcggtgacg
    74581 aactcgtccc atgagatgct gtggtggcgc tgtcctgtcg ggcacgagtg gcgtgagaca
    74641 ccgctgcaac ggcgatcacc cgccgcgtgg aagaacgggg ccctgcacgc ctgcctgcac
    74701 tgcgtcgcac ccggctgtct tgtctacagt tgcggccacc gcaggtttca gccctccgaa
    74761 tccaccttcc gggtgctcgc ccacccgtgc cgcaagtgcg aggtcaccga gcacgcacgc
    74821 ctgatcctcg accggctcga cgagtcggcg gccgccgcgg tccgcgtcct cgacggcagt
    74881 cccctctacg ccctgttctg tgccacggcg gccgacaccg tcgagtggtg ggacaagatt
    74941 tttccgctgg tggaggcgta cttcgtgcgg atggtcagcg tgtacgtcgc cctcgcggcc
    75001 atcgagcacc gacccacgct cagctgcccc acctcgggcc tgctcggcgc gtgcatgctg
    75061 cggatccttg acgcgctgcc gccgagctgc cgggaggaga tgcacaatgc tgtgccggac
    75121 gatgccggcc acttccggca cacgtatctc cctggctggc atgacagcga catcgggtgg
    75181 ggcctgaaga agctcggctt cgacatccgc gatacatccc tggacaccga tatcgagcgg
    75241 cgcctgcagt tctgcgagca gcaacgtttc accgcgaccg gtgagctgcc cccggtccac
    75301 ctcgcgaacc ggcactatcc cctgttcacc caccttcccc gggaccggga gagtggggcg
    75361 ttggccgagc tgcggggctt tcgcccgaag caggccccgc cgcgtatcac cgcggtccgg
    75421 gtcaccctcg gcgaatcttg ccccgccggc cccggcgacc ccctgggccg cacgcacgtc
    75481 gggtacgccc caggtctgac aacggcggag ttgtgggagc tcggccgcgg cgtctggaag
    75541 ctgcgtgccg atcacgtcgc cgcctcgtcg atcgtcctcg tcgtgttcga caagaccgtc
    75601 gtgctggtcg cctcgatcac cggactgacc gtgcaccgcg gcggtctggc cattcttggt
    75661 gaacccgttc ccgagcaccc tctcctcggc aggcccgacc cgctgtacac accgaatcct
    75721 ctggcgcacg gcgtcatcca cggcgaggcc gaacgcagag ggagggagtc ggagcaccgt
    75781 ttccgttcgt catcgtcgcg accggtaccg atcccactgc cccgcacggt ctccagtgcc
    75841 gatgccgtca ggtccgggag ggaacgggtc gtccgggctc acgcttcgaa cagcatcgtc
    75901 tgatgcgttt cggggtgggg gagtggaccg ttcgtgacgg cggcaccggc gtgacgcgct
    75961 tcggcgagct cggggcggag gtcgtcggct cgcgggccgc ggtggccctg agcccgagct
    76021 ggtggcgaga gcccgcgcct cgggcggcgc gaggtcgtcc tgtgagtggt cgaggcagcc
    76081 ccaccccagc cgattctcga cattccgtta cattttgtta tgaaatgaaa tgaaacgaaa
    76141 tgttatgtaa tgttacgatg atggggtgat aacccgttta tcgaggggga gtggcgtcga
    76201 gatgagcgag agcaggccgg gtaggcctcg ggagtacgcc tcggacgccg accgggtccg
    76261 cgcctggcgg gccaggcaga agggaaagtc cggctcgact acagccgaca cggctgaggc
    76321 gccgaccgat ccgatcgagg cctcggcaac cctggctcag tcccttccgc tgttgaggca
    76381 ggaagccgac aggctgtccg ccgtcgccac ccgcatcacc gagtcggtga acctgctcgg
    76441 cgaccccgct gctgtcgatg cgcatctacg ccgcgcccag gtcgctgcgg acaaggtccg
    76501 ggcggatgcc gccgccgaga tcgaacaact ccgcgatcag ctcgacaccg cggtcgacga
    76561 ccggatcaac gccgatgccg ccgcccaggc cgccgagcaa gcggcggagc agtccgccac
    76621 cgcgctcgcc gacgccaacg ccagccacgc cgaacagatg cgcacgatgg aaagctccta
    76681 ccgcgaaagg ctggtcgagc aggagcaact cgtcgaatcc ctgcgcacac agaccaccga
    76741 actcggcgac gaagtcgtcc agatccgcgg cggcgcggac cgggcggccg cagccgccgc
    76801 ggccaccatc aaccggctcg aagcggacct cgacgaggca cgggccgccg ttcaggccga
    76861 acgggcccgc acagacggca ttcgtgacga actcgccgcc gcgcgtgccg acctcgccgc
    76921 agcacgcacc cagaccgagg ccagccgcga acgggtcgag gaactgcgcg ccgaactcgc
    76981 cgagatccgg agccaccccc cgcgctgagg cgatcagacc gggagccgtg gggtgtccgg
    77041 accgacaccg gtgccgcaca ccaccgagta cgtgactggc cgtggcccga aacccgatcg
    77101 ggcccccgtc gccaggcggc ggtcgttcca gcggtgggct gcggagggat atattgccaa
    77161 aaccaaagct gtcggcgggt gtcacccggt tcactttgga aggcgtacgc caaaccgcag
    77221 ttatccctga atggtgcttg gatgtagcgg tgtctgaaca gagtcctgca ccccatgcgc
    77281 cattcccgct tcatcttcgc ctgaatatcg caaagtacat gctggtcgcg ttcgatccaa
    77341 agaattatct aaaattgtca gagataatcg gcctagagtc gtccggcgat atcagacctc
    77401 tttcgatgca gcaattcttc gctctacttc cgcggctcgg cttaatcagc gatccctatc
    77461 cagtcatgtg gcagatcaca tcgatcgcgg atcagcttgt ttccaatggt ttgctgcaga
    77521 agatgccggg agcatcattg ccgccgcccc tgggaaacac gttctatgcg atgcacggtg
    77581 gggcaacgaa ggcacaggct gcgggagatc tctggctgag cgaaagccta ggaccggagc
    77641 tgataatccg tagctatatc gctcggacag tccaaatttc aggtaggaaa tcaaacggag
    77701 atgcgagttg cggcactggt ttactactcg acaaccacca tattctcacc aacgcacatg
    77761 tggtgacaga tatgactgtc gatgaaatcc tgtggacacc gaagtcgcca cctgtagatt
    77821 ctccggagtc caccattgat gcggtagaac tacgggtcga agacagtaga tatcatgaga
    77881 caggcgaatt ctcacatgcc aatcctgtcg atgtcgccat cctcgaagtg actggcctgg
    77941 gggaaactta cgccgacggt ggtggcatcg cgtttcgggg cccgggatgg tcagattcgg
    78001 catggagctt cggttatcca ccggtgccac aagctgctga gcccgcggtg gtggtgcatc
    78061 gtggcgaggt cgtcaacccg caggtacaga accagaggcg gaacgacatg atgctgttct
    78121 cggcaacagc tcggcccggc aacagcggcg ggccgatcgt ggcgcaggac gggcgtgtca
    78181 tcgggattgt cgccgaggat ttgggagtca aggacagtgc ggaggtcccg ttctacgcag
    78241 gcgttccgac tcacgagatc gcccgcgcac tcaacgaaat gggttacccc gacctcttga
    78301 atcttgagac ctgggaagca ccgtaaaagg tgtgcgagcg cgactggggg caggtcgggc
    78361 ctggtgtctc tcgctgagct ctgagtccct ccaccgcacg cctaacaagg gcagggcgtt
    78421 tgcaggagcg accgccggct tgtctggtgc agaggatctg tggggcgtgg ccgggcccgc
    78481 gctgtcctct cgatgaccgg gcgcagggcg ccgtcctcgc cccagccacc ttcaactact
    78541 gcggcggcgg cgcatcatcg tcgttgatca gccacaatcc tcgacagtac tatccgcgcc
    78601 catgattgcc gcacaaaaga gccgcgatca ggctcaaccc gaaccaggac tgccccgttt
    78661 cggaccccga gaacaaggaa gccgcgccag atgggccgca tttatctgga tgcagccacg
    78721 tagaaagagt gtgcggcatc gacatggatt tgggcgaaga tcacgccctc gaactggcac
    78781 cgtataatgg ctggagcgcg ccacgaagga acaactggcg gatactcagc gaggtcaagg
    78841 cgggcatgcg atcgaaggca cgcaggaacg gatgaccggg gcgagcaaac aggcggcatt
    78901 ggacggggag tggcgcaccc gaatcccgat gttcggatat accgcacacg gtgcggcggt
    78961 cgtggagtcg gaggcggcgg cgatacggga gggcgcgcgg tcgctgtcgt ccggtgtgtc
    79021 caccggagaa atctcgcgga ggtggaacac agccgggctc accacccgcg aggggaaccc
    79081 cttcaccagc aaaaaggtag ttgccgtgct gcggaatccg acctatgccg cgctgtccac
    79141 atataggggg cagatcgtcg gtgccggcca ttggcccgcc atcatcgacg aacacacgca
    79201 ccggacagta gtcgggatac tcgatggccg acgcacggcg gcacgggatc ggcgctggca
    79261 gggatcgggt gtctacctct gcgggaaatg cgggagcacg acacacgtca cggcgagccg
    79321 ggccacgcac tactacgtct gcaaagagtc agcccacctg tggaggcgac aggacactct
    79381 cgatgcatac attgacacgc tggtgatcga ccgcgtcacc gcagaggaca tgcgccctgt
    79441 cctcggcaag cccgataatg gggaagaagg gctgctcgaa gcgctgtacg acgtcacccg
    79501 gatcgacagc gccttcgccg tccagacgca atgggaccgg ctggcgaagt cgatcggggc
    79561 cgacgatctc cgcgcacgat gggagaagat aggggccgac gatctccgcg cacgatggga
    79621 gaagataggc gcggacagac gcggcgcggt tatcgcactg ctgatgacgg tgaccatact
    79681 tccgtcccca cgcgggcgaa aggccttcga cccgaacttt gtccggatcg attggaaaca
    79741 ctgacccttc ttgaatctcc cggcccaatc ggatctagca aataccttct aagcgggatc
    79801 tgcttggcag cggacgcctt tcaccgtcac agcttcagct gatcgagctg accgcagcgg
    79861 gtgccgttgc cgccgttggt cgacgcactg acggtgtcgg tgagcgtccc gaactgcgac
    79921 agcaactagg gcgggcggaa acagactcag atgatgtgga tgcactcgtc gggatggtcg
    79981 tgatccgaga caggatccac attagcggtc gaatggcgaa tgccatgccg ctacgtgcct
    80041 ggctgtgaac catcacatgt gctacttgga tcttgcacaa atgctttgac gaaccccgct
    80101 gattgataga ggtattggta cgcccaccgg gcaactgagt atgtcccagg cactggcacc
    80161 atgagaacgt ctctgccgtc gagacagcgg gagaatatgt accgtgctct gggcaggtgg
    80221 tagcgccacg agacgaccat aagactattc cagccgttcg cagtagcgag attgcgggtg
    80281 aagacagctt cgccgagagt cgtgcttgga ttcggtggaa tgcacctgac tgtgaatcga
    80341 gggtcacggg tttcgcagcg ggcagccaac ttggtgccgt aagggccgta cggatccgat
    80401 aacacgacgt tacgcgacag gccttggcga gcgaggtcga acgcgaactc ttcgcgaccg
    80461 tcccgttcgc cgccaagcac aacgatcgcg tcaactgatc ttatgtcgtc caccgcggat
    80521 ctgttgtaga cgatgaaccc ggcaccagca gtgcagcaga taaggatcgt cgcaactatc
    80581 attgctgcga cgattttccg cactgatgca gtctaactgc tcgtatcggt caggctgatc
    80641 ctgtcgatat tgtctggaat cttgaaccgt tcacctctta cggccgcccc agtccgcggt
    80701 aggtccatcc gccctcgcgc cactgttgcg ggtcgaggca gttccgcccg tcgattagaa
    80761 ccttcctgcg gacgacggca tcgaggtcgg ccggctggag cttctggaat tccggccatt
    80821 ccgtgagtac gagaaccaca tcggcaccct cgcacgcgtc catcgccgtg gtggagtagc
    80881 cgagagtggg gaacagcgcg cgcgagtttt ccatggcttt cgggtcatac acgttgacgg
    80941 acgcgccctg gagttggatc tgcccggcga cgttgagtgc gggtgaatcg cggacgtcgt
    81001 cggagtcggg cttgaaggcc gcccccagga ttgcaacgcg cgcgccaagc agggatccgc
    81061 acgcctcgcg ggcaagttcg accattcgcg tgcgacgtcg catgttgatg ttgtctactt
    81121 cccgtaggaa cgtcagggcc tggtctgcgc ccaactctcc cgcccgggcc atgaaggcac
    81181 gaatgtcttt gggaaggcag ccgccgccga atccaagtcc ggcgttcagg aagcggcggc
    81241 caatgcgagc gtcgtgcccg atcgcatccg ccagtaccgt gacgtccgcg ccggttgcct
    81301 cgcacacctc ggagatcgcg ttgataaacg agatcttggt ggcgaggaag gcgttcgcgg
    81361 acgccttcac cagttcggcg gtggccaggt cggtcaccac gaacgggatg ttctccccga
    81421 ggagctgcgc atagacctca cgcgcaacct gctctgccct gcccggacga ttccggtcga
    81481 cgccgagcac tagccggtct ggatgcaggg tgtcttggac ggcgaaacct tcgcgcagga
    81541 attcggggtt ccatgcgacc tcaaggtcgg cgcctgctgg cgagagttct cgtgcgagag
    81601 acccgagacg ttcggccgtg cctaccggta cggtcgattt cccgaatagc actgcaggac
    81661 tggtgatcag gggtgcgagg gtttcgatta cggcgtcgac gaacttcagg tcggcggcga
    81721 actcaccctt cttctgaggg gtgccgaccc cgaggaagtg cacgtcagcg aatgccgcgg
    81781 cttcttcgta tgacgaagtg aatcgcaacc gtcccgcggc gatgttgcgg cgcaggacgt
    81841 cctcgaggcc tggctcgtag aacgggacct ctccggcctc gagctttgcg agcttctctg
    81901 tgtcgacgtc aacgccgagg acttcgtggc cgagttcggc catgcaggcc gcatgggtgg
    81961 caccgaggta gccggtgccg aacacagcaa tgcgagtagt caccgcgaac tcactatctg
    82021 gagcatgggt aggtgtttgg tggaacgtga gcgctaggtc cgcacgaggt ccacgtgctg
    82081 tcggtaccag gagatggtcg acgcgattcc ctcgcggagg ccgatctttg gttcccatcc
    82141 cgagttccgc agcttggtga tgtcgaggag cttccgcgga gttccgtccg gcttagacgt
    82201 atcccattcg atgcggccgc cgtagccgac ttcctcggcg acgatctgtg cgatctcttt
    82261 gatcgtcgag tcttcgcctg tgccgacatt gacctggtcc ggaccgtcgt agttctcgag
    82321 taagtgcagg cacgccgacg ccatgtcgtc aacgtggagg aactcgcgcc gcggtgagcc
    82381 tgtgccccaa ttggtcaccg actcgaggcc ggtatgacgg gcttcgtcgt accgccgaat
    82441 cagtgcggga agtacgtgtg atccctgagg ggagaagttg tcgcccggac cgtagaggtt
    82501 ggtcggcatc gctgagatcc acggcagccc gtactggcga cgcactgctt ggatctgcag
    82561 gatgccggcg atcttcgcga tcgcgtaggc atcattcgtg ggttcgaggt gcccggtgag
    82621 gaggtactcc tccttgatgg gctgtggagc cagcttcggg taaatgcagg acgacccgag
    82681 gaagagcaac cgctcgactc catgttcgag agccgcgtcg aggacattga cctggatgcg
    82741 catgttttcg gacaagaagt cgacggggta ggtgttgttc gccaggatgc cgccgacttt
    82801 ggcggccgcc agcaccacgg tgcgtggctt ggtctgctcg aagaactcga agaccgcctc
    82861 tctgtcgcga agatcaagct cgctcgacga tcgaccgatg aggttgtcga atccgtctgc
    82921 ttcgagccga cgccagatcg cggagccgac caggccgcgg tgaccggcga cgtagagagg
    82981 cgcgtgacga tcgagtggtc ccggtacgaa actcgcttcc gtcacaggat ctcccaatca
    83041 gggtgcgcgg gagaatcgat ccacggacgg ccctcgtgct cgagtgccct gatgtcggcg
    83101 tccaccatga ttcgggcgag ttcgggtgta tgcacggcgg ccttccagcc gagcttttcc
    83161 tcagccttgc tcgcatcacc aatcaacgcg tcaacctcgg tggggcggag gtagcgctcg
    83221 tcaaaccgaa cgtgcttctc ccaatccagg cctgcatgct caaatgcgac ggtgaggaag
    83281 tcccgaacgg agtacttccc gcccgtggca agaacaaagt cgtcgggctc gtcggcctga
    83341 agcatcttcc acatgccctc gacgtactcg ggtgcgtaac cccagtcgcg gatggcgtcc
    83401 aggttgccca tgtacaggtg ctcctccaca cccgccttga tccgtgccac cgcacgtgtg
    83461 atcttccggg tcacgaaggt ctcgcctcgc cgaggtgatt cgtggttgaa gaggatgccg
    83521 ttgacggcga acaggccata cgcctcccgg tagttcttcg tcacccagta cgagtaaacc
    83581 ttcgccgctc cgtacggcga gcgggggtag aagggtgtct cctcgttctg aggtgggggt
    83641 gttgcgccga acatctctga actcgatgcc tggtagtacc tgcagttcaa acccgtgaga
    83701 cgcacagcct cgagcaggcg gaccgaccca atgcccgttg tattgcctgt gtgctcgggt
    83761 tcatcgaaac tcacgcgcac atgcgattgg gctgcgaggt tgtatacctc gtcaggcctg
    83821 atcccggcca ggagagtgac gagtcgcgca ccatcgctga ggtctccgta gtggaggaaa
    83881 agtcgcgctt cgggatcgtg ggggtcgaca tacaggtggt cgatccgcgc cgtgttgaag
    83941 ctcgaggccc tgcggatcag gccgtgtacc tcgtagccct tccgcagcaa cagctcagca
    84001 aggtacgacc cgtcctgacc ggtgatacct gttatcaacg cgcgcttcat gaatcctcgt
    84061 ctcgagcttt ggtggaggca gttggggaac cccggtgaaa taatagctgg ctgcatagag
    84121 tcgctgctca ccgcggtatg cgtcagtcga ggcgcagatg atgtggcacg gatcatctat
    84181 ctgatcgcta gccacgaggt cgtagatcga ctgttcctct tttgacgatt tcccaggtaa
    84241 actgcgcgag cagcgatctg acgctcggac gatcctactt ccctgaagat cgagccggga
    84301 cgacgtaggt ctggtttcgg tcgttgcggg caaaccctga ctaccgaccc acactcgtcc
    84361 ccgtctcgcc tgaagcttcg actaaagcag tcactccggc gagactcaga gtgcattcac
    84421 acgaggacca tcgttcatga ctaccggttc aattggcgca cggttcgaaa gacgtggcgt
    84481 tggccatatc cctttcagcg tcaccactct tcgcaacgcg acggaaacca tcattgaggc
    84541 tgcagtcaaa ggtgtcgcga tgccgatcag gttgtcgaat gcctactgcg tcgcgcttgc
    84601 cgcgcaggac gaggagtaca gggccgtgat gaatggcccg ggagtgaacc tcccggacgg
    84661 aacccctatt ccgtgggtga tgaattacgg gtcagacgtc gacgtattcg caggtcgggt
    84721 tcgtggtccc tccctgttcg tcgaggttct ggatatcggt cgccggagca acgtgaggca
    84781 tttcttcctc ggcgcaaccg aagacacttt ggcgagtctg gtggagcagg cctcagcacg
    84841 ttttcctggg attcagatcg caggtgccta ctcccctccg ttcgcgccgg tgaccgagca
    84901 tttctacgcg cagtgcgtca gtgagattca gcgaacagac gcacagatcg tgtgggtagc
    84961 tctgggaacg cctaagcaag acgtggttgg tgcaacgatc gcagagatgg cgcagttgcc
    85021 gacggttgcg gtcggggcgg cgttcgattt tctcgccggt acggttcggg aggcaccagt
    85081 gtggatccag aattcgggta ctgagtggct gtttcgtctc gcgacggagc ctcggcgcct
    85141 ctggcgtcgg tacctaatcg ggaactttca gttcctgcgt gctgcgtact acgcacgagg
    85201 gcttcggaac cttcctgcga tcgaaatcta ggtacgggcg gaggatttgc tgtgtcctgc
    85261 gtaggtcagc caccgttctc gaacggacaa tcggctgacc gcgtggagca ggcacggaac
    85321 aaactgacag agagtcaggc ctatcaggag gctgatcgct ggggcgagcg taccggcgct
    85381 acctaccagg acgaccgtgc aggaagttac aaaaaccacg gtcaagacgg ttgtcagtgc
    85441 ttggaatctt agtccgcggg agtccgtcag atacatcccg gacgctagat gcaaggcttg
    85501 gactagcacc acaccgccca gcagccagta cagcgcccac ggcacatgga ctgcatttcc
    85561 tactgctagt cgtgagacga atggtcccgc tacaacgaga cccgcgaaac cgcctagacc
    85621 gatgactgcg ccggtcgtga ggccgatggc gaagcgacgg gtactgctgt ggtggtttgc
    85681 gcggtcatgc gcgtactcac cccacaacga gcggccggcc acctgcgcga tcgagaatac
    85741 gggcaggaac gcgatcattg ctgctgagta caccgctacg tcctccagcg acgcacgcca
    85801 gctcagaatc aaccggccgc cttggatggc aaacggcatc gccagcgcga taacgagcat
    85861 cggaccggcc gatccgaaca gcgctggtcg ggtctggacg ggtcgtcgaa ggttcggacg
    85921 gatgccgcgt gcgcgcagtg acgcgatggc catggcaagc gcaagccacg atgcgatcgg
    85981 aatgccgatt gtcgaaatcg caatgatact ttgcagattc aactgcaacg acgccgcgat
    86041 gacaacaagg cccgacaaaa tcggggcaac accttgcagc agaatcgcca gcgggttccg
    86101 cttcaaaccg atgaggattg cgtatccgat cgatgctggc atagtcatca ggaaaaccga
    86161 cagcgcgaga cagactcccc agttcatgcc gagaacctga tcgacgccga ggatgggggg
    86221 ccacagctga agtagaccaa tcagattgat gacaagaagg ccgatggcac atccgccgag
    86281 aagatacttg cccgatgccc gaaggatcgc gacgaacttc tccgcctcgg acggcaatcc
    86341 tgctgctgca tttgtgaccg ccgccccaag accgaggtcg atgaccggca gaagcaacgg
    86401 cagtgacacg acgagggaga agaccgcata tgcctcgacg ccgtaggttc cagtgatcgt
    86461 gcgggcaaga acgattgatg tcacgccagt tagcggcagg atcgcgaccc gagcggccgc
    86521 ggagactacc gctgatcgtg cagatggact cctccagacg ctggtgtctg tgtggttctt
    86581 ggagtccgat cgaaccgcgg tcacgctcgt ctcagggcag agcctgcgta gctgcgtgct
    86641 gttcgcccaa ccgcgattgc atgcgatgcc attcggtcca acttcgccga gtcaccgagt
    86701 gcgactccgt tcttgactcg catcctgtgc cacaaatctt cgcgttcgaa gaaactgatg
    86761 tcagtgtgaa cgccgccgac gcggaaatcg ctcatgaatc gcacccacac gcgcggattg
    86821 gatttgaggg cagcacgcat cgccagttct tgatcgcacg ccacgccgaa atcgacatca
    86881 aaccctccga ggccacggat gaactcgagg ctgaggtagg tcgcctgatg cggaacgaaa
    86941 cggatgccca tctcgaaacg tcgctgtaag aacggtgcct gcacggtcgc cccgaagacg
    87001 tcgccttcct cagacatgta acggaggcat ccgtatgccc agtcccagcc gactgcctgg
    87061 tagtcggctg caacaaacga cagggtttcc tcgtccgtga accggtcgcc ggcgttcatg
    87121 aagacgacga cgtcgccaga ggccatgcgg atgcccttgt tcattgcgtc aaagatcccg
    87181 tcatcgggtt cgctgaccgc aacaacacga ctgtcgcgct ggcggtagtt gtcgatgaac
    87241 tctgcgctac cgtcactgga accgccgtca acgatgacat gctcgtaggt gcagtcacgt
    87301 tggttggtca aactttccgt tgtctcgacc aggccgtcgt gatcgttgta gttgacggtg
    87361 attacgctga gaacaggaga tgtcgtcgca ctcactttgt tttccctccg gcgaccgttt
    87421 tggtcggctg attgcccgct tggggtgacg gcgtgatttt gtcagctgaa ccacttactg
    87481 ccagatgcag cagctcagcg gccgattcga tcgtgaagcg gttgagccag gcttgcactt
    87541 ccgccgttcg tgcgaacgat gccttcctga tcgctgctga gaaggacggc accgaatcgt
    87601 ccgagatcag ctgcccggta actccgggta tgcatgcatc ggcagccccg aggcagcgtg
    87661 aactgactac cacggggatt cctgccgatg cggcctcgat cagaacgttg ccgaaacctt
    87721 cgattggcga tggaacgacg agcaccgatc ccggttcgca gtgcttgtgc cattggtcga
    87781 cccatccgtg gaagttcacg gggaatgggt ggttcgccgc cattgcgctc agctgtggcc
    87841 ggaggtcccc gtcaccgatg aagtcgacga caactggctc tccccaggat gaggtgaggt
    87901 gcgcggcgat atcgaggacg agttcgggac gctttggggc gaggattcgg cctacgaaga
    87961 ccagtctcaa cggcgcgttc ggtggccgct tgtaatagtc cggctcttgc gacggcgcgt
    88021 cgaacgcgac ggggttaggt accacccaca ttttcttgtt atcgaggtgg taggcggtcg
    88081 tcatttccgc tgcgaccgcg tgagacggag caatccagcc gtctgcatac cgatagagca
    88141 accgcgctag ccgctgctga ccgcgcatgt tcaccccgta ttcggctcgc cgatggctgt
    88201 gtagcgtgtg ctcactgatg atgatgcgcg gacgtgactg gcgcatgagg gacgcggcga
    88261 gtaggcatag aaggttcgag aaggtcagga gggatacaac ggtgtcgtag cgaccggtct
    88321 cgaaggtcgc cttcaaagcg cgaacagcgg cgattacgcc cgacttcggt ggcgtgagcg
    88381 gcacgagatt aaatcccgtc accggggcag acgggacgcg gtgcgtggtg atcacgtcta
    88441 cccggtggtc acgatgtccg agggcctctg cccactttct agccactact tccgcgccgc
    88501 caccttcgat cgcagggacc acgatcgcta tgcgctggtt attcattgtc ggtgctgtta
    88561 ggcgctcgta ggggtccgtc atccggtacg gcgagtagtc ggctgacggc caccggtgct
    88621 gatctgtcgg ctaccgcgtt ggcgcactgt tgggggtcga agttggcggc cagcagcacg
    88681 gcgctggcca gctctcgtgg ctcgcgggcg gcgacgcgta cgccgtttcc gaactccgag
    88741 tcaaggacgt ggtccggatc ggcaccgttc gtcgccacga ccggcaagcc gactgccccc
    88801 gcctcggcca tgacccgtgg ggagccttcg tagtgcgatg tcatcaacat gacggtcgag
    88861 tcggccatta tgcgtgccac ctcggctcgc gacagagctc cggcgaagac cacgtgagcg
    88921 gcgatatcct tgtcgttggc ctgactggcg atcgtggacc gaaggctccc ctcccccacg
    88981 aacaccatct gcgcattcgg gtatcgcttg tgcacctcgg cgaacgtcgc cagggcgagc
    89041 gacggatcct tctgcgattc aagacgacca acgaagacga ccttgagcgg gtcgctactt
    89101 ttccactgct tgcgtttgag agtgaagacg gcaggatcga accatgtctt tgccactgtg
    89161 agtcgcggat acatttcttt gatgcgtgcg ctgtcgctct gattgaacag aacgacctga
    89221 tcggcgcgcc ggaacacgac cttttcacag gctcgataga ggaatccgag atacttccac
    89281 agcgagtccg agttgccacc agtgagtccg gtggagtcgt tgtgaatgaa ctgaacaagg
    89341 cgcttcgggc gtacgactgc ggaaaccaca accccggttt cgatacggtg ggtctgcagt
    89401 accccacgag gtatctgttt ccggaagcgc accaaccccc acgccaagcg gacggaatgc
    89461 ggaatccgca ggaatcgcgc ttctctcgta cgagagaagc gagcaaccgg caagaagggc
    89521 accgattcat ccgctacttg cgcactgcac cactgaccga gctgcgccga gtcggactcg
    89581 gtgacaccga cgatcgcaag gctggacgtt tccgagtact tgacgaggtc gtggatgcac
    89641 gtgtcggtac ccccgggaac gagtcgttcc gggtcgatct ggtcgatgat gatccgcgcg
    89701 gcatcaagcg cgtcgacgct cttcaggttg tatgtgctca tgtgagggga ccttcgccga
    89761 atacgtctcg cgcccactgg tactgctttt ccagtccatc gtcgattgga acaatcggcg
    89821 accaacccaa ttcactggag attttcgcgg tcgagccgcc tgttcggaag acgtctccgg
    89881 cgaccgtacc gcccgacgag atctcgaccg gcctcttcgt gatgtcgccg atgatcttga
    89941 tcgtttcgtt cagcgaaacg ctcgatccgc ccgcgacgtt gtacaccgaa gccggcggta
    90001 cgtcactgaa tgccgctgcg atgttcgcct cgacgatgtc gtcgatgtag gtgaagtcgc
    90061 gaatttggtc accggttccg tacacctcga tactgtcgcc ttgcagaact gctcggaaga
    90121 accgagtgaa tgccatgtca ggacgctgac cgggaccgta gacggtgaag taccggagcg
    90181 acactgtcgg aataccgaag ttttcgccgt agagcgagca aaggtgctca gcggcgagct
    90241 ttgtgactcc gtacggactc aacggtcgag gagtgtccga ttccaccgtc gggtattgca
    90301 gtgcgttgcc gtacaccgat gacgatgagg cgtagacaag tttcttgatc cgagaaccat
    90361 cagtcttcac tgcttcgagg agacgctgcg tggcttgcac attgtccaac gcgtagaggt
    90421 cgaactcact gccccacgac ttccgcacac ccggctgccc agcctgatgg aacacgaact
    90481 ccaccccacg gagcagatca gacaactcca gcgtgttgag gtcaccctct acaaactcga
    90541 agcgactctt tgggatcgac gccagattac tcttcttgag atcagggtcg tagtagtccg
    90601 taagtgagtc gacgccacgg acctcaatcc cttcactgat gagacgacgc gcaagcgtac
    90661 tgccgatgaa cccggctact ccggtaatta gtgcaaccat tgttgacctc tcctagcacg
    90721 gtccagcaga agcggccgaa ctttgacaaa ctgcacgatc aatcacagac ggtaggtctg
    90781 ctccttgaat gggggcttag ctagtacgct cctcgccccc ccgcgatggc cttaaccgtc
    90841 ttcgcgatga tcagaccgtc ccccaccatg gaccagtttt ctacatacga caggtcaaga
    90901 cgcacactgt cttcccacga caaatcggat cttccgctca cctgccacaa acctgtgatg
    90961 cccggcttca ccaacaggcg acgacgcacc gtaccgtcgt acgactcaac ctctctgcgg
    91021 agcggcggcc gaggaccgac cacactcatc tcacgccgta ggacgttgag gaactgaggc
    91081 aattcgtcga ggctgtactt gcgaaggaac cggcccaccc gagtcacccg gggatcctcg
    91141 tgcagtttga agagcaggcc agcgccatca tttgacgaca tgagacgtga cacgtgcttg
    91201 tcggcaccaa cgaccatgct gcggaacttg agcatgctga atggagtgcc atcaagaccc
    91261 attcgctctg accgatacaa gaccgggcca ggactgctga atttgatcgc aagggcgata
    91321 gccagcatga ccggacagac cacgatgagt gccactgtcg cgaacaggag gtcaaatgac
    91381 gtcttcgaga agcgttgagc gcctcggtat tgtggcttct ctatgtgaat caaaggaagg
    91441 ccagcgacag gcctcatgga cagtcgcggc ccggacacgt ccatcatccc tggggcgact
    91501 acaaggtcga cgcgatgggg ctcgagtgac caggcaagag cgcgcagacc gtcgtcgcca
    91561 agatgttcgg tcgccgtgac agcaacggta tcagcgtggc acacctccaa cgccctgacg
    91621 atgttgcact cgtccccgaa gatcggtagt gcctgccccg cgacatcgac tgctgccggc
    91681 aactttcccg tgtatccagg gatgcataca cctacgaccc ggtatccgtc cgcggtacca
    91741 cgcgcaaaag acgccacaag gttgcggact gagcgctcgt tgccgaccac cagaaccgat
    91801 gtttgatact cgccccttgc acgcttgctc gcgactacct gccgccacat ccaccggccg
    91861 acgatgagcc ctgcaagtcc cacagggaag gcgatggcca ggtagaggcg cgcgaggtct
    91921 aggcggaaca gcaaagccat gattgcaatg aacccgaaga gccgaactgt ggattcaaag
    91981 atcctgcggt actcgtcggg cccgctgcca accaccctga cgctccgcgt ccggaagatc
    92041 accagtgcga tgagccacgc gaagatcaaa agtgcagaaa taaatgtgta actcaaatta
    92101 tcaaacaact cggaactatg caggatccca ttatcaccga agcgaatcca ttgcgcgaga
    92161 cacacagcgg caacgatgac cagcgcgtcg gtggccgcca agcaccgacg gtacttcgat
    92221 tgccaatcct ctcggccgcc agtccttctc ggaagcgccg aaccttccgc cccaccgttg
    92281 accgtcagtg ttggctcgac agagaagtcg aacgcggtca cctcacaccc tccagctggt
    92341 atttcggagc ggctagcgtg tccgatgact tcgtggtgat ggttacagac cggtcccccg
    92401 ttttactgcc gcgcggttga taatcgcacc ttcaaccagt ttgttacaac gatgtgagtg
    92461 gtgtcacaac gacattcagt ccaccgacta ccgccgcgcc acaagtgatt cacaagtaga
    92521 tcgttcgaca ttttcccgca tgccgatgat ctggtctatc tactgcgtga atgacagcgg
    92581 ccatttccaa tgcggtccgc tccatccagc acacgtatgg ttaaccggtg ctcatcgctg
    92641 tgttggcggc agtctccgtc attgcgctct tcgtcgtggc ccgccaactc cggcaacgcc
    92701 acctcatctg ggatgccgga acggtgttca tcctggtact cgggtgggca gcactaatcc
    92761 ctgtcgtcct gaacaaattg agcgacggcg tgatgcactc gtggaactac tggggtgagc
    92821 tggtcgaggt ccctatcccc gtcgaccccc gggtacagtc cgcccttcag tacgtgatca
    92881 tcggggcttc gctgctccta ttgtggcgct ctgtccggga cgccgataca tggcgaatct
    92941 ccctattcgg gatcgcggtc atgggcacct cgttcgtcgc gatggcggtc gacacgtccg
    93001 cctacgacag catcatcaag ggacagccga tggttctcct ggtcgtcctc gtcgcagcca
    93061 gtttcgccac cccatcccgc gaaggggcaa tcacaggcgg tgcactcttt actatcagcg
    93121 tctgcgcaac tggagccttc ctcgggctgt atgcgcccga caaggtgttc atgccgtgca
    93181 cggacaaatg cagcttggct ggcgagctct atatggccgc gaccccccac agcaacactc
    93241 tcggcctcat caccgcgatc ggcatcccat tcgtgtggct ggcattcaaa gggcctatcc
    93301 ggttctggat gctggtctac ataggtgcca accttgtcgt taccggaagt cgcacgtcga
    93361 tgttcgccgc ggccgcaacc ctcgtcgtgc tcgccctgac taatccaacc cacacgggcg
    93421 ggagcattgt cggtcgccat cgagcatttc tcacgctcgg cgtggtcaca tcgaccgcag
    93481 tcgcgatgat cctgccgttc actggacagt ccgactcctt cgcaaccggg cgaggatacc
    93541 tgtggcgaat cgctgtcgag cagttcgagc acacaccatt cttcggcgcc ggactgaccg
    93601 cgtgggaccg cttctacgag gcgggcgagt tcggcgctgc ggccgcgtac tcgacccaca
    93661 accagtggct cgagttgctt ctgctcgcag gtgtggccgg agcggtcgtc ttcgcgctcg
    93721 ggtgggccat cctggtcttc ggaggcgacg aaagtcgaaa gttcaccgtc ctcccggtct
    93781 tgctcaccgt ggccttgctg agctcaaccg agcgcccgtt gtcgatcggc ctgatcaaca
    93841 cgatgacgtg ggtgctcgtc gcactcgtcg cgttgtctag cgagggacgt caaggtcagg
    93901 gccggcaagc gacggcggcg acgcccagct ccaaccggtc ataccggttt atgccagcac
    93961 acggcccgtc acaatcccgc acacctgatg cgggtcgaac gtccacgcct gccgcaagca
    94021 ggcttaccac ggcggtcgca atgcccggtg aagtggcaat tgctccaacc gtgcacttat
    94081 agcgcctttt tccactccgc gggaactccc gcgtacaggc tgttcggctt gcaatcgcgg
    94141 gtgacgacac tgcctgcagc gatgacgcaa ccctcgccaa tgctgacacc aggcatgatg
    94201 acggagcggg caccgatcca cgcgccgtcg ccgacacgaa tcggtgcggc ctttgcggtg
    94261 ccggcgcgtc gggcggaatc gccgtcttcg tgcgtgcacg tggcgaacac gacctcatag
    94321 ccgatgtcca ccctctcgcc gatggtcgtg ggagcgccaa ggtcgaagaa acacccgtag
    94381 ttgatgaacg acccagcgcc gatcgtcagt ccggagttgc ttccatagaa gcctcgggga
    94441 ttgatccaag cggtcgggtg aatgtcgtgg ccggcggccc gaagaattcg acggcgaagt
    94501 tgggcgggta cgccataccc ggcggccagt cggttgagga cgatgtctcg acgtgcagga
    94561 cctaagtccc ggccgatgct cttgaggatt cccatcagag aactatgcag gatgccccgt
    94621 cctgtcgata catgtagatc gtccgaatga ccccggagaa gcacaaaaga tgggtgccga
    94681 ccaatgctcg ccggcgggaa gggtctgcct attccaacgc gtccagcagc gcttctgcaa
    94741 acgcgggaga aataaggtct gcatatgcag gtgtcatatg tttggcatcc attttggcag
    94801 gcgtcgtacc tacaaagctc gggcagtagt cctctggcgt gcagaaccat ttccgcgaat
    94861 ccaggaaggt tccgttaaga gaatcggcaa ggtactgctc ggttgtgaag cgttcaaacc
    94921 aagtgccagt gactcgacta atacagtcgg ccggactgtt gacacggttg tagcactcgc
    94981 cgatgtttac gtcgtccgga ggcgatgaga ggaatacgat ctttccgacg ttgccagcga
    95041 actgatctgt cattcgggta atgccggcgg cccatttgtc gtttgctcca tcgctgtagg
    95101 agttcgcgat cacgactact tccgggcgaa tttcattcag cgaacggatc gccgaagcct
    95161 ttcgcgtggg gcacgccgcg ccgatctcgt catcagctgc gcggagttcg agatcaacaa
    95221 acggacatcc gaacatcgcc tcagaacgaa cgctccactg accattactt ttttccgcga
    95281 acttgcgcag gggctccaca tacgtcattg ctactgaatc tccgaggacg aagatgctcc
    95341 gtggcgccaa ggggttaccc catatgcagg cggtggtttc gggacgatca actaggccac
    95401 acggcacgat gtcaggtggt gcctggcggc ccttgataac agcatccatg gatgggttca
    95461 gctccggcca ggaagttgcc tggaccgctg aagcgatcga ctgggcgagt ttcgattgct
    95521 ccggaccgac cacctttcca gtgacggctg caattgccgg ggccgctgtc ctgaccggtg
    95581 gcgcggttgc cggggagacc ggcgcgaggg tgaacgcgac aagcccggct gtgatgagcg
    95641 ctagtgccac gatgccacgt gtctgattgg attcactcat ccgcagagtc ggcaatcgcc
    95701 agcgggattt ggcgagtagg tttcgttcct gcttctcttt gcgggtggcg agccagttcg
    95761 agttccgaat tggattttca aagaagtggt acgacgcgat agagataccg aacatcagta
    95821 acaacgcagc cgcgaaatag tggttatttc gatcggctag agatgccaac aggataataa
    95881 taggccagtg ccataggtag agcgagtatg agatgtcacc aatgtaagta cttccccggt
    95941 tggtcaggat ctgcagatgt ttctgatcac ctgacacgcc ggccgcgatt accagggcgg
    96001 cgcccagcac aggcacagcc gcccatggtg cagggaaccc tccgcctgtt tcggtgattg
    96061 cgaacgcacc cgcaccgatc gcgatcaacc cagtccaggc gatatacggg cgtgcccagt
    96121 cggggatgcg ctcgaagtaa ccgatcgaga tcgcgaggag cgcaccgact cccagctccc
    96181 agacgcgggc gagggtagag aagtaggccc aggttgggct gccttctgtg ttcagtaccg
    96241 agtaccaaaa ggatacgagg acagcggttc ccatcaccgc ggcggcgagg acgagccgcg
    96301 ctctcaccga ccaggacttt cgcatgacaa caatcccggt cgcgaggatt accgccggcc
    96361 agacgaaata gaactgctct tcaacagaca gggaccaata gtgctggagc ggcgacacag
    96421 gtccggcaga gttgaagtag tcggtgcctt cgattccgaa tcgccagttg gacacgaaga
    96481 agaacgcggc gactgcatcg aggacagtcg acttgaatct tgctccggtg tagatgaagt
    96541 acgaggcgac gatcgtcgcg aacagcacca gggtggctat ggggacgatg cggcgaatcc
    96601 ggcggcgata gaagttggag aaggagattt tgccagtttt ctcgaaagtg tgcagaagtg
    96661 atccggtgat gaggaatccg gagatgacga agaacacgtc aacgccgatg aagccgcctc
    96721 gtggccagtg aaacagatgc gagagcacga cgagcatgac cgcgaccatg cgcagacctt
    96781 ggatgtcgag acgttgcttc ggtttggcct cccccatccc tcggcggcga gcgccccgcc
    96841 tggatcccgg aagcagtgaa gtgaccacga tcgaccccta gatgactgag gcccgcgaga
    96901 gagtttgcgg gacgggaaga atatagtcgg cgtcctgcta acctgccggt tacggtcccc
    96961 tggaatccgt cctagtcatt cacgtaaatg actccgcaca aagttgctca tgccgcaccg
    97021 tttgcgaccg gtaccctccc gtaccacggc cacatcacgt aggcgtcgtg gtagacaccc
    97081 ttggttggac cggggagctt catgatgtcc caggtataga cacctgccgc ggcacttcgg
    97141 ccaccacttc tgggcatacc cgcgcgggat gccgagcctg ccggcgatgc tcggtcgacg
    97201 agaagttggg cgtaggcaca ctgaacctca cgaacccgcg ctgctgacct gacccccgtg
    97261 ccgacgaact cgcccggcgc cgtatatcac tattcaagtt cgaccgttag agtcttttgg
    97321 atgcaaaacc caacccgcgt acatcgagca cgccagatcg ggaagccgtc gcgtggacgc
    97381 tgacagcgcc ggtgcggtcc ctggtggcgt ccagaccgag gatctcctca cccgagcggt
    97441 gatcgaggcc ctcaaggctg gcaaatcgtg ggcgcacatc gctacccaac tcggggttcc
    97501 acccccttct acctgcgatc atgtcgcgac cgatcgggac tggcaggagg caatcgtcga
    97561 tcacgagaat gcccgggcag cacgggcttg acccggcttg gcccccaggc gaggcctcgg
    97621 gaaaggcgtc gagcaccgcg ccatcgtcgg atgccggttg aagactgctg cacctgggtg
    97681 tcagagctcg tcgagagaaa ccaacccgtc ctgcagcgcc cgcactaaca atccggactt
    97741 gtcggccaca gggcgtccga cggcggcata cttcgctcgg atccgggtca ggtgggtttg
    97801 gatcgtgccc aaactgatcc ccagctcgga cgcggcaaca ttcctcgatt cgctgcgcag
    97861 ccacaaacga agaatttcca gctcgcgagg cgacagcgcc ggccgccgcg gcggtcccgc
    97921 gatggagtcc ggcacgggtc ctggaccgga actcatttgc gatctcacct tctcgagcta
    97981 tagcgactac gtccggacga aacactgctc cgttcggagc atgagccata cttggggaca
    98041 atacgatccg gcggcgacaa caagcacgtt gttaccgcgg taaacaaacc gtacctgaag
    98101 ccggtttctg gacgtgtgtc gtcgcagacg aggccggccg atggcgtgtg gtcgcggagc
    98161 caccactcgg cgatacccgc ggattgtgtc gcgcggtcag cgttgctcag tttcagctga
    98221 aacagcagta caccagtggc cggggggtgg catcggcgtt ccgatcggta gaaagcagct
    98281 gtcgtcgtag aaccgctcgt tgagcgccat gcggggccgt ccgttcgagt cagttcctcc
    98341 gggccgtcga gaccaggata tcgatcgggc tgagctcggc cggggcgctc agggcacgtc
    98401 gttgaggatg ccgtccagct cggccaacag ttggtcggcg cggtcttcga tgtcgtcgag
    98461 gaggtcggtg acgttcgtca ggtcgtggtg ggcgctgcgg cgggccgcgg ttccccgttc
    98521 gtagtagtgc gggtcgagga cacgtccgtc gtcgatcgga taccggtcgg gcgactcggc
    98581 ctgccgcggc cgcggacgtg gtttcggcgg cggaaggatg tgtgcgggtg cggttccggc
    98641 caggtgggcg tggacgatcg cggtgatggc acgtgcggtg ggcggggccg ggtcgagcgg
    98701 ggtgtggccc cagcggttga tcgaggtcag cagcggtcgg tcgtcggcgc ggtagccggc
    98761 gtcgaagccg gtgaggtcgc ggccggcttt gacgtgtttc gcgattgtgg tggtggcgtg
    98821 gttccggtcg agaaatccca ggacctcgat ccagtcccgg tagatcgccg ccagagggat
    98881 ctccggtgac tcgggcagat cgatccggtc gccgtcgatg cacagttgga ggggtgcacc
    98941 gcggtcgccg gttgcggtga gatcgcggcg gcggagccgg gcgagctgct cgaaccccac
    99001 gcccgcggcg gccagtgcca ggatgaaccg gtcgcgacgg ccgaagaagc cggccggcca
    99061 cccggcggta gggatgttcg ggatccgctc ggcgacgaca gccgatacgc ggtgcaggcg
    99121 agcggctctg gtggtgttga gggcgcggcg gatcgcctcg tcggtgccgg gtgccgggtg
    99181 tccctgcctt cggtggacgg tgttgatgac gctgacccgg cggcgttggg tggccagggc
    99241 ggcggggttc tcgcacagga aacgggccag ctgctgcggc gtggcgggag tctgaggttg
    99301 gtcggtcgcg gcacaccagt cggcgaacag ggcccagacg tgccggtccc gggcggacag
    99361 acgcggcgtg ggtgcggtgc cggtgccggg tgtggtggcg tacacgccta cagcccgagg
    99421 atggtgacgg cgttcccgac cagcggagta cgttcccgcg catacgcttc caccatttcc
    99481 ggggtggtat gtccggtctg acgcatgatc gcgtgggcgt cggcgccgtt gcggaaggcc
    99541 tgggtgacga aaccggcccg cagcgagtgc ccgccgagct gcgtgacctg gtccgggtcg
    99601 tagccagcct gtgcggcgcg gcgtcggatc gccttgtgca ccgccgcccc ggacagcgcg
    99661 gtgtcggaga ggttgccgtt cttgcggatc gacctgaaca gcggcacccg cgccgcgatg
    99721 cgcggactag cgccgcggca cacgtgggtc tcgaacggtt ccgcggtggt cagcagccgg
    99781 atcaccccgg ggcggccgcg agtatcgaac gcggccacga cctgcgccca ccgcacgtac
    99841 gcgcacggcg ggcagctgtc gtggcggtcg gtgatcggca gcgcccgcac cgtcccgtcg
    99901 ccttcctggt cggtcttcga ccggcgcaga cgcacgtgca caccgtcgtg ccggtgcacg
    99961 cgcacgtcgc cgccgtccag gccgacgagt tcactgcggc ggaacgcacc ggcgaacccc
   100021 atcagaatca gtgcgctgtc gcggcgttcg aggaccgcat ccgcccagcc gtccaccgcg
   100081 ttccgggcgg cggcgacgat ggtgacgatg tccgccgtca gcagggcggc ccgcgggttg
   100141 cggggccggt cccccaccgc ggcgtagtcg cggcggatcc cggacaacgt ggcccggacg
   100201 atctcctgcc cggtcggcga ctcgtggccg gcgcgggaat ggtggtgggc gatcgcggcc
   100261 acccacttgg tcaaggtcgc cggcgcatac acccggacgc cgtccgggcc gatggtgtcg
   100321 gcggcatcga ccaggtaggc ggccaccgtc gccgagtgcg ccggcaacgg agcatgcccc
   100381 tgcgtggcgc accagtgcgt gaaccgccgc cacgccgagg cgtaggtgcg gcgggtgccc
   100441 tcggaccggg actcggccat cgaccgcccg atccgcccga ccaccgcctc cgacaaatcc
   100501 ggaaacaccg ccgggtcgcc ggtaacagca gccgcgggca gctcgcgggg gcgtaggccc
   100561 tggtcgatcg tcatgccgag catgttatcg gcaccctccg acacggcttc gccgcgaaaa
   100621 acgcgctgag gtgcggtttt cggggagacg gtgcgggaag cggaattctc gtcgccaacc
   100681 gcgcataaac aggaagtgaa acgggcgcag gacgtcgagg gtgcccctaa gtggtgtgtg
   100741 taggttctcg cggcctcgtg tcactttcca aatttcgtgt cactgccgtg tcagtttctc
   100801 aatttcatgt cagttggcca gccattgctt caacgtttcc ccagctcacg gccactcgct
   100861 tggcgcgcac tccgtccggg acgccgaaga ttctgacaag aagatgagaa tctgtcgtgg
   100921 acaggactct ggaaacccgc agttcaggac tacacgtgac tgacatattc ggcggaaacc
   100981 tacatgtgtg taggttctca agttcggtgt cagtcactcg gtgtcgaacg tagcccggtg
   101041 agggtgaggc gcaggtgatc cgccaacgca agttcgtgtc gagaccgacg tagagcagcc
   101101 gcagagttga tggtcgcttg aagtgttgtc acactacaac gaaccattgc actgagatgt
   101161 ccaaggttca ctcttaagca tggctgcaaa cggtccattg ctcgctgaga gatcgatgta
   101221 ggtaccgtct tcgacgattt ggccgtcgtg gagcacgacg atgcggtcca tagtgctcag
   101281 agtgctgagc cggtgtgcca cgacgagcat cgttacgtcg tcaaaaccgt cgatagcgcg
   101341 ctgaacgatg gcttgcgacg gcccatcgag ggcggaggtg ggctcgtcga gcagcatgat
   101401 cgatggcgtg tggaggagtg cgcgggcgat gcacaaacgt tgctgttgcc cgccggagag
   101461 gttctcgccc ttttgagcga cgttggcctc gtagccaccg tcgatccgct ggatgtcgtg
   101521 gtagatgttg gccctaaggc aggctgtgtc gaggtccgtg tcggtgatcc cgggccggcc
   101581 catcacgagg ttgtcacgga tcgtgccggg gaacagggtc ggcctctgcc cgacgtagcc
   101641 gatattctcg gtcatgtagg tgcggtcgat gctgcacagg tcgcggccat tgatggtgat
   101701 tgatccggtg tagtggtggt ggagccgctc aaggaggtcg aggatggtgg acttgccgct
   101761 gccgctggcg ccgactagcc cgactcgctg gccgaggggc acccgcaggg ttaccccgcg
   101821 caagatctgc cgcgccgatg cagcactatc ccgcgggtcg tccctcacat gatggtcgtc
   101881 gatctgctgg tagctgaagg agacgttgtc gagggtcacc gccgacacgt gtgacaggtc
   101941 ggcgaccggg gtgccgctgc cggtgcgccg ccgtagccca tggtcctcgt cggtgtcggg
   102001 cgcgggtgat acgtcggcgc gcttgaagga cgggtcgatg gggccggcga ggtcatcgag
   102061 gaggtcgcgg gcctggaggg cggcctcgga actctcgtcg atcacgcggt ggagttcgtt
   102121 gaggggcctg gtgagggcgg cgtagaggag gatgacactg gcaaggtcac cgggagtatc
   102181 ggcgaggtcg aactggatag caacgacgac cgtgacgacg agccagagga cttcgttggc
   102241 ggccttgccg cagtcgaaga ggctcatgac gatgtggtga cgcagctctg tgcgtcggag
   102301 gtcctggact tcggcgctga cacggttgtc gaagtacgac tcggtgccac tggtgcggat
   102361 gaccttgagc atggtcaggc atgaggtgac ccagccgtcg atgcgctcct tggtgttttt
   102421 gagcgagaca cggatgccgt tctgagaagc gatctgccag gcgacgaggc cgaacccggt
   102481 cgggatgacc acggacatga gtagaccgag gaggccgtga cgggcggtgg cgatgccgat
   102541 ggcgaagacc gcgatgagga cggcgggcag caggtccgcg gacccgagct tgatcagtcg
   102601 cactgcgccc tctactgacc ggtttgcgcg gccgtaaatg gcgccgtcgg tgccggtatg
   102661 gaagcgctgc aggggccagc ggatgaggtg gccgtagatc ttggtgcgtg ctccggcctc
   102721 gaagctcgtt gtcacggcgt ggaccttctg gtgtcggacc acgttcatca ggctgatcag
   102781 cgtgtaggcg atgaacaagg taatcagcgg ccagagggcc tggccgaggc ctacgagctc
   102841 gccgtcgtca tagacggcgt cgacgaacat accgacgatg acggggatgc tggccgtggc
   102901 gaggctggcg atcgcggtcg ccagtactgc ctgcaggagc cggcgacgat ccggtaccgg
   102961 gagatgcgcg acgagctgcc gccacatcgt gaccgcggcg ctgacgggcg cgacggcggc
   103021 cctgagccga cgtcgcctgc cacgaacgtc gccaccgggc gacgctggca cgatcgtgtc
   103081 gcagtcctgg ggcatgagct gctgagtcga agtcatcggt tggtcgcctt tcgcatagcg
   103141 gtggtcgtga cccgccggcc cgtctggcgc agggcacggc gcctaagtgc tcgcggtcgt
   103201 ggagtcgcat cgccgatgcc gtcccgagcg gggtcgacgc ccccggccgt cattcgatgg
   103261 agcggcgact cggtggtggc cgatgagcgc attacgcggg cgtacatgcc aactcctcgc
   103321 gagaccagtc gagagtgatc acactgccga cggtggggta cttcacgatc gcgacgaact
   103381 cgacggagtt gtcggtctcg tgcatcgtcg ggcagacgag cgaggtcatg gcgatctcgg
   103441 cattggtcac gtgggtgata ctcagccgtg caggcggcag cggggccgac gggtgttcga
   103501 gcacgacccg gatgatggcg aggcgcgtcg gcgccgatat cacgacgcgg tcggtagtca
   103561 acgcgtcgtc gaacgtcgcc ttgaaggcgg tgtgcaggac gtcattggcc tcgaaggtgc
   103621 cgatgcgtgg ggcgtgagtc tcggtgaaaa tgtagccctc gctgtccgac gtgcgatggc
   103681 tgtcgtcgcc ggtcacgaca accggcagcg cctcggcgcc ccgacgtagc tgtgtgatag
   103741 acgctgtcgt gcgcggcatc ctcgtggtca ccgcgacggt ggtgccgtga gtcgtccggc
   103801 cggcttgagt gaatacggtc gtggtcaggc tgcgggcgat ggagccctgg gcgccgacga
   103861 tgacctggtg ggcgatggac tcgacgccga agccctcggc atcgaggctg tcactgaggt
   103921 agcgctggcg cggtgcagtg gcgatccgct cggtgcctgg gaaaccagcc atcagccact
   103981 tcgagggggt cgcgagcccg aggttcgcga tccagcgggt gacggtgaac gcaccggcca
   104041 tcgggagggt gttcatcatt ccggccggct tgcgggccgc aacgagttgc ggggccacct
   104101 ggccgataca gagcacaatg agggcgccgg gcacgccgat gccgagcaat atttcggcgg
   104161 tgtgcgggat cccgatgctg gtgaacggca gagacgtcat gcctgcggtc cgggtcacct
   104221 cagcgatacc gaaaactacc aggacgacgc cggcttgtcg gccggccaga tagtgctcca
   104281 accgctcgct cgtggcgacg aacggatgca acttgaacac acgtgagtgg gactcgcgca
   104341 gctggctgac atcggctgta gagagcgcca cagcggcgat gtgagcggcc tccagaagtg
   104401 cgaggagacc gaggcagacg gcgagcgcgc ccaggacgaa cgcggtcgac gtgtggttcg
   104461 ccatcgcgtt ctggccggtc agcaccgcgc cgagtacgag gtacaggcag aacgcgaaca
   104521 gggcgccggc ggcgacatcg cgtacgtgcc gcaccaggcg ggtgaccggc gagatcaaat
   104581 cgatcgactc gaaggtgccg agatccagct cctctacagc ctcgacgacc cggcgcatgg
   104641 cggcgcgagt cggcaccggg gcggcggtgt tgaagcaata gtggatggcg tcggcgtccg
   104701 tctttcgggc cggcacggtg cggagcatcg cgttgagggt gtcttcgtcg atgcccttgg
   104761 cagccacagc ctcgcggacc gcggccgcgg ccgcggtcac cggattgtta ccggtgaccg
   104821 cgaccagacg ggtgaagctc agcgacacga tctcgcgccg gaacttggca atgtgcaaca
   104881 cggtgatcac gccttgccgg cgtcgcgctg cggcgtcccg aacttgggaa cctggtccga
   104941 gctcgggatg cggttcgccc cgtactcctc ccacgcggcg tgaacccgga acacgaactc
   105001 accgtggtgg ttacgctcga agacggtctc gttggtgacc tgctcgggca tcgagaccaa
   105061 cacacccttg aaggtgaact cggggttctc ggcgatcaac tttcccaacg cctcgagctc
   105121 ccggccgaac tcctcccggg tcatcaccct gctgtcgtgc tcaagccaac cgtgcccgtg
   105181 gtggtccggg ccgtgggggg ggtggtgtgg cccgtggtgg tgcggcccgt ggtggtgcgg
   105241 cccgtggtgg tgcggcccgt agtggtccgg gccgtggtgg tccgggccgt gggggaggtg
   105301 gtgtggcatg ttcatcactc ctatcggttc ggcgatagga gtgatgatgc tcaaagcgat
   105361 tcaagtggcg agggactcag gctaaagaac cagttaagcg tcagccgttc ggtttgcgac
   105421 tcttcacgcg agtttcatcg gaacttcagc ggagcaaccc cgttgtgtag cgcgactgaa
   105481 gacgtcgcga agcgcgtcga cggagatgga ctctactcgg tccaaacccc ggttagacat
   105541 acacgtgtag acgaagcccg ccacgtcgag ccgggtccct ggagccgcgc aacgttggta
   105601 cgtgcacaaa taacggcagt aacgaacttc aacgccgccc acccgcgctg cgctggtggc
   105661 aggcgcgaat tgatcagtct cagtgaagtc tggccgatga ccaagggtgt ccgtcaaggt
   105721 tcgcataaac cactcctcac tcacttgtgg cttcggacgc atagaattga ttagtcttcc
   105781 gggctctggg gcgcctacct caagatgctc gaagaacttg atgttcactc cgttgacaac
   105841 cgcccaccgc aagaaacgcg gaacctcgcg ctgattgaat cgagtaagca ccacgttgac
   105901 ctcgaccgcc aagccggctt cacgcaccgc ggcaactgtg tcatcgatcg agaatggatc
   105961 gtcaaggtac ccgacggacg gtcgcggttt gtcctccctg aaggagtcga cgcccaacct
   106021 gatcttgcta agacccgcaa aggcgaggtc tcgagcgagc gacggagtca gtaggagccc
   106081 gttggtgatg agcgaggaac gcgccacatt gggactcacg gcctcgacca actcaaggac
   106141 acgcggatgc agcaacggct cgccaccgct gaggatgacc ttctcaactt cgggctgacg
   106201 ggacatggag acagcagcgt caaatagttg atccgagagg taggcggaac ccttgggctg
   106261 cccttcgttg tggcaataaa agcaggcaag gttgcactgc tcagtcaaga aaactcggag
   106321 tctgccaaac gaaactggca tctcaacgcc cccgaccgga tcgcagaatc ggagtcgatt
   106381 ctgtgtcgag gaatgcatcc ccaccaagtc gatctagttc gtcccgcgtg accactacgc
   106441 ccggaacgcc tcgctcacgc aggacgacag cgaagtgggc gagcagactg gcttcttcga
   106501 acagaaagcc gcaccccggt gggcacgctt cgagcagcgg aagtaggtct acagaagcgc
   106561 ttgacgctat gaagatcgtc ggctcgtctg gggcgtcacc gacgacgctc tgatacagat
   106621 gggcatgcag gtcctcaacc tgcgcgttgc cacgaaggtc aacgatcgga cctcctgcgt
   106681 gacctcgcga gacaatgcct cgttcaagat cgtcggatcc caggtccaca gaaaggtggt
   106741 cggactctgc agcgtcgatc aagtacacga tgcccccctc cccacgtttc gttatcccaa
   106801 actccaacgc gagttgaggc tcaacctcga tgagaggccc caaggtctcg acgaccttca
   106861 cgatgtcatc ggcggtgagc cacggggatt ctggcgggtc gacctcgcga atcacatggc
   106921 cattgacgaa gtgaaaggcg acagattgcc gcacctcacg tcgagacaga acccaccctg
   106981 ctttgtcgac gacgtaggcc gatgtctcga cgtagccctt cggtacgaaa tggcccaggc
   107041 cgacctccag caggtatccg tccgccgagg cgcggatgat ccccgtgact tcggcgtccc
   107101 agatctcctg ctccagtacg acagcgaccg ctgcgctcga aagtcccatc gttgccacgc
   107161 gcgtttcggt gtccgtgatg ttctcgaaac tcgggtagtc gcgtatcgag tatctccgac
   107221 attcagccgt gaagaattca acatccgacc ggtcgatctt cgcgaactca cggatgactc
   107281 gactgcctac ggtgaacggg tgcaatagaa caacactgct ccctgcgatc gcaggactcc
   107341 gcgtcatcgg aggctggggt aggtgctccc gagatgtcgc gaccgtagcc cgactcggag
   107401 tcatttcgac ccccagctcc gccgctctcc ggcgaagcga aatcttgggg tgtcccgaga
   107461 ccaccgacgg cagatcgagg aaggccgcag cggaatcgag gttctgaacg ccaggatcgg
   107521 gtaggacgat cggacggacc tggagaacaa tcagttcccc agcggaatct acgcaccact
   107581 ctacgtcgac gggcccggcg agttctctcg caaggtcttt gagtgcagtg ccgatttgct
   107641 ccagcaggtc ctcgcgtagg ggccatgttc cgtagcgagg aatcccattc gaccaggcga
   107701 ccaggacgtc gtttcctgtg cttcgcccag agacaagtcc gtcacccaag ccttcgaccc
   107761 aggacacggc ccacgagtcg agtgagtaac tcgtcggatc gacggagaat gccacgcctg
   107821 agacggctgc ggggactagc tcttgtatca ccacccccat cggcttgcct cgtgcacttg
   107881 cgcggacccg cgcggcggcg gcttcgaccg cgtcgaactt cacgcccagc tccgtcagaa
   107941 acgaacctgc gctcgataag gtgacagagt cctcggacaa gcctgagctt cgcacagcca
   108001 aggactcagc ctccttcagg aggactggag gagtgatggt ttcatcggtg cggtatgcca
   108061 cacccctcgg tgtcttgtag ccaagtccgg acaggcgacc tagatagtgc gccttccacc
   108121 cgaagacggc gggttcaaca gcggaggtga gttcacgagg caaggaagtt gctctctccg
   108181 agaagccgag ccactgcacc gggaacgagg gcccgccagt cgtcacccga tgtcacccgc
   108241 cagtcgtcac ccgatgtcaa cagtgttcga atctgggtac ccgaggcgac gcgagagtca
   108301 tcgtcgcggc gccacaggac ctcgacctga tagccaagct tgctcatgaa ctcgactttc
   108361 tgctcgcccc aggcgtcgta gatcgtcatg tagaccgtcg tctcagcggg tctagggagg
   108421 tagtgaagca gccggtccgc ttgcaggatg ggtgctggga cgattgcgaa gtctcggccg
   108481 gtccagccca agtcccacaa gctctcctca atcatcgtgc gtcgctcggc gaacgtgaac
   108541 gggttgttct ccgccaggga cctcttcggg tcggcgccac ttggaacccg tgactccggg
   108601 tccgggttcg tgatcccgac aaacaaccgg cgacagtgcg aacgagccgc ctctacgtac
   108661 tcaaggtgac cgagatgaaa gggctggaag cgcccaagca ccaagccgtt cttcggctcg
   108721 ctcaccaaag ctcctctcga cgtctccccg acttaaatgt tgctcagagc gtacgcggaa
   108781 gcggtgaagg tcgagtaaaa ctgccgcgca ccccagcctg ccgggacgtc ccgcgtcacc
   108841 cggaggttcg ggaccgagtt ggaaggggat ttgccgcgtc ccactcactg tcaaagtaga
   108901 gccggaaggc gggcgctagc ggaaacggcg ccaatgggtc gagcagcatg tgcggcgcct
   108961 gccagccgag acgactcgac tgcgcactct gattttcgag gtcgtaaggc gagactgaga
   109021 cgatgtcgtc atcaattacg aggacacgga aggccggcag atgtttcgtc ccgcggactt
   109081 caagacacgg gtacttttcc cggagtcgaa gcagcacctc tacggagcta ggcgacacct
   109141 ctcctccgcg aatctgaacc aggcggtcgt atgcctccga actcgggtcg atgaccaaga
   109201 agcgggcacg tcccctcgga ttccgacgct ggaatttctg aagcatcgcc acgaagctgt
   109261 cgtgaacttc gcgagtgcca acccatttcc cggcaagcac cccagcaaag tcgagagcgt
   109321 tctcggcgcg cttcgtacat tcgatcgggc tgagactgac ttcaccaagt gcatgggcgg
   109381 acggggcccc gatgcccagc gcctcgacga ttgggaccaa cgcatcgatt ccgcttcgac
   109441 tctcgggggt gccgggctgt gtcgccgcct tgcctcgatc caagttctgc cgtcctctgt
   109501 gcggctttag ctgctcaacc tcgggaggca tctcctcccc gtcttttgcg aagtgctttt
   109561 cagctcgtgc ccagaagtct tcgtgtcgtt tcctgtcgcc tgcgcgatcc gctgcaaaga
   109621 gtaggcgata ccagatgcga tcatccgggg gcgcgatttt ggcgagccga cttacccgct
   109681 ccagaacctc gttagaggct gctttgccgt catccgaaaa cagcgtgcag tcagctcgaa
   109741 gtagtaccgc atcagcgtgc ctcttcttcc attcgtcgaa tatgtcgacc aatcgctcac
   109801 ggtgtccgtc gagatccctg aggtccgcga ctttgagctt cttcggattg cagtttctgc
   109861 ttcccgcgtg gtcgagcccc gtagcggggg atccgcgcca cattccaagg gccttatcta
   109921 acagcggcac cgcggcggcc acggcgctgt ccgtcaagtc gcggtgatcg gtccacatct
   109981 caccggcgat ctccagcgct tgatcggtaa gcgtccggaa ctcagggaag tcagctgtaa
   110041 gactgacctt gtaggtagtt ggctgacgag ggatagaccg actattgccg gcgattgtct
   110101 ctaaacgcgc cttggcctcg cggtcaccaa gcgcatcccg caggttccct acataggttc
   110161 ctatgtggct cgacctcaca tcgagcacgt gtgcggccag gtcagcggtg acgagaccat
   110221 catcccagag gagcagcaac cgcaggaaga gcgcggcctg gccggtcagc ggtaagggat
   110281 cggcgtctcc agattgcacg gtaacgcgag tgtcacacaa tctgacgaac aagcgtctcc
   110341 tccattcacc tccgattacg tctgagagac tagcgctcga ccaggatggc cgcgccgcag
   110401 ctccgcgccg cgccgcgccg cgccgcgccg ctgagcggag ctgagctgag ctgagctgcg
   110461 cggtgggcca ttgcacgtgt cgcctggcac tcaaagagct ggagctctgg gccccgcaat
   110521 gcgaacggcg ccccggtcgt cgtcgaggac cagctcaact cgtgtgccgc atggacggac
   110581 gaggccggcg cgatcaacct gctcgacgct ggcaaggtgc acgctgtcga tcgaccccct
   110641 gagcaggaga agcttcttga ggccaccgac ttcgcaggca acaacggctg gtccgacgat
   110701 tacggcaagc gagacctgcg gaagctgctc gccgaagcga agcaatctgg gtggagcgct
   110761 gcttgaccag ccgccgcagc gatcgccgcc tgcatgcgga ccggccagcc gtacgccctg
   110821 cggaacgtgg acggcacgcc gatcaccagg ccggcccgag caactcgacc aagtggcgtc
   110881 ctccacgaga tcgtcgacgg actcgtagag tgcaacgtgg ctctgaacat cgatggcacg
   110941 aagtatcacc cggcagaccc gatgggcaag atgttcatcg ggtttctggc gatgccgagt
   111001 tcgaatcaga cctcaaacct caagctcgca cgcaataaac gtgcaggcgc atcaccgcag
   111061 cccgagttgg cggaggatga actgccagag tgaaattcgg aggggccgac tgtgaagctc
   111121 ggcccctccg aagcaatcag tccgagatga ggagactcga
//